4NV7A

Crystal structure of mesorhizobium loti arylamine n-acetyltransferase 1 in complex with coa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
268
Chain Sequence
PPFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPWENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into cofactor recognition in arylamine N-acetyltransferase enzymes: structure of Mesorhizobium loti arylamine N-acetyltransferase in complex with coenzyme A.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
molecule keywords Arylamine N-acetyltransferase
total genus 84
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4nv7A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4nv7A01
1GX3A 4GUZA 4C5PA 4B55A 4NV8A 1E2TA 1W5RA 2VFBA 3LTWA 3D9WA 1W4TA 4NV7A 4BGFA 2BSZA 2VFCA 1W6FA
chains in the Genus database with same CATH superfamily
1LICA 2BT9A 2FKGA 4LZUA 2PY1A 1TXLA 1GT3A 1O1UA 4KIIA 4ZHGA 4BGFA 4I6SA 1BLRA 2X45A 5HZ5A 2Q2MA 1UZ2X 2WR6A 2AT8X 1SLDB 2CZUA 1ZNGA 2Y32A 2RTOB 3FR4A 4N7CA 4NV7A 3F6ZB 2IZDB 4XMFA 5BVQA 3PDFA 5LJBA 3TF6A 4PSQA 5HA0A 1SY1A 2OY7A 2ACPX 2NNEA 4IB9A 3QKGA 1VWDB 4PJ2A 1VWMB 3NP1A 4FBVA 5CSEA 4Y0SA 1SWCA 2GTFX 3ZUOA 2GH7A 4ML7B 1X8UA 4L3RA 4AYHA 2PQTA 4ORWA 3FIDA 1VWRB 2FWVA 2GJ5A 3BX7A 4JO6A 4OS8A 3B2LA 1H91A 1UYOX 3B2HA 3GAQA 1ZNDA 4IRWA 1SWGA 4NYRA 5K06A 2HZQA 4OMWA 1BM5A 1SWPA 1QY0A 2OF8A 3S5XA 4ZHFA 5B2AO 3BSZE 4YGGA 1KL3A 2F73A 1G74A 1RSTB 2IZAA 2OVAA 1QY1A 2RQ0A 3OE3A 4Z2VA 4DMOA 1BSYA 1EQDA 3VHMA 3FA9A 3HOLA 4IBAA 4TJZA 3SLJA 2FGSA 4A1HA 2OZQA 4Y5DA 4BQUA 4O4SA 2LBVA 5FAZA 1TVQA 3B2IA 3O19A 2A2UA 4RUUA 4KH8A 3X00A 4CPHA 4D6BA 1A3YA 1G7NA 2OL8O 4ALBA 2RTGB 1GT5A 2BSZA 2L68A 2A2GA 1GX3A 1SXUA 2KD2A 4U8UO 4FBOA 2LA7A 4GUZA 4XMEA 5B3MO 2HNXA 5F6ZA 3ZW0A 2VFBA 2RTFB 1AB0A 3D96A 5FQ6E 3VHHA 1DZJA 4AZNA 1JJJA 1SWEA 2MWHA 2AT3X 1HQQA 4O9SA 1HN2A 1HMSA 3ELZA 1SXYA 1LUQA 4M7MA 4I9RA 3FW4A 2IZBA 3P6DA 4CDEA 4WHIA 3N91A 2HZRA 1NQNA 1VWCB 2KW1A 1QFVA 4EKVA 1E06A 5AJCA 3WJDA 4NLJA 2K62A 1LDQA 5F6BA 2N93A 2WWPA 3JS1A 2BHVA 4CV7A 5CE4A 2K23A 3RE5A 3LNBA 4A60A 2C1SA 3Q6LA 4C5PA 2G79A 3VG2A 4EDEA 5IRAA 4Y0PA 2JGSA 1GX9A 1L6MA 5EDBA 4YFQA 2QM9A 1SY0A 3T2WA 3WZQA 2F01A 2PI3O 2CBSA 2AF5A 3PH6A 1D3SA 3G7XA 4XMDA 3TGBA 4EFGA 4GDAA 2AT5X 3FW5A 3FYFA 4B55A 1YWDA 1HXLA 5B27A 1LNMA 1A18A 1ACDA 2NP1A 3EC5A 3OD9A 4I95A 4ORSA 2JOZA 1B56A 2JU7A 3SLOA 1HY2A 2OVDA 5F1EA 4BX7B 3WOVA 1CRBA 1G85A 4YGHA 4ZGFA 1ICNA 2IZLB 1NBXA 1Y52X 3SZIA 3H3IA 3FR5A 1ZRYA 3OBLA 1KT7A 1QABE 3VG6A 4AZRA 5LJKA 4ORXA 1U0XA 5HTEA 1OBUA 1YWAA 1MDCA 1BBPA 2QO5A 1BSQA 2RTJA 2WPUA 3MG5A 4GDZA 1N7YA 4GZVA 1KT3A 1SLEB 4KT5A 4GGRA 4ID2A 4RUNA 4YCHA 2C4IA 5KICA 5L8OA 5D4AA 4CSBA 1VWBB 2FS6A 3APVA 1SWBA 4O4OA 5H9AA 2RTHB 1NP4A 2IZHB 3B2JA 2E4JA 3APXA 1B0OA 1SA8A 1MX8A 2NNQA 4OELA 1Y9TA 5EZ2A 2RTKA 1EPAA 2AH7X 1RAVA 3RBYA 1KT5A 3ZUIA 1Y53X 1KZXA 1TW4A 1JBHA 3AEHA 2QOSC 4WBKA 3VG3A 4QNIA 1R0UA 3MBTA 4YMYA 3D9WA 5CHKA 3B2KA 2KTSA 4Y0RA 3F8AA 1SWSA 2JU3A 1GXAA 3SLTA 1EW3A 4O3XB 4O3WA 3RDQA 5C0NA 2BS5A 5IRUA 3WZPA 4AW8A 1STRB 1VYOA 2RTPB 4HPCA 4TLJA 3EW2A 2QOMA 4ZCBA 3VGWA 1EIIA 2FR3A 1CBIA 2MO5A 4DQ3A 4QZTA 2R74A 1SWUA 3PQUA 1LCWA 1DF8A 2POAA 1N0SA 5HCDC 2YMSA 5LJGA 3CMPA 2HYSA 3NR3A 1X8QA 