4NV7A

Crystal structure of mesorhizobium loti arylamine n-acetyltransferase 1 in complex with coa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
268
Chain Sequence
b'PPFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPWENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase
publication title Insight into cofactor recognition in arylamine N-acetyltransferase enzymes: structure of Mesorhizobium loti arylamine N-acetyltransferase in complex with coenzyme A.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 84
structure length 268
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4nv7A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4nv7A01
2VFCA 1GX3A 4B55A 3D9WA 4NV8A 4GUZA 4BGFA 4C5PA 1W4TA 2BSZA 1W6FA 1W5RA 4NV7A 1E2TA 3LTWA 2VFBA
chains in the Genus database with same CATH superfamily
3NQKA 2KT4B 2IZIA 1BJ7A 3WZPA 4YBPA 1SWQA 4TKBA 4C5PA 1FTPA 4TKHA 2HNXA 3AUMO 3UEUA 1SWOA 4ML7B 5HTEA 3BRNA 4GU8A 1GX3A 4HFOA 1ML7A 5LJCA 5F6BA 5FQ6E 1K3BA 2ZSCA 1BM5A 2WWPA 1G85A 2I5VO 2RTOB 2LA7A 3E3CA 3HTYA 2HZRA 3OD9A 1I05A 5D8JA 2QO5A 4DQ3A 3KFIA 4ES7A 1FE3A 1LELA 1LPJA 2YG2A 4ORWA 4LZVA 4OKAA 4AZNA 1MEPA 1SLGB 3SZHA 2PFRA 2IZJA 4TNNA 4BX5B 4KC7A 1WBIA 4XMHA 4YFPA 2P8GA 4BVMA 3UEXA 1ICMA 1Y0GA 1JYJA 1HQPA 2FT9A 1HN2A 3F9DA 3CQRA 3OBLA 4IB7A 4MVIA 2L5PA 4QQ1A 3WYQA 3P24A 1GKAA 1SRGA 1GT1A 1W4TA 1ZNEA 4YGHA 1DZPA 3WVMA 4YGZA 2OL7A 2WQ9A 3PDFA 4MVLA 4UU3A 2FHLA 1X89A 2A2UA 2DM5A 4YVBA 1LNMA 4IMOA 1SWEA 1ZNKA 3MG5A 1QY2A 3FEKA 3X00A 3RKGA 1DF3A 5BVQA 4ORUA 4M6SA 5IO6A 4BGFA 2WR6A 3O2YA 2W2AA 1OEJA 1VWHB 2AF5A 1SMPI 2GTLO 5D47A 3KFHA 3FA6A 3FIDA 2VDFA 2POAA 3WXQA 4JNJA 4LQZA 4U9CA 5HTDA 2RTCB 1DZKA 1PBYA 5EPQA 4KT5A 1HXLA 2DJFA 3FA9A 1DF8A 1E5PA 1N43A 2NNQA 2GH7A 2OZQA 1I04A 3PH6A 3FIQA 4MISA 5B27A 3T1DA 1E00A 2X34A 3RBYA 3VG5A 2UZ2A 1EPBA 2RTRB 2W2BA 3NQ9A 4INNA 4L3RA 3SLOA 4GETA 4O3ZA 5LKFA 3VHIA 5LJEA 1Y55X 3EM0A 2OFMX 1W5RA 2RTNB 4KCAA 4ZH6A 1E2TA 2AT6X 1OBQA 3C77X 4DMOA 3WBGA 2IZCB 1EIOA 3SLTA 4ZFXA 1SRIA 3DTQA 3MM0A 2G79A 4MVEA 1JIWI 3BU1A 3S26A 1T0VA 3PQUA 1SWLA 3HWFA 1VWRB 1SWJA 2X56A 4HWMA 1NDJA 4GJSA 3MBTA 4I60A 2A5CA 4Z28A 5B2AO 2E4JA 2Z4HA 3EBWA 3F8AA 3WJFA 3WJCA 5C0NA 1RXKA 2NNDA 3B2JA 1BBPA 2ZAGA 3KVNA 3VHMA 1E02A 1VWCB 4GNWA 2IZEB 4QAEA 4K19A 2CBRA 2LFOA 4NV8A 4A1HA 5F2BA 3UAQA 3MX7A 3S5VA 2GC9A 1T8VA 2IZHB 3RDUA 1XKIA 2OF8A 2X46A 4BX6A 1ERBA 4AZQA 5K68A 4ZR2A 5IRUA 1SWNA 1Y53X 2L9CA 1LDOA 3PH5A 3QQ2A 4O4OA 4QZUA 4ZH9A 2QO6A 5B5FA 3APWA 3SZJA 4GDZA 3ZW0B 4ZHDA 2MWHA 1ADLA 5LKEA 5IRWA 1VYOA 1SXYA 4WHIA 4NLJA 2IZGB 5IXGA 4YFRA 1KL4A 5D45A 3KFGA 2Q2PA 4Y0PA 2KD2A 3D95A 2DJGA 5FFHA 2Q2MA 3BX8A 2KTSA 3FW4A 3ZI8A 1G5WA 1S2PA 1I06A 1GGLA 1AQBA 2Q9SA 3SAOA 1PM1X 4BJ8A 1X8UA 5HZ9A 1PTSA 2PI3O 2RCTA 4TLJA 5LJGA 1DV9A 3TGCA 2QOMA 4CDEA 3NX1A 3ZZVA 2CAMA 2WPUA 1N4JA 1AVEA 1Y9TA 4IAWA 5DG4A 1YP7A 2Y3FA 1A2DA 3HPEA 2AT0X 3VU1A 2FHNX 1SWGA 1S44A 3B2HA 3O19A 5HCEC 1IW2A 1LUQA 4FBOA 4GDAA 4QGXA 1O1UA 1ZNDA 2AL0X 1SWSA 1B56A 4OMWA 1TW4A 4ALBA 1RAVA 1BSOA 2A13A 2CM4A 1VWIB 2FR3A 2IZKA 1HBQA 4O4XA 1LCVA 1GT4A 4EQAC 1KZWA 1STPA 1SWAA 4ORRA 3ZW1B 1VWLB 1G74A 1YUPA 1OPBA 1UZ2X 1LFOA 5H9AA 3T2WA 2LB6A 4YCEA 3BY0A 3HWEA 4QYPA 2F73A 4Z2OA 