4NV8A

Crystal structure of mesorhizobium loti arylamine n-acetyltransferase f42w mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
271
structure length
270
Chain Sequence
b'PPFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPWENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase
molecule tags Transferase
source organism Mesorhizobium loti
publication title Insight into cofactor recognition in arylamine N-acetyltransferase enzymes: structure of Mesorhizobium loti arylamine N-acetyltransferase in complex with coenzyme A.
pubmed doi rcsb
total genus 82
structure length 270
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4nv8A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4nv8A01
2VFBA 3D9WA 4GUZA 3LTWA 1W4TA 1E2TA 1GX3A 4NV8A 1W6FA 2BSZA 1W5RA 4NV7A 4BGFA 4B55A 4C5PA 2VFCA
chains in the Genus database with same CATH superfamily
1PM1X 2OY5O 3TGAA 4U8UO 4KIIA 3WXQA 3FR2A 1B56A 3CQRA 3WJEA 1VWAB 2JW1A 1OPAA 4COTA 2BC3A 4ON1A 2XSTA 3C78X 3ZZVA 4INNA 2LBAA 5EEEA 3C77X 3U0DA 4ZHFA 3FEPA 4EQAC 5LKEA 3S26A 2F01A 3BSZE 3RY1A 3T2XA 3WJGA 5BVTA 4GRJA 2F73A 4YKOA 1SWFA 4GK9A 4U3QA 1I9HA 1KXOA 2FKJA 1X71A 2GTLM 4MVIA 5HCCC 3NPOA 5LJEA 1NBXA 3VHIA 1ICMA 1SWLA 2X55A 3BU9A 3O2YA 4U8UN 1BEBA 1SLGB 4GU8A 4NYQA 2HZRA 1EALA 1GKAB 2RTFB 1YWCA 5FAZA 4GJSA 4WBKA 3WJDA 4DMOA 2YG2A 5F58A 3P02A 4GUZA 3CQNA 2JU8A 1GT3A 2I5ZO 3APXA 4ODDA 4ML7B 4BX7B 1SWHA 3B2IA 3BY0A 4NLJA 2Y3EA 4BGFA 4EXZA 2RTIB 4ORRA 2QMIA 4XMFA 1N9YA 1YP7A 2GH7A 3B2KA 4KC7A 3UEXA 3LNBA 1ZNGA 5EPQA 4FBRA 3RDSA 1LIFA 1STSB 3WVMA 4Y59A 1SXUA 1VWEB 1KZWA 1JIWI 4FBVA 2G7BA 4HWMA 1QQSA 1CBRA 1I78A 3VG7A 4O3YA 1SRJA 3AKMA 1LKEA 4GJVA 3TF6A 1DFVA 2OFRX 3MM0A 4U8UM 5KHPA 2AVIA 4XMHA 4ARHA 4NNSA 1LNMA 3MG5A 2RCTA 4YCHA 5K68A 2Q9SA 2A5CA 3FW5A 2RTGB 3RBYA 1JQPA 4Z27A 1SY3A 4GETA 1SA8A 2KTSA 2IZFB 4N7CA 4QGWA 1ADLA 5EZ2A 1P6PA 2A2UA 4GNWA 3ZW0B 4QGXA 3EBKA 2AF5A 1DZPA 4A1HA 2FGSA 4GNYA 1AQBA 4FQBB 5DPQA 5FQ8E 1RXHA 1Z24A 4YGHA 1NC9A 5HA1A 1B0OA 4ALBA 1DF3A 3OD9A 4YDAA 1SRHA 1PMPA 3F8AA 3L4RA 1KT6A 1X8NA 4OS0A 5D45A 2OL7A 4GGZA 5FQ6E 3CKGA 5L8NA 3TGBA 4Y0PA 4R0BA 1SRFA 3BS2A 4ZFXA 1EXSA 3Q6LA 1IW2A 2K23A 2RA6A 4A1YA 4D6BA 1QWDA 3FIDA 1NP4A 1VWKB 5F2BA 1JJJA 4DQ3A 2QCBA 1O1UA 2ANSA 4Y0SA 5H9AA 4ALOA 2GTLN 2IZGB 1IKEA 3NQ3A 4QNIA 1PTSA 3HWGA 3RDXA 5HZ5A 1A18A 4CV7A 4OELA 1EUOA 3LHNA 2FHLA 1KZXA 1X8QA 1I05A 1E5PA 1OBQA 1VWBB 2CBSA 4I3DA 5B5GA 1DF8A 2VDFA 4CPEA 4GZVA 1XCAA 2VFBA 1K24A 2FR3A 1JJUA 5D4AA 1LICA 1QG5A 5FQ7E 4CPHB 1ERXA 1JMXA 1PBYA 3RDOA 1OBUA 1SRGA 4FGIB 1Y9TA 2K62A 3QKGA 3VG6A 4BVMA 3APWA 1SWAA 2JU7A 1GX9A 5JD2A 5EDBA 2AT5X 4LKPA 1BSYA 2G5LA 1W5RA 3OBLA 5D47A 2Y32A 1LCZA 5H8TA 3F9DA 4BX5A 2RTPB 3BDRA 4WFVA 2R73A 4EKVA 3NX1A 3VHMA 1EW3A 1H91A 3HWEA 4OMXA 2QOMA 2Z4HA 3G7XA 4NP1A 4Z2VA 1ACDA 1RXJA 1FENA 1U18A 2BLGA 2RTJA 1CBQA 3ZW1B 5HWZA 2OL8O 1ICNA 4TJZA 1X8OA 1UYOX 4NW4A 5BYPA 1RSUB 1DZMA 1VWGB 2CBRA 3MVFA 1OSPO 1E02A 2L68A 2IZHB 3BX7A 2IZCB 1I04A 1MVGA 2FS7A 2OVSA 1BSQA 4Z28A 4DQ4A 3S5XA 4BX6A 3RY2A 5AQ6A 5H9KA 3OE3A 4BJ8A 5IXGA 2X34A 5HTDA 1JYDA 2AH7X 4YGGA 2Z4IA 4GGTA 3WZOA 3P6HA 1SWTA 1B4MA 1KT4A 2JGSA 3IFBA 4JHQA 2POAA 3FA7A 1QFVA 1T0VA 3JQOA 3NX2A 1NDJA 2RTQB 3PQSA 1BRPA 