4NV7A

Crystal structure of mesorhizobium loti arylamine n-acetyltransferase 1 in complex with coa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
268
Chain Sequence
PPFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPWENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase
publication title Insight into cofactor recognition in arylamine N-acetyltransferase enzymes: structure of Mesorhizobium loti arylamine N-acetyltransferase in complex with coenzyme A.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 84
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4nv7A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4nv7A01
4BGFA 4NV7A 1W5RA 1E2TA 2VFCA 4GUZA 2VFBA 3LTWA 4C5PA 3D9WA 2BSZA 4B55A 1GX3A 4NV8A 1W6FA 1W4TA
chains in the Genus database with same CATH superfamily
1ACDA 2RTCB 1B8EA 3DSZA 2FGSA 2MM3A 1CJ5A 2JMBA 4B55A 3EC5A 1BEBA 3NQ9A 1LIEA 3VHIA 4CV7A 1SWKA 1JJXA 1GGLA 4NYRA 3WZQA 3WBGA 1S2PA 1HMSA 4XMEA 1QABE 4BVMA 1QFVA 4LZVA 5C0NA 2AT8X 2IZBA 2ZSCA 3C77X 5IXGA 3CR6A 4ZHGA 2MO5A 3PQUA 1JQPA 5HTDA 1MM9A 3AUMO 4WFVA 3O2YA 4TKHA 3ZW1B 3VG4A 1HXLA 1JIWI 3E3CA 1UREA 2E4JA 1NDJA 4NV7A 4TLJA 2IZDB 4O4OA 5HBSA 1SWNA 1SLDB 3RKGA 2RTLA 4AYHA 4AZQA 1DV9A 1U18A 1BWYA 4XMDA 3ZW2A 1FJ1E 5H8TA 1PBYA 2RTMA 4NLIA 1FELA 1UZ2X 2OFMX 3FA9A 3MG5A 2RA6A 3CQNA 4M7MA 2BS5A 2VFBA 2GTLN 2X8SA 1YWBA 1SWUA 5B29A 2WQ9A 4BX5A 1E2TA 5LJBA 1N4JA 2QOMA 2BS6A 1LDOA 2OFBA 2X8TA 3FW5A 4I9RA 1BBPA 1P6PA 3F6ZB 4Z2PA 1PMPA 4MVKA 4O4SA 2OVSA 1UYOX 3PP6A 5BYPA 1SWGA 2NNEA 1VWPB 5JD2A 4NLJA 3O22A 2BLGA 2LFOA 1U17A 2FLJA 2JOZA 1LCVA 2F09A 3GE2A 2DJFA 2IFBA 4A1HA 1AQBA 3B2KA 3P6EA 1BRQA 2GC9A 3IA8A 4YFRA 2CZUA 1N7YA 2MF6A 2RTAA 1ZRYA 3ZUOA 4ML7B 1QY0A 1SWQA 4IB9A 4ORRA 3D97A 3FW4A 3P6CA 5HZ6A 1Y0GA 1HXZA 2JN3A 4GDZA 2HYSA 1GM6A 4BX7B 3P6HA 1QQSA 4LQZA 5D48A 4GE1A 1LPJA 1SRHA 2RCTA 2CM9A 3VE2A 4D6BA 3VG2A 1LFOA 3CKGA 4YGHA 5JR8A 1KZWA 5F2BA 2QOSC 1CBQA 2K23A 4GUZA 3STKA 5B10O 3EMMA 1SWHA 4EDEA 5D47A 4NYQA 3FEKA 4GJSA 2G78A 1FENA 4KH8A 2QCBA 4DCBA 3ELZA 4MVIA 2R73A 3WYQA 1TXLA 2LKKA 1GT4A 4ORSA 2RTRB 1QFTA 2R56A 3D4RA 2LB6A 2VFCA 3RDSA 1DFVA 4QGVA 3VG3A 2RTEB 2FR2A 2F01A 4NNSA 1I9HA 1W5RA 4ZGFA 1EI5A 2IZHB 3BU1A 5H9KA 2X32A 4KC7A 3RBYA 2DJGA 3MBTA 1G85A 4IB6A 4AW8A 1PM1X 1S44A 5F1EA 3RE6A 4BGFA 1DZMA 5B11O 3WJEA 1OEJA 1N9MA 1EIIA 1OPBA 1VWMB 4MISA 4QRLA 1DC9A 3WZPA 1FDQA 4YMYA 4BX6B 2JU8A 3NPOA 3BY0A 5KIDA 3PH6A 3VGWA 1GT3A 2A5CA 4UU2A 5CYBA 4Z2OA 5K67A 1RSTB 1Y55X 2M4LA 1K24A 2I5VO 2JW1A 4ZHHA 1LNMA 1CRBA 3S26A 1AELA 1JJJA 4O49A 1KQWA 1YIVA 2ZAIA 1OEKA 3FLLA 5HA1A 3STNA 2RTHB 2IZKA 4U9CA 3WVMA 3HPEA 5AJBA 1A2DA 4PJ2A 5BVQA 2BC3A 2X4MA 2FS7A 5K68A 2Z4IA 5D45A 1LICA 4FGIB 3OJYC 1X8NA 3BS2A 3SLJA 1D3SA 1E06A 1WBIA 3APWA 1GX8A 1HQPA 3VE1A 1AVGI 4Y0QA 1HQQA 3UEXA 3B2IA 1NQNA 1EALA 1AVEA 4YKMA 1LKEA 4QQ1A 3PK2A 1FTPA 3RY1A 1OBUA 1SWRA 1BSYA 3APXA 4GD9A 1ZNEA 3T1DA 1ZNLA 3FELA 3NP1A 2OZQA 3SLTA 3VPJE 4Y0SA 1RSUB 1HMTA 3EM0A 1KGLA 4O3ZA 1I05A 2RTDB 4O9SA 3MM0A 3HWGA 1STRB 2FHLA 2W2FA 3OBLA 4N7CA 3TGAA 1DF3A 3HK1A 3QQ2A 1SY3A 1CBRA 3F9DA 1DZJA 2NP1A 1T68X 2OF8A 3ZW0B 1VYOA 2RTIB 5HAEA 4I3CA 2QM9A 2RN4A 1JJUA 2GTLM 3SZIA 1MOYA 3S5XA 1IFCA 3B2HA 4LKPA 4BQUA 