5HCEC 4OMXA 3CR6A 3HWEA 3NPOA 3C77X 1IIUA 1ICMA 2OFAA 2F09A 2OVEA 1RXJA 4EXZA 4QQ1A 3D97A 3VE2A 4BX5A 2LBAA 1KT6A 1SWOA 4U9CA 3STMX 4YFRA 3NX2A 4Z2PA 2FTBA 1DZKA 1LCZA 4BJ8A 4CPIA 5AJBA 5H9LA 5EEDA 5FQ8E 1SWLA 3VU1A 4ORRA 2WQ9A 2VDFA 2IZIA 3LTWA 5HTDA 3VG4A 4YGZA 3JQOA 1PMPA 2RTQB 2RCQA 5H9NA 1ADLA 3P02A 3SOTA 2RA6A 4FGIB 2RTCB 4CDFA 1KOIA 2MJIA 2WUTA 4YBUA 5EEEA 4YKMA 3WJBA 1FEMA 1GM6A 1X89A 3ELXA 1SREA 4BX6A 4NW4A 1HMRA 4YVBA 1NP1A 2ANSA 4JHQA 2OF9A 2OY5O 4O3ZA 4GJSA 4HPDA 4HFOA 4IMNA 1AQBA 4MVKA 2LKKA 2RTIB 2Z4IA 1SRHA 3DTQA 4GRJA 3T1DA 5LJEA 4GKCA 1YUPA 2NNDA 4GJVA 2Q2PA 3FA6A 2W2BA 5K67A 1AVEA 4OEMA 1LIEA 4TNNA 1EXSA 1IKJA 4ZFXA 2GTLN 1I06A 4ZH9A 1SY3A 3WYPA 1STPA 4CDCA 4EEJA 2KT4B 3HPEA 2YG2A 3V8UA 4XMHA 1BSOA 1SWQA 4ZHHA 1AVDA 3ZW1A 1W5RA 1HBQA 2IZGB 2A8GA 2Y3EA 4QYNA 4ALOA 2ALLX 4BVMA 4MISA 4MVIA 1W6FA 5CYBA 1KQWA 3OJYC 4FBRA 3BDRA 1Y55X 3ZW2A 5IRWA 2OFRX 4BBOA 2RCTA 4WFUA 5B5GA 3ZI8A 1VPRA 1YP6A 3SZHA 3F9DA 1GKAA 1BJ7A 2PFRA 3KZAA 2RTRB 3WYQA 1SRJA 2QCBA 5HZ6A 2MF6A 1LIDA 2A0AA 2A5CA 2X8FA 3CBSA 2OL7A 1NGLA 4U3QA 2AVIA 3HTYA 2O62A 4KC8A 3P24A 4IMOA 5B10O 3WJEA 2Q9SA 3NADA 2JU8A 4AZOA 4D6AA 1DZPA 3HWGA 4L1NA 4R0BA 3SAOA 3RE6A 3MM0A 3NQ3A 4O4UA 2LB6A 2Y3FA 2HLVA 2RTBB 4AZPA 3S60A 3K3LA 2VFCA 2FKJA 2QO4A 1ERXA 4FQBB 4HPAA 1EPBA 4TKBA 2WSJA 4HWMA 4JGLA 5HAEA 2X34A 4CPEA 5D8JA 1YIVA 1S44A 1SRGA 1SWHA 2A13A 2RTNB 3WVMA 1KXOA 5KHPA 1IFBA 3KFIA 2OYBO 1N9MA 4O49A 1VWFB 1IW2A 3LV4A 3AKMA 4CPFA 4MIRA 1KL5A 1XKIA 4GH7A 3P6HA 4Z6JA 5HZQA 3NBXX 3HK1A 1WUBA 1X8PA 1S7DA 2G78A 4GGTA 4LKTA 2IFBA 3MX7A 5D47A 1CJ5A 4ZHDA 2IZKA 2XSTA 3FMZA 4MEEA 3O22A 4MVLA 1TOWA 1OPBA 4N7DA 1BWYA 4YBPA 2RN4A 2L5PA 5DPQA 5FENA 1K24A 3SZJA 1I9HA 2RTAA 2HMBA 4A8ZA 1SWJA 3STKA 1SWAA 2A3FX 4IAWA 2FLJA 5F7GA 2JW1A 3CKFA 3P6CA 2W2FA 5D48A 2JMBA 1P6PA 4U8UM 4GK9A 2IZEB 1VWHB 2IZJA 3IA8A 3NX1A 4HPBA 4IB6A 4NNTA 2RTDB 5DG4A 3L4RA 4YKOA 3U9PC 1LPJA 1B8EA 1VWEB 3RDSA 4QGXA 1LDOA 2WQAE 3PECA 4YDBA 1JMZA 1MVGA 4ZH6A 3WJFA 3ZZVA 1O1VA 1SRFA 2X8TA 4ORYA 4COTA 5IO7A 1Y0GA 3UAQA 2GTLO 1JQPA 5H8TA 5LKFA 3RDOA 4QGVA 3KQ0A 3PPTA 2ZAIA 2W2AA 1SWDA 1OBPA 5L8NA 1NQMA 2Z4HA 4NNSA 4AZMA 1YWCA 1B4MA 1BRPA 2QO6A 3EM0A 4GNYA 2ZSCA 2X46A 1HBPA 3CQRA 3CQNA 3JSQA 4OS3A 1AVGI 4ARHA 1RSUB 4GNWA 1E00A 4TQ2A 1N43A 5LJHA 4TKJA 2UZ2A 2FHNX 1UREA 2MM3A 3FENA 2CM4A 3NQKA 5L8IA 2RTLA 4YFPA 1S2PA 1SY2A 1N4JA 3IFBA 3UEXA 1JYJA 4YCEA 4BCSA 3BRNA 2X8SA 1ZNKA 1SXXA 3BU9A 3E3CA 1PBOA 1YP7A 3PH5A 3O2YA 1TOUA 1EI5A 3T6FA 1AELA 4CPHB 1DV9A 3TGCA 2IZCB 2CBRA 1JJXA 1JV4A 1VWIB 5FQ7E 4ZGUA 5JD2A 5HZ9A 3I0AA 5HBSA 1W4TA 3P6FA 5BVSA 4DCBA 2OL6O 3U0DA 4A1YA 2G7BA 1LIBA 4BX6B 4ON1A 3CBCA 5HWZA 2I5VO 4TKHA 1ERBA 1GT4A 1OEJA 1SWNA 2FT9A 3T6LA 3APUA 3HWDA 3HOEA 3VG5A 1LFOA 4ZJ0A 1QWDA 2AMMX 2EU7X 4M6SA 2OFMX 1FJ1E 1QY2A 1SRIA 2Q39A 3I17A 4QYPA 1QG5A 1N9YA 3T2XA 3PK2A 4O4XA 5JR8A 3CKGA 1KZWA 4U46A 1FTPA 2P8GA 2C1QA 5B5FA 1RLBE 4I3DA 4LZVA 1KFFA 1U17A 2R56A 2FS7A 1FELA 1X8OA 5D45A 3RSWA 1STSB 4LQZA 2OFBA 1SWRA 3EYCA 5EPQA 3RDUA 3FA7A 3KVNA 1LF7A 4NV8A 4CK4A 1GGLA 3BX8A 3RY2A 1T0VA 4CDDA 3NQ9A 2G5LA 1U18A 3BS2A 4GGZA 2ZAGA 1O8VA 4XMCA 3UEUA 1JYDA 1ML7A 3BU1A 3EBKA 4LKPA 5L3YA 4BX7A 4ZR2A 4BOEA 1Y9LA 1VWLB 3DSZA 2HKDA 1ALBA 