3HWDA 4IB9A 4NYQA 4N7DA 3TGAA 5B3MO 2FS6A 1GM6A 3APUA 4ZGFA 5BVTA 2Y32A 1JV4A 3U0DA 3CWKA 3P6FA 2HLVA 2M4LA 2VFCA 3IFBA 4YFQA 1NQNA 4JHQA 4BX7B 1T68X 1KFFA 4NP1A 5F1EA 4A60A 3CMPA 3STMX 4Z2PA 1KT5A 4FGIB 1N9MA 1TOUA 1U18A 2HYSA 3OJYC 1K24A 2CM9A 3S5XA 2AMMX 3VHHA 3WJEA 2NNEA 4CPFA 3T6FA 1JMXA 2XSTA 1VWFB 3CR6A 3NPOA 4PJ2A 1HMRA 2PQTA 1LIDA 5EEDA 1Y9LA 3FA7A 1QFVA 1UYOX 3P02A 2RTQB 4WFUA 4TQ2A 2BS6A 4GGRA 4UU2A 1PBOA 4BBOA 2G78A 1KT4A 5EZ2A 3TF6A 1RSUB 2OFAA 4LKTA 5H9LA 3WYPA 1IJ8A 4HPAA 4OELA 1X8PA 4GK9A 3P6EA 5B5GA 4I9RA 5LJDA 1TVQA 4O49A 1YWBA 3AEHA 1JQPA 2R56A 2X8TA 3ZW0A 3EYCA 2IZBA 2YMSA 1SRJA 1LF7A 1YWDA 2MF6A 3EC5A 3JS1A 2G5LA 1ERXA 3RE5A 4M7MA 1UREA 3WJDA 5HZ8A 3P6GA 1HXZA 3ZUIA 2OVEA 4Y0RA 3RDXA 3B2KA 1SLEB 4ORSA 1KOIA 4EFGA 1AELA 1LIBA 4WFVA 2AKQA 1LKEA 1SWDA 2BC3A 5FAZA 4HPDA 4CDDA 5EEEA 1BRQA 2OY5O 2GJ5A 1KT3A 1MDCA 2OL6O 5HCDC 5L3YA 1KT6A 1AVGI 2RA6A 2AH7X 1D2UA 2ACPX 4GZVA 1OBUA 3GAQA 4ZHHA 5CSEA 1MOYA 1KL3A 4GKCA 3T6LA 1H91A 1KL5A 4O3YA 2AT5X 5KICA 3PECA 1GT3A 1NBXA 3N91A 1VWPB 5AJBA 3PK2A 5FQ8E 3VG3A 2C4IA 4MEEA 4JO6A 2MM3A 5KIDA 2HZQA 2EU7X 3FA8A 1STSB 4Y5DA 4YKOA 1ZNHA 2K23A 2OFRX 4R0BA 4U8UM 5HZQA 1OEKA 1P6PA 4DCBA 1ALBA 3ZW1A 2X55A 3LNBA 5HCCC 3CKFA 3RDMA 4GE1A 1CJ5A 2AT8X 1FEMA 1OEEA 2G7BA 3SZIA 1CBIA 1QG5A 4I95A 4N7CA 4ORXA 1KXOA 1LIFA 2JOZA 4XMFA 4YCHA 5IO7A 2BHVA 4Y59A 3U9PC 4YGGA 2RN4A 2WEXA 4QNIA 3NADA 4NNTA 4D6AA 1CBSA 2JW1A 1BRPA 3CBSA 2BS5A 3RE6A 3EW2A 4CPHB 4BX7A 3FR4A 1CBQA 4O9SA 2JN3A 3V8UA 5HWZA 5HA0A 2RTBB 4TKJA 3D4RA 3FELA 1SWTA 1VYFA 4IB6A 3RWXA 1I9HA 1IFCA 1B4MA 4Z27A 2KW1A 3Q34A 3FDCA 2X32A 4BX5A 2IZFB 3B2IA 1X8QA 5D48A 4CSBA 1NGLA 1QY0A 2RTMA 3VE2A 2RTLA 3FW5A 1HY2A 4YDAA 3JQOA 1KT7A 1JYDA 5H8TA 3PEDA 1DC9A 4IMNA 4IRWA 5JD2A 4CDCA 3SLJA 1BSQA 3FENA 3WJBA 1CRBA 3EMMA 1QWDA 3WZOA 4OS8A 1KGLA 3VGWA 2I5ZO 2NP1A 1E06A 1U0XA 1VYGA 3D9WA 1JMZA 3O22A 4Z6JA 2FTBA 1GX8A 2FR2A 2QOSC 2K62A 1NP1A 3HK1A 1HMTA 5HA1A 3MVFA 4OMXA 3BSZE 2OVDA 4CV7A 3BX7A 5IO5A 2GTLM 2RTKA 3RSWA 2QM9A 2UYWA 4WBKA 1U17A 2JU3A 3FEPA 1HBPA 4XMEA 3ZQ3A 4MIRA 4QZTA 4BQUA 2IZLB 5HAEA 1ZRYA 3CKGA 5BYPA 2N93A 4CPEA 2RTEB 4IAXA 1QFTA 4ORYA 5F6ZA 4ARHA 3Q6LA 5H9KA 5F7GA 1B8EA 1SWUA 3ZW2A 1HQQA 5LJHA 5H9NA 1NP4A 3HOLA 4OS0A 3VG2A 1ZNLA 1MVGA 4YKMA 5D4AA 2OYBO 1SRHA 2Y3EA 1SY3A 4CK4A 4ZCBA 1I4UA 2X4MA 2A8GA 4I9SA 1A57A 1VWNB 3NP1A 1AB0A 1SXXA 1SLFB 2WUTA 1MX7A 2BLGA 3FMZA 3D97A 1WUBA 1DZMA 1MM9A 1N7YA 4LZUA 3TZSA 2OVAA 3ZWEA 1HMSA 1OSPO 2MHDA 2BSZA 5B29A 2R73A 2WSJA 3G7XA 3PQSA 4U8UO 2OL8O 2RTFB 4MVKA 5K67A 1SY0A 2FGSA 4AZMA 1OBPA 1OPAA 2Z4IA 1SRFA 2JGSA 3NQ3A 5HBSA 2PY1A 1MX8A 4IABA 3D96A 1KZXA 1SA8A 3EBKA 3CQNA 3L4RA 1EXSA 3KFFA 1YIVA 1YP6A 2FRSA 3FR2A 2O62A 1DFVA 3K3LA 1VWDB 1BWYA 4AZOA 2RQ0A 4O3WA 4ON1A 4BOEA 1AVDA 1JJUA 1EALA 3KQ0A 1FENA 2AVIA 4CPHA 1LCZA 4NW4A 2A3FX 4ODDA 4L1NA 5F58A 5KHPA 1A18A 1RSTB 2OF9A 3APXA 5AQ6A 3RDQA 4BX6B 1TOWA 2LKKA 4I3DA 5BVSA 2R74A 3VG4A 2C1QA 1EUOA 4OEMA 3FLLA 4NYRA 1N9YA 3H3IA 4AZRA 1Z24A 1SWKA 3DSZA 1JJXA 4QYNA 3ELXA 3HOEA 4QGWA 1X71A 1SY1A 1SXUA 2RTDB 1Y52X 2F09A 3NR3A 4GGZA 3AKMA 2RCQA 4ZHFA 2RD7C 3C78X 1LCWA 1BLRA 2A0AA 1R0UA 5CHKA 3OE3A 4CPIA 1RXJA 4XMDA 4EKVA 3HWGA 3VPJE 2A5BA 3NX2A 1SWPA 2ALLX 4A1YA 