1G5WA 2RTPB 4DNEA 3FEPA 4PSQA 1PTSA 2FTBA 1DZPA 2OY8A 4GH7A 3FR4A 4OKAA 1SY2A 1QY2A 5HZQA 1KQXA 2BHVA 1RLBE 4EKVA 2OL6O 1E02A 1ICMA 1X89A 2HNXA 2Q9SA 3WZOA 2GTFX 5B5FA 2WSJA 3CBCA 2A2GA 2A13A 1SREA 5L8OA 4O4UA 2L68A 1LIBA 1SXUA 1SWTA 2EU7X 5LKEA 4YGZA 5HZ8A 4RUNA 1SWEA 3NBXX 5BVTA 3X00A 1VWJB 5LJDA 4GZVA 5EEEA 4ORWA 5IRAA 3T2XA 1BJ7A 3UEVA 3VG5A 1TOWA 3D9WA 4QZTA 4GJVA 4YBUA 5D4AA 2WR6A 3RDMA 2FKJA 2KTDA 4GGTA 3Q34A 4IAWA 4U8UN 2ALLX 4XMFA 3SLOA 1RBPA 3UAQA 1E5PA 2X8FA 3KZAA 4TNNA 1VWFB 1U0XA 1ZNDA 4YGGA 5LJCA 1X8UA 1KZXA 1VWEB 4FQBB 2A0AA 5F6ZA 5AJCA 3CWKA 1VWGB 1O8VA 4GGRA 4UU3A 4ARHA 3PECA 1HBQA 1X8PA 2WEXA 3HWDA 3I17A 3NQ3A 1ZNHA 1VWOB 1HBPA 1NQMA 4ZR2A 3RDQA 2ANSA 1SRJA 3APUA 3BX7A 2AH7X 2F73A 3KVNA 2N93A 2FS6A 3NQKA 1YWAA 3AKNA 3F8AA 2RD7C 3C76X 3G7XA 4A60A 1LUQA 3OE3A 1T8VA 1STPA 4O3YA 2FHNX 5AQ6A 1XKIA 4JGLA 4KIIA 1EPAA 5CHKA 2KW1A 4INNA 1RXKA 1HMRA 2P8GA 2RQ0A 1KT4A 3T6LA 1PEEA 1JYDA 3RE5A 3KQ0A 2K62A 4BX7A 1CBIA 2AF5A 4N7DA 4AZPA 5LJHA 1O1VA 5K06A 2NNDA 1SWLA 1LELA 2OVAA 1B56A 4YDAA 3STMX 3WJGA 3WZNA 2AT6X 2JGSA 3FA7A 2LBVA 3NX1A 4COTA 1R0UA 1KT7A 2MHDA 4BX5B 1SLFB 2I5ZO 1KFFA 2C1QA 4I3DA 3TF6A 4IAXA 3L4RA 4ZH6A 1ADLA 4NV8A 1SWCA 1KXOA 4QGXA 2FT9A 5EDBA 2OL7A 3BDRA 1EXSA 4QYPA 1O1UA 2OL8O 1HY2A 2G8CO 3BSZE 4CPIA 2PI3O 4WHIA 2GJ5A 2XKLA 1GXAA 4ON1A 5KHPA 4IBAA 4I3BA 1QY1A 1IW2A 2W2BA 5F7GA 4Z27A 1MEPA 1VWDB 3HOEA 4MVEA 3S5VA 2WEWA 3VHHA 3VU1A 3P6DA 1VWAB 5HCCC 4NNTA 4YKOA 4JNJA 1A3YA 3GAQA 3ZQ3A 1N0SA 1IKEA 4DQ3A 3I0AA 3JSQA 3FMZA 1G7NA 3PH5A 1SLGB 2O62A 4YH0A 4OS8A 4BX6A 4CPEA 1Y9LA 2A5BA 3EBKA 1SLEB 4KT5A 4OS0A 1BLRA 4U8UO 3KFHA 3HWFA 4RUUA 3V8UA 4MIRA 2X45A 1H91A 3MVFA 4HPAA 1A18A 1OBQA 2PFRA 2IZLB 1DZKA 1KL5A 3WYPA 3ZWEA 4OMXA 1BSQA 1ICNA 3B2JA 3EW2A 2IZCB 2PY1A 1SA8A 1NP4A 3ZZVA 2R74A 3WOVA 4R0BA 2KD2A 3RY2A 3BX8A 3UEUA 5LJEA 3U0DA 3HOLA 1VWHB 2Y32A 3RZYA 3VHMA 3RDUA 4DMOA 4GKCA 4TKBA 1OPAA 4OS3A 4ORXA 2RTBB 5B27A 2FRSA 4BBOA 1JZUA 2YG2A 2MJIA 5CSEA 3FR2A 1KT5A 5IO7A 5F6BA 2NNQA 4Z6JA 1DF8A 2JU7A 2KT4B 2Q4NA 3DTQA 4OELA 2OY1O 1ERBA 3BRNA 4YCHA 2GH7A 3WJFA 5IRWA 4YCEA 2CBSA 3SOTA 2A2UA 1BM5A 5LKFA 2HZQA 2Y3FA 2HLVA 5HWZA 4GDAA 1RAVA 1VYGA 2FR3A 1SMPI 4IMOA 5F58A 1Y52X 4AZMA 1MX8A 3OD9A 4IMNA 1SXXA 2G7BA 3KFIA 4HPBA 4U8UM 1YWCA 3EYCA 3WJBA 2AVIA 5DG4A 2IZFB 4EFGA 1GKAB 4LZUA 3SAOA 1GT5A 1MUPA 4JHQA 4FBRA 5DPQA 1EUOA 1KL3A 3N91A 1SWDA 2WQAE 4TKJA 5D8JA 1EIOA 3C78X 2PQTA 1KOIA 2ACOA 1X8QA 5L8IA 1NC9A 2L67A 1ALBA 1A57A 1VYFA 5EEDA 1LF7A 5H9NA 3AKMA 5HTEA 3RDOA 1LCZA 2CM4A 1SY0A 3K3LA 3FDCA 5FQ8E 3UEWA 1AB0A 5HCDC 4U46A 2YMSA 2ZAGA 1MDCA 1OBPA 1NBXA 3ZW1A 3TGCA 2QO4A 4BOEA 2UZ2A 5KICA 1STSB 1Z24A 4IB7A 1AVDA 4O3WA 5H9LA 2RTQB 5L3YA 3VG6A 4CPHB 1IFBA 5LJKA 1FE3A 1LIDA 1Y53X 1N9YA 1ZNKA 1IKJA 2HMBA 2X56A 5IRUA 1YUPA 4YFQA 5CE4A 4ZJ0A 2IZGB 3SZHA 1GX3A 4CSBA 1YP6A 1HN2A 2DM5A 4Y0RA 4EQAC 1B4MA 1YP7A 2L5PA 4Y0PA 4D6AA 3BLGA 4GRJA 4HPCA 1SXYA 4TQ2A 1SXWA 3P02A 2RTNB 4CDFA 1S7DA 1BSOA 1YWDA 2A3FX 4NP1A 1MX7A 4I60A 1JMZA 2QO5A 2OY7A 4BCSA 4GU8A 1EW3A 4LKTA 5FQ7E 2AMMX 2WWPA 1W6FA 3JS1A 2IZEB 2IZJA 3ELXA 1IIUA 2OFRX 5FQ6E 1JMXA 4I95A 2RTFB 1JV4A 2BT9A 4GGZA 4XMGA 4HPDA 1W4TA 1Y9TA 2IZIA 4ORYA 4Y5DA 1VWIB 2AT3X 1X8OA 3T6FA 3AEHA 3EBWA 