4INNA 5AQ6A 4JNJA 4GU8A 1PBYA 3AUMO 3UEWA 3VHIA 1UYNX 1A57A 2JN3A 1VWAB 5FFHA 5B11O 2IJAA 2WEXA 5KIDA 1NC9A 2OVSA 1PM1X 3FEPA 1VWQB 2IZFB 4O3YA 1OBQA 4ODDA 1ZNHA 2RTMA 3ZQ3A 4ES7A 3APWA 4Z28A 2X56A 3WJCA 3P6EA 3RY1A 2QMIA 4Z27A 2BS6A 3VPJE 4I9SA 3BLGA 4AZQA 2OY1O 3C76X 1JIWI 4XMGA 4GE1A 3EW1A 2CZTA 1IFCA 1G5WA 1LELA 2X55A 1NDJA 1VWOB 2UYWA 3Q34A 1KT4A 1MX7A 1EALA 3WZOA 2BLGA 3FA8A 1RBPA 1KGLA 1PTSA 3CWKA 1XCAA 3MVFA 1QQSA 1MK5A 5BVTA 4QGWA 3VE1A 2AKQA 4KCAA 1VWKB 1RXHA 1VWGB 1I05A 4OS0A 2GTLM 2OY8A 3VG7A 3WJGA 4ZHCA 5HCCC 1E2TA 1K3BA 1OPAA 3LHNA 3ZW0B 5LJCA 3S5VA 1SXWA 1CBRA 1PEEA 1IKEA 2MHDA 4ORUA 2FRSA 5H9KA 5AEOA 3QQ2A 1KQXA 1GX8A 4IABA 3RZYA 4Y59A 1MUPA 2X4MA 3BY0A 2A5BA 3RDXA 3RWXA 4NP1A 4I3BA 4BX5B 1I4UA 2AT0X 1T68X 1HXZA 3EMMA 1E5PA 1LIFA 1SLFB 4OKAA 3ZWEA 4QAEA 4GETA 2LFOA 1FE3A 4KC7A 1OSPO 4YH0A 3RKGA 1WBIA 4U8UN 1HQPA 1CBQA 4IAXA 4WFVA 3UEVA 2X32A 2RTEB 1ZNLA 1BRQA 1JZUA 1FENA 3PP6A 3D4RA 3KFHA 1KL4A 5LJDA 3STNA 2KTDA 3GE2A 5IO5A 1YWBA 4I60A 1A2DA 3EBWA 1SLGB 3ZW1B 5LKEA 1DFVA 1VWPB 1VWNB 5K68A 1OEKA 3KFFA 4Y0QA 2FR2A 2AL0X 3D95A 5B29A 3FIQA 2BC3A 2R73A 4QZUA 3FDCA 2GC9A 3RDMA 1DF3A 1DC9A 3PEDA 4MVEA 1E02A 5BYPA 1QFTA 1GKAB 5F58A 1IJ8A 1Z24A 4IB8A 3S26A 4DQ4A 1LCVA 3TGAA 1LKEA 2WEWA 1JMXA 1CBSA 2I5ZO 1MOYA 2RD7C 3FELA 3PQSA 1T8VA 1DZMA 1I04A 1MEPA 2L67A 3AKNA 2DJGA 2XKLA 1HMTA 3WBGA 4NYQA 3TZSA 1SMPI 2DJFA 2FHLA 4Z2OA 5EDCA 3HWFA 1OEEA 3FEKA 3WXQA 1VYFA 1JJUA 1RXKA 4IB7A 3C78X 2ACOA 4I3CA 3WZNA 5HZ8A 3KFGA 1I78A 1GT1A 1X8NA 1VYGA 2CM9A 4NLIA 2Q4NA 2L9CA 2G8CO 4K19A 1BEBA 2M4LA 5F2BA 1ZNEA 5HA1A 5IO6A 1EUOA 1MM9A 5IXGA 3U03A 4UU3A 4EQAC 2ASNX 3P6GA 4QRLA 4YDAA 2DM5A 1X71A 1SWFA 1D2UA 3FR2A 3FLLA 2AT6X 1SWTA 4GD9A 4DNEA 1VWJB 4UU2A 1EIOA 2CAMA 1SWKA 1FDQA
chains in the Genus database with same CATH topology
1CQDA 2GFOA 3KWBX 3P5VA 3RVWA 4BGFA 2NQGA 4I04A 4MZSA 4W4UA 1AYVA 4NV7A 5K16A 2R6NA 1S4VA 1AYWA 3PDFA 1ITOA 2OZ2A 2IPPB 2NQAA 1MS6A 2R9NA 3WXEA 3D6SA 1SNKA 1MIRA 1Y08A 5CHVA 1NB3A 1PPOA 3IV2A 1ME4A 4MSXA 2DC6A 4CDFB 3O0UA 1BY8A 2AS8A 3GCBA 1NQCA 1AU3A 2R9OA 3BC3A 4RY2A 3ZUAA 4FK5A 4MZOA 1XKGA 1TU6A 3KX1A 3PNRA 2BSZA 1GX3A 3MTNA 2FTDA 4GUZA 3BPMA 2DCAA 2VFBA 1CJLA 3U8EA 3IEJA 7PCKA 1ATKA 2F7DA 2JQGR 4CDCB 2F1GA 2AUZA 3BCNA 1AU0A 3H6SA 4K7CA 1NL6A 2AU1A 1EWLA 2AYOA 4C5PA 1PPNA 1F2CA 5CVOB 1EF7A 2R9MA 2YJ8A 3CH3X 3H8BA 2ATOA 4B55A 3IOQA 1KFUL 5CVMA 1PPDA 4PP1A 4CDDB 2YJ9A 4BS6A 1CPJA 2DC7A 1YT7A 3KWZA 1ZCMA 2YJBA 1PIPA 1AYUA 3MORA 5EF4A 1A6RA 1U9QX 3H7DA 3I06A 3HHAA 4OELA 1SP4B 4X6HA 3MHHA 4BPVA 4XUIA 3D9WA 3V6EA 5CVNB 1EWOA 2R9FA 1GLOA 1K3BB 2CIOA 4Q8HA 4QH6A 2GHUA 4QBBA 1KHQA 1BGOA 2HXZA 4XR7A 3IHPA 2WBFX 2YJCA 1F2BA 2OP3A 2DZYA 2E00A 4BSQA 1U9VA 3BPFA 4PP2E 4P6EA 5PADA 3V6CA 3LTWA 2AIMA 1GCBA 1PBHA 4AXLA 4P6GA 1AECA 3DF0A 3KFQA 4N79A 3P5XA 1CV8A 1EWPA 1TL9A 2IBIA 1ZIVA 3KKUA 1PADA 1CSBB 2H7JA 4OEMA 6PADA 3WXFA 3F75A 2DCBA 3E1ZB 3OF9A 1M6DA 4FJCA 2VHFA 1PCIA 1W5RA 4BQVA 5A24A 1W6FA 3OVZA 3PBHA 2BDZA 3RVXA 1MDWA 1QXPA 5J94A 1DEUA 3CBJA 4I07A 2Y6EA 2DC8A 2CB5A 4BS5A 1FH0A 3IMAA 2DJGB 4X6JA 3K24A 2HH5A 2DJFB 2P7UA 2O6XA 1POPA 2C0YA 1QDQA 2VFCA 2FUDA 2YJ2A 2DC9A 1MHWA 3K9MA 1AU4A 4CZWA 3LXSA 3C9EA 1GECE 2B1NA 2FRQA 2B1MA 3PW3A 