4NV8A

Crystal structure of mesorhizobium loti arylamine n-acetyltransferase f42w mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
271
structure length
270
Chain Sequence
PPFDLDAYLARIGYTGPRNASLDTLKALHFAHPQAIPWENIDPFLGRPVRLDLAALQDKIVLGGRGGYCFEHNLLFMHALKALGFEVGGLAARVLWGQSEAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGREQKTPHEPFRIVEADDHFRLQAAIGGDWRSLYRFDLQPQYEVDYSVTNYFLSTSPTSHFLSSVIAARAAPDRRYALRGNRLSIHHLGGRTEQTEIATAADLADTLQGLLGIIIPDRTAFEAKVRETKIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into cofactor recognition in arylamine N-acetyltransferase enzymes: structure of Mesorhizobium loti arylamine N-acetyltransferase in complex with coenzyme A.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
molecule keywords Arylamine N-acetyltransferase
total genus 82
structure length 270
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4nv8A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4nv8A01
4BGFA 2VFCA 4C5PA 3LTWA 1E2TA 2BSZA 4NV8A 1W6FA 4B55A 1W5RA 1W4TA 2VFBA 3D9WA 4GUZA 4NV7A 1GX3A
chains in the Genus database with same CATH superfamily
2BS6A 3C77X 1FENA 3O19A 4YBUA 1XCAA 1X8NA 4AZQA 1GT4A 4CPHB 2Q2MA 1NDJA 4B55A 1DZJA 1DZKA 3VGWA 3H3IA 5K67A 1HBQA 5F58A 3RWXA 3EC5A 3RY2A 2BHVA 1K3BA 4ARHA 1ZRYA 4A1HA 4COTA 5LKFA 4I9SA 3U03A 2OL6O 1RXHA 5IO5A 4ES7A 2JN3A 2QO4A 3AUMO 4ORUA 4LQZA 2IZAA 4QAEA 1BSQA 3WZQA 2LFOA 1GX3A 4GDAA 1UYOX 1BRQA 1H91A 5KICA 5D45A 4IMOA 5L8IA 1LUQA 2G8CO 2GC9A 4XMHA 1SWTA 4YGGA 1IJ8A 4KIIA 5EDCA 4AYHA 1MX7A 2OYBO 3P6EA 1UZ2X 4PSQA 4I95A 4BCSA 5HZQA 1SXUA 4DNEA 1SWKA 2AMMX 3FR2A 1LPJA 2C1SA 3BU1A 5EZ2A 1QWDA 3S60A 4AZMA 2FKJA 2FLJA 5AEOA 2OFMX 1VWFB 1YWAA 1P6PA 1N4JA 3SOTA 4I3CA 1U0XA 4GGRA 4PJ2A 2RTIB 4FBVA 3IFBA 2AT6X 1Y9TA 4YFRA 1VWPB 2MWHA 2R74A 3BS2A 3EW2A 3HWGA 4TKBA 2IZHB 2FS7A 4ZCBA 2MHDA 1SRGA 4OELA 3ELZA 3NQ3A 1OBQA 3T1DA 4ORWA 4ZHDA 1EUOA 1SA8A 3HWEA 4JGLA 1ZNKA 3VHHA 4ZH6A 2Y3EA 2HKDA 1VWKB 3P6FA 4MVLA 3ZWEA 4ZR2A 2X34A 5L8NA 1YWCA 1TVQA 1VWLB 1E06A 1SWRA 1LIDA 3CMPA 3UEXA 5KIDA 4MEEA 2HZQA 3VG4A 1BRPA 2F01A 2NNDA 4HPCA 4Y5DA 2DJFA 3RBYA 5CE4A 2A0AA 2AVIA 2ALLX 4QZUA 1R0UA 1IKEA 1VYOA 1W5RA 2FHLA 4GK9A 4ORSA 2WQAE 1GM6A 4OS8A 4FQBB 4ML7B 1AB0A 1AVGI 3BU9A 1JYJA 3HK1A 4GD9A 4I3DA 1B56A 4NLJA 2MF6A 4YKOA 4ORRA 1PBYA 3VG5A 4Z2VA 3AEHA 2LKKA 3ZZVA 4BX6A 1STRB 2RTRB 4MVIA 2OL7A 4QZTA 2AT8X 3BX7A 1OBUA 3NBXX 1SWAA 1QFTA 2ANSA 4IMNA 1DV9A 3B2JA 1D2UA 1MUPA 