1DZJA 1SWBA 2R56A 3UEUA 1LELA 1MX8A 4AZQA 4EFGA 1QY2A 1SRIA 1BWYA 1RBPA 2GC9A 2X8TA 2ACOA 1VWFB 2W2AA 2X8FA 3CWKA 2RTOB 2KTDA 2QO6A 1G7NA 1KT7A 1OPBA 2QO4A 5EEDA 5HCEC 2RTDB 1HXZA 4UU3A 4AYHA 4KH8A 5H9NA 2YMSA 1ZNKA 4AW8A 3WOVA 1UREA 3GE2A 4TKJA 1MK5A 1KT3A 5HBSA 4ZHCA 1SXXA 2RTBB 1STRB 3CKFA 2HYSA 1LDOA 1ZRYA 2AL0X 5FENA 3LV4A 2RCQA 4A60A 3WJFA 3B2HA 5IRWA 4GDAA 1W4TA 2A13A 4TKBA 1AELA 4YVBA 5K06A 1EIIA 3RE5A 1MX7A 1IKJA 4ZHDA 3ZUOA 2OY1O 4DCBA 3FR5A 1LPJA 1N9MA 4QGVA 2X32A 4Z2OA 3FIQA 4TNNA 1HQPA 4AZPA 4BX7A 3RWXA 3WYQA 4Z6JA 4M6SA 5HAEA 5LJBA 2OVDA 3UEWA 1Y0GA 5CSEA 1UYNX 1MOYA 1VWIB 1VWHB 3EM0A 4D6AA 1HN2A 1JV4A 5LJHA 4O4OA 1VWDB 1SWQA 1TVQA 3APVA 2IZJA 4GGRA 1SY1A 2BS5A 3STKA 2KD2A 3WZNA 1VYFA 2ZAIA 1FJ1E 1KT5A 1SMPI 3FYFA 3PQUA 4KC8A 4NYRA 4ZHGA 2OL6O 2FT9A 4I6SA 2ZAGA 2G8CO 3P6CA 1O1VA 3FLLA 2RTHB 3T2WA 5HZ6A 5BVSA 1E2TA 1GX8A 3KFFA 3DSZA 3MX7A 2L9CA 4ZH6A 3PPTA 5F1EA 2Q4NA 4BQUA 1GT1A 2NP1A 3D9WA 1YWAA 5KIDA 1YIVA 1T8VA 4OKAA 3MBTA 2MWHA 4XMEA 1X8UA 2O62A 3EYCA 4AZRA 4PJ2A 1EPAA 1S7DA 3FENA 2A3FX 2Q39A 2QM9A 3BU1A 4YFPA 2BHVA 5KICA 2IZDB 4HPBA 3SLOA 3ZW0A 1SWOA 3VGWA 1G5WA 5K67A 1VYOA 1L6MA 2WR6A 3CBCA 1JMZA 1X89A 4O9SA 2CM4A 5HA0A 3VG3A 3TGCA 3EC5A 4Y0RA 3VU1A 5IRUA 4ZCBA 3SZIA 3SOTA 2PQTA 3WZPA 4AZNA 4MEEA 3T6FA 2HZQA 1LCVA 2NNEA 1QY1A 4ZH9A 1CJ5A 3VG5A 2RTEB 1ZNEA 1BBPA 4GD9A 3PDFA 2P8GA 1AB0A 4EDEA 3O19A 2F09A 3RE6A 3IA8A 2BS6A 1SXYA 1SWGA 4QAEA 5LJCA 1SY2A 2FTBA 3JSQA 4EEJA 2L5PA 1DZKA 1XKIA 3P6FA 2BSZA 3PECA 4FBOA 2A0AA 4MVLA 4O3XB 2GJ5A 1VWQB 3FW4A 2GTFX 1WBIA 3P6EA 2CM9A 2PY1A 2FHNX 2IZIA 3SLJA 4LKTA 5HZ8A 3GAQA 5HTEA 4ES7A 2C4IA 4BCSA 4MISA 5B2AO 3SZJA 1RAVA 1SLFB 1E00A 2JN3A 4YMYA 2FRSA 5IO5A 1SXWA 1LUQA 1JBHA 4YH0A 4Y5DA 1JJXA 2OFAA 1FELA 1VWCB 2ZSCA 1LDQA 4LQZA 5AJBA 1I06A 1EI5A 2A2GA 3FA8A 4LZVA 2PFRA 2W2FA 5HZ9A 5BVQA 1SWDA 3CBSA 4OS3A 2DM5A 3JS1A 2JU3A 3RDQA 1N4JA 3SLTA 3STNA 1WUBA 3ZQ3A 1KGLA 1SWEA 4IAWA 1MUPA 1UZ2X 1JYJA 2AMMX 2MF6A 2RTCB 3C76X 4TQ2A 2AKQA 3I0AA 1N7YA 4IBAA 4YKMA 4O4SA 4IABA 3HWDA 3HPEA 5HZQA 3I17A 5LJDA 4JNJA 3NADA 2OYBO 4ZJ0A 5CE4A 4YBUA 1TOWA 2RD7C 4QZTA 2AT8X 2IFBA 1YUPA 2A8GA 2LB6A 3VG4A 1SWCA 4GE1A 1VYGA 3WYPA 3ZWEA 4CK4A 1A57A 1BLRA 4BOEA 4XMGA 3FEKA 1G85A 2WQ9A 4IMNA 3NQKA 1TOUA 1GT4A 2HLVA 3DTQA 4IMOA 2OVAA 4K19A 2FKGA 2QO5A 4U46A 1EPBA 3BLGA 1YWBA 3B2LA 3D96A 2MM3A 2HKDA 2RTLA 4YGZA 1RSTB 1U17A 1LIDA 3NQ9A 4MVKA 4NLIA 3KFGA 4OEMA 2RTMA 3ZUIA 4ZGFA 3VE2A 3KVNA 1E06A 1HMSA 4CDEA 3T6LA 3X00A 1SLDB 3F6ZB 4DNEA 2A5BA 1PBOA 4WHIA 1KFFA 4Y0QA 1HQQA 4WFUA 5LJKA 2VFCA 3VE1A 1GXAA 3K3LA 3RKGA 1K3BA 1YP6A 4BBOA 1AVDA 1G74A 1SWJA 3TZSA 2IZBA 5B10O 1B8EA 1D3SA 2CAMA 2X56A 4IB6A 2RQ0A 4O49A 1HXLA 4HFOA 4YFRA 3HK1A 1VWOB 4IB7A 2X4MA 4XMDA 1SWRA 1FTPA 4I60A 1T68X 4GKCA 2FS6A 3P6DA 4ORSA 1BSOA 1OBPA 5IRAA 5LJGA 5B3MO 4CDFA 2X46A 2W2BA 5D8JA 2RTRB 2NNDA 1CBSA 2FWVA 3CMPA 4IRWA 3D95A 2MO5A 3HOEA 2FR2A 4CDCA 2L67A 4HPDA 1N0SA 3UAQA 3FDCA 1LFOA 3PP6A 3H3IA 1HY2A 1IFCA 3KFIA 2RTKA 1GKAA 4N7DA 4QYNA 2JOZA 2CZTA 2I5VO 2Q2PA 3T1DA 2LFOA 1VWJB 2Y3FA 1VWLB 3FA9A 3EW1A 4ID2A 3D97A 3LTWA 4KCAA 5AEOA 1JZUA 5CYBA 4QQ1A 2EU7X 1BRQA 1VWPB 2DJGA 4ORXA 1OEEA 3NBXX 2BT9A 1EIOA 3WJBA 5JR8A 4L3RA 5F6ZA 4Z2PA 2M4LA 5C0NA 5F6BA 