1F29A 1PXVA 1CTEA 4YYQA 4PADA 2Y5BA 2PADA 4X6IA 3LFYA 3CH2X 4YYWA 2XU5A 1U9XA 2XU1A 3P5UA 3TNXA 3N4CA 2FO5A 3H89A 4ZUXU 1JQPA 3KSEA 1YALA 3S3QA 5JA7A 3HHIA 2FQ9A 1NB5A 1CVZA 2G7YA 3MHSA 4N4ZA 1HUCB 1F2AA 4KLBA 2E01A 1Y4HA 1MEGA 2ACTA 2DZZA 1W4TA 2FYEA 3H8CA 2AVWA 4G54A 3QJ3A 3BWKA 1NLJA 2G8EA 4CDEB 4I05A 4QRGA 1THEA 2AUXA 2HHNA 1ICFA 4YVAA 2E03A 4YYSA 4YYRA 4N8WA 1KFXL 2NQIA 4NV8A 4YYVA 1TLOA 1YVBA 4DMYA 3B79A 3HWNA 4AXMA 4QRVA 2PBHA 5F02A 4PI3A 1O0EA 1BQIA 3KW9A 8PCHA 4WA6A 5FPWA 4YV8A 4QRXA 1U9WA 3OISA 3NHEA 2JQFR 1STFE 3QT4A 3USVA 1KHPA 3RVVA 1MEMA 1NPZA 1IWDA 4DMXA 5EGWA 1KXRA 3O1GA 5JH3A 3QSDA 1PE6A 1CS8A 3M99A 3AI8A 1PPPA 3IUTA 2FT2A 2PNSA 2PREA 1E2TA 3S3RA 2XU3A 3I3TA 3N3GA 2E02A 2P0RA 3BOWA 9PAPA 3F5VA 3ERVA 1YK8A 2BDLA 3WXGA 1YK7A 3K8UA 1DF0A 2NQDB 2OULA 2ARYA 1QMYA 5CHTA 2XU4A 1ME3A 1QOLA 2G8JA 3P5WA 1VJVA 2HD5A 4W5BA 2R9CA 1EWMA 3OF8A 1U5IA 2FRAA 2P86A 4W5CA 1VSNA 4Q8GA 1AU2A 2DCCA 1Q6KA 4HWYA 2G6DA 3N3KA 3CBKA 1AIMA 3HD3A 2VHSA 4YYUA 1BP4A 2DCDA 3OVXA 1GMYA 1X9YA 2AYNA 4FIPA 1CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX3 A;  4GUZ A;  4C5P A;  4B55 A;  4NV8 A;  1E2T A;  1W5R A;  2VFB A;  3LTW A;  3D9W A;  1W4T A;  4NV7 A;  4BGF A;  2BSZ A;  2VFC A;  1W6F A; 
#chains in the Genus database with same CATH topology
 1LIC A;  2BT9 A;  2FKG A;  4LZU A;  2PY1 A;  1TXL A;  1GT3 A;  1O1U A;  4KII A;  4ZHG A;  4BGF A;  4I6S A;  1BLR A;  2X45 A;  5HZ5 A;  2Q2M A;  1UZ2 X;  2WR6 A;  2AT8 X;  1SLD B;  2CZU A;  1ZNG A;  2Y32 A;  2RTO B;  3FR4 A;  4N7C A;  4NV7 A;  3F6Z B;  2IZD B;  4XMF A;  5BVQ A;  3PDF A;  5LJB A;  3TF6 A;  4PSQ A;  5HA0 A;  1SY1 A;  2OY7 A;  2ACP X;  2NNE A;  4IB9 A;  3QKG A;  1VWD B;  4PJ2 A;  1VWM B;  3NP1 A;  4FBV A;  5CSE A;  4Y0S A;  1SWC A;  2GTF X;  3ZUO A;  2GH7 A;  4ML7 B;  1X8U A;  4L3R A;  4AYH A;  2PQT A;  4ORW A;  3FID A;  1VWR B;  2FWV A;  2GJ5 A;  3BX7 A;  4JO6 A;  4OS8 A;  3B2L A;  1H91 A;  1UYO X;  3B2H A;  3GAQ A;  1ZND A;  4IRW A;  1SWG A;  4NYR A;  5K06 A;  2HZQ A;  4OMW A;  1BM5 A;  1SWP A;  1QY0 A;  2OF8 A;  3S5X A;  4ZHF A;  5B2A O;  3BSZ E;  4YGG A;  1KL3 A;  2F73 A;  1G74 A;  1RST B;  2IZA A;  2OVA A;  1QY1 A;  2RQ0 A;  3OE3 A;  4Z2V A;  4DMO A;  1BSY A;  1EQD A;  3VHM A;  3FA9 A;  3HOL A;  4IBA A;  4TJZ A;  3SLJ A;  2FGS A;  4A1H A;  2OZQ A;  4Y5D A;  4BQU A;  4O4S A;  2LBV A;  5FAZ A;  1TVQ A;  3B2I A;  3O19 A;  2A2U A;  4RUU A;  4KH8 A;  3X00 A;  4CPH A;  4D6B A;  1A3Y A;  1G7N A;  2OL8 O;  4ALB A;  2RTG B;  1GT5 A;  2BSZ A;  2L68 A;  2A2G A;  1GX3 A;  1SXU A;  2KD2 A;  4U8U O;  4FBO A;  2LA7 A;  4GUZ A;  4XME A;  5B3M O;  2HNX A;  5F6Z A;  3ZW0 A;  2VFB A;  2RTF B;  1AB0 A;  3D96 A;  5FQ6 E;  3VHH A;  1DZJ A;  4AZN A;  1JJJ A;  1SWE A;  2MWH A;  2AT3 X;  1HQQ A;  4O9S A;  1HN2 A;  1HMS A;  3ELZ A;  1SXY A;  1LUQ A;  4M7M A;  4I9R A;  3FW4 A;  2IZB A;  3P6D A;  4CDE A;  4WHI A;  3N91 A;  2HZR A;  1NQN A;  1VWC B;  2KW1 A;  1QFV A;  4EKV A;  1E06 A;  5AJC A;  3WJD A;  4NLJ A;  2K62 A;  1LDQ A;  5F6B A;  2N93 A;  2WWP A;  3JS1 A;  2BHV A;  4CV7 A;  5CE4 A;  2K23 A;  3RE5 A;  3LNB A;  4A60 A;  2C1S A;  3Q6L A;  4C5P A;  2G79 A;  3VG2 A;  4EDE A;  5IRA A;  4Y0P A;  2JGS A;  1GX9 A;  