3CKFA 3PPTA 3ZI8A 3U03A 3D95A 5BVSA 1NGLA 4AZOA 4CDEA 1I4UA 3EW1A 2CZTA 3LV4A 1IJ8A 2RTOB 4XMHA 5EDCA 2OYBO 5H9AA 4Z2VA 1SWJA 4ZHFA 2IJAA 1QWDA 1KT6A 1OSPO 4OMWA 1G74A 3PDFA 2OY5O 3H3IA 3PEDA 4U3QA 1VWQB 2QO6A 3IFBA 3P24A 1WUBA 4YFPA 1TVQA 2A8GA 3Q6LA 3WXQA 3QKGA 3HWEA 4KCAA 4QAEA 5FFHA 1OEEA 3FIQA 3APVA 4IB8A 1SY1A 2JU3A 3FENA 3RDXA 4ORUA 1KT3A 1VWLB 5AEOA 1VWNB 5LJGA 1ML7A 1SWPA 1EQDA 3KFFA 3PQSA 1X71A 2OVDA 4I9SA 4ODDA 4NW4A 2OFAA 4XMCA 4ZH9A 3TGBA 2RTKA 1EPBA 3JQOA 1JBHA 1SRIA 3FA6A 2AT0X 4TJZA 2WUTA 1RXHA 1ZNGA 1GT1A 1XCAA 2AT5X 2Q39A 3LTWA 4AZRA 3P6GA 4GNWA 3P6FA 1SWOA 4OEMA 2CBRA 4CK4A 4QZUA 1SWSA 4JO6A 2L9CA 2RTJA 4YDBA 4WFUA 2KTSA 3D96A 3U9PC 2X55A 4FBVA 4ZHCA 1N43A 1K3BA 4CDCA 2OF9A 3NR3A 4L1NA 4IABA 1KL4A 1TOUA 3FYFA 5HZ9A 3CMPA 5HCEC 2OVEA 4ES7A 3RSWA 4GETA 4ID2A 4GK9A 1JYJA 1VPRA 2ASNX 2W2AA 3WJCA 4DQ4A 4KC8A 1MVGA 2WPUA 2G5LA 4A1YA 2C1SA 2G79A 4EXZA 1VWKB 2Y3EA 3MX7A 5FAZA 5B3MO 5B5GA 3S60A 1FEMA 3O19A 1RXJA 3VG7A 1QG5A 4MVLA 1GX9A 1D2UA 2AL0X 1CBSA 1SRFA 2GTLO 4CDDA 3HTYA 3KFGA 1SWFA 4BJ8A 2AKQA 2LBAA 1VWCB 1TW4A 2POAA 4FBOA 1VWBB 3TZSA 4HFOA 5IO6A 3LHNA 1BRPA 5EPQA 3T2WA 1VWRB 4GNYA 2Q2PA 3SZJA 4YVBA 2IZAA 1T0VA 2XSTA 3ZW0A 2FWVA 3FIDA 4L3RA 4MEEA 2HKDA 2MWHA 3NX2A 4CPFA 5IO5A 2VDFA 1GKAA 2X34A 4YBPA 1MK5A 1L6MA 3LNBA 2HZRA 2LA7A 1ERXA 2RTGB 3CQRA 1I06A 3FA8A 4ZFXA 4K19A 3ZUIA 1LIFA 4ALBA 5L8NA 4QGWA 1NP1A 4C5PA 4M6SA 3WJDA 4IRWA 1B0OA 4QNIA 1E00A 3B2LA 2FKGA 3FR5A 1I78A 4I6SA 4O4XA 5HA0A 2ACPX 2BSZA 2Q2MA 2RCQA 4WBKA 1I04A 1UYNX 4ZCBA 4AZNA 3CBSA 4ZGUA 3NADA 1SRGA 1PBOA 5HZ5A 2X46A 5EZ2A 4ALOA 4O3XB 4QYNA 3BU9A 5B2AO 4EEJA 4Y59A 2UYWA 2CAMA 4Z28A 5FENA 1SWAA 1LCWA 2C4IA 4ZHDA 4A8ZA 4CPHA 2Z4HA 4HWMA 1LDQA 2QMIA 3RWXA 1SWBA
chains in the Genus database with same CATH topology
3P5WA 3K8UA 1EF7A 4B55A 2AS8A 3MTNA 1KFXL 1NLJA 3KKUA 2AUZA 9PAPA 4P6EA 1JQPA 2CB5A 2DC7A 4YVAA 4NV7A 1EWMA 2F1GA 1AU0A 3P5XA 1CS8A 3C9EA 1XKGA 1F2CA 2VFBA 2AYOA 3IMAA 3M99A 1E2TA 1YVBA 4HWYA 4CDFB 3CH2X 4P6GA 1U5IA 4XUIA 5JH3A 4AXMA 1GCBA 2G8EA 3OVXA 1MEMA 1YK8A 3QSDA 4N8WA 4QRVA 1YT7A 1AYVA 2F7DA 3HWNA 4MZSA 3PNRA 4GUZA 1F2BA 2B1MA 3ZUAA 1MHWA 2Y6EA 4W5CA 2VFCA 1AYUA 3OF8A 4FIPA 1THEA 3BCNA 1BY8A 1Y08A 1TLOA 2YJ2A 1BGOA 1W5RA 2NQIA 2FTDA 2VHFA 1ME4A 4BGFA 3S3QA 3KFQA 2AVWA 5CHTA 3F75A 2HHNA 5PADA 1QOLA 2XU1A 3O0UA 5EGWA 2OZ2A 2G7YA 2DZZA 2WBFX 5FPWA 1ME3A 1CTEA 2R9FA 1K3BB 4CDCB 1NPZA 3CBKA 2OULA 2FO5A 3N3GA 1ITOA 1NQCA 3TNXA 4DMYA 2ACTA 2IBIA 3IEJA 2PADA 4CDDB 5EF4A 2HXZA 1S4VA 1TL9A 2GFOA 1MEGA 1FH0A 2AU1A 4W5BA 1U9VA 3BC3A 2XU3A 5CHVA 1PPDA 3IOQA 4PADA 4YYWA 3WXFA 4Q8GA 2P86A 3H89A 3K24A 3KWBX 3IUTA 2B1NA 4QRGA 5CVOB 4KLBA 2PBHA 4YYVA 3H8CA 1VSNA 1AU3A 1IWDA 3KW9A 1U9XA 8PCHA 1YALA 2YJCA 3D9WA 2G8JA 1AECA 1PPNA 3AI8A 4I04A 1EWPA 4X6IA 1PADA 3LFYA 3MORA 3NHEA 7PCKA 1PCIA 1NL6A 4N79A 1F2AA 1DEUA 1MIRA 4ZUXU 4AXLA 2NQAA 4I05A 2FUDA 1PXVA 1QDQA 3B79A 4K7CA 1GECE 2FRQA 2H7JA 3H8BA 2OP3A 5A24A 1KHPA 3PBHA 1AIMA 4CZWA 1M6DA 1X9YA 3IHPA 3RVWA 2YJ8A 4CDEB 2ARYA 3H7DA 4NV8A 1PPOA 2BDZA 1ZCMA 5F02A 4FJCA 1NB5A 3USVA 3O1GA 4YYSA 4PP1A 3WXEA 3HD3A 4FK5A 3DF0A 4YV8A 1EWLA 2GHUA 1A6RA 3KSEA 2O6XA 2E03A 4QRXA 2DCDA 3QJ3A 1CV8A 2P0RA 1Y4HA 4X6JA 3HHAA 