2WEWA 3B2LA 4MVEA 4QQ1A 4Y0QA 2OL8O 2AH7X 1MOYA 1YP7A 5LKEA 3TGCA 1VWDB 3PH5A 1N9MA 1RXJA 3C78X 3CWKA 4WHIA 1DZMA 1CBSA 2KT4B 1QY0A 3ZQ3A 2RTGB 1BEBA 2W2BA 2HNXA 3WJEA 1JYDA 3PH6A 4JO6A 5B11O 1VWEB 2F73A 3I0AA 1A2DA 3FYFA 1IFBA 3APXA 4INNA 3NQ9A 3ZW2A 2AKQA 3VG2A 3UEVA 2KTSA 2PFRA 4GNWA 1BWYA 1E2TA 4IRWA 4YGHA 5DPQA 3SLTA 4YCEA 3UAQA 4O4SA 1KZXA 2IZCB 1LCVA 1OBPA 3FA7A 4GRJA 4NNTA 4ZHHA 1O1UA 4L1NA 1Y0GA 2Q2PA 5FQ6E 2ZAIA 3MG5A 5JR8A 5IXGA 1ML7A 1XKIA 4YDBA 4HWMA 3IA8A 4IAXA 1KQXA 4L3RA 1KFFA 4ZHCA 5H8TA 3BX8A 2JW1A 2RN4A 3LHNA 4AZRA 4N7CA 1VWOB 4YVBA 3OBLA 4GUZA 5LJKA 3ZW0A 1ZNGA 4D6BA 4NYQA 2AF5A 1MM9A 3RY1A 3AKNA 5DG4A 1VWMB 5B3MO 2X4MA 3VPJE 5F2BA 1SXXA 4OS3A 1NP4A 1X8PA 3EBWA 4ZGUA 2WSJA 2OFBA 2MM3A 2OVEA 4BBOA 5IO6A 4IB8A 1VWIB 1OPBA 4N7DA 5B27A 1KT6A 2FS6A 2HMBA 1VYFA 2RQ0A 4AZPA 4GH7A 2A13A 2DJGA 4R0BA 5HCDC 4BX5A 1I9HA 4CPEA 1KXOA 2NNQA 2VDFA 1ZNEA 5EDBA 1N7YA 4O3XB 1LDQA 2FTBA 1KQWA 4I6SA 1GGLA 1A57A 1VWNB 1SRHA 1JJUA 2X56A 3CBCA 1HBPA 5BVTA 3B2IA 5B10O 2IZFB 2OVAA 1WBIA 2PQTA 2X8FA 2MJIA 2YG2A 4QRLA 1G5WA 1PEEA 4ZHGA 1AELA 1QG5A 1KGLA 3HOLA 4ZJ0A 3UEUA 3F9DA 2Y3FA 2RCQA 2X46A 4O9SA 1JV4A 3FLLA 1JQPA 2A5BA 2OFAA 4YGZA 5LJGA 3X00A 1DZPA 2QCBA 2HYSA 3WJBA 1SWSA 2RTFB 2JU7A 1JJXA 1W6FA 4ORYA 5EEDA 1SY3A 1STPA 2QO5A 5B5GA 3RDQA 3EYCA 3GAQA 1ICNA 2OVDA 3RE5A 3C76X 3F6ZB 3FR5A 2L9CA 3RE6A 2NNEA 3PEDA 1BBPA 2I5ZO 3S26A 3MM0A 4Z27A 4KCAA 4OMXA 1HQPA 3WXQA 4BX7A 4ZHFA 1JBHA 5HCEC 1VWCB 2ZSCA 1HY2A 3U0DA 1I05A 5F6BA 1I06A 5D47A 2K62A 2FRSA 4ZH9A 5BVSA 4WFUA 1QY1A 5HBSA 2X45A 3KVNA 1OEEA 1EI5A 1ERBA 4LKPA 4XMEA 4Y0SA 5FQ7E 3JSQA 3LNBA 3VG3A 1Y52X 4HPDA 2G78A 2RTQB 3EM0A 4XMCA 4A1YA 3PQSA 5LJEA 1FEMA 3FIDA 1SWHA 3KFIA 3VG6A 1T0VA 2OY1O 4IAWA 1FELA 5LJBA 3NP1A 1A18A 2IJAA 1OEJA 1VWJB 1U18A 4MVKA 3CR6A 3APVA 4BVMA 1SWLA 1PMPA 4XMDA 1LCWA 2JU3A 4O4OA 1JIWI 2LBVA 2OF9A 2X32A 1EALA 3BRNA 3RDXA 2KW1A 3WJFA 5LJHA 2QO6A 3P6HA 3FENA 3WZPA 1RAVA 5IRUA 1GX8A 3QQ2A 5HCCC 4YDAA 2X8SA 2LA7A 1SLDB 1HMSA 1LIBA 3OJYC 3SLOA 1EPBA 4KH8A 3N91A 2WR6A 2KD2A 2JOZA 2FGSA 2X55A 3NPOA 4ALOA 3GE2A 4KC7A 3SZIA 5HTDA 2IZKA 3STNA 1PM1X 3HWFA 1BLRA 1IKJA 1HMTA 2BT9A 2G7BA 4U8UO 1G7NA 1MEPA 2RTEB 1SWNA 5B29A 2P8GA 2JU8A 5IRAA 1S2PA 3L4RA 1ACDA 4C5PA 3PPTA 3NX2A 3T6FA 1EPAA 2IZDB 1FDQA 1O8VA 5AQ6A 4D6AA 4DMOA 2GTLM 2ACPX 1S44A 3KFGA 1VWRB 1X8QA 3SZJA 5HAEA 3WJCA 2R73A 2YMSA 1YUPA 4IABA 4U46A 1BSYA 1VWHB 1L6MA 2LB6A 1SRFA 1SWGA 2IZBA 2FT9A 