1AVGI 3VPJE 1RXKA 2CZUA 1LF7A 2AT0X 2AT3X 2N93A 2OF8A 4TLJA 3EW2A 1VWRB 3PEDA 5L3YA 2C1SA 3RDMA 2WSJA 1VWNB 2AT6X 4IAXA 1GM6A 2MJIA 1QFTA 2WUTA 4ORWA 1QABE 4AZMA 1A2DA 3KZAA 1PEEA 1DC9A 3P6GA 4CPIA 4I9RA 2X45A 4YBPA 2HNXA 4ZGUA 3FA6A 1QY0A 1MDCA 2KT4B 2IZEB 2OVEA 3ZW2A 3ZI8A 1BM5A 1ML7A 1CBIA 1NP1A 2QOSC 3CR6A 3HTYA 4RUNA 5FFHA 2NNQA 3AUMO 2UZ2A 1KQXA 2OF9A 2LA7A 2IZAA 3O22A 4I3BA 1D2UA 2JMBA 1X8PA 4L1NA 2KW1A 5B27A 4NV7A 3FELA 5H9LA 2E4JA 5IO6A 4C5PA 2X8SA 2WPUA 1SWPA 2ASNX 1GX3A 2LKKA 1S44A 1ZNHA 3FR4A 5EDCA 2LBVA 3U03A 3ELXA 1FEMA 1LIBA 1TXLA 1KQWA 2ALLX 1LCWA 3KFHA 4O4XA 3ELZA 3U9PC 4B55A 4ORYA 4XMCA 5IO7A 3Q34A 4NNTA 2RN4A 1LIEA 4GH7A 3SAOA 1YWDA 4YCEA 4CPFA 3S60A 4TKHA 4CDDA 4LZUA 2OZQA 2WWPA 4O3ZA 4CSBA 1IIUA 5L8OA 2RTNB 1SWUA 4RUUA 1Y55X 1ALBA 4QYPA 1OEJA 4NV8A 2OY7A 1NQMA 1VPRA 1KL5A 3RZYA 3RDUA 5B11O 1GGLA 1Y9LA 1N43A 3PH5A 1SLEB 3S5VA 5CHKA 1SWNA 1SY0A 3AKNA 5DG4A 3AEHA 2R74A 1O8VA 4UU2A 4MVEA 1OEKA 3RSWA 3B2JA 4I9SA 4U9CA 1NQNA 2UYWA 2OFBA 1MEPA 3KQ0A 2IJAA 4M7MA 3APUA 2XKLA 2IZKA 4HPAA 1IJ8A 4I3CA 4KT5A 4I95A 2MHDA 4MIRA 4YFQA 5AJCA 4QZUA 2OY8A 1GT5A 1SREA 1KL4A 4CPHA 4IB9A 4HPCA 1DV9A 3BRNA 4YDBA 1S2PA 1IFBA 5L8IA 5LKFA 2C1QA 1KOIA 1RLBE 4OMWA 3VG2A 4QRLA 3WBGA 4PSQA 1HBPA 3QQ2A 1SWSA 3OJYC 3NP1A 1Y53X 3BX8A 2Q2MA 4BX5B 5F7GA 4ORUA 1MM9A 3V8UA 1BJ7A 1Y52X 2GTLO 3NR3A 2DJFA 4JO6A 4O3WA 1U0XA 3PK2A 3VHHA 3E3CA 1NGLA 2G78A 2IZLB 3HWFA 1CRBA 2PI3O 3WJCA 1VWMB 3P24A 1EQDA 1KL3A 3UEVA 3FMZA 3EBWA 1R0UA 4IB8A 1FE3A 2FLJA 3ZW1A 1I4UA 3D4RA 3EMMA 1HBQA 2RTAA 2WEWA 2WEXA 1SWKA 3HOLA 1ZNLA 5D48A 2G79A 4AZOA 3N91A 4JGLA 4OS8A 5B29A 2ACPX 3SZHA 4BX6B 4GDZA 5B5FA 1FDQA 3WZQA 1AVEA 1STPA 1ERBA 1ZNDA 2HMBA 1HMRA 4O4UA 4ZR2A 5HCDC 2OFMX 1A3YA 3STMX 4A8ZA 1TW4A 1W6FA 1HMTA 2WQAE 4ZHHA 3PH6A
chains in the Genus database with same CATH topology
2FUDA 3BPMA 2IBIA 3BC3A 4I04A 1FH0A 3S3RA 1AYUA 1NPZA 1AU3A 1BP4A 4CDFB 1PPNA 2GFOA 3O0UA 3MTNA 2VHSA 1YK7A 4CDCB 2NQGA 3CH2X 1GLOA 1BQIA 4HWYA 1MHWA 2Y6EA 5A24A 3KWBX 4BSQA 2JQGR 4PP1A 4AXLA 2GHUA 4GUZA 4XR7A 2DJGB 2FT2A 2F7DA 4N8WA 2YJ9A 4BGFA 1PE6A 1DEUA 3KSEA 2HH5A 3RVVA 1CPJA 1EWLA 2FYEA 3OVZA 3H89A 3OVXA 1KHQA 2PREA 3N3KA 2OULA 3DF0A 1PBHA 2AYOA 3P5VA 2P7UA 3E1ZB 4BQVA 3ZUAA 4PP2E 4MSXA 1YK8A 2FRQA 2E03A 4N79A 3BWKA 2G8EA 5CVMA 1JQPA 4ZUXU 2R6NA 3HHIA 1KFXL 1QDQA 2E00A 1KXRA 5CHTA 5CVNB 1F2AA 1QOLA 1VJVA 2ATOA 4CDDB 4X6IA 3RVWA 3WXEA 5EF4A 1EF7A 1GMYA 2H7JA 1STFE 1U9XA 4OELA 1AIMA 1DF0A 2DCAA 2PNSA 3BCNA 2VFBA 2R9FA 4QRGA 2R9MA 1AU4A 2F1GA 4I07A 1W5RA 4BS6A 4X6HA 4FJCA 3BPFA 2VHFA 1YVBA 5F02A 1CJLA 3CBKA 3USVA 1U5IA 3U8EA 1ZCMA 3MHHA 3BOWA 1F2CA 3P5XA 1EWPA 2YJ2A 4YYSA 2PADA 1F29A 1PPOA 4DMXA 5JH3A 1BGOA 3N3GA 2DCBA 1KHPA 4G54A 5J94A 2NQDB 1TU6A 3K9MA 3QT4A 2JQFR 3IMAA 3HWNA 4WA6A 4RY2A 1MEGA 3M99A 1M6DA 1IWDA 4CDEB 2ACTA 2DC8A 2AYNA 3QSDA 3TNXA 1U9WA 1W4TA 2HHNA 2B1NA 4QRVA 1AYVA 2R9CA 3I3TA 1GCBA 3K8UA 3PBHA 3HD3A 1NB5A 4QH6A 2XU3A 2P0RA 3IUTA 1AECA 3P5WA 4P6GA 1PCIA 3OF8A 4YYQA 1E2TA 2OZ2A 1X9YA 4XUIA 4I05A 3KFQA 3D9WA 1PIPA 3O1GA 1CVZA 3H8BA 3LFYA 3PW3A 4YYVA 1Y4HA 1PADA 2YJ8A 4MZOA 2FO5A 9PAPA 2DCDA 1CB5A 3MORA 3NHEA 2DCCA 3D6SA 3C9EA 4W4UA 2YJBA 3PDFA 3WXGA 1SNKA 1ME4A 2FQ9A 1NB3A 2BSZA 3PNRA 