2IPPB 1CQDA 4X6HA 2JQGR 2CIOA 2ATOA 3RVXA 2FRAA 2P7UA 2XU5A 1U9QX 4MSXA 2NQDB 4XR7A 5CVNB 1POPA 4OELA 2VHSA 2JQFR 3D6SA 1DF0A 2HD5A 1ZIVA 4N4ZA 1PE6A 4BQVA 4WA6A 1CPJA 3V6CA 4QBBA 2DC9A 3LXSA 1BP4A 1ATKA 3CBJA 3P5UA 1CVZA 5K16A 3IV2A 2C0YA 2R9MA 4RY2A 1QXPA 2DZYA 5JA7A 2E02A 1AU4A 3I3TA 3P5VA 1ICFA 1PBHA 2HH5A 2R6NA 3QT4A 4QH6A 4YYQA 1GX3A 1Q6KA 4I07A 2DC8A 2R9NA 1GLOA 3H6SA 2Y5BA 1QMYA 3BPMA 2E01A 1TU6A 3PW3A 1W6FA 1GMYA 2G6DA 3OF9A 3RVVA 1YK7A 1W4TA 1MS6A 5J94A 2R9CA 2XU4A 1CSBB 4BSQA 3PDFA 3BWKA 4MZOA 1SNKA 3KX1A 3MHHA 2YJ9A 2DJFB 2YJBA 2PREA 4BS5A 2PNSA 4YYUA 6PADA 3U8EA 1CJLA 1KHQA 1U9WA 4PI3A 2AUXA 1AU2A 3LTWA 2NQGA 4OEMA 1CB5A 2DCBA 4G54A 5CVMA 1PIPA 1SP4B 2FYEA 3N3KA 1EWOA 2DC6A 1MDWA 3S3RA 2BDLA 3F5VA 2AYNA 2DJGB 3K9MA 3OISA 3V6EA 1KXRA 3MHSA 1O0EA 1PPPA 2FQ9A 4PP2E 2DCAA 2AIMA 4BPVA 2DCCA 3OVZA 4YYRA 3WXGA 2E00A 4DMXA 1VJVA 4C5PA 2FT2A 1HUCB 3HHIA 1NB3A 4W4UA 4BS6A 3GCBA 3CH3X 1AYWA 2R9OA 3I06A 2BSZA 1F29A 3BOWA 3KWZA 4Q8HA 3N4CA 1STFE 3ERVA 1KFUL 3E1ZB 3BPFA 1BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGF A;  4NV7 A;  1W5R A;  1E2T A;  2VFC A;  4GUZ A;  2VFB A;  3LTW A;  4C5P A;  3D9W A;  2BSZ A;  4B55 A;  1GX3 A;  4NV8 A;  1W6F A;  1W4T A; 
#chains in the Genus database with same CATH topology
 1ACD A;  2RTC B;  1B8E A;  3DSZ A;  2FGS A;  2MM3 A;  1CJ5 A;  2JMB A;  4B55 A;  3EC5 A;  1BEB A;  3NQ9 A;  1LIE A;  3VHI A;  4CV7 A;  1SWK A;  1JJX A;  1GGL A;  4NYR A;  3WZQ A;  3WBG A;  1S2P A;  1HMS A;  4XME A;  1QAB E;  4BVM A;  1QFV A;  4LZV A;  5C0N A;  2AT8 X;  2IZB A;  2ZSC A;  3C77 X;  5IXG A;  3CR6 A;  4ZHG A;  2MO5 A;  3PQU A;  1JQP A;  5HTD A;  1MM9 A;  3AUM O;  4WFV A;  3O2Y A;  4TKH A;  3ZW1 B;  3VG4 A;  1HXL A;  1JIW I;  3E3C A;  1URE A;  2E4J A;  1NDJ A;  4NV7 A;  4TLJ A;  2IZD B;  4O4O A;  5HBS A;  1SWN A;  1SLD B;  3RKG A;  2RTL A;  4AYH A;  4AZQ A;  1DV9 A;  1U18 A;  1BWY A;  4XMD A;  3ZW2 A;  1FJ1 E;  5H8T A;  1PBY A;  2RTM A;  4NLI A;  1FEL A;  1UZ2 X;  2OFM X;  3FA9 A;  3MG5 A;  2RA6 A;  3CQN A;  4M7M A;  2BS5 A;  2VFB A;  2GTL N;  2X8S A;  1YWB A;  1SWU A;  5B29 A;  2WQ9 A;  4BX5 A;  1E2T A;  5LJB A;  1N4J A;  2QOM A;  2BS6 A;  1LDO A;  2OFB A;  2X8T A;  3FW5 A;  4I9R A;  1BBP A;  1P6P A;  3F6Z B;  4Z2P A;  1PMP A;  4MVK A;  4O4S A;  2OVS A;  1UYO X;  3PP6 A;  5BYP A;  1SWG A;  2NNE A;  1VWP B;  5JD2 A;  4NLJ A;  3O22 A;  2BLG A;  2LFO A;  1U17 A;  2FLJ A;  2JOZ A;  1LCV A;  2F09 A;  3GE2 A;  2DJF A;  2IFB A;  4A1H A;  1AQB A;  3B2K A;  3P6E A;  1BRQ A;  2GC9 A;  3IA8 A;  4YFR A;  2CZU A;  1N7Y A;  2MF6 A;  2RTA A;  1ZRY A;  3ZUO A;  4ML7 B;  1QY0 A;  1SWQ A;  4IB9 A;  4ORR A;  3D97 A;  3FW4 A;  3P6C A;  5HZ6 A;  1Y0G A;  1HXZ A;  2JN3 A;  4GDZ A;  2HYS A;  1GM6 A;  4BX7 B;  3P6H A;  1QQS A;  4LQZ A;  5D48 A;  4GE1 A;  1LPJ A;  1SRH A;  2RCT A;  2CM9 A;  3VE2 A;  4D6B A;  3VG2 A;  1LFO A;  3CKG A;  4YGH A;  5JR8 A;  1KZW A;  5F2B A;  2QOS C;  1CBQ A;  2K23 A;  4GUZ A;  3STK A;  5B10 O;  3EMM A;  1SWH A;  4EDE A;  5D47 A;  4NYQ A;  3FEK A;  4GJS A;  2G78 A;  1FEN A;  4KH8 A;  2QCB A;  4DCB A;  3ELZ A;  4MVI A;  2R73 A;  3WYQ A;  1TXL A;  2LKK A;  1GT4 A;  4ORS A;  2RTR B;  1QFT A;  2R56 A;  3D4R