4NNSA 1VWGB 5HZ9A 1LELA 3PECA 3WVMA 1MK5A 4I9RA 3ZW1A 4CDFA 1YIVA 3U9PC 1K24A 2RTKA 3WYQA 1SWEA 1ZNHA 1AQBA 1OSPO 2JGSA 5B5FA 2RTJA 1PTSA 3AKMA 2UYWA 1WUBA 2BLGA 2PY1A 1VWQB 2Q9SA 4IBAA 2GTLO 2RTCB 2FKGA 2Z4HA 4TKJA 4BX5B 2IFBA 3D9WA 3I17A 4YBPA 1N0SA 4A8ZA 5EEEA 2A8GA 4CPHA 3VG7A 1SY2A 3APUA 4GJVA 5EPQA 2OY5O 3NADA 1DC9A 4OS0A 4DQ3A 3P6GA 2EU7X 3FEPA 2RTLA 4U8UM 1AVDA 3PDFA 1DF3A 1NP1A 4GJSA 4O3WA 1ERXA 2OVSA 4IB6A 4EEJA 4GGTA 3TF6A 3WYPA 4I60A 5HZ8A 2AT3X 5FQ8E 3HWDA 1BM5A 3KFHA 1KT3A 2DM5A 1CBIA 2CBRA 1VPRA 2CM9A 2OY7A 3WBGA 1SXYA 5K68A 1CRBA 3FIQA 1LDOA 3P6DA 4LKTA 3BY0A 1B4MA 4TKHA 5IRWA 4CK4A 1X8UA 1NQNA 2GTFX 3BSZE 4YMYA 5LJDA 3LTWA 4NV8A 2GTLN 3O22A 3BLGA 3RSWA 3S5XA 4TLJA 4Y0PA 3WOVA 1HMRA 5BVQA 4CSBA 2MO5A 4CDCA 4Z2PA 3NQKA 1HQQA 5L3YA 1LICA 3APWA 2QMIA 3D96A 1SY1A 4MISA 5HWZA 1B0OA 3FR4A 4O4UA 1NGLA 2O62A 3JS1A 4YCHA 3ZW0B 3VHMA 3T2WA 3FA9A 5BYPA 5JD2A 1CBRA 3FELA 2A2UA 4OEMA 3RKGA 1E02A 2X8TA 2M4LA 3Q34A 4NLIA 1I04A 3FA6A 4GGZA 1SWOA 4DQ4A 4GZVA 3DTQA 4O3ZA 1I78A 2OFRX 3ZUIA 4O49A 1SXWA 1SWJA 2OY8A 3HPEA 1VWAB 4QYPA 5B2AO 4EQAC 1FJ1E 3B2HA 1GXAA 4QGVA 4ODDA 5H9AA 4Y0RA 2FWVA 2RTHB 2RA6A 1RSUB 5K06A 5D48A 4RUNA 4GETA 2RCTA 3F8AA 4QYNA 4CV7A 1ZNDA 2ASNX 2QOMA 1U17A 4U8UN 1RBPA 2Q4NA 1GT5A 2ACOA 1HN2A 1GT1A 3CQNA 1VYGA 3RDUA 1Y9LA 3S5VA 2Z4IA 4I3BA 2VFCA 3SAOA 1SWQA 1E5PA 3VHIA 4ZGFA 4HPAA 3RDMA 4AW8A 1UYNX 3FA8A 3HOEA 3WZOA 1HXLA 1SY0A 2AT5X 2CBSA 1G85A 3ELXA 4KT5A 3ZW1B 1B8EA 3D4RA 2WQ9A 4M6SA 1KT5A 2K23A 4HFOA 4M7MA 2RTDB 1SRJA 3SLJA 5F1EA 3V8UA 4U3QA 1GKAB 1EIIA 1Z24A 4AZNA 1YWDA 4BOEA 2WEXA 2Y32A 4XMFA 5CSEA 3VU1A 1D3SA 4EFGA 3G7XA 4XMGA 3JQOA 2RTNB 1ADLA 3ZUOA 2FR2A 1ALBA 1ICMA 1QY2A 2Q39A 2RTAA 4JNJA 3EW1A 5HTEA 1E00A 1LIEA 1QABE 1QFVA 5FAZA 3TZSA 1NC9A 1TOWA 4YKMA 4QNIA 3KFFA 2JMBA 4FGIB 1LKEA 3EMMA 1GX9A 1FE3A 3WJDA 4EXZA 2HZRA 4YH0A 3FW5A 4AZOA 1RSTB 3FMZA 3D95A 1PBOA 2C4IA 2OZQA 1ZNLA 4NV7A 2OF8A 3K3LA 1I4UA 1BJ7A 5IO7A 1IIUA 1SLEB 4QGWA 1GT3A 1EIOA 3NR3A 5D4AA 4NYRA 3STKA 2IZIA 1MDCA 1SWUA 2IZEB 4JHQA 3STMX 1DFVA 1LNMA 5C0NA 5H9LA 2A5CA 2CM4A 3VE1A 1LF7A 4ORXA 3FW4A 2XKLA 2PI3O 3OD9A 4TJZA 2A2GA 2W2FA 3SZHA 3TGAA 1X8OA 1GKAA 5H9NA 2W2AA 4GNYA 4FBRA 5LJCA 1OEKA 4YFQA 4DCBA 4WFVA 2GJ5A 5L8OA 2G79A 1MVGA 1KT7A 4CDEA 2UZ2A 1JMZA 2BS5A 2G5LA 2WUTA 1MX8A 4GU8A 3CKGA 1RXKA 4UU3A 3WJGA 4ID2A 1LFOA 4BQUA 2AT0X 2GH7A 5HZ6A 1DF8A 1HXZA 4ON1A 1IFCA 3RZYA 1SWPA 3RDSA 2R56A 1Y53X 4EDEA 2IZLB 5FFHA 