6PADA 5CVOB 2AS8A 3LXSA 1TLOA 2G7YA 2NQIA 4FIPA 3KKUA 2FRAA 4Q8GA 3OISA 3P5UA 2XU4A 4PI3A 2PBHA 1NQCA 3MHSA 4YV8A 2G8JA 2AU1A 1AYWA 1S4VA 2R9NA 2BDLA 2Y5BA 3N4CA 2R9OA 2XU1A 4DMYA 1XKGA 3F5VA 1CTEA 1HUCB 2DC6A 2DJFB 5EGWA 2YJCA 4YYWA 1MIRA 1EWMA 1U9QX 4OEMA 5PADA 4KLBA 4QBBA 2HD5A 3QJ3A 1AU0A 3ERVA 3IEJA 2VFCA 2DC9A 3KX1A 2E01A 4AXMA 1CQDA 3S3QA 2CIOA 4YYRA 1CSBB 1MS6A 4YYUA 1U9VA 2DZYA 1VSNA 2IPPB 2AIMA 1MDWA 3IHPA 1TL9A 1YALA 4W5BA 4W5CA 4BS5A 1KFUL 3H7DA 2O6XA 1A6RA 2ARYA 3H6SA 3IV2A 4K7CA 3LTWA 2AVWA 3K24A 8PCHA 3I06A 3IOQA 3H8CA 1ITOA 1Y08A 2C0YA 1ME3A 2AUZA 3GCBA 2BDZA 4BPVA 4P6EA 2XU5A 5CHVA 1F2BA 1AU2A 1ICFA 4YVAA 4FK5A 3CBJA 1MEMA 3KW9A 3B79A 1ZIVA 4NV7A 1PPDA 3CH3X 3WXFA 4C5PA 2B1MA 1POPA 1GX3A 4Q8HA 4X6JA 4B55A 4QRXA 4CZWA 3V6CA 7PCKA 1ATKA 1SP4B 4NV8A 1NLJA 2P86A 3HHAA 5JA7A 3RVXA 2G6DA 3V6EA 1O0EA 2WBFX 1THEA 1PPPA 4MZSA 3OF9A 4N4ZA 1YT7A 1BY8A 1CS8A 3F75A 2AUXA 2E02A 2CB5A 1Q6KA 2HXZA 3KWZA 1EWOA 3AI8A 5K16A 2DC7A 4PADA 1QMYA 2OP3A 1QXPA 1PXVA 5FPWA 2FTDA 2DZZA 1NL6A 1K3BB 1W6FA 1CV8A 2NQAA 1GECE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFB A;  3D9W A;  4GUZ A;  3LTW A;  1W4T A;  1E2T A;  1GX3 A;  4NV8 A;  1W6F A;  2BSZ A;  1W5R A;  4NV7 A;  4BGF A;  4B55 A;  4C5P A;  2VFC A; 
#chains in the Genus database with same CATH topology
 1PM1 X;  2OY5 O;  3TGA A;  4U8U O;  4KII A;  3WXQ A;  3FR2 A;  1B56 A;  3CQR A;  3WJE A;  1VWA B;  2JW1 A;  1OPA A;  4COT A;  2BC3 A;  4ON1 A;  2XST A;  3C78 X;  3ZZV A;  4INN A;  2LBA A;  5EEE A;  3C77 X;  3U0D A;  4ZHF A;  3FEP A;  4EQA C;  5LKE A;  3S26 A;  2F01 A;  3BSZ E;  3RY1 A;  3T2X A;  3WJG A;  5BVT A;  4GRJ A;  2F73 A;  4YKO A;  1SWF A;  4GK9 A;  4U3Q A;  1I9H A;  1KXO A;  2FKJ A;  1X71 A;  2GTL M;  4MVI A;  5HCC C;  3NPO A;  5LJE A;  1NBX A;  3VHI A;  1ICM A;  1SWL A;  2X55 A;  3BU9 A;  3O2Y A;  4U8U N;  1BEB A;  1SLG B;  4GU8 A;  4NYQ A;  2HZR A;  1EAL A;  1GKA B;  2RTF B;  1YWC A;  5FAZ A;  4GJS A;  4WBK A;  3WJD A;  4DMO A;  2YG2 A;  5F58 A;  3P02 A;  4GUZ A;  3CQN A;  2JU8 A;  1GT3 A;  2I5Z O;  3APX A;  4ODD A;  4ML7 B;  4BX7 B;  1SWH A;  3B2I A;  3BY0 A;  4NLJ A;  2Y3E A;  4BGF A;  4EXZ A;  2RTI B;  4ORR A;  2QMI A;  4XMF A;  1N9Y A;  1YP7 A;  2GH7 A;  3B2K A;  4KC7 A;  3UEX A;  3LNB A;  1ZNG A;  5EPQ A;  4FBR A;  3RDS A;  1LIF A;  1STS B;  3WVM A;  4Y59 A;  1SXU A;  1VWE B;  1KZW A;  1JIW I;  4FBV A;  2G7B A;  4HWM A;  1QQS A;  1CBR A;  1I78 A;  3VG7 A;  4O3Y A;  1SRJ A;  3AKM A;  1LKE A;  4GJV A;  3TF6 A;  1DFV A;  2OFR X;  3MM0 A;  4U8U M;  5KHP A;  2AVI A;  4XMH A;  4ARH A;  4NNS A;  1LNM A;  3MG5 A;  2RCT A;  4YCH A;  5K68 A;  2Q9S A;  2A5C A;  3FW5 A;  2RTG B;  3RBY A;  1JQP A;  4Z27 A;  1SY3 A;  4GET A;  1SA8 A;  2KTS A;  2IZF B;  4N7C A;  4QGW A;  1ADL A;  5EZ2 A;  1P6P A;  2A2U A;  4GNW A;  3ZW0 B;  4QGX A;  3EBK A;  2AF5 A;  1DZP A;  4A1H A;  2FGS A;  4GNY A;  1AQB A;  4FQB B;  5DPQ A;  5FQ8 E;  1RXH A;  1Z24 A;  4YGH A;  1NC9 A;  5HA1 A;  1B0O A;  4ALB A;  1DF3 A;  3OD9 A;  4YDA A;  1SRH A;  1PMP A;  3F8A A;  3L4R A;  1KT6 A;  1X8N A;  4OS0 A;  5D45 A;  2OL7 A;  4GGZ A;  5FQ6 E;  3CKG A;  5L8N A;  3TGB A;  4Y0P A;  4R0B A;  1SRF A;  3BS2 A;  4ZFX A;  1EXS A;  