A;  2LB6 A;  2VFC A;  3RDS A;  1DFV A;  4QGV A;  3VG3 A;  2RTE B;  2FR2 A;  2F01 A;  4NNS A;  1I9H A;  1W5R A;  4ZGF A;  1EI5 A;  2IZH B;  3BU1 A;  5H9K A;  2X32 A;  4KC7 A;  3RBY A;  2DJG A;  3MBT A;  1G85 A;  4IB6 A;  4AW8 A;  1PM1 X;  1S44 A;  5F1E A;  3RE6 A;  4BGF A;  1DZM A;  5B11 O;  3WJE A;  1OEJ A;  1N9M A;  1EII A;  1OPB A;  1VWM B;  4MIS A;  4QRL A;  1DC9 A;  3WZP A;  1FDQ A;  4YMY A;  4BX6 B;  2JU8 A;  3NPO A;  3BY0 A;  5KID A;  3PH6 A;  3VGW A;  1GT3 A;  2A5C A;  4UU2 A;  5CYB A;  4Z2O A;  5K67 A;  1RST B;  1Y55 X;  2M4L A;  1K24 A;  2I5V O;  2JW1 A;  4ZHH A;  1LNM A;  1CRB A;  3S26 A;  1AEL A;  1JJJ A;  4O49 A;  1KQW A;  1YIV A;  2ZAI A;  1OEK A;  3FLL A;  5HA1 A;  3STN A;  2RTH B;  2IZK A;  4U9C A;  3WVM A;  3HPE A;  5AJB A;  1A2D A;  4PJ2 A;  5BVQ A;  2BC3 A;  2X4M A;  2FS7 A;  5K68 A;  2Z4I A;  5D45 A;  1LIC A;  4FGI B;  3OJY C;  1X8N A;  3BS2 A;  3SLJ A;  1D3S A;  1E06 A;  1WBI A;  3APW A;  1GX8 A;  1HQP A;  3VE1 A;  1AVG I;  4Y0Q A;  1HQQ A;  3UEX A;  3B2I A;  1NQN A;  1EAL A;  1AVE A;  4YKM A;  1LKE A;  4QQ1 A;  3PK2 A;  1FTP A;  3RY1 A;  1OBU A;  1SWR A;  1BSY A;  3APX A;  4GD9 A;  1ZNE A;  3T1D A;  1ZNL A;  3FEL A;  3NP1 A;  2OZQ A;  3SLT A;  3VPJ E;  4Y0S A;  1RSU B;  1HMT A;  3EM0 A;  1KGL A;  4O3Z A;  1I05 A;  2RTD B;  4O9S A;  3MM0 A;  3HWG A;  1STR B;  2FHL A;  2W2F A;  3OBL A;  4N7C A;  3TGA A;  1DF3 A;  3HK1 A;  3QQ2 A;  1SY3 A;  1CBR A;  3F9D A;  1DZJ A;  2NP1 A;  1T68 X;  2OF8 A;  3ZW0 B;  1VYO A;  2RTI B;  5HAE A;  4I3C A;  2QM9 A;  2RN4 A;  1JJU A;  2GTL M;  3SZI A;  1MOY A;  3S5X A;  1IFC A;  3B2H A;  4LKP A;  4BQU A;  1G5W A;  2RTP B;  4DNE A;  3FEP A;  4PSQ A;  1PTS A;  2FTB A;  1DZP A;  2OY8 A;  4GH7 A;  3FR4 A;  4OKA A;  1SY2 A;  1QY2 A;  5HZQ A;  1KQX A;  2BHV A;  1RLB E;  4EKV A;  2OL6 O;  1E02 A;  1ICM A;  1X89 A;  2HNX A;  2Q9S A;  3WZO A;  2GTF X;  5B5F A;  2WSJ A;  3CBC A;  2A2G A;  2A13 A;  1SRE A;  5L8O A;  4O4U A;  2L68 A;  1LIB A;  1SXU A;  1SWT A;  2EU7 X;  5LKE A;  4YGZ A;  5HZ8 A;  4RUN A;  1SWE A;  3NBX X;  5BVT A;  3X00 A;  1VWJ B;  5LJD A;  4GZV A;  5EEE A;  4ORW A;  5IRA A;  3T2X A;  1BJ7 A;  3UEV A;  3VG5 A;  1TOW A;  3D9W A;  4QZT A;  4GJV A;  4YBU A;  5D4A A;  2WR6 A;  3RDM A;  2FKJ A;  2KTD A;  4GGT A;  3Q34 A;  4IAW A;  4U8U N;  2ALL X;  4XMF A;  3SLO A;  1RBP A;  3UAQ A;  1E5P A;  2X8F A;  3KZA A;  4TNN A;  1VWF B;  1U0X A;  1ZND A;  4YGG A;  5LJC A;  1X8U A;  1KZX A;  1VWE B;  4FQB B;  2A0A A;  5F6Z A;  5AJC A;  3CWK A;  1VWG B;  1O8V A;  4GGR A;  4UU3 A;  4ARH A;  3PEC A;  1HBQ A;  1X8P A;  2WEX A;  3HWD A;  3I17 A;  3NQ3 A;  1ZNH A;  1VWO B;  1HBP A;  1NQM A;  4ZR2 A;  3RDQ A;  2ANS A;  1SRJ A;  3APU A;  3BX7 A;  2AH7 X;  2F73 A;  3KVN A;  2N93 A;  2FS6 A;  3NQK A;  1YWA A;  3AKN A;  3F8A A;  2RD7 C;  3C76 X;  3G7X A;  4A60 A;  1LUQ A;  3OE3 A;  1T8V A;  1STP A;  4O3Y A;  2FHN X;  5AQ6 A;  1XKI A;  4JGL A;  4KII A;  1EPA A;  5CHK A;  2KW1 A;  4INN A;  1RXK A;  1HMR A;  2P8G A;  2RQ0 A;  1KT4 A;  3T6L A;  1PEE A;  1JYD A;  3RE5 A;  3KQ0 A;  2K62 A;  4BX7 A;  1CBI A;  2AF5 A;  4N7D A;  4AZP A;  5LJH A;  1O1V A;  5K06 A;  2NND A;  1SWL A;  1LEL A;  2OVA A;  1B56 A;  4YDA