1X71A 4IB9A 4YFPA 4GE1A 4LZVA 2BC3A 1X89A 3FEKA 4CPFA 3E3CA 3QKGA 1UREA 1RLBE 3UEWA 4ALBA 1SRIA 2RD7C 4BX7B 5F6ZA 4ZFXA 4GDZA 4O3YA 4IB7A 3LV4A 4QGXA 2L67A 1A3YA 1CBQA 3T2XA 4Z28A 4EKVA 1G74A 1STSB 3P24A 2A3FX 3CQRA 2FHNX 4NP1A 2QM9A 1EW3A 4BJ8A 3PQUA 4BGFA 2LBAA 3KZAA 2BSZA 1YP6A 1OPAA 4RUUA 1KOIA 3BDRA 1TOUA 3D97A 1KZWA 5HZ5A 1O1VA 3VE2A 4CDDA 1KL4A 3KQ0A 1QQSA 3HTYA 3PP6A 2L68A 1FTPA 4KC8A 3PK2A 2CZUA 2HLVA 1SWCA 4FBOA 3TGBA 1EQDA 4BX6B 1TW4A 5FENA 5CYBA 5AJBA 1KL3A 2N93A 1KT4A 2QOSC 3MBTA 1LCZA 2NP1A 1AVEA 1SLGB 3O2YA 4LZUA 2RTMA 3CBSA 1T8VA 4O4XA 1T68X 3P6CA 4K19A 3WZNA 2L5PA 4TQ2A 1W4TA 1LIFA 4GKCA 4OKAA 1EXSA 3CKFA 4UU2A 4TNNA 1SMPI 2C1QA 1JZUA 2E4JA 3MX7A 5KHPA 1CJ5A 4Z2OA 1S7DA 1SLFB 3FDCA 3EBKA 5F7GA 2RTOB 2RTPB 4NW4A 1TXLA 5CHKA 2IZGB 4WBKA 1SREA 4U9CA 2RTBB 2KTDA 3RDOA 2IZJA 3Q6LA 2FR3A 1VWBB 1N43A 1IW2A 5HA1A 2CZTA 2ZAGA 4CPIA 4Y59A 4A60A 1BSOA 1N9YA 4OMWA 1Y55X 3MVFA 2WWPA 4MIRA 5HA0A 1JJJA 1YWBA 3NX1A 2WPUA 1SWDA 4Z6JA 2CAMA 2F09A 3ZI8A 2VFBA 2I5VO 3B2KA 4HPBA 2POAA 3DSZA 5AJCA 3P02A 1KL5A 3T6LA 5H9KA 1JMXA 2AL0X 5D8JA 1SWFA 1SWBA 3OE3A 2XSTA 1NBXA 1NQMA
chains in the Genus database with same CATH topology
2AIMA 2JQGR 4B55A 5JH3A 4BS6A 2DCCA 1QDQA 3HWNA 3PNRA 1GX3A 2VHSA 1NB3A 4DMXA 2FRQA 4Q8HA 1POPA 1VJVA 3TNXA 4QBBA 1SNKA 1XKGA 3H7DA 1PIPA 2F1GA 2CB5A 3P5WA 5EF4A 3LXSA 4OELA 2E02A 2AUXA 1MEMA 2DC7A 5K16A 1SP4B 4ZUXU 1AIMA 3BCNA 2IPPB 4AXLA 3OF8A 2ACTA 1AYWA 1Y4HA 3KSEA 3N3GA 3OISA 1ATKA 5CVNB 3MTNA 2DC8A 3OVXA 1W5RA 4CDDB 2DC9A 3BWKA 1S4VA 2OP3A 3IEJA 1U9VA 1VSNA 2YJ2A 4FIPA 4X6IA 1BGOA 2R9OA 3RVWA 1QOLA 1YK8A 4P6GA 2B1NA 1PE6A 4RY2A 4DMYA 2HHNA 2HH5A 1PPNA 2HXZA 3P5XA 3F5VA 1K3BB 2FO5A 1AU0A 2DJGB 3CBKA 3N4CA 3KWZA 2P86A 3P5UA 2C0YA 1E2TA 1MS6A 3NHEA 1KXRA 4W4UA 1NPZA 3MORA 2YJ9A 4N4ZA 1DEUA 3IUTA 3H6SA 3IMAA 4GUZA 2DCBA 2BDLA 3ZUAA 1Y08A 2FT2A 2GHUA 1F2BA 1THEA 1NB5A 1M6DA 5J94A 4MZSA 4CDFB 2NQAA 1GECE 3IV2A 2Y6EA 1FH0A 4YYUA 5PADA 1AECA 3H8BA 2XU1A 1PPDA 3RVVA 1STFE 2HD5A 3B79A 1U9QX 2OULA 1EWPA 1TU6A 3F75A 1U5IA 6PADA 1JQPA 3BC3A 1W6FA 2H7JA 5JA7A 1CQDA 1CS8A 3CH3X 2Y5BA 2DZYA 2CIOA 2R9CA 1EWLA 1F2CA 2PBHA 1ZCMA 3E1ZB 1F29A 5CVOB 1U9XA 3S3QA 4YYQA 4PADA 4I07A 1X9YA 3K8UA 8PCHA 1NL6A 2FQ9A 3CH2X 1KFXL 5CHVA 3IOQA 2R6NA 3ERVA 3BOWA 1U9WA 7PCKA 4C5PA 1YVBA 1DF0A 2PREA 1CB5A 1ME4A 2G6DA 4N79A 4PP1A 2E03A 3WXGA 4FK5A 3QJ3A 1YALA 1KFUL 2DCDA 3O0UA 3BPMA 1AYVA 3D9WA 3I3TA 3KWBX 5CVMA 2AU1A 2E01A 