3WZNA 2FS7A 1N0SA 1SWBA 3AKNA 1RXHA 3VG7A 1QY1A 3UEWA 2HKDA 1VPRA 2IFBA 4I6SA 3PP6A 2ANSA 5HZ6A 2BT9A 3ELZA 1MK5A 4EDEA 4FBRA 2IZDB 1EQDA 4IB8A 2JU7A 1BSYA 3PPTA 4NLIA 3WZQA 5CYBA 3UEVA 4A8ZA 4IBAA 2F01A 4XMCA 2GTFX 2RTHB 2RTPB 4DQ4A 1S7DA 3WJGA 3JSQA 1RBPA 1SLDB 1SWRA 1D3SA 2CBSA 4TJZA 1PEEA 1GX9A 1QABE 1QQSA 4YBUA 5K06A 4GUZA 1EW3A 2A2GA 1GT5A 2IZAA 4I3CA 4Y0SA 5IRAA 2ASNX 4O3XB 2QO4A 1KQXA 2RTAA 1VWAB 1BEBA 2W2FA 3BS2A 5EDBA 1MUPA 1EPAA 2Q4NA 2RTJA 2OY7A 4ALOA 3LTWA 4QRLA 3RY2A 4ZGUA 1IKJA 5FQ7E 1SWFA 4RUUA 2AT3X 4EEJA 2ACOA 3U03A 3P6HA 1PMPA 3BU9A 1DZJA 4Y0QA 3BLGA 5CE4A 1VWEB 2CZTA 2L68A 2OFBA 3I17A 4GRJA 1GXAA 4O4SA 4U8UN 2VFBA 5L8IA 5AEOA 5LJKA 2WQAE 2WEWA 1ACDA 1NQMA 2X45A 4AYHA 5L8NA 3STNA 4ZHCA 1LDQA 1G7NA 1ICNA 1STRB 3FR5A 1SXWA 3LHNA 3LV4A 5LJBA 3RZYA 4B55A 3NBXX 1X8NA 1YWCA 4YH0A 3S60A 3SOTA 1SREA 1TXLA 1JJJA 4PSQA 3I0AA 1GKAB 2MJIA 1XCAA 4COTA 2ZAIA 4EXZA 4Z2VA 2C1SA 1O1VA 5JR8A 1FJ1E 1KQWA 4FBVA 2FKGA 1I78A 2HMBA 3FYFA 4GH7A 4GJVA 5B11O 3WOVA 2X8SA 4NV7A 4NNSA 5HZ5A 1SWCA 2CZUA 3ZUOA 1EIIA 1JZUA 4FQBB 3CBCA 4BCSA 1VWBB 1NC9A 3VG6A 2FWVA 3B2LA 2RTIB 5AJCA 4ZJ0A 2JMBA 2IJAA 1VWQB 1VWKB 4KH8A 2XKLA 2KTDA 3T2XA 1X8OA 1VWOB 3C76X 3KZAA 1JBHA 2G8CO 4KC8A 3BDRA 4GNYA 2OY8A 3QKGA 5L8OA 1YWAA 3TGBA 1IFBA 4YDBA 4RUNA 1SWHA 2OVSA 4O4UA 4AZPA 4YMYA 4D6BA 1O8VA 4LKPA 1VWJB 4HPCA 2X8FA 4XMGA 4U46A 1RLBE 4JGLA 5B10O 1SY2A 1CBRA 1VWGB 3IA8A 1UYNX 3RDOA 4QGVA 1LIEA 1VWMB 4GGTA 4HPBA 2RTGB 1B0OA 1FELA 4GD9A 4I3BA 3EW1A 4OS3A 2FKJA 5EDCA 1LICA 2JU8A 4DNEA 3APVA 1IIUA 2FLJA 2OY1O 3STKA 1EI5A 5DPQA 2LBVA 1FDQA 3RDSA 4ZHGA 3RY1A 2GTLN 1ZNGA 2Q39A 3GE2A 2MO5A 4U3QA 5FENA 3P6CA 4KIIA 3F6ZB 1L6MA 3P6DA 4AW8A 1IKEA 2LBAA 2QMIA 4ID2A 4CDFA 1W6FA 3VE1A 2QCBA 1A3YA 2L67A
chains in the Genus database with same CATH topology
4YYRA 3K8UA 4I05A 1CVZA 1AIMA 4C5PA 7PCKA 3HD3A 3F5VA 3P5WA 1BY8A 2R9CA 1GX3A 3ERVA 1CTEA 4X6HA 5CHVA 4PP2E 1F29A 3KX1A 1BGOA 3RVVA 2P7UA 5K16A 1ME4A 2C0YA 1W4TA 2DJGB 3H8CA 3IUTA 5JA7A 3PDFA 4MSXA 3LXSA 8PCHA 4CDEB 4BGFA 4BQVA 1PXVA 3OVZA 1PPPA 2F7DA 4XUIA 4X6IA 4X6JA 2BDLA 3S3RA 5FPWA 1S4VA 1IWDA 1CJLA 1KHQA 2XU5A 2E03A 3K24A 1YT7A 1Y08A 1W5RA 1E2TA 2G8EA 1NL6A 1A6RA 1POPA 1U9XA 2WBFX 2YJ8A 3N3KA 2P0RA 4NV8A 1THEA 3PW3A 3QT4A 4Q8GA 2B1NA 2DC7A 1GCBA 1AU2A 2AVWA 4I07A 3WXEA 3PNRA 4P6EA 2ATOA 2B1MA 2XU1A 3I3TA 2G6DA 1BP4A 1MHWA 3IV2A 1GECE 1YALA 3CH3X 3H8BA 1SNKA 2AYNA 2HHNA 3OF9A 1BQIA 3USVA 1MIRA 3IEJA 1FH0A 4Q8HA 2IBIA 2R9FA 2YJ2A 1DF0A 4PADA 4YYSA 3H6SA 1Y4HA 3D6SA 3LFYA 2FUDA 4CZWA 2XU4A 1M6DA 4QRGA 1X9YA 3CBJA 2DC8A 4I04A 2YJCA 3OF8A 9PAPA 2NQDB 2VFCA 2FT2A 5EGWA 2FRAA 2NQIA 1TLOA 2NQGA 1CQDA 3E1ZB 4W4UA 2BDZA 3V6EA 2O6XA 4HWYA 3KWZA 3IHPA 5CVMA 1MDWA 4CDCB 4YVAA 1F2BA 3I06A 4OELA 3MHSA 1NB3A 4KLBA 2GFOA 1JQPA 2GHUA 1AU3A 2DCDA 4AXMA 2R9MA 3BC3A 4CDFB 2PBHA 4XR7A 2R6NA 4AXLA 4P6GA 1AYVA 4FIPA 1YK8A 2PREA 1ZIVA 1PCIA 3U8EA 4QH6A 3NHEA 1CS8A 1SP4B 2AS8A 4YV8A 1ZCMA 1HUCB 2OULA 1CV8A 1GMYA 4QRXA 3B79A 1EF7A 4N4ZA 4N8WA 2FO5A 1CPJA 3IMAA 4YYUA 2CIOA 3BPMA 5CVOB 3RVXA 1EWMA 5F02A 1PIPA 2DCCA 3CBKA 2IPPB 3C9EA 1NLJA 1PBHA 1AYWA 2PADA 3P5VA 4DMXA 6PADA 2DC9A 5A24A 4MZOA 2HD5A 3BCNA 4G54A 2FTDA 3D9WA 1PPOA 1YK7A 1VSNA 2ACTA 5J94A 