A;  3STM X;  3WJG A;  3WZN A;  2AT6 X;  2JGS A;  3FA7 A;  2LBV A;  3NX1 A;  4COT A;  1R0U A;  1KT7 A;  2MHD A;  4BX5 B;  1SLF B;  2I5Z O;  1KFF A;  2C1Q A;  4I3D A;  3TF6 A;  4IAX A;  3L4R A;  4ZH6 A;  1ADL A;  4NV8 A;  1SWC A;  1KXO A;  4QGX A;  2FT9 A;  5EDB A;  2OL7 A;  3BDR A;  1EXS A;  4QYP A;  1O1U A;  2OL8 O;  1HY2 A;  2G8C O;  3BSZ E;  4CPI A;  2PI3 O;  4WHI A;  2GJ5 A;  2XKL A;  1GXA A;  4ON1 A;  5KHP A;  4IBA A;  4I3B A;  1QY1 A;  1IW2 A;  2W2B A;  5F7G A;  4Z27 A;  1MEP A;  1VWD B;  3HOE A;  4MVE A;  3S5V A;  2WEW A;  3VHH A;  3VU1 A;  3P6D A;  1VWA B;  5HCC C;  4NNT A;  4YKO A;  4JNJ A;  1A3Y A;  3GAQ A;  3ZQ3 A;  1N0S A;  1IKE A;  4DQ3 A;  3I0A A;  3JSQ A;  3FMZ A;  1G7N A;  3PH5 A;  1SLG B;  2O62 A;  4YH0 A;  4OS8 A;  4BX6 A;  4CPE A;  1Y9L A;  2A5B A;  3EBK A;  1SLE B;  4KT5 A;  4OS0 A;  1BLR A;  4U8U O;  3KFH A;  3HWF A;  4RUU A;  3V8U A;  4MIR A;  2X45 A;  1H91 A;  3MVF A;  4HPA A;  1A18 A;  1OBQ A;  2PFR A;  2IZL B;  1DZK A;  1KL5 A;  3WYP A;  3ZWE A;  4OMX A;  1BSQ A;  1ICN A;  3B2J A;  3EW2 A;  2IZC B;  2PY1 A;  1SA8 A;  1NP4 A;  3ZZV A;  2R74 A;  3WOV A;  4R0B A;  2KD2 A;  3RY2 A;  3BX8 A;  3UEU A;  5LJE A;  3U0D A;  3HOL A;  1VWH B;  2Y32 A;  3RZY A;  3VHM A;  3RDU A;  4DMO A;  4GKC A;  4TKB A;  1OPA A;  4OS3 A;  4ORX A;  2RTB B;  5B27 A;  2FRS A;  4BBO A;  1JZU A;  2YG2 A;  2MJI A;  5CSE A;  3FR2 A;  1KT5 A;  5IO7 A;  5F6B A;  2NNQ A;  4Z6J A;  1DF8 A;  2JU7 A;  2KT4 B;  2Q4N A;  3DTQ A;  4OEL A;  2OY1 O;  1ERB A;  3BRN A;  4YCH A;  2GH7 A;  3WJF A;  5IRW A;  4YCE A;  2CBS A;  3SOT A;  2A2U A;  1BM5 A;  5LKF A;  2HZQ A;  2Y3F A;  2HLV A;  5HWZ A;  4GDA A;  1RAV A;  1VYG A;  2FR3 A;  1SMP I;  4IMO A;  5F58 A;  1Y52 X;  4AZM A;  1MX8 A;  3OD9 A;  4IMN A;  1SXX A;  2G7B A;  3KFI A;  4HPB A;  4U8U M;  1YWC A;  3EYC A;  3WJB A;  2AVI A;  5DG4 A;  2IZF B;  4EFG A;  1GKA B;  4LZU A;  3SAO A;  1GT5 A;  1MUP A;  4JHQ A;  4FBR A;  5DPQ A;  1EUO A;  1KL3 A;  3N91 A;  1SWD A;  2WQA E;  4TKJ A;  5D8J A;  1EIO A;  3C78 X;  2PQT A;  1KOI A;  2ACO A;  1X8Q A;  5L8I A;  1NC9 A;  2L67 A;  1ALB A;  1A57 A;  1VYF A;  5EED A;  1LF7 A;  5H9N A;  3AKM A;  5HTE A;  3RDO A;  1LCZ A;  2CM4 A;  1SY0 A;  3K3L A;  3FDC A;  5FQ8 E;  3UEW A;  1AB0 A;  5HCD C;  4U46 A;  2YMS A;  2ZAG A;  1MDC A;  1OBP A;  1NBX A;  3ZW1 A;  3TGC A;  2QO4 A;  4BOE A;  2UZ2 A;  5KIC A;  1STS B;  1Z24 A;  4IB7 A;  1AVD A;  4O3W A;  5H9L A;  2RTQ B;  5L3Y A;  3VG6 A;  4CPH B;  1IFB A;  5LJK A;  1FE3 A;  1LID A;  1Y53 X;  1N9Y A;  1ZNK A;  1IKJ A;  2HMB A;  2X56 A;  5IRU A;  1YUP A;  4YFQ A;  5CE4 A;  4ZJ0 A;  2IZG B;  3SZH A;  1GX3 A;  4CSB A;  1YP6 A;  1HN2 A;  2DM5 A;  4Y0R A;  4EQA C;  1B4M A;  1YP7 A;  2L5P A;  4Y0P A;  4D6A A;  3BLG A;  4GRJ A;  4HPC A;  1SXY A;  4TQ2 A;  1SXW A;  3P02 A;  2RTN B;  4CDF A;  1S7D A;  1BSO A;  1YWD A;  2A3F X;  4NP1 A;  1MX7 A;  4I60 A;  1JMZ A;  2QO5 A;  2OY7 A;  4BCS A;  4GU8 A;  1EW3 A;  4LKT A;  5FQ7 E;  2AMM X;  2WWP A;  1W6F A;  3JS1 A;  2IZE B;  2IZJ A;  3ELX A;  1IIU A;  2OFR X;  5FQ6 E;  1JMX A;  4I95 A;  2RTF B;  1JV4 A;  2BT9 A;  4GGZ A;  4XMG A;  4HPD A;  1W4T A;  1Y9T A;  2IZI A;  4ORY A;  4Y5D A;  1VWI B;  2AT3 