3PDFA 2GFOA 4BSQA 2FYEA 9PAPA 2AYOA 2R9NA 3KW9A 2F7DA 2YJBA 4XR7A 2XU3A 3K24A 1GLOA 3O1GA 4BQVA 3D6SA 2BDZA 1MEGA 4YVAA 1MHWA 3LTWA 4NV8A 2DZZA 3USVA 3CBJA 3IHPA 4XUIA 1PBHA 2JQFR 4QRXA 2FUDA 4W5CA 4OEMA 3KX1A 4HWYA 1PXVA 4PI3A 2IBIA 1YT7A 3H89A 1PPOA 5A24A 1CSBB 3BPFA 2YJ8A 2OZ2A 3HHIA 3I06A 2VFCA 4BPVA 2NQGA 4W5BA 4I04A 4QRVA 3PBHA 1AU3A 1F2AA 4X6HA 2ARYA 4YYWA 2ATOA 1HUCB 2DC6A 2G7YA 2DCAA 5F02A 1ZIVA 5CHTA 2AVWA 2NQDB 1MDWA 5EGWA 2G8EA 2PNSA 2E00A 3H8CA 2XU5A 3OF9A 3S3RA 1CTEA 1KHQA 3KFQA 3C9EA 2DJFB 1IWDA 2VHFA 1QXPA 4NV7A 4FJCA 2P7UA 3RVXA 1ME3A 4AXMA 3WXEA 3HHAA 3QSDA 2FRAA 1CPJA 4QH6A 3KKUA 2WBFX 2AS8A 4YYSA 1EWMA 2AYNA 3MHHA 3PW3A 2O6XA 4N8WA 2P0RA 3V6EA 4YYRA 2YJCA 2XU4A 4BS5A 1ICFA 1AU4A 2AUZA 4Q8GA 1EF7A 1Q6KA 4MZOA 1PPPA 3OVZA 1MIRA 2FTDA 3K9MA 3MHSA 1BY8A 1YK7A 3U8EA 4KLBA 5FPWA 4BGFA 3GCBA 4I05A 3QT4A 2BSZA 4P6EA 1EWOA 1PADA 2PADA 4CZWA 4G54A 4QRGA 4PP2E 1CVZA 2G8JA 1GCBA 1AYUA 1GMYA 3DF0A 2NQIA 1TLOA 4YYVA 1TL9A 4K7CA 1W4TA 4MSXA 4CDCB 4WA6A 2R9MA 3LFYA 3AI8A 1QMYA 4YV8A 1KHPA 4X6JA 1PCIA 3HD3A 1NQCA 4CDEB 1NLJA 1O0EA 2R9FA 1BQIA 1A6RA 1CJLA 1BP4A 3WXFA 3N3KA 2VFBA 1ITOA 2B1MA 1AU2A 3P5VA 3M99A 3V6CA 1CV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGF A;  2VFC A;  4C5P A;  3LTW A;  1E2T A;  2BSZ A;  4NV8 A;  1W6F A;  4B55 A;  1W5R A;  1W4T A;  2VFB A;  3D9W A;  4GUZ A;  4NV7 A;  1GX3 A; 
#chains in the Genus database with same CATH topology
 2BS6 A;  3C77 X;  1FEN A;  3O19 A;  4YBU A;  1XCA A;  1X8N A;  4AZQ A;  1GT4 A;  4CPH B;  2Q2M A;  1NDJ A;  4B55 A;  1DZJ A;  1DZK A;  3VGW A;  3H3I A;  5K67 A;  1HBQ A;  5F58 A;  3RWX A;  3EC5 A;  3RY2 A;  2BHV A;  1K3B A;  4ARH A;  1ZRY A;  4A1H A;  4COT A;  5LKF A;  4I9S A;  3U03 A;  2OL6 O;  1RXH A;  5IO5 A;  4ES7 A;  2JN3 A;  2QO4 A;  3AUM O;  4ORU A;  4LQZ A;  2IZA A;  4QAE A;  1BSQ A;  3WZQ A;  2LFO A;  1GX3 A;  4GDA A;  1UYO X;  1BRQ A;  1H91 A;  5KIC A;  5D45 A;  4IMO A;  5L8I A;  1LUQ A;  2G8C O;  2GC9 A;  4XMH A;  1SWT A;  4YGG A;  1IJ8 A;  4KII A;  5EDC A;  4AYH A;  1MX7 A;  2OYB O;  3P6E A;  1UZ2 X;  4PSQ A;  4I95 A;  4BCS A;  5HZQ A;  1SXU A;  4DNE A;  1SWK A;  2AMM X;  3FR2 A;  1LPJ A;  2C1S A;  3BU1 A;  5EZ2 A;  1QWD A;  3S60 A;  4AZM A;  2FKJ A;  2FLJ A;  5AEO A;  2OFM X;  1VWF B;  1YWA A;  1P6P A;  1N4J A;  3SOT A;  4I3C A;  1U0X A;  4GGR A;  4PJ2 A;  2RTI B;  4FBV A;  3IFB A;  2AT6 X;  1Y9T A;  4YFR A;  1VWP B;  2MWH A;  2R74 