2H7JA 2AIMA 4K7CA 3WXGA 1STFE 5PADA 2YJBA 3QSDA 3S3QA 4W5BA 3MTNA 3BPFA 3RVWA 3BWKA 2DJFB 1U9QX 5EF4A 2E02A 1ATKA 3OVXA 5CVNB 4YYWA 1KFUL 5JH3A 1PE6A 1NPZA 2FRQA 2YJ9A 1YVBA 1AECA 1QXPA 1F2CA 4QBBA 2FYEA 1AU4A 3N3GA 3KW9A 2BSZA 1GLOA 5CHTA 1ITOA 1QOLA 2VHFA 4BSQA 2CB5A 3DF0A 3OISA 1ME3A 2DCAA 1TU6A 2AYOA 2JQGR 3K9MA 1AYUA 3M99A 3ZUAA 3KKUA 2R9NA 4OEMA 4N79A 2OZ2A 3O1GA 2NQAA 4PP1A 1CB5A 3N4CA 2Y5BA 3HWNA 2DCBA 2G7YA 3PBHA 3P5UA 2HH5A 1ICFA 3CH2X 1NB5A 3H89A 3V6CA 1PADA 1QMYA 1CSBB 3HHIA 1XKGA 1U9WA 4YYQA 2AUZA 1KHPA 4RY2A 1Q6KA 3AI8A 3KFQA 2G8JA 2P86A 4GUZA 2FQ9A 2E00A 2DZZA 2JQFR 2XU3A 2HXZA 2E01A 4W5CA 3LTWA 3QJ3A 1K3BB 1PPDA 2DZYA 4FK5A 2ARYA 1U9VA 2VFBA 1TL9A 3MORA 3KWBX 2R9OA 1U5IA 4B55A 1VJVA 2AUXA 1F2AA 3H7DA 3O0UA 2AU1A 1NQCA 1KXRA 1O0EA 4NV7A 4ZUXU 1EWPA 1MEGA 3MHHA 1AU0A 3BOWA 4YYVA 3F75A 4MZSA 4WA6A 4BS6A 1MEMA 1DEUA 1MS6A 3WXFA 1KFXL 2DC6A 4CDDB 4FJCA 1PPNA 2PNSA 1QDQA 4BS5A 4DMYA 2OP3A 4PI3A 3HHAA 3KSEA 1EWLA 4QRVA 3GCBA 3P5XA 4BPVA 1EWOA 3IOQA 2VHSA 1W6FA 2Y6EA 2F1GA 3TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFC A;  1GX3 A;  4B55 A;  3D9W A;  4NV8 A;  4GUZ A;  4BGF A;  4C5P A;  1W4T A;  2BSZ A;  1W6F A;  1W5R A;  4NV7 A;  1E2T A;  3LTW A;  2VFB A; 
#chains in the Genus database with same CATH topology
 3NQK A;  2KT4 B;  2IZI A;  1BJ7 A;  3WZP A;  4YBP A;  1SWQ A;  4TKB A;  4C5P A;  1FTP A;  4TKH A;  2HNX A;  3AUM O;  3UEU A;  1SWO A;  4ML7 B;  5HTE A;  3BRN A;  4GU8 A;  1GX3 A;  4HFO A;  1ML7 A;  5LJC A;  5F6B A;  5FQ6 E;  1K3B A;  2ZSC A;  1BM5 A;  2WWP A;  1G85 A;  2I5V O;  2RTO B;  2LA7 A;  3E3C A;  3HTY A;  2HZR A;  3OD9 A;  1I05 A;  5D8J A;  2QO5 A;  4DQ3 A;  3KFI A;  4ES7 A;  1FE3 A;  1LEL A;  1LPJ A;  2YG2 A;  4ORW A;  4LZV A;  4OKA A;  4AZN A;  1MEP A;  1SLG B;  3SZH A;  2PFR A;  2IZJ A;  4TNN A;  4BX5 B;  4KC7 A;  1WBI A;  4XMH A;  4YFP A;  2P8G A;  4BVM A;  3UEX A;  1ICM A;  1Y0G A;  1JYJ A;  1HQP A;  2FT9 A;  1HN2 A;  3F9D A;  3CQR A;  3OBL A;  4IB7 A;  4MVI A;  2L5P A;  4QQ1 A;  3WYQ A;  3P24 A;  1GKA A;  1SRG A;  1GT1 A;  1W4T A;  1ZNE A;  4YGH A;  1DZP A;  3WVM A;  4YGZ A;  2OL7 A;  2WQ9 A;  3PDF A;  4MVL A;  4UU3 A;  2FHL A;  1X89 A;  2A2U A;  2DM5 A;  4YVB A;  1LNM A;  4IMO A;  1SWE A;  1ZNK A;  3MG5 A;  1QY2 A;  3FEK A;  3X00 A;  3RKG A;  1DF3 A;  5BVQ A;  4ORU A;  4M6S A;  5IO6 A;  4BGF A;  2WR6 A;  3O2Y A;  2W2A A;  1OEJ A;  1VWH B;  2AF5 A;  1SMP I;  2GTL O;  5D47 A;  3KFH A;  3FA6 A;  3FID A;  2VDF A;  2POA A;  3WXQ A;  4JNJ A;  4LQZ A;  4U9C A;  5HTD A;  2RTC B;  1DZK A;  1PBY A;  5EPQ A;  4KT5 A;  1HXL A;  2DJF A;  3FA9 A;  1DF8 A;  1E5P A;  1N43 A;  2NNQ A;  2GH7 A;  2OZQ A;  1I04 A;  3PH6 A;  3FIQ A;  4MIS A;  5B27 A;  3T1D A;  1E00 A;  2X34 A;  3RBY A;  3VG5 A;  2UZ2 A;  1EPB A;  2RTR B;  2W2B A;  3NQ9 A;  4INN A;  4L3R A;  3SLO A;  4GET A;  4O3Z A;  5LKF A;  3VHI A;  5LJE A;  1Y55 X;  3EM0 A;  2OFM X;  1W5R A;  2RTN B;  4KCA A;  4ZH6 A;  1E2T A;  2AT6 X;  1OBQ A;  3C77 X;  4DMO A;  3WBG A;  2IZC B;  1EIO A;  3SLT A;  4ZFX A;  1SRI A;  3DTQ A;  3MM0 A;  2G79 A;  4MVE A;  1JIW I;  3BU1 A;  3S26 A;  1T0V A;  3PQU A;  1SWL A;  3HWF A;  1VWR B;  1SWJ A;  2X56 A;  4HWM A;  1NDJ A;  4GJS