X;  1X8O A;  3T6F A;  3AEH A;  3EBW A;  3CKF A;  3PPT A;  3ZI8 A;  3U03 A;  3D95 A;  5BVS A;  1NGL A;  4AZO A;  4CDE A;  1I4U A;  3EW1 A;  2CZT A;  3LV4 A;  1IJ8 A;  2RTO B;  4XMH A;  5EDC A;  2OYB O;  5H9A A;  4Z2V A;  1SWJ A;  4ZHF A;  2IJA A;  1QWD A;  1KT6 A;  1OSP O;  4OMW A;  1G74 A;  3PDF A;  2OY5 O;  3H3I A;  3PED A;  4U3Q A;  1VWQ B;  2QO6 A;  3IFB A;  3P24 A;  1WUB A;  4YFP A;  1TVQ A;  2A8G A;  3Q6L A;  3WXQ A;  3QKG A;  3HWE A;  4KCA A;  4QAE A;  5FFH A;  1OEE A;  3FIQ A;  3APV A;  4IB8 A;  1SY1 A;  2JU3 A;  3FEN A;  3RDX A;  4ORU A;  1KT3 A;  1VWL B;  5AEO A;  1VWN B;  5LJG A;  1ML7 A;  1SWP A;  1EQD A;  3KFF A;  3PQS A;  1X71 A;  2OVD A;  4I9S A;  4ODD A;  4NW4 A;  2OFA A;  4XMC A;  4ZH9 A;  3TGB A;  2RTK A;  1EPB A;  3JQO A;  1JBH A;  1SRI A;  3FA6 A;  2AT0 X;  4TJZ A;  2WUT A;  1RXH A;  1ZNG A;  1GT1 A;  1XCA A;  2AT5 X;  2Q39 A;  3LTW A;  4AZR A;  3P6G A;  4GNW A;  3P6F A;  1SWO A;  4OEM A;  2CBR A;  4CK4 A;  4QZU A;  1SWS A;  4JO6 A;  2L9C A;  2RTJ A;  4YDB A;  4WFU A;  2KTS A;  3D96 A;  3U9P C;  2X55 A;  4FBV A;  4ZHC A;  1N43 A;  1K3B A;  4CDC A;  2OF9 A;  3NR3 A;  4L1N A;  4IAB A;  1KL4 A;  1TOU A;  3FYF A;  5HZ9 A;  3CMP A;  5HCE C;  2OVE A;  4ES7 A;  3RSW A;  4GET A;  4ID2 A;  4GK9 A;  1JYJ A;  1VPR A;  2ASN X;  2W2A A;  3WJC A;  4DQ4 A;  4KC8 A;  1MVG A;  2WPU A;  2G5L A;  4A1Y A;  2C1S A;  2G79 A;  4EXZ A;  1VWK B;  2Y3E A;  3MX7 A;  5FAZ A;  5B3M O;  5B5G A;  3S60 A;  1FEM A;  3O19 A;  1RXJ A;  3VG7 A;  1QG5 A;  4MVL A;  1GX9 A;  1D2U A;  2AL0 X;  1CBS A;  1SRF A;  2GTL O;  4CDD A;  3HTY A;  3KFG A;  1SWF A;  4BJ8 A;  2AKQ A;  2LBA A;  1VWC B;  1TW4 A;  2POA A;  4FBO A;  1VWB B;  3TZS A;  4HFO A;  5IO6 A;  3LHN A;  1BRP A;  5EPQ A;  3T2W A;  1VWR B;  4GNY A;  2Q2P A;  3SZJ A;  4YVB A;  2IZA A;  1T0V A;  2XST A;  3ZW0 A;  2FWV A;  3FID A;  4L3R A;  4MEE A;  2HKD A;  2MWH A;  3NX2 A;  4CPF A;  5IO5 A;  2VDF A;  1GKA A;  2X34 A;  4YBP A;  1MK5 A;  1L6M A;  3LNB A;  2HZR A;  2LA7 A;  1ERX A;  2RTG B;  3CQR A;  1I06 A;  3FA8 A;  4ZFX A;  4K19 A;  3ZUI A;  1LIF A;  4ALB A;  5L8N A;  4QGW A;  1NP1 A;  4C5P A;  4M6S A;  3WJD A;  4IRW A;  1B0O A;  4QNI A;  1E00 A;  3B2L A;  2FKG A;  3FR5 A;  1I78 A;  4I6S A;  4O4X A;  5HA0 A;  2ACP X;  2BSZ A;  2Q2M A;  2RCQ A;  4WBK A;  1I04 A;  1UYN X;  4ZCB A;  4AZN A;  3CBS A;  4ZGU A;  3NAD A;  1SRG A;  1PBO A;  5HZ5 A;  2X46 A;  5EZ2 A;  4ALO A;  4O3X B;  4QYN A;  3BU9 A;  5B2A O;  4EEJ A;  4Y59 A;  2UYW A;  2CAM A;  4Z28 A;  5FEN A;  1SWA A;  1LCW A;  2C4I A;  4ZHD A;  4A8Z A;  4CPH A;  2Z4H A;  4HWM A;  1LDQ A;  2QMI A;  3RWX A;  1SWB A; 
#chains in the Genus database with same CATH homology
 3P5W A;  3K8U A;  1EF7 A;  4B55 A;  2AS8 A;  3MTN A;  1KFX L;  1NLJ A;  3KKU A;  2AUZ A;  9PAP A;  4P6E A;  1JQP A;  2CB5 A;  2DC7 A;  4YVA A;  4NV7 A;  1EWM A;  2F1G A;  1AU0 A;  3P5X A;  1CS8 A;  3C9E A;  1XKG A;  1F2C A;  2VFB A;  2AYO A;  3IMA A;  3M99 A;  1E2T A;  1YVB A;  4HWY A;  4CDF B;  3CH2 X;  4P6G A;  1U5I A;  4XUI A;  5JH3 A;  4AXM A;  1GCB A;  2G8E A;  3OVX A;  1MEM A;  1YK8 A;  3QSD A;  4N8W A;  4QRV A;  1YT7 A;  1AYV A;  2F7D A;  3HWN A;  4MZS A;  3PNR A;  4GUZ A;  1F2B