A;  3BS2 A;  3EW2 A;  3HWG A;  4TKB A;  2IZH B;  2FS7 A;  4ZCB A;  2MHD A;  1SRG A;  4OEL A;  3ELZ A;  3NQ3 A;  1OBQ A;  3T1D A;  4ORW A;  4ZHD A;  1EUO A;  1SA8 A;  3HWE A;  4JGL A;  1ZNK A;  3VHH A;  4ZH6 A;  2Y3E A;  2HKD A;  1VWK B;  3P6F A;  4MVL A;  3ZWE A;  4ZR2 A;  2X34 A;  5L8N A;  1YWC A;  1TVQ A;  1VWL B;  1E06 A;  1SWR A;  1LID A;  3CMP A;  3UEX A;  5KID A;  4MEE A;  2HZQ A;  3VG4 A;  1BRP A;  2F01 A;  2NND A;  4HPC A;  4Y5D A;  2DJF A;  3RBY A;  5CE4 A;  2A0A A;  2AVI A;  2ALL X;  4QZU A;  1R0U A;  1IKE A;  1VYO A;  1W5R A;  2FHL A;  4GK9 A;  4ORS A;  2WQA E;  1GM6 A;  4OS8 A;  4FQB B;  4ML7 B;  1AB0 A;  1AVG I;  3BU9 A;  1JYJ A;  3HK1 A;  4GD9 A;  4I3D A;  1B56 A;  4NLJ A;  2MF6 A;  4YKO A;  4ORR A;  1PBY A;  3VG5 A;  4Z2V A;  3AEH A;  2LKK A;  3ZZV A;  4BX6 A;  1STR B;  2RTR B;  4MVI A;  2OL7 A;  4QZT A;  2AT8 X;  3BX7 A;  1OBU A;  3NBX X;  1SWA A;  1QFT A;  2ANS A;  4IMN A;  1DV9 A;  3B2J A;  1D2U A;  1MUP A;  2WEW A;  3B2L A;  4MVE A;  4QQ1 A;  4Y0Q A;  2OL8 O;  2AH7 X;  1MOY A;  1YP7 A;  5LKE A;  3TGC A;  1VWD B;  3PH5 A;  1N9M A;  1RXJ A;  3C78 X;  3CWK A;  4WHI A;  1DZM A;  1CBS A;  2KT4 B;  1QY0 A;  3ZQ3 A;  2RTG B;  1BEB A;  2W2B A;  2HNX A;  3WJE A;  1JYD A;  3PH6 A;  4JO6 A;  5B11 O;  1VWE B;  2F73 A;  3I0A A;  1A2D A;  3FYF A;  1IFB A;  3APX A;  4INN A;  3NQ9 A;  3ZW2 A;  2AKQ A;  3VG2 A;  3UEV A;  2KTS A;  2PFR A;  4GNW A;  1BWY A;  1E2T A;  4IRW A;  4YGH A;  5DPQ A;  3SLT A;  4YCE A;  3UAQ A;  4O4S A;  1KZX A;  2IZC B;  1LCV A;  1OBP A;  3FA7 A;  4GRJ A;  4NNT A;  4ZHH A;  1O1U A;  4L1N A;  1Y0G A;  2Q2P A;  5FQ6 E;  2ZAI A;  3MG5 A;  5JR8 A;  5IXG A;  1ML7 A;  1XKI A;  4YDB A;  4HWM A;  3IA8 A;  4IAX A;  1KQX A;  4L3R A;  1KFF A;  4ZHC A;  5H8T A;  3BX8 A;  2JW1 A;  2RN4 A;  3LHN A;  4AZR A;  4N7C A;  1VWO B;  4YVB A;  3OBL A;  4GUZ A;  5LJK A;  3ZW0 A;  1ZNG A;  4D6B A;  4NYQ A;  2AF5 A;  1MM9 A;  3RY1 A;  3AKN A;  5DG4 A;  1VWM B;  5B3M O;  2X4M A;  3VPJ E;  5F2B A;  1SXX A;  4OS3 A;  1NP4 A;  1X8P A;  3EBW A;  4ZGU A;  2WSJ A;  2OFB A;  2MM3 A;  2OVE A;  4BBO A;  5IO6 A;  4IB8 A;  1VWI B;  1OPB A;  4N7D A;  5B27 A;  1KT6 A;  2FS6 A;  2HMB A;  1VYF A;  2RQ0 A;  4AZP A;  4GH7 A;  2A13 A;  2DJG A;  4R0B A;  5HCD C;  4BX5 A;  1I9H A;  4CPE A;  1KXO A;  2NNQ A;  2VDF A;  1ZNE A;  5EDB A;  1N7Y A;  4O3X B;  1LDQ A;  2FTB A;  1KQW A;  4I6S A;  1GGL A;  1A57 A;  1VWN B;  1SRH A;  