1L6M A;  5EDB A;  4YFQ A;  2QM9 A;  1SY0 A;  3T2W A;  3WZQ A;  2F01 A;  2PI3 O;  2CBS A;  2AF5 A;  3PH6 A;  1D3S A;  3G7X A;  4XMD A;  3TGB A;  4EFG A;  4GDA A;  2AT5 X;  3FW5 A;  3FYF A;  4B55 A;  1YWD A;  1HXL A;  5B27 A;  1LNM A;  1A18 A;  1ACD A;  2NP1 A;  3EC5 A;  3OD9 A;  4I95 A;  4ORS A;  2JOZ A;  1B56 A;  2JU7 A;  3SLO A;  1HY2 A;  2OVD A;  5F1E A;  4BX7 B;  3WOV A;  1CRB A;  1G85 A;  4YGH A;  4ZGF A;  1ICN A;  2IZL B;  1NBX A;  1Y52 X;  3SZI A;  3H3I A;  3FR5 A;  1ZRY A;  3OBL A;  1KT7 A;  1QAB E;  3VG6 A;  4AZR A;  5LJK A;  4ORX A;  1U0X A;  5HTE A;  1OBU A;  1YWA A;  1MDC A;  1BBP A;  2QO5 A;  1BSQ A;  2RTJ A;  2WPU A;  3MG5 A;  4GDZ A;  1N7Y A;  4GZV A;  1KT3 A;  1SLE B;  4KT5 A;  4GGR A;  4ID2 A;  4RUN A;  4YCH A;  2C4I A;  5KIC A;  5L8O A;  5D4A A;  4CSB A;  1VWB B;  2FS6 A;  3APV A;  1SWB A;  4O4O A;  5H9A A;  2RTH B;  1NP4 A;  2IZH B;  3B2J A;  2E4J A;  3APX A;  1B0O A;  1SA8 A;  1MX8 A;  2NNQ A;  4OEL A;  1Y9T A;  5EZ2 A;  2RTK A;  1EPA A;  2AH7 X;  1RAV A;  3RBY A;  1KT5 A;  3ZUI A;  1Y53 X;  1KZX A;  1TW4 A;  1JBH A;  3AEH A;  2QOS C;  4WBK A;  3VG3 A;  4QNI A;  1R0U A;  3MBT A;  4YMY A;  3D9W A;  5CHK A;  3B2K A;  2KTS A;  4Y0R A;  3F8A A;  1SWS A;  2JU3 A;  1GXA A;  3SLT A;  1EW3 A;  4O3X B;  4O3W A;  3RDQ A;  5C0N A;  2BS5 A;  5IRU A;  3WZP A;  4AW8 A;  1STR B;  1VYO A;  2RTP B;  4HPC A;  4TLJ A;  3EW2 A;  2QOM A;  4ZCB A;  3VGW A;  1EII A;  2FR3 A;  1CBI A;  2MO5 A;  4DQ3 A;  4QZT A;  2R74 A;  1SWU A;  3PQU A;  1LCW A;  1DF8 A;  2POA A;  1N0S A;  5HCD C;  2YMS A;  5LJG A;  3CMP A;  2HYS A;  3NR3 A;  1X8Q A;  5HCE C;  4OMX A;  3CR6 A;  3HWE A;  3NPO A;  3C77 X;  1IIU A;  1ICM A;  2OFA A;  2F09 A;  2OVE A;  1RXJ A;  4EXZ A;  4QQ1 A;  3D97 A;  3VE2 A;  4BX5 A;  2LBA A;  1KT6 A;  1SWO A;  4U9C A;  3STM X;  4YFR A;  3NX2 A;  4Z2P A;  2FTB A;  1DZK A;  1LCZ A;  4BJ8 A;  4CPI A;  5AJB A;  5H9L A;  5EED A;  5FQ8 E;  1SWL A;  3VU1 A;  4ORR A;  2WQ9 A;  2VDF A;  2IZI A;  3LTW A;  5HTD A;  3VG4 A;  4YGZ A;  3JQO A;  1PMP A;  2RTQ B;  2RCQ A;  5H9N A;  1ADL A;  3P02 A;  3SOT A;  2RA6 A;  4FGI B;  2RTC B;  4CDF A;  1KOI A;  2MJI A;  2WUT A;  4YBU A;  5EEE A;  4YKM A;  3WJB A;  1FEM A;  1GM6 A;  1X89 A;  3ELX A;  1SRE A;  4BX6 A;  4NW4 A;  1HMR A;  4YVB A;  1NP1 A;  2ANS A;  4JHQ A;  2OF9 A;  2OY5 O;  4O3Z A;  4GJS A;  4HPD A;  4HFO A;  4IMN A;  1AQB A;  4MVK A;  2LKK A;  2RTI B;  2Z4I A;  1SRH A;  3DTQ A;  4GRJ A;  3T1D A;  5LJE A;  4GKC A;  1YUP A;  2NND A;  4GJV A;  2Q2P A;  3FA6 A;  2W2B A;  5K67 A;  1AVE A;  4OEM A;  1LIE A;  4TNN A;  1EXS A;  1IKJ A;  4ZFX A;  2GTL N;  1I06 A;  4ZH9 A;  1SY3 A;  3WYP A;  1STP A;  4CDC A;  4EEJ A;  2KT4 B;  3HPE A;  2YG2 A;  3V8U A;  4XMH A;  1BSO A;  1SWQ A;  4ZHH A;  1AVD A;  3ZW1 A;  1W5R A;  1HBQ A;  2IZG B;  2A8G A;  2Y3E A;  4QYN A;  4ALO A;  2ALL X;  4BVM A;  4MIS A;  4MVI A;  1W6F A;  5CYB A;  1KQW A;  3OJY C;  4FBR A;  3BDR A;  1Y55 X;  3ZW2 A;  5IRW A;  2OFR X;  4BBO A;  2RCT A;  4WFU A;  5B5G A;  3ZI8 A;  1VPR A;  1YP6 A;  3SZH A;  3F9D A;  1GKA A;  1BJ7 A;  2PFR A;  3KZA A;  2RTR B;  3WYQ A;  1SRJ A;  2QCB A;  5HZ6 A;  2MF6 A;  1LID A;  2A0A A;  2A5C A;  2X8F A;  3CBS A;  2OL7 