A;  2B1M A;  3ZUA A;  1MHW A;  2Y6E A;  4W5C A;  2VFC A;  1AYU A;  3OF8 A;  4FIP A;  1THE A;  3BCN A;  1BY8 A;  1Y08 A;  1TLO A;  2YJ2 A;  1BGO A;  1W5R A;  2NQI A;  2FTD A;  2VHF A;  1ME4 A;  4BGF A;  3S3Q A;  3KFQ A;  2AVW A;  5CHT A;  3F75 A;  2HHN A;  5PAD A;  1QOL A;  2XU1 A;  3O0U A;  5EGW A;  2OZ2 A;  2G7Y A;  2DZZ A;  2WBF X;  5FPW A;  1ME3 A;  1CTE A;  2R9F A;  1K3B B;  4CDC B;  1NPZ A;  3CBK A;  2OUL A;  2FO5 A;  3N3G A;  1ITO A;  1NQC A;  3TNX A;  4DMY A;  2ACT A;  2IBI A;  3IEJ A;  2PAD A;  4CDD B;  5EF4 A;  2HXZ A;  1S4V A;  1TL9 A;  2GFO A;  1MEG A;  1FH0 A;  2AU1 A;  4W5B A;  1U9V A;  3BC3 A;  2XU3 A;  5CHV A;  1PPD A;  3IOQ A;  4PAD A;  4YYW A;  3WXF A;  4Q8G A;  2P86 A;  3H89 A;  3K24 A;  3KWB X;  3IUT A;  2B1N A;  4QRG A;  5CVO B;  4KLB A;  2PBH A;  4YYV A;  3H8C A;  1VSN A;  1AU3 A;  1IWD A;  3KW9 A;  1U9X A;  8PCH A;  1YAL A;  2YJC A;  3D9W A;  2G8J A;  1AEC A;  1PPN A;  3AI8 A;  4I04 A;  1EWP A;  4X6I A;  1PAD A;  3LFY A;  3MOR A;  3NHE A;  7PCK A;  1PCI A;  1NL6 A;  4N79 A;  1F2A A;  1DEU A;  1MIR A;  4ZUX U;  4AXL A;  2NQA A;  4I05 A;  2FUD A;  1PXV A;  1QDQ A;  3B79 A;  4K7C A;  1GEC E;  2FRQ A;  2H7J A;  3H8B A;  2OP3 A;  5A24 A;  1KHP A;  3PBH A;  1AIM A;  4CZW A;  1M6D A;  1X9Y A;  3IHP A;  3RVW A;  2YJ8 A;  4CDE B;  2ARY A;  3H7D A;  4NV8 A;  1PPO A;  2BDZ A;  1ZCM A;  5F02 A;  4FJC A;  1NB5 A;  3USV A;  3O1G A;  4YYS A;  4PP1 A;  3WXE A;  3HD3 A;  4FK5 A;  3DF0 A;  4YV8 A;  1EWL A;  2GHU A;  1A6R A;  3KSE A;  2O6X A;  2E03 A;  4QRX A;  2DCD A;  3QJ3 A;  1CV8 A;  2P0R A;  1Y4H A;  4X6J A;  3HHA A;  2IPP B;  1CQD A;  4X6H A;  2JQG R;  2CIO A;  2ATO A;  3RVX A;  2FRA A;  2P7U A;  2XU5 A;  1U9Q X;  4MSX A;  2NQD B;  4XR7 A;  5CVN B;  1POP A;  4OEL A;  2VHS A;  2JQF R;  3D6S A;  1DF0 A;  2HD5 A;  1ZIV A;  4N4Z A;  1PE6 A;  4BQV A;  4WA6 A;  1CPJ A;  3V6C A;  4QBB A;  2DC9 A;  3LXS A;  1BP4 A;  1ATK A;  3CBJ A;  3P5U A;  1CVZ A;  5K16 A;  3IV2 A;  2C0Y A;  2R9M A;  4RY2 A;  1QXP A;  2DZY A;  5JA7 A;  2E02 A;  1AU4 A;  3I3T A;  3P5V A;  1ICF A;  1PBH A;  2HH5 A;  2R6N A;  3QT4 A;  4QH6 A;  4YYQ A;  1GX3 A;  1Q6K A;  4I07 A;  2DC8 A;  2R9N A;  1GLO A;  3H6S A;  2Y5B A;  1QMY A;  3BPM A;  2E01 A;  1TU6 A;  3PW3 A;  1W6F A;  1GMY A;  2G6D A;  3OF9 A;  3RVV A;  1YK7 A;  1W4T A;  1MS6 A;  5J94 A;  2R9C A;  2XU4 A;  1CSB B;  4BSQ A;  3PDF A;  3BWK A;  4MZO A;  1SNK A;  3KX1 A;  3MHH A;  2YJ9 A;  2DJF B;  2YJB A;  2PRE A;  4BS5 A;  2PNS A;  4YYU A;  6PAD A;  3U8E A;  1CJL A;  1KHQ A;  1U9W A;  4PI3 A;  2AUX A;  1AU2 A;  3LTW A;  2NQG A;  4OEM A;  1CB5 A;  2DCB A;  4G54 A;  5CVM A;  1PIP A;  1SP4 B;  2FYE A;  3N3K A;  1EWO A;  2DC6 A;  1MDW A;  3S3R A;  2BDL A;  3F5V A;  2AYN A;  2DJG B;  3K9M A;  3OIS A;  3V6E A;  1KXR A;  3MHS A;  1O0E A;  1PPP A;  2FQ9 A;  4PP2 E;  2DCA A;  2AIM A;  4BPV A;  2DCC A;  3OVZ A;  4YYR A;  3WXG A;  2E00 A;  4DMX A;  1VJV A;  4C5P A;  2FT2 A;  1HUC B;  3HHI A;  1NB3 A;  4W4U A;  4BS6 A;  3GCB A;  3CH3 X;  1AYW A;  2R9O A;  3I06 A;  2BSZ A;  1F29 A;  3BOW A;  3KWZ A;  4Q8H A;  3N4C A;  1STF E;  3ERV A;  1KFU L;  3E1Z B;  3BPF A;  1BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...