1JJU A;  2X56 A;  3CBC A;  1HBP A;  5BVT A;  3B2I A;  5B10 O;  2IZF B;  2OVA A;  1WBI A;  2PQT A;  2X8F A;  2MJI A;  2YG2 A;  4QRL A;  1G5W A;  1PEE A;  4ZHG A;  1AEL A;  1QG5 A;  1KGL A;  3HOL A;  4ZJ0 A;  3UEU A;  3F9D A;  2Y3F A;  2RCQ A;  2X46 A;  4O9S A;  1JV4 A;  3FLL A;  1JQP A;  2A5B A;  2OFA A;  4YGZ A;  5LJG A;  3X00 A;  1DZP A;  2QCB A;  2HYS A;  3WJB A;  1SWS A;  2RTF B;  2JU7 A;  1JJX A;  1W6F A;  4ORY A;  5EED A;  1SY3 A;  1STP A;  2QO5 A;  5B5G A;  3RDQ A;  3EYC A;  3GAQ A;  1ICN A;  2OVD A;  3RE5 A;  3C76 X;  3F6Z B;  3FR5 A;  2L9C A;  3RE6 A;  2NNE A;  3PED A;  1BBP A;  2I5Z O;  3S26 A;  3MM0 A;  4Z27 A;  4KCA A;  4OMX A;  1HQP A;  3WXQ A;  4BX7 A;  4ZHF A;  1JBH A;  5HCE C;  1VWC B;  2ZSC A;  1HY2 A;  3U0D A;  1I05 A;  5F6B A;  1I06 A;  5D47 A;  2K62 A;  2FRS A;  4ZH9 A;  5BVS A;  4WFU A;  1QY1 A;  5HBS A;  2X45 A;  3KVN A;  1OEE A;  1EI5 A;  1ERB A;  4LKP A;  4XME A;  4Y0S A;  5FQ7 E;  3JSQ A;  3LNB A;  3VG3 A;  1Y52 X;  4HPD A;  2G78 A;  2RTQ B;  3EM0 A;  4XMC A;  4A1Y A;  3PQS A;  5LJE A;  1FEM A;  3FID A;  1SWH A;  3KFI A;  3VG6 A;  1T0V A;  2OY1 O;  4IAW A;  1FEL A;  5LJB A;  3NP1 A;  1A18 A;  2IJA A;  1OEJ A;  1VWJ B;  1U18 A;  4MVK A;  3CR6 A;  3APV A;  4BVM A;  1SWL A;  1PMP A;  4XMD A;  1LCW A;  2JU3 A;  4O4O A;  1JIW I;  2LBV A;  2OF9 A;  2X32 A;  1EAL A;  3BRN A;  3RDX A;  2KW1 A;  3WJF A;  5LJH A;  2QO6 A;  3P6H A;  3FEN A;  3WZP A;  1RAV A;  5IRU A;  1GX8 A;  3QQ2 A;  5HCC C;  4YDA A;  2X8S A;  2LA7 A;  1SLD B;  1HMS A;  1LIB A;  3OJY C;  3SLO A;  1EPB A;  4KH8 A;  3N91 A;  2WR6 A;  2KD2 A;  2JOZ A;  2FGS A;  2X55 A;  3NPO A;  4ALO A;  3GE2 A;  4KC7 A;  3SZI A;  5HTD A;  2IZK A;  3STN A;  1PM1 X;  3HWF A;  1BLR A;  1IKJ A;  1HMT A;  2BT9 A;  2G7B A;  4U8U O;  1G7N A;  1MEP A;  2RTE B;  1SWN A;  5B29 A;  2P8G A;  2JU8 A;  5IRA A;  1S2P A;  3L4R A;  1ACD A;  4C5P A;  3PPT A;  3NX2 A;  3T6F A;  1EPA A;  2IZD B;  1FDQ A;  1O8V A;  5AQ6 A;  4D6A A;  4DMO A;  2GTL M;  2ACP X;  1S44 A;  3KFG A;  1VWR B;  1X8Q A;  3SZJ A;  5HAE A;  3WJC A;  2R73 A;  2YMS A;  1YUP A;  4IAB A;  4U46 A;  1BSY A;  1VWH B;  1L6M A;  2LB6 A;  1SRF A;  1SWG A;  2IZB A;  2FT9 A;  4NNS A;  1VWG B;  5HZ9 A;  1LEL A;  3PEC A;  3WVM A;  1MK5 A;  4I9R A;  3ZW1 A;  4CDF A;  1YIV A;  3U9P C;  1K24 A;  2RTK A;  3WYQ A;  1SWE A;  1ZNH A;  1AQB A;  1OSP O;  2JGS A;  5B5F A;  2RTJ A;  1PTS A;  3AKM A;  2UYW A;  1WUB A;  