A;  3MBT A;  4I60 A;  2A5C A;  4Z28 A;  5B2A O;  2E4J A;  2Z4H A;  3EBW A;  3F8A A;  3WJF A;  3WJC A;  5C0N A;  1RXK A;  2NND A;  3B2J A;  1BBP A;  2ZAG A;  3KVN A;  3VHM A;  1E02 A;  1VWC B;  4GNW A;  2IZE B;  4QAE A;  4K19 A;  2CBR A;  2LFO A;  4NV8 A;  4A1H A;  5F2B A;  3UAQ A;  3MX7 A;  3S5V A;  2GC9 A;  1T8V A;  2IZH B;  3RDU A;  1XKI A;  2OF8 A;  2X46 A;  4BX6 A;  1ERB A;  4AZQ A;  5K68 A;  4ZR2 A;  5IRU A;  1SWN A;  1Y53 X;  2L9C A;  1LDO A;  3PH5 A;  3QQ2 A;  4O4O A;  4QZU A;  4ZH9 A;  2QO6 A;  5B5F A;  3APW A;  3SZJ A;  4GDZ A;  3ZW0 B;  4ZHD A;  2MWH A;  1ADL A;  5LKE A;  5IRW A;  1VYO A;  1SXY A;  4WHI A;  4NLJ A;  2IZG B;  5IXG A;  4YFR A;  1KL4 A;  5D45 A;  3KFG A;  2Q2P A;  4Y0P A;  2KD2 A;  3D95 A;  2DJG A;  5FFH A;  2Q2M A;  3BX8 A;  2KTS A;  3FW4 A;  3ZI8 A;  1G5W A;  1S2P A;  1I06 A;  1GGL A;  1AQB A;  2Q9S A;  3SAO A;  1PM1 X;  4BJ8 A;  1X8U A;  5HZ9 A;  1PTS A;  2PI3 O;  2RCT A;  4TLJ A;  5LJG A;  1DV9 A;  3TGC A;  2QOM A;  4CDE A;  3NX1 A;  3ZZV A;  2CAM A;  2WPU A;  1N4J A;  1AVE A;  1Y9T A;  4IAW A;  5DG4 A;  1YP7 A;  2Y3F A;  1A2D A;  3HPE A;  2AT0 X;  3VU1 A;  2FHN X;  1SWG A;  1S44 A;  3B2H A;  3O19 A;  5HCE C;  1IW2 A;  1LUQ A;  4FBO A;  4GDA A;  4QGX A;  1O1U A;  1ZND A;  2AL0 X;  1SWS A;  1B56 A;  4OMW A;  1TW4 A;  4ALB A;  1RAV A;  1BSO A;  2A13 A;  2CM4 A;  1VWI B;  2FR3 A;  2IZK A;  1HBQ A;  4O4X A;  1LCV A;  1GT4 A;  4EQA C;  1KZW A;  1STP A;  1SWA A;  4ORR A;  3ZW1 B;  1VWL B;  1G74 A;  1YUP A;  1OPB A;  1UZ2 X;  1LFO A;  5H9A A;  3T2W A;  2LB6 A;  4YCE A;  3BY0 A;  3HWE A;  4QYP A;  2F73 A;  4Z2O A;  3HWD A;  4IB9 A;  4NYQ A;  4N7D A;  3TGA A;  5B3M O;  2FS6 A;  1GM6 A;  3APU A;  4ZGF A;  5BVT A;  2Y32 A;  1JV4 A;  3U0D A;  3CWK A;  3P6F A;  2HLV A;  2M4L A;  2VFC A;  3IFB A;  4YFQ A;  1NQN A;  4JHQ A;  4BX7 B;  1T68 X;  1KFF A;  4NP1 A;  5F1E A;  4A60 A;  3CMP A;  3STM X;  4Z2P A;  1KT5 A;  4FGI B;  1N9M A;  1TOU A;  1U18 A;  2HYS A;  3OJY C;  1K24 A;  2CM9 A;  3S5X A;  2AMM X;  3VHH A;  3WJE A;  2NNE A;  4CPF A;  3T6F A;  1JMX A;  2XST A;  1VWF B;  3CR6 A;  3NPO A;  4PJ2 A;  1HMR A;  2PQT A;  1LID A;  5EED A;  1Y9L A;  3FA7 A;  1QFV A;  1UYO X;  3P02 A;  2RTQ B;  4WFU A;  4TQ2 A;  2BS6 A;  4GGR A;  4UU2 A;  1PBO A;  4BBO A;  2G78 A;  1KT4 A;  5EZ2 A;  3TF6 A;  1RSU B;  2OFA A;  4LKT A;  5H9L A;  3WYP A;  1IJ8 A;  4HPA A;  4OEL A;  1X8P A;  4GK9 A;  3P6E A;  5B5G A;  4I9R A;  5LJD A;  1TVQ A;  4O49 A;  1YWB A;  3AEH A;  1JQP A;  2R56 A;  2X8T A;  3ZW0 A;  3EYC A;  2IZB A;  2YMS A;  1SRJ A;  1LF7 A;  1YWD A;  2MF6 A;  3EC5 A;  3JS1 A;  2G5L A;  1ERX A;  3RE5 A;  4M7M A;  1URE A;  3WJD A;  5HZ8 A;  3P6G A;  1HXZ A;  3ZUI A;  2OVE A;  4Y0R A;  3RDX A;  3B2K A;  1SLE B;  4ORS A;  1KOI A;  4EFG A;  1AEL A;  1LIB A;  4WFV A;  2AKQ A;  1LKE A;  1SWD A;  2BC3 A;  5FAZ A;  4HPD A;  4CDD A;  5EEE A;  1BRQ A;  2OY5 O;  2GJ5 A;  1KT3 A;  1MDC A;  2OL6 O;  5HCD C;  5L3Y A;  1KT6 A;  1AVG I;  2RA6 A;  2AH7 X;  1D2U A;  2ACP X;  4GZV A;  1OBU A;  3GAQ A;  4ZHH A;  5CSE A;  1MOY A;  1KL3 A;  4GKC A;  3T6L A;  1H91 A;  1KL5 A;  4O3Y A;  2AT5 X;  5KIC A;  3PEC A;  1GT3 A;  1NBX A;  3N91 A;  1VWP B;  5AJB A;  3PK2 