3Q6L A;  1IW2 A;  2K23 A;  2RA6 A;  4A1Y A;  4D6B A;  1QWD A;  3FID A;  1NP4 A;  1VWK B;  5F2B A;  1JJJ A;  4DQ3 A;  2QCB A;  1O1U A;  2ANS A;  4Y0S A;  5H9A A;  4ALO A;  2GTL N;  2IZG B;  1IKE A;  3NQ3 A;  4QNI A;  1PTS A;  3HWG A;  3RDX A;  5HZ5 A;  1A18 A;  4CV7 A;  4OEL A;  1EUO A;  3LHN A;  2FHL A;  1KZX A;  1X8Q A;  1I05 A;  1E5P A;  1OBQ A;  1VWB B;  2CBS A;  4I3D A;  5B5G A;  1DF8 A;  2VDF A;  4CPE A;  4GZV A;  1XCA A;  2VFB A;  1K24 A;  2FR3 A;  1JJU A;  5D4A A;  1LIC A;  1QG5 A;  5FQ7 E;  4CPH B;  1ERX A;  1JMX A;  1PBY A;  3RDO A;  1OBU A;  1SRG A;  4FGI B;  1Y9T A;  2K62 A;  3QKG A;  3VG6 A;  4BVM A;  3APW A;  1SWA A;  2JU7 A;  1GX9 A;  5JD2 A;  5EDB A;  2AT5 X;  4LKP A;  1BSY A;  2G5L A;  1W5R A;  3OBL A;  5D47 A;  2Y32 A;  1LCZ A;  5H8T A;  3F9D A;  4BX5 A;  2RTP B;  3BDR A;  4WFV A;  2R73 A;  4EKV A;  3NX1 A;  3VHM A;  1EW3 A;  1H91 A;  3HWE A;  4OMX A;  2QOM A;  2Z4H A;  3G7X A;  4NP1 A;  4Z2V A;  1ACD A;  1RXJ A;  1FEN A;  1U18 A;  2BLG A;  2RTJ A;  1CBQ A;  3ZW1 B;  5HWZ A;  2OL8 O;  1ICN A;  4TJZ A;  1X8O A;  1UYO X;  4NW4 A;  5BYP A;  1RSU B;  1DZM A;  1VWG B;  2CBR A;  3MVF A;  1OSP O;  1E02 A;  2L68 A;  2IZH B;  3BX7 A;  2IZC B;  1I04 A;  1MVG A;  2FS7 A;  2OVS A;  1BSQ A;  4Z28 A;  4DQ4 A;  3S5X A;  4BX6 A;  3RY2 A;  5AQ6 A;  5H9K A;  3OE3 A;  4BJ8 A;  5IXG A;  2X34 A;  5HTD A;  1JYD A;  2AH7 X;  4YGG A;  2Z4I A;  4GGT A;  3WZO A;  3P6H A;  1SWT A;  1B4M A;  1KT4 A;  2JGS A;  3IFB A;  4JHQ A;  2POA A;  3FA7 A;  1QFV A;  1T0V A;  3JQO A;  3NX2 A;  1NDJ A;  2RTQ B;  3PQS A;  1BRP A;  1DZJ A;  1SWB A;  2R56 A;  3UEU A;  1LEL A;  1MX8 A;  4AZQ A;  4EFG A;  1QY2 A;  1SRI A;  1BWY A;  1RBP A;  2GC9 A;  2X8T A;  2ACO A;  1VWF B;  2W2A A;  2X8F A;  3CWK A;  2RTO B;  2KTD A;  2QO6 A;  1G7N A;  1KT7 A;  1OPB A;  2QO4 A;  5EED A;  5HCE C;  2RTD B;  1HXZ A;  4UU3 A;  4AYH A;  4KH8 A;  5H9N A;  2YMS A;  1ZNK A;  4AW8 A;  3WOV A;  1URE A;  3GE2 A;  4TKJ A;  1MK5 A;  1KT3 A;  5HBS A;  4ZHC A;  1SXX A;  2RTB B;  1STR B;  3CKF A;  2HYS A;  1LDO A;  1ZRY A;  2AL0 X;  5FEN A;  3LV4 A;  2RCQ A;  4A60 A;  3WJF A;  3B2H A;  5IRW A;  4GDA A;  1W4T A;  2A13 A;  4TKB A;  1AEL A;  4YVB A;  5K06 A;  1EII A;  3RE5 A;  1MX7 A;  1IKJ A;  4ZHD A;  3ZUO A;  2OY1 O;  4DCB A;  3FR5 A;  1LPJ A;  1N9M A;  4QGV A;  2X32 A;  4Z2O A;  3FIQ A;  4TNN A;  1HQP A;  4AZP A;  4BX7 A;  3RWX A;  3WYQ A;  4Z6J A;  4M6S A;  5HAE A;  5LJB A;  2OVD A;  3UEW A;  1Y0G A;  5CSE A;  1UYN X;  1MOY A;  1VWI B;  1VWH B;  3EM0 A;  4D6A A;  1HN2 A;  1JV4 A;  5LJH A;  4O4O A;  1VWD B;  1SWQ A;  1TVQ A;  3APV A;  2IZJ A;  4GGR A;  1SY1 A;  2BS5 A;  3STK A;  2KD2 A;  3WZN A;  1VYF A;  2ZAI A;  1FJ1 E;  1KT5 A;  1SMP I;  3FYF A;  3PQU A;  4KC8 A;  4NYR A;  4ZHG A;  2OL6 O;  2FT9 A;  4I6S A;  2ZAG A;  2G8C O;  3P6C A;  1O1V A;  3FLL A;  2RTH B;  3T2W A;  5HZ6 A;  5BVS A;  1E2T A;  1GX8 A;  3KFF A;  3DSZ A;  3MX7 A;  2L9C A;  4ZH6 A;  3PPT A;  5F1E A;  2Q4N A;  4BQU A;  1GT1 A;  2NP1 A;  3D9W A;  1YWA A;  5KID A;  1YIV A;  1T8V A;  4OKA A;  3MBT A;  2MWH A;  4XME A;  1X8U A;  2O62 A;  3EYC A;  4AZR A;  4PJ2 A;  1EPA A;  1S7D A;  3FEN A;  2A3F X;  2Q39 A;  2QM9 A;  3BU1 A;  4YFP A;  