A;  1NGL A;  4U3Q A;  2AVI A;  3HTY A;  2O62 A;  4KC8 A;  3P24 A;  4IMO A;  5B10 O;  3WJE A;  2Q9S A;  3NAD A;  2JU8 A;  4AZO A;  4D6A A;  1DZP A;  3HWG A;  4L1N A;  4R0B A;  3SAO A;  3RE6 A;  3MM0 A;  3NQ3 A;  4O4U A;  2LB6 A;  2Y3F A;  2HLV A;  2RTB B;  4AZP A;  3S60 A;  3K3L A;  2VFC A;  2FKJ A;  2QO4 A;  1ERX A;  4FQB B;  4HPA A;  1EPB A;  4TKB A;  2WSJ A;  4HWM A;  4JGL A;  5HAE A;  2X34 A;  4CPE A;  5D8J A;  1YIV A;  1S44 A;  1SRG A;  1SWH A;  2A13 A;  2RTN B;  3WVM A;  1KXO A;  5KHP A;  1IFB A;  3KFI A;  2OYB O;  1N9M A;  4O49 A;  1VWF B;  1IW2 A;  3LV4 A;  3AKM A;  4CPF A;  4MIR A;  1KL5 A;  1XKI A;  4GH7 A;  3P6H A;  4Z6J A;  5HZQ A;  3NBX X;  3HK1 A;  1WUB A;  1X8P A;  1S7D A;  2G78 A;  4GGT A;  4LKT A;  2IFB A;  3MX7 A;  5D47 A;  1CJ5 A;  4ZHD A;  2IZK A;  2XST A;  3FMZ A;  4MEE A;  3O22 A;  4MVL A;  1TOW A;  1OPB A;  4N7D A;  1BWY A;  4YBP A;  2RN4 A;  2L5P A;  5DPQ A;  5FEN A;  1K24 A;  3SZJ A;  1I9H A;  2RTA A;  2HMB A;  4A8Z A;  1SWJ A;  3STK A;  1SWA A;  2A3F X;  4IAW A;  2FLJ A;  5F7G A;  2JW1 A;  3CKF A;  3P6C A;  2W2F A;  5D48 A;  2JMB A;  1P6P A;  4U8U M;  4GK9 A;  2IZE B;  1VWH B;  2IZJ A;  3IA8 A;  3NX1 A;  4HPB A;  4IB6 A;  4NNT A;  2RTD B;  5DG4 A;  3L4R A;  4YKO A;  3U9P C;  1LPJ A;  1B8E A;  1VWE B;  3RDS A;  4QGX A;  1LDO A;  2WQA E;  3PEC A;  4YDB A;  1JMZ A;  1MVG A;  4ZH6 A;  3WJF A;  3ZZV A;  1O1V A;  1SRF A;  2X8T A;  4ORY A;  4COT A;  5IO7 A;  1Y0G A;  3UAQ A;  2GTL O;  1JQP A;  5H8T A;  5LKF A;  3RDO A;  4QGV A;  3KQ0 A;  3PPT A;  2ZAI A;  2W2A A;  1SWD A;  1OBP A;  5L8N A;  1NQM A;  2Z4H A;  4NNS A;  4AZM A;  1YWC A;  1B4M A;  1BRP A;  2QO6 A;  3EM0 A;  4GNY A;  2ZSC A;  2X46 A;  1HBP A;  3CQR A;  3CQN A;  3JSQ A;  4OS3 A;  1AVG I;  4ARH A;  1RSU B;  4GNW A;  1E00 A;  4TQ2 A;  1N43 A;  5LJH A;  4TKJ A;  2UZ2 A;  2FHN X;  1URE A;  2MM3 A;  3FEN A;  2CM4 A;  3NQK A;  5L8I A;  2RTL A;  4YFP A;  1S2P A;  1SY2 A;  1N4J A;  3IFB A;  3UEX A;  1JYJ A;  4YCE A;  4BCS A;  3BRN A;  2X8S A;  1ZNK A;  1SXX A;  3BU9 A;  3E3C A;  1PBO A;  1YP7 A;  3PH5 A;  3O2Y A;  1TOU A;  1EI5 A;  3T6F A;  1AEL A;  4CPH B;  1DV9 A;  3TGC A;  2IZC B;  2CBR A;  1JJX A;  1JV4 A;  1VWI B;  5FQ7 E;  4ZGU A;  5JD2 A;  5HZ9 A;  3I0A A;  5HBS A;  1W4T A;  3P6F A;  5BVS A;  4DCB A;  2OL6 O;  3U0D A;  4A1Y A;  2G7B A;  1LIB A;  4BX6 B;  4ON1 A;  3CBC A;  5HWZ A;  2I5V O;  4TKH A;  1ERB A;  1GT4 A;  1OEJ A;  1SWN A;  2FT9 A;  3T6L A;  3APU A;  3HWD A;  3HOE A;  3VG5 A;  1LFO A;  4ZJ0 A;  1QWD A;  2AMM X;  2EU7 X;  4M6S A;  2OFM X;  1FJ1 E;  1QY2 A;  1SRI A;  2Q39 A;  3I17 A;  4QYP A;  1QG5 A;  1N9Y A;  3T2X A;  3PK2 A;  4O4X A;  5JR8 A;  3CKG A;  1KZW A;  4U46 A;  1FTP A;  2P8G A;  2C1Q A;  5B5F A;  1RLB E;  4I3D A;  4LZV A;  1KFF A;  1U17 A;  2R56 A;  2FS7 A;  1FEL A;  1X8O A;  5D45 A;  3RSW A;  1STS B;  4LQZ A;  2OFB A;  1SWR A;  3EYC A;  5EPQ A;  3RDU A;  3FA7 A;  3KVN A;  1LF7 A;  4NV8 A;  4CK4 A;  1GGL A;  3BX8 A;  3RY2 A;  1T0V A;  4CDD A;  3NQ9 A;  2G5L A;  1U18 A;  3BS2 A;  4GGZ A;  2ZAG A;  1O8V A;  4XMC A;  3UEU A;  1JYD A;  1ML7 A;  3BU1 A;  3EBK A;  4LKP A;  5L3Y A;  4BX7 A;  4ZR2 A;  4BOE A;  1Y9L A;  1VWL B;  3DSZ A;  2HKD A;  