A;  5FQ8 E;  3VG3 A;  2C4I A;  4MEE A;  4JO6 A;  2MM3 A;  5KID A;  2HZQ A;  2EU7 X;  3FA8 A;  1STS B;  4Y5D A;  4YKO A;  1ZNH A;  2K23 A;  2OFR X;  4R0B A;  4U8U M;  5HZQ A;  1OEK A;  1P6P A;  4DCB A;  1ALB A;  3ZW1 A;  2X55 A;  3LNB A;  5HCC C;  3CKF A;  3RDM A;  4GE1 A;  1CJ5 A;  2AT8 X;  1FEM A;  1OEE A;  2G7B A;  3SZI A;  1CBI A;  1QG5 A;  4I95 A;  4N7C A;  4ORX A;  1KXO A;  1LIF A;  2JOZ A;  4XMF A;  4YCH A;  5IO7 A;  2BHV A;  4Y59 A;  3U9P C;  4YGG A;  2RN4 A;  2WEX A;  4QNI A;  3NAD A;  4NNT A;  4D6A A;  1CBS A;  2JW1 A;  1BRP A;  3CBS A;  2BS5 A;  3RE6 A;  3EW2 A;  4CPH B;  4BX7 A;  3FR4 A;  1CBQ A;  4O9S A;  2JN3 A;  3V8U A;  5HWZ A;  5HA0 A;  2RTB B;  4TKJ A;  3D4R A;  3FEL A;  1SWT A;  1VYF A;  4IB6 A;  3RWX A;  1I9H A;  1IFC A;  1B4M A;  4Z27 A;  2KW1 A;  3Q34 A;  3FDC A;  2X32 A;  4BX5 A;  2IZF B;  3B2I A;  1X8Q A;  5D48 A;  4CSB A;  1NGL A;  1QY0 A;  2RTM A;  3VE2 A;  2RTL A;  3FW5 A;  1HY2 A;  4YDA A;  3JQO A;  1KT7 A;  1JYD A;  5H8T A;  3PED A;  1DC9 A;  4IMN A;  4IRW A;  5JD2 A;  4CDC A;  3SLJ A;  1BSQ A;  3FEN A;  3WJB A;  1CRB A;  3EMM A;  1QWD A;  3WZO A;  4OS8 A;  1KGL A;  3VGW A;  2I5Z O;  2NP1 A;  1E06 A;  1U0X A;  1VYG A;  3D9W A;  1JMZ A;  3O22 A;  4Z6J A;  2FTB A;  1GX8 A;  2FR2 A;  2QOS C;  2K62 A;  1NP1 A;  3HK1 A;  1HMT A;  5HA1 A;  3MVF A;  4OMX A;  3BSZ E;  2OVD A;  4CV7 A;  3BX7 A;  5IO5 A;  2GTL M;  2RTK A;  3RSW A;  2QM9 A;  2UYW A;  4WBK A;  1U17 A;  2JU3 A;  3FEP A;  1HBP A;  4XME A;  3ZQ3 A;  4MIR A;  4QZT A;  4BQU A;  2IZL B;  5HAE A;  1ZRY A;  3CKG A;  5BYP A;  2N93 A;  4CPE A;  2RTE B;  4IAX A;  1QFT A;  4ORY A;  5F6Z A;  4ARH A;  3Q6L A;  5H9K A;  5F7G A;  1B8E A;  1SWU A;  3ZW2 A;  1HQQ A;  5LJH A;  5H9N A;  1NP4 A;  3HOL A;  4OS0 A;  3VG2 A;  1ZNL A;  1MVG A;  4YKM A;  5D4A A;  2OYB O;  1SRH A;  2Y3E A;  1SY3 A;  4CK4 A;  4ZCB A;  1I4U A;  2X4M A;  2A8G A;  4I9S A;  1A57 A;  1VWN B;  3NP1 A;  1AB0 A;  1SXX A;  1SLF B;  2WUT A;  1MX7 A;  2BLG A;  3FMZ A;  3D97 A;  1WUB A;  1DZM A;  1MM9 A;  1N7Y A;  4LZU A;  3TZS A;  2OVA A;  3ZWE A;  1HMS A;  1OSP O;  2MHD A;  2BSZ A;  5B29 A;  2R73 A;  2WSJ A;  3G7X A;  3PQS A;  4U8U O;  2OL8 O;  2RTF B;  4MVK A;  5K67 A;  1SY0 A;  2FGS A;  4AZM A;  1OBP A;  1OPA A;  2Z4I A;  1SRF A;  2JGS A;  3NQ3 A;  5HBS A;  2PY1 A;  1MX8 A;  4IAB A;  3D96 A;  1KZX A;  1SA8 A;  3EBK A;  3CQN A;  3L4R A;  1EXS A;  3KFF A;  1YIV A;  1YP6 A;  2FRS A;  3FR2 A;  2O62 A;  1DFV A;  3K3L A;  1VWD B;  1BWY A;  4AZO A;  2RQ0 A;  4O3W A;  4ON1 A;  4BOE A;  1AVD A;  1JJU A;  1EAL A;  3KQ0 A;  1FEN A;  2AVI A;  4CPH A;  1LCZ A;  4NW4 A;  2A3F X;  4ODD A;  4L1N A;  5F58 A;  5KHP A;  1A18 A;  1RST B;  2OF9 A;  3APX A;  5AQ6 A;  3RDQ A;  4BX6 B;  1TOW A;  2LKK A;  4I3D A;  5BVS A;  2R74 A;  3VG4 A;  2C1Q A;  1EUO A;  4OEM A;  3FLL A;  4NYR A;  1N9Y A;  3H3I A;  4AZR A;  1Z24 A;  1SWK A;  3DSZ A;  1JJX A;  4QYN A;  3ELX A;  3HOE A;  4QGW A;  1X71 A;  1SY1 A;  1SXU A;  2RTD B;  1Y52 X;  2F09 A;  3NR3 A;  4GGZ A;  3AKM A;  2RCQ A;  4ZHF A;  2RD7 C;  3C78 X;  1LCW A;  1BLR A;  2A0A A;  1R0U A;  5CHK A;  3OE3 A;  4CPI A;  1RXJ A;  4XMD A;  4EKV A;  3HWG A;  3VPJ E;  2A5B A;  3NX2 A;  1SWP A;  