2BHV A;  5KIC A;  2IZD B;  4HPB A;  3SLO A;  3ZW0 A;  1SWO A;  3VGW A;  1G5W A;  5K67 A;  1VYO A;  1L6M A;  2WR6 A;  3CBC A;  1JMZ A;  1X89 A;  4O9S A;  2CM4 A;  5HA0 A;  3VG3 A;  3TGC A;  3EC5 A;  4Y0R A;  3VU1 A;  5IRU A;  4ZCB A;  3SZI A;  3SOT A;  2PQT A;  3WZP A;  4AZN A;  4MEE A;  3T6F A;  2HZQ A;  1LCV A;  2NNE A;  1QY1 A;  4ZH9 A;  1CJ5 A;  3VG5 A;  2RTE B;  1ZNE A;  1BBP A;  4GD9 A;  3PDF A;  2P8G A;  1AB0 A;  4EDE A;  3O19 A;  2F09 A;  3RE6 A;  3IA8 A;  2BS6 A;  1SXY A;  1SWG A;  4QAE A;  5LJC A;  1SY2 A;  2FTB A;  3JSQ A;  4EEJ A;  2L5P A;  1DZK A;  1XKI A;  3P6F A;  2BSZ A;  3PEC A;  4FBO A;  2A0A A;  4MVL A;  4O3X B;  2GJ5 A;  1VWQ B;  3FW4 A;  2GTF X;  1WBI A;  3P6E A;  2CM9 A;  2PY1 A;  2FHN X;  2IZI A;  3SLJ A;  4LKT A;  5HZ8 A;  3GAQ A;  5HTE A;  4ES7 A;  2C4I A;  4BCS A;  4MIS A;  5B2A O;  3SZJ A;  1RAV A;  1SLF B;  1E00 A;  2JN3 A;  4YMY A;  2FRS A;  5IO5 A;  1SXW A;  1LUQ A;  1JBH A;  4YH0 A;  4Y5D A;  1JJX A;  2OFA A;  1FEL A;  1VWC B;  2ZSC A;  1LDQ A;  4LQZ A;  5AJB A;  1I06 A;  1EI5 A;  2A2G A;  3FA8 A;  4LZV A;  2PFR A;  2W2F A;  5HZ9 A;  5BVQ A;  1SWD A;  3CBS A;  4OS3 A;  2DM5 A;  3JS1 A;  2JU3 A;  3RDQ A;  1N4J A;  3SLT A;  3STN A;  1WUB A;  3ZQ3 A;  1KGL A;  1SWE A;  4IAW A;  1MUP A;  1UZ2 X;  1JYJ A;  2AMM X;  2MF6 A;  2RTC B;  3C76 X;  4TQ2 A;  2AKQ A;  3I0A A;  1N7Y A;  4IBA A;  4YKM A;  4O4S A;  4IAB A;  3HWD A;  3HPE A;  5HZQ A;  3I17 A;  5LJD A;  4JNJ A;  3NAD A;  2OYB O;  4ZJ0 A;  5CE4 A;  4YBU A;  1TOW A;  2RD7 C;  4QZT A;  2AT8 X;  2IFB A;  1YUP A;  2A8G A;  2LB6 A;  3VG4 A;  1SWC A;  4GE1 A;  1VYG A;  3WYP A;  3ZWE A;  4CK4 A;  1A57 A;  1BLR A;  4BOE A;  4XMG A;  3FEK A;  1G85 A;  2WQ9 A;  4IMN A;  3NQK A;  1TOU A;  1GT4 A;  2HLV A;  3DTQ A;  4IMO A;  2OVA A;  4K19 A;  2FKG A;  2QO5 A;  4U46 A;  1EPB A;  3BLG A;  1YWB A;  3B2L A;  3D96 A;  2MM3 A;  2HKD A;  2RTL A;  4YGZ A;  1RST B;  1U17 A;  1LID A;  3NQ9 A;  4MVK A;  4NLI A;  3KFG A;  4OEM A;  2RTM A;  3ZUI A;  4ZGF A;  3VE2 A;  3KVN A;  1E06 A;  1HMS A;  4CDE A;  3T6L A;  3X00 A;  1SLD B;  3F6Z B;  4DNE A;  2A5B A;  1PBO A;  4WHI A;  1KFF A;  4Y0Q A;  1HQQ A;  4WFU A;  5LJK A;  2VFC A;  3VE1 A;  1GXA A;  3K3L A;  3RKG A;  1K3B A;  1YP6 A;  4BBO A;  1AVD A;  1G74 A;  1SWJ A;  3TZS A;  2IZB A;  5B10 O;  1B8E A;  1D3S A;  2CAM A;  2X56 A;  4IB6 A;  2RQ0 A;  4O49 A;  1HXL A;  4HFO A;  4YFR A;  3HK1 A;  1VWO B;  4IB7 A;  2X4M A;  4XMD A;  1SWR A;  1FTP A;  4I60 A;  1T68 X;  4GKC A;  2FS6 A;  3P6D A;  4ORS A;  1BSO A;  1OBP A;  5IRA A;  5LJG A;  5B3M O;  4CDF A;  2X46 A;  2W2B A;  5D8J A;  2RTR B;  2NND A;  1CBS A;  2FWV A;  3CMP A;  4IRW A;  3D95 A;  2MO5 A;  3HOE A;  2FR2 A;  4CDC A;  2L67 A;  4HPD A;  1N0S A;  3UAQ A;  3FDC A;  1LFO A;  3PP6 A;  3H3I A;  1HY2 A;  1IFC A;  3KFI A;  2RTK A;  1GKA A;  4N7D A;  4QYN A;  2JOZ A;  2CZT A;  2I5V O;  2Q2P A;  3T1D A;  2LFO A;  1VWJ B;  2Y3F A;  1VWL B;  3FA9 A;  3EW1 A;  4ID2 A;  3D97 A;  3LTW A;  4KCA A;  5AEO A;  1JZU A;  5CYB A;  4QQ1 A;  2EU7 X;  1BRQ A;  1VWP B;  2DJG A;  4ORX A;  1OEE A;  3NBX X;  2BT9 A;  1EIO A;  3WJB A;  5JR8 A;  4L3R A;  5F6Z A;  4Z2P A;  2M4L A;  5C0N A;  5F6B A;  1AVG I;  3VPJ E;  