1ALB A;  4INN A;  5AQ6 A;  4JNJ A;  4GU8 A;  1PBY A;  3AUM O;  3UEW A;  3VHI A;  1UYN X;  1A57 A;  2JN3 A;  1VWA B;  5FFH A;  5B11 O;  2IJA A;  2WEX A;  5KID A;  1NC9 A;  2OVS A;  1PM1 X;  3FEP A;  1VWQ B;  2IZF B;  4O3Y A;  1OBQ A;  4ODD A;  1ZNH A;  2RTM A;  3ZQ3 A;  4ES7 A;  3APW A;  4Z28 A;  2X56 A;  3WJC A;  3P6E A;  3RY1 A;  2QMI A;  4Z27 A;  2BS6 A;  3VPJ E;  4I9S A;  3BLG A;  4AZQ A;  2OY1 O;  3C76 X;  1JIW I;  4XMG A;  4GE1 A;  3EW1 A;  2CZT A;  1IFC A;  1G5W A;  1LEL A;  2X55 A;  1NDJ A;  1VWO B;  2UYW A;  3Q34 A;  1KT4 A;  1MX7 A;  1EAL A;  3WZO A;  2BLG A;  3FA8 A;  1RBP A;  1KGL A;  1PTS A;  3CWK A;  1XCA A;  3MVF A;  1QQS A;  1MK5 A;  5BVT A;  4QGW A;  3VE1 A;  2AKQ A;  4KCA A;  1VWK B;  1RXH A;  1VWG B;  1I05 A;  4OS0 A;  2GTL M;  2OY8 A;  3VG7 A;  3WJG A;  4ZHC A;  5HCC C;  1E2T A;  1K3B A;  1OPA A;  3LHN A;  3ZW0 B;  5LJC A;  3S5V A;  1SXW A;  1CBR A;  1PEE A;  1IKE A;  2MHD A;  4ORU A;  2FRS A;  5H9K A;  5AEO A;  3QQ2 A;  1KQX A;  1GX8 A;  4IAB A;  3RZY A;  4Y59 A;  1MUP A;  2X4M A;  3BY0 A;  2A5B A;  3RDX A;  3RWX A;  4NP1 A;  4I3B A;  4BX5 B;  1I4U A;  2AT0 X;  1T68 X;  1HXZ A;  3EMM A;  1E5P A;  1LIF A;  1SLF B;  4OKA A;  3ZWE A;  4QAE A;  4GET A;  2LFO A;  1FE3 A;  4KC7 A;  1OSP O;  4YH0 A;  3RKG A;  1WBI A;  4U8U N;  1HQP A;  1CBQ A;  4IAX A;  4WFV A;  3UEV A;  2X32 A;  2RTE B;  1ZNL A;  1BRQ A;  1JZU A;  1FEN A;  3PP6 A;  3D4R A;  3KFH A;  1KL4 A;  5LJD A;  3STN A;  2KTD A;  3GE2 A;  5IO5 A;  1YWB A;  4I60 A;  1A2D A;  3EBW A;  1SLG B;  3ZW1 B;  5LKE A;  1DFV A;  1VWP B;  1VWN B;  5K68 A;  1OEK A;  3KFF A;  4Y0Q A;  2FR2 A;  2AL0 X;  3D95 A;  5B29 A;  3FIQ A;  2BC3 A;  2R73 A;  4QZU A;  3FDC A;  2GC9 A;  3RDM A;  1DF3 A;  1DC9 A;  3PED A;  4MVE A;  1E02 A;  5BYP A;  1QFT A;  1GKA B;  5F58 A;  1IJ8 A;  1Z24 A;  4IB8 A;  3S26 A;  4DQ4 A;  1LCV A;  3TGA A;  1LKE A;  2WEW A;  1JMX A;  1CBS A;  2I5Z O;  1MOY A;  2RD7 C;  3FEL A;  3PQS A;  1T8V A;  1DZM A;  1I04 A;  1MEP A;  2L67 A;  3AKN A;  2DJG A;  2XKL A;  1HMT A;  3WBG A;  4NYQ A;  3TZS A;  1SMP I;  2DJF A;  2FHL A;  4Z2O A;  5EDC A;  3HWF A;  1OEE A;  3FEK A;  3WXQ A;  1VYF A;  1JJU A;  1RXK A;  4IB7 A;  3C78 X;  2ACO A;  4I3C A;  3WZN A;  5HZ8 A;  3KFG A;  1I78 A;  1GT1 A;  1X8N A;  1VYG A;  2CM9 A;  4NLI A;  2Q4N A;  2L9C A;  2G8C O;  4K19 A;  1BEB A;  2M4L A;  5F2B A;  1ZNE A;  5HA1 A;  5IO6 A;  1EUO A;  1MM9 A;  5IXG A;  3U03 A;  4UU3 A;  4EQA C;  2ASN X;  3P6G A;  4QRL A;  4YDA A;  2DM5 A;  1X71 A;  1SWF A;  1D2U A;  3FR2 A;  3FLL A;  2AT6 X;  1SWT A;  4GD9 A;  4DNE A;  1VWJ B;  4UU2 A;  1EIO A;  2CAM A;  1SWK A;  1FDQ A; 
#chains in the Genus database with same CATH homology
 1CQD A;  2GFO A;  3KWB X;  3P5V A;  3RVW A;  4BGF A;  2NQG A;  4I04 A;  4MZS A;  4W4U A;  1AYV A;  4NV7 A;  5K16 A;  2R6N A;  1S4V A;  1AYW A;  3PDF A;  1ITO A;  2OZ2 A;  2IPP B;  2NQA A;  1MS6 A;  2R9N A;  3WXE A;  3D6S A;  1SNK A;  1MIR A;  1Y08 A;  5CHV A;  1NB3 A;  1PPO A;  3IV2 A;  1ME4 A;  4MSX A;  2DC6 A;  4CDF B;  3O0U A;  1BY8 A;  2AS8 A;  3GCB A;  1NQC A;  1AU3 A;  2R9O A;  3BC3 A;  4RY2 A;  3ZUA A;  4FK5 A;  4MZO A;  1XKG A;  1TU6 A;  3KX1 A;  3PNR A;  2BSZ A;  1GX3 A;  