2ALL X;  4A1Y A;  3WZN A;  2FS7 A;  1N0S A;  1SWB A;  3AKN A;  1RXH A;  3VG7 A;  1QY1 A;  3UEW A;  2HKD A;  1VPR A;  2IFB A;  4I6S A;  3PP6 A;  2ANS A;  5HZ6 A;  2BT9 A;  3ELZ A;  1MK5 A;  4EDE A;  4FBR A;  2IZD B;  1EQD A;  4IB8 A;  2JU7 A;  1BSY A;  3PPT A;  4NLI A;  3WZQ A;  5CYB A;  3UEV A;  4A8Z A;  4IBA A;  2F01 A;  4XMC A;  2GTF X;  2RTH B;  2RTP B;  4DQ4 A;  1S7D A;  3WJG A;  3JSQ A;  1RBP A;  1SLD B;  1SWR A;  1D3S A;  2CBS A;  4TJZ A;  1PEE A;  1GX9 A;  1QAB E;  1QQS A;  4YBU A;  5K06 A;  4GUZ A;  1EW3 A;  2A2G A;  1GT5 A;  2IZA A;  4I3C A;  4Y0S A;  5IRA A;  2ASN X;  4O3X B;  2QO4 A;  1KQX A;  2RTA A;  1VWA B;  1BEB A;  2W2F A;  3BS2 A;  5EDB A;  1MUP A;  1EPA A;  2Q4N A;  2RTJ A;  2OY7 A;  4ALO A;  3LTW A;  4QRL A;  3RY2 A;  4ZGU A;  1IKJ A;  5FQ7 E;  1SWF A;  4RUU A;  2AT3 X;  4EEJ A;  2ACO A;  3U03 A;  3P6H A;  1PMP A;  3BU9 A;  1DZJ A;  4Y0Q A;  3BLG A;  5CE4 A;  1VWE B;  2CZT A;  2L68 A;  2OFB A;  3I17 A;  4GRJ A;  1GXA A;  4O4S A;  4U8U N;  2VFB A;  5L8I A;  5AEO A;  5LJK A;  2WQA E;  2WEW A;  1ACD A;  1NQM A;  2X45 A;  4AYH A;  5L8N A;  3STN A;  4ZHC A;  1LDQ A;  1G7N A;  1ICN A;  1STR B;  3FR5 A;  1SXW A;  3LHN A;  3LV4 A;  5LJB A;  3RZY A;  4B55 A;  3NBX X;  1X8N A;  1YWC A;  4YH0 A;  3S60 A;  3SOT A;  1SRE A;  1TXL A;  1JJJ A;  4PSQ A;  3I0A A;  1GKA B;  2MJI A;  1XCA A;  4COT A;  2ZAI A;  4EXZ A;  4Z2V A;  2C1S A;  1O1V A;  5JR8 A;  1FJ1 E;  1KQW A;  4FBV A;  2FKG A;  1I78 A;  2HMB A;  3FYF A;  4GH7 A;  4GJV A;  5B11 O;  3WOV A;  2X8S A;  4NV7 A;  4NNS A;  5HZ5 A;  1SWC A;  2CZU A;  3ZUO A;  1EII A;  1JZU A;  4FQB B;  3CBC A;  4BCS A;  1VWB B;  1NC9 A;  3VG6 A;  2FWV A;  3B2L A;  2RTI B;  5AJC A;  4ZJ0 A;  2JMB A;  2IJA A;  1VWQ B;  1VWK B;  4KH8 A;  2XKL A;  2KTD A;  3T2X A;  1X8O A;  1VWO B;  3C76 X;  3KZA A;  1JBH A;  2G8C O;  4KC8 A;  3BDR A;  4GNY A;  2OY8 A;  3QKG A;  5L8O A;  1YWA A;  3TGB A;  1IFB A;  4YDB A;  4RUN A;  1SWH A;  2OVS A;  4O4U A;  4AZP A;  4YMY A;  4D6B A;  1O8V A;  4LKP A;  1VWJ B;  4HPC A;  2X8F A;  4XMG A;  4U46 A;  1RLB E;  4JGL A;  5B10 O;  1SY2 A;  1CBR A;  1VWG B;  3IA8 A;  1UYN X;  3RDO A;  4QGV A;  1LIE A;  1VWM B;  4GGT A;  4HPB A;  2RTG B;  1B0O A;  1FEL A;  4GD9 A;  4I3B A;  3EW1 A;  4OS3 A;  2FKJ A;  5EDC A;  1LIC A;  2JU8 A;  4DNE A;  3APV A;  1IIU A;  2FLJ A;  2OY1 O;  3STK A;  1EI5 A;  5DPQ A;  2LBV A;  1FDQ A;  3RDS A;  4ZHG A;  3RY1 A;  2GTL N;  1ZNG A;  2Q39 A;  3GE2 A;  2MO5 A;  4U3Q A;  5FEN A;  3P6C A;  4KII A;  3F6Z B;  1L6M A;  3P6D A;  4AW8 A;  1IKE A;  2LBA A;  2QMI A;  4ID2 A;  4CDF A;  1W6F A;  3VE1 A;  2QCB A;  1A3Y A;  2L67 A; 
#chains in the Genus database with same CATH homology
 4YYR A;  3K8U A;  4I05 A;  1CVZ A;  1AIM A;  4C5P A;  7PCK A;  3HD3 A;  3F5V A;  3P5W A;  1BY8 A;  2R9C A;  1GX3 A;  3ERV A;  1CTE A;  4X6H A;  5CHV A;  4PP2 E;  1F29 A;  3KX1 A;  1BGO A;  3RVV A;  2P7U A;  5K16 A;  1ME4 A;  2C0Y A;  1W4T A;  2DJG B;  3H8C A;  3IUT A;  5JA7 A;  3PDF A;  4MSX A;  3LXS A;  8PCH A;  4CDE B;  4BGF A;  4BQV A;  1PXV A;  3OVZ A;  1PPP A;  2F7D A;  4XUI A;  4X6I A;  4X6J A;  2BDL A;  3S3R A;  5FPW A;  1S4V A;  1IWD A;  1CJL A;  1KHQ A;  2XU5 A;  2E03 A;  