1RXK A;  2CZU A;  1LF7 A;  2AT0 X;  2AT3 X;  2N93 A;  2OF8 A;  4TLJ A;  3EW2 A;  1VWR B;  3PED A;  5L3Y A;  2C1S A;  3RDM A;  2WSJ A;  1VWN B;  2AT6 X;  4IAX A;  1GM6 A;  2MJI A;  1QFT A;  2WUT A;  4ORW A;  1QAB E;  4AZM A;  1A2D A;  3KZA A;  1PEE A;  1DC9 A;  3P6G A;  4CPI A;  4I9R A;  2X45 A;  4YBP A;  2HNX A;  4ZGU A;  3FA6 A;  1QY0 A;  1MDC A;  2KT4 B;  2IZE B;  2OVE A;  3ZW2 A;  3ZI8 A;  1BM5 A;  1ML7 A;  1CBI A;  1NP1 A;  2QOS C;  3CR6 A;  3HTY A;  4RUN A;  5FFH A;  2NNQ A;  3AUM O;  2UZ2 A;  1KQX A;  2OF9 A;  2LA7 A;  2IZA A;  3O22 A;  4I3B A;  1D2U A;  2JMB A;  1X8P A;  4L1N A;  2KW1 A;  5B27 A;  4NV7 A;  3FEL A;  5H9L A;  2E4J A;  5IO6 A;  4C5P A;  2X8S A;  2WPU A;  1SWP A;  2ASN X;  1GX3 A;  2LKK A;  1S44 A;  1ZNH A;  3FR4 A;  5EDC A;  2LBV A;  3U03 A;  3ELX A;  1FEM A;  1LIB A;  1TXL A;  1KQW A;  2ALL X;  1LCW A;  3KFH A;  4O4X A;  3ELZ A;  3U9P C;  4B55 A;  4ORY A;  4XMC A;  5IO7 A;  3Q34 A;  4NNT A;  2RN4 A;  1LIE A;  4GH7 A;  3SAO A;  1YWD A;  4YCE A;  4CPF A;  3S60 A;  4TKH A;  4CDD A;  4LZU A;  2OZQ A;  2WWP A;  4O3Z A;  4CSB A;  1IIU A;  5L8O A;  2RTN B;  1SWU A;  4RUU A;  1Y55 X;  1ALB A;  4QYP A;  1OEJ A;  4NV8 A;  2OY7 A;  1NQM A;  1VPR A;  1KL5 A;  3RZY A;  3RDU A;  5B11 O;  1GGL A;  1Y9L A;  1N43 A;  3PH5 A;  1SLE B;  3S5V A;  5CHK A;  1SWN A;  1SY0 A;  3AKN A;  5DG4 A;  3AEH A;  2R74 A;  1O8V A;  4UU2 A;  4MVE A;  1OEK A;  3RSW A;  3B2J A;  4I9S A;  4U9C A;  1NQN A;  2UYW A;  2OFB A;  1MEP A;  3KQ0 A;  2IJA A;  4M7M A;  3APU A;  2XKL A;  2IZK A;  4HPA A;  1IJ8 A;  4I3C A;  4KT5 A;  4I95 A;  2MHD A;  4MIR A;  4YFQ A;  5AJC A;  4QZU A;  2OY8 A;  1GT5 A;  1SRE A;  1KL4 A;  4CPH A;  4IB9 A;  4HPC A;  1DV9 A;  3BRN A;  4YDB A;  1S2P A;  1IFB A;  5L8I A;  5LKF A;  2C1Q A;  1KOI A;  1RLB E;  4OMW A;  3VG2 A;  4QRL A;  3WBG A;  4PSQ A;  1HBP A;  3QQ2 A;  1SWS A;  3OJY C;  3NP1 A;  1Y53 X;  3BX8 A;  2Q2M A;  4BX5 B;  5F7G A;  4ORU A;  1MM9 A;  3V8U A;  1BJ7 A;  1Y52 X;  2GTL O;  3NR3 A;  2DJF A;  4JO6 A;  4O3W A;  1U0X A;  3PK2 A;  3VHH A;  3E3C A;  1NGL A;  2G78 A;  2IZL B;  3HWF A;  1CRB A;  2PI3 O;  3WJC A;  1VWM B;  3P24 A;  1EQD A;  1KL3 A;  3UEV A;  3FMZ A;  3EBW A;  1R0U A;  4IB8 A;  1FE3 A;  2FLJ A;  3ZW1 A;  1I4U A;  3D4R A;  3EMM A;  1HBQ A;  2RTA A;  2WEW A;  2WEX A;  1SWK A;  3HOL A;  1ZNL A;  5D48 A;  2G79 A;  4AZO A;  3N91 A;  4JGL A;  4OS8 A;  5B29 A;  2ACP X;  3SZH A;  4BX6 B;  4GDZ A;  5B5F A;  1FDQ A;  3WZQ A;  1AVE A;  1STP A;  1ERB A;  1ZND A;  2HMB A;  1HMR A;  4O4U A;  4ZR2 A;  5HCD C;  2OFM X;  1A3Y A;  3STM X;  4A8Z A;  1TW4 A;  1W6F A;  1HMT A;  2WQA E;  4ZHH A;  3PH6 A; 
#chains in the Genus database with same CATH homology
 2FUD A;  3BPM A;  2IBI A;  3BC3 A;  4I04 A;  1FH0 A;  3S3R A;  1AYU A;  1NPZ A;  1AU3 A;  1BP4 A;  4CDF B;  1PPN A;  2GFO A;  3O0U A;  3MTN A;  2VHS A;  1YK7 A;  4CDC B;  2NQG A;  3CH2 X;  1GLO A;  1BQI A;  4HWY A;  1MHW A;  2Y6E A;  5A24 A;  3KWB X;  4BSQ A;  2JQG R;  4PP1 A;  4AXL A;  2GHU A;  4GUZ A;  4XR7 A;  2DJG B;  2FT2 A;  2F7D A;  4N8W A;  2YJ9 A;  4BGF A;  1PE6 A;  1DEU A;  3KSE A;  2HH5 A;  3RVV A;  1CPJ A;  1EWL A;  2FYE A;  3OVZ A;  3H89 A;  3OVX A;  1KHQ A;  2PRE