3MTN A;  2FTD A;  4GUZ A;  3BPM A;  2DCA A;  2VFB A;  1CJL A;  3U8E A;  3IEJ A;  7PCK A;  1ATK A;  2F7D A;  2JQG R;  4CDC B;  2F1G A;  2AUZ A;  3BCN A;  1AU0 A;  3H6S A;  4K7C A;  1NL6 A;  2AU1 A;  1EWL A;  2AYO A;  4C5P A;  1PPN A;  1F2C A;  5CVO B;  1EF7 A;  2R9M A;  2YJ8 A;  3CH3 X;  3H8B A;  2ATO A;  4B55 A;  3IOQ A;  1KFU L;  5CVM A;  1PPD A;  4PP1 A;  4CDD B;  2YJ9 A;  4BS6 A;  1CPJ A;  2DC7 A;  1YT7 A;  3KWZ A;  1ZCM A;  2YJB A;  1PIP A;  1AYU A;  3MOR A;  5EF4 A;  1A6R A;  1U9Q X;  3H7D A;  3I06 A;  3HHA A;  4OEL A;  1SP4 B;  4X6H A;  3MHH A;  4BPV A;  4XUI A;  3D9W A;  3V6E A;  5CVN B;  1EWO A;  2R9F A;  1GLO A;  1K3B B;  2CIO A;  4Q8H A;  4QH6 A;  2GHU A;  4QBB A;  1KHQ A;  1BGO A;  2HXZ A;  4XR7 A;  3IHP A;  2WBF X;  2YJC A;  1F2B A;  2OP3 A;  2DZY A;  2E00 A;  4BSQ A;  1U9V A;  3BPF A;  4PP2 E;  4P6E A;  5PAD A;  3V6C A;  3LTW A;  2AIM A;  1GCB A;  1PBH A;  4AXL A;  4P6G A;  1AEC A;  3DF0 A;  3KFQ A;  4N79 A;  3P5X A;  1CV8 A;  1EWP A;  1TL9 A;  2IBI A;  1ZIV A;  3KKU A;  1PAD A;  1CSB B;  2H7J A;  4OEM A;  6PAD A;  3WXF A;  3F75 A;  2DCB A;  3E1Z B;  3OF9 A;  1M6D A;  4FJC A;  2VHF A;  1PCI A;  1W5R A;  4BQV A;  5A24 A;  1W6F A;  3OVZ A;  3PBH A;  2BDZ A;  3RVX A;  1MDW A;  1QXP A;  5J94 A;  1DEU A;  3CBJ A;  4I07 A;  2Y6E A;  2DC8 A;  2CB5 A;  4BS5 A;  1FH0 A;  3IMA A;  2DJG B;  4X6J A;  3K24 A;  2HH5 A;  2DJF B;  2P7U A;  2O6X A;  1POP A;  2C0Y A;  1QDQ A;  2VFC A;  2FUD A;  2YJ2 A;  2DC9 A;  1MHW A;  3K9M A;  1AU4 A;  4CZW A;  3LXS A;  3C9E A;  1GEC E;  2B1N A;  2FRQ A;  2B1M A;  3PW3 A;  1F29 A;  1PXV A;  1CTE A;  4YYQ A;  4PAD A;  2Y5B A;  2PAD A;  4X6I A;  3LFY A;  3CH2 X;  4YYW A;  2XU5 A;  1U9X A;  2XU1 A;  3P5U A;  3TNX A;  3N4C A;  2FO5 A;  3H89 A;  4ZUX U;  1JQP A;  3KSE A;  1YAL A;  3S3Q A;  5JA7 A;  3HHI A;  2FQ9 A;  1NB5 A;  1CVZ A;  2G7Y A;  3MHS A;  4N4Z A;  1HUC B;  1F2A A;  4KLB A;  2E01 A;  1Y4H A;  1MEG A;  2ACT A;  2DZZ A;  1W4T A;  2FYE A;  3H8C A;  2AVW A;  4G54 A;  3QJ3 A;  3BWK A;  1NLJ A;  2G8E A;  4CDE B;  4I05 A;  4QRG A;  1THE A;  2AUX A;  2HHN A;  1ICF A;  4YVA A;  2E03 A;  4YYS A;  4YYR A;  4N8W A;  1KFX L;  2NQI A;  4NV8 A;  4YYV A;  1TLO A;  1YVB A;  4DMY A;  3B79 A;  3HWN A;  4AXM A;  4QRV A;  2PBH A;  5F02 A;  4PI3 A;  1O0E A;  1BQI A;  3KW9 A;  8PCH A;  4WA6 A;  5FPW A;  4YV8 A;  4QRX A;  1U9W A;  3OIS A;  3NHE A;  2JQF R;  1STF E;  3QT4 A;  3USV A;  1KHP A;  3RVV A;  1MEM A;  1NPZ A;  1IWD A;  4DMX A;  5EGW A;  1KXR A;  3O1G A;  5JH3 A;  3QSD A;  1PE6 A;  1CS8 A;  3M99 A;  3AI8 A;  1PPP A;  3IUT A;  2FT2 A;  2PNS A;  2PRE A;  1E2T A;  3S3R A;  2XU3 A;  3I3T A;  3N3G A;  2E02 A;  2P0R A;  3BOW A;  9PAP A;  3F5V A;  3ERV A;  1YK8 A;  2BDL A;  3WXG A;  1YK7 A;  3K8U A;  1DF0 A;  2NQD B;  2OUL A;  2ARY A;  1QMY A;  5CHT A;  2XU4 A;  1ME3 A;  1QOL A;  2G8J A;  3P5W A;  1VJV A;  2HD5 A;  4W5B A;  2R9C A;  1EWM A;  3OF8 A;  1U5I A;  2FRA A;  2P86 A;  4W5C A;  1VSN A;  4Q8G A;  1AU2 A;  2DCC A;  1Q6K A;  4HWY A;  2G6D A;  3N3K A;  3CBK A;  1AIM A;  3HD3 A;  2VHS A;  4YYU A;  1BP4 A;  2DCD A;  3OVX A;  1GMY A;  1X9Y A;  2AYN A;  4FIP A;  1CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...