3K24 A;  1YT7 A;  1Y08 A;  1W5R A;  1E2T A;  2G8E A;  1NL6 A;  1A6R A;  1POP A;  1U9X A;  2WBF X;  2YJ8 A;  3N3K A;  2P0R A;  4NV8 A;  1THE A;  3PW3 A;  3QT4 A;  4Q8G A;  2B1N A;  2DC7 A;  1GCB A;  1AU2 A;  2AVW A;  4I07 A;  3WXE A;  3PNR A;  4P6E A;  2ATO A;  2B1M A;  2XU1 A;  3I3T A;  2G6D A;  1BP4 A;  1MHW A;  3IV2 A;  1GEC E;  1YAL A;  3CH3 X;  3H8B A;  1SNK A;  2AYN A;  2HHN A;  3OF9 A;  1BQI A;  3USV A;  1MIR A;  3IEJ A;  1FH0 A;  4Q8H A;  2IBI A;  2R9F A;  2YJ2 A;  1DF0 A;  4PAD A;  4YYS A;  3H6S A;  1Y4H A;  3D6S A;  3LFY A;  2FUD A;  4CZW A;  2XU4 A;  1M6D A;  4QRG A;  1X9Y A;  3CBJ A;  2DC8 A;  4I04 A;  2YJC A;  3OF8 A;  9PAP A;  2NQD B;  2VFC A;  2FT2 A;  5EGW A;  2FRA A;  2NQI A;  1TLO A;  2NQG A;  1CQD A;  3E1Z B;  4W4U A;  2BDZ A;  3V6E A;  2O6X A;  4HWY A;  3KWZ A;  3IHP A;  5CVM A;  1MDW A;  4CDC B;  4YVA A;  1F2B A;  3I06 A;  4OEL A;  3MHS A;  1NB3 A;  4KLB A;  2GFO A;  1JQP A;  2GHU A;  1AU3 A;  2DCD A;  4AXM A;  2R9M A;  3BC3 A;  4CDF B;  2PBH A;  4XR7 A;  2R6N A;  4AXL A;  4P6G A;  1AYV A;  4FIP A;  1YK8 A;  2PRE A;  1ZIV A;  1PCI A;  3U8E A;  4QH6 A;  3NHE A;  1CS8 A;  1SP4 B;  2AS8 A;  4YV8 A;  1ZCM A;  1HUC B;  2OUL A;  1CV8 A;  1GMY A;  4QRX A;  3B79 A;  1EF7 A;  4N4Z A;  4N8W A;  2FO5 A;  1CPJ A;  3IMA A;  4YYU A;  2CIO A;  3BPM A;  5CVO B;  3RVX A;  1EWM A;  5F02 A;  1PIP A;  2DCC A;  3CBK A;  2IPP B;  3C9E A;  1NLJ A;  1PBH A;  1AYW A;  2PAD A;  3P5V A;  4DMX A;  6PAD A;  2DC9 A;  5A24 A;  4MZO A;  2HD5 A;  3BCN A;  4G54 A;  2FTD A;  3D9W A;  1PPO A;  1YK7 A;  1VSN A;  2ACT A;  5J94 A;  2H7J A;  2AIM A;  4K7C A;  3WXG A;  1STF E;  5PAD A;  2YJB A;  3QSD A;  3S3Q A;  4W5B A;  3MTN A;  3BPF A;  3RVW A;  3BWK A;  2DJF B;  1U9Q X;  5EF4 A;  2E02 A;  1ATK A;  3OVX A;  5CVN B;  4YYW A;  1KFU L;  5JH3 A;  1PE6 A;  1NPZ A;  2FRQ A;  2YJ9 A;  1YVB A;  1AEC A;  1QXP A;  1F2C A;  4QBB A;  2FYE A;  1AU4 A;  3N3G A;  3KW9 A;  2BSZ A;  1GLO A;  5CHT A;  1ITO A;  1QOL A;  2VHF A;  4BSQ A;  2CB5 A;  3DF0 A;  3OIS A;  1ME3 A;  2DCA A;  1TU6 A;  2AYO A;  2JQG R;  3K9M A;  1AYU A;  3M99 A;  3ZUA A;  3KKU A;  2R9N A;  4OEM A;  4N79 A;  2OZ2 A;  3O1G A;  2NQA A;  4PP1 A;  1CB5 A;  3N4C A;  2Y5B A;  3HWN A;  2DCB A;  2G7Y A;  3PBH A;  3P5U A;  2HH5 A;  1ICF A;  3CH2 X;  1NB5 A;  3H89 A;  3V6C A;  1PAD A;  1QMY A;  1CSB B;  3HHI A;  1XKG A;  1U9W A;  4YYQ A;  2AUZ A;  1KHP A;  4RY2 A;  1Q6K A;  3AI8 A;  3KFQ A;  2G8J A;  2P86 A;  4GUZ A;  2FQ9 A;  2E00 A;  2DZZ A;  2JQF R;  2XU3 A;  2HXZ A;  2E01 A;  4W5C A;  3LTW A;  3QJ3 A;  1K3B B;  1PPD A;  2DZY A;  4FK5 A;  2ARY A;  1U9V A;  2VFB A;  1TL9 A;  3MOR A;  3KWB X;  2R9O A;  1U5I A;  4B55 A;  1VJV A;  2AUX A;  1F2A A;  3H7D A;  3O0U A;  2AU1 A;  1NQC A;  1KXR A;  1O0E A;  4NV7 A;  4ZUX U;  1EWP A;  1MEG A;  3MHH A;  1AU0 A;  3BOW A;  4YYV A;  3F75 A;  4MZS A;  4WA6 A;  4BS6 A;  1MEM A;  1DEU A;  1MS6 A;  3WXF A;  1KFX L;  2DC6 A;  4CDD B;  4FJC A;  1PPN A;  2PNS A;  1QDQ A;  4BS5 A;  4DMY A;  2OP3 A;  4PI3 A;  3HHA A;  3KSE A;  1EWL A;  4QRV A;  3GCB A;  3P5X A;  4BPV A;  1EWO A;  3IOQ A;  2VHS A;  1W6F A;  2Y6E A;  2F1G A;  3TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...