A;  3N3K A;  2OUL A;  3DF0 A;  1PBH A;  2AYO A;  3P5V A;  2P7U A;  3E1Z B;  4BQV A;  3ZUA A;  4PP2 E;  4MSX A;  1YK8 A;  2FRQ A;  2E03 A;  4N79 A;  3BWK A;  2G8E A;  5CVM A;  1JQP A;  4ZUX U;  2R6N A;  3HHI A;  1KFX L;  1QDQ A;  2E00 A;  1KXR A;  5CHT A;  5CVN B;  1F2A A;  1QOL A;  1VJV A;  2ATO A;  4CDD B;  4X6I A;  3RVW A;  3WXE A;  5EF4 A;  1EF7 A;  1GMY A;  2H7J A;  1STF E;  1U9X A;  4OEL A;  1AIM A;  1DF0 A;  2DCA A;  2PNS A;  3BCN A;  2VFB A;  2R9F A;  4QRG A;  2R9M A;  1AU4 A;  2F1G A;  4I07 A;  1W5R A;  4BS6 A;  4X6H A;  4FJC A;  3BPF A;  2VHF A;  1YVB A;  5F02 A;  1CJL A;  3CBK A;  3USV A;  1U5I A;  3U8E A;  1ZCM A;  3MHH A;  3BOW A;  1F2C A;  3P5X A;  1EWP A;  2YJ2 A;  4YYS A;  2PAD A;  1F29 A;  1PPO A;  4DMX A;  5JH3 A;  1BGO A;  3N3G A;  2DCB A;  1KHP A;  4G54 A;  5J94 A;  2NQD B;  1TU6 A;  3K9M A;  3QT4 A;  2JQF R;  3IMA A;  3HWN A;  4WA6 A;  4RY2 A;  1MEG A;  3M99 A;  1M6D A;  1IWD A;  4CDE B;  2ACT A;  2DC8 A;  2AYN A;  3QSD A;  3TNX A;  1U9W A;  1W4T A;  2HHN A;  2B1N A;  4QRV A;  1AYV A;  2R9C A;  3I3T A;  1GCB A;  3K8U A;  3PBH A;  3HD3 A;  1NB5 A;  4QH6 A;  2XU3 A;  2P0R A;  3IUT A;  1AEC A;  3P5W A;  4P6G A;  1PCI A;  3OF8 A;  4YYQ A;  1E2T A;  2OZ2 A;  1X9Y A;  4XUI A;  4I05 A;  3KFQ A;  3D9W A;  1PIP A;  3O1G A;  1CVZ A;  3H8B A;  3LFY A;  3PW3 A;  4YYV A;  1Y4H A;  1PAD A;  2YJ8 A;  4MZO A;  2FO5 A;  9PAP A;  2DCD A;  1CB5 A;  3MOR A;  3NHE A;  2DCC A;  3D6S A;  3C9E A;  4W4U A;  2YJB A;  3PDF A;  3WXG A;  1SNK A;  1ME4 A;  2FQ9 A;  1NB3 A;  2BSZ A;  3PNR A;  6PAD A;  5CVO B;  2AS8 A;  3LXS A;  1TLO A;  2G7Y A;  2NQI A;  4FIP A;  3KKU A;  2FRA A;  4Q8G A;  3OIS A;  3P5U A;  2XU4 A;  4PI3 A;  2PBH A;  1NQC A;  3MHS A;  4YV8 A;  2G8J A;  2AU1 A;  1AYW A;  1S4V A;  2R9N A;  2BDL A;  2Y5B A;  3N4C A;  2R9O A;  2XU1 A;  4DMY A;  1XKG A;  3F5V A;  1CTE A;  1HUC B;  2DC6 A;  2DJF B;  5EGW A;  2YJC A;  4YYW A;  1MIR A;  1EWM A;  1U9Q X;  4OEM A;  5PAD A;  4KLB A;  4QBB A;  2HD5 A;  3QJ3 A;  1AU0 A;  3ERV A;  3IEJ A;  2VFC A;  2DC9 A;  3KX1 A;  2E01 A;  4AXM A;  1CQD A;  3S3Q A;  2CIO A;  4YYR A;  1CSB B;  1MS6 A;  4YYU A;  1U9V A;  2DZY A;  1VSN A;  2IPP B;  2AIM A;  1MDW A;  3IHP A;  1TL9 A;  1YAL A;  4W5B A;  4W5C A;  4BS5 A;  1KFU L;  3H7D A;  2O6X A;  1A6R A;  2ARY A;  3H6S A;  3IV2 A;  4K7C A;  3LTW A;  2AVW A;  3K24 A;  8PCH A;  3I06 A;  3IOQ A;  3H8C A;  1ITO A;  1Y08 A;  2C0Y A;  1ME3 A;  2AUZ A;  3GCB A;  2BDZ A;  4BPV A;  4P6E A;  2XU5 A;  5CHV A;  1F2B A;  1AU2 A;  1ICF A;  4YVA A;  4FK5 A;  3CBJ A;  1MEM A;  3KW9 A;  3B79 A;  1ZIV A;  4NV7 A;  1PPD A;  3CH3 X;  3WXF A;  4C5P A;  2B1M A;  1POP A;  1GX3 A;  4Q8H A;  4X6J A;  4B55 A;  4QRX A;  4CZW A;  3V6C A;  7PCK A;  1ATK A;  1SP4 B;  4NV8 A;  1NLJ A;  2P86 A;  3HHA A;  5JA7 A;  3RVX A;  2G6D A;  3V6E A;  1O0E A;  2WBF X;  1THE A;  1PPP A;  4MZS A;  3OF9 A;  4N4Z A;  1YT7 A;  1BY8 A;  1CS8 A;  3F75 A;  2AUX A;  2E02 A;  2CB5 A;  1Q6K A;  2HXZ A;  3KWZ A;  1EWO A;  3AI8 A;  5K16 A;  2DC7 A;  4PAD A;  1QMY A;  2OP3 A;  1QXP A;  1PXV A;  5FPW A;  2FTD A;  2DZZ A;  1NL6 A;  1K3B B;  1W6F A;  1CV8 A;  2NQA A;  1GEC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...