2BLG A;  2PY1 A;  1VWQ B;  2Q9S A;  4IBA A;  2GTL O;  2RTC B;  2FKG A;  2Z4H A;  4TKJ A;  4BX5 B;  2IFB A;  3D9W A;  3I17 A;  4YBP A;  1N0S A;  4A8Z A;  5EEE A;  2A8G A;  4CPH A;  3VG7 A;  1SY2 A;  3APU A;  4GJV A;  5EPQ A;  2OY5 O;  3NAD A;  1DC9 A;  4OS0 A;  4DQ3 A;  3P6G A;  2EU7 X;  3FEP A;  2RTL A;  4U8U M;  1AVD A;  3PDF A;  1DF3 A;  1NP1 A;  4GJS A;  4O3W A;  1ERX A;  2OVS A;  4IB6 A;  4EEJ A;  4GGT A;  3TF6 A;  3WYP A;  4I60 A;  5HZ8 A;  2AT3 X;  5FQ8 E;  3HWD A;  1BM5 A;  3KFH A;  1KT3 A;  2DM5 A;  1CBI A;  2CBR A;  1VPR A;  2CM9 A;  2OY7 A;  3WBG A;  1SXY A;  5K68 A;  1CRB A;  3FIQ A;  1LDO A;  3P6D A;  4LKT A;  3BY0 A;  1B4M A;  4TKH A;  5IRW A;  4CK4 A;  1X8U A;  1NQN A;  2GTF X;  3BSZ E;  4YMY A;  5LJD A;  3LTW A;  4NV8 A;  2GTL N;  3O22 A;  3BLG A;  3RSW A;  3S5X A;  4TLJ A;  4Y0P A;  3WOV A;  1HMR A;  5BVQ A;  4CSB A;  2MO5 A;  4CDC A;  4Z2P A;  3NQK A;  1HQQ A;  5L3Y A;  1LIC A;  3APW A;  2QMI A;  3D96 A;  1SY1 A;  4MIS A;  5HWZ A;  1B0O A;  3FR4 A;  4O4U A;  1NGL A;  2O62 A;  3JS1 A;  4YCH A;  3ZW0 B;  3VHM A;  3T2W A;  3FA9 A;  5BYP A;  5JD2 A;  1CBR A;  3FEL A;  2A2U A;  4OEM A;  3RKG A;  1E02 A;  2X8T A;  2M4L A;  3Q34 A;  4NLI A;  1I04 A;  3FA6 A;  4GGZ A;  1SWO A;  4DQ4 A;  4GZV A;  3DTQ A;  4O3Z A;  1I78 A;  2OFR X;  3ZUI A;  4O49 A;  1SXW A;  1SWJ A;  2OY8 A;  3HPE A;  1VWA B;  4QYP A;  5B2A O;  4EQA C;  1FJ1 E;  3B2H A;  1GXA A;  4QGV A;  4ODD A;  5H9A A;  4Y0R A;  2FWV A;  2RTH B;  2RA6 A;  1RSU B;  5K06 A;  5D48 A;  4RUN A;  4GET A;  2RCT A;  3F8A A;  4QYN A;  4CV7 A;  1ZND A;  2ASN X;  2QOM A;  1U17 A;  4U8U N;  1RBP A;  2Q4N A;  1GT5 A;  2ACO A;  1HN2 A;  1GT1 A;  3CQN A;  1VYG A;  3RDU A;  1Y9L A;  3S5V A;  2Z4I A;  4I3B A;  2VFC A;  3SAO A;  1SWQ A;  1E5P A;  3VHI A;  4ZGF A;  4HPA A;  3RDM A;  4AW8 A;  1UYN X;  3FA8 A;  3HOE A;  3WZO A;  1HXL A;  1SY0 A;  2AT5 X;  2CBS A;  1G85 A;  3ELX A;  4KT5 A;  3ZW1 B;  1B8E A;  3D4R A;  2WQ9 A;  4M6S A;  1KT5 A;  2K23 A;  4HFO A;  4M7M A;  2RTD B;  1SRJ A;  3SLJ A;  5F1E A;  3V8U A;  4U3Q A;  1GKA B;  1EII A;  1Z24 A;  4AZN A;  1YWD A;  4BOE A;  2WEX A;  2Y32 A;  4XMF A;  5CSE A;  3VU1 A;  1D3S A;  4EFG A;  3G7X A;  4XMG A;  3JQO A;  2RTN B;  1ADL A;  3ZUO A;  2FR2 A;  1ALB A;  1ICM A;  1QY2 A;  2Q39 A;  2RTA A;  4JNJ A;  3EW1 A;  5HTE A;  1E00 A;  1LIE A;  1QAB E;  1QFV A;  5FAZ A;  3TZS A;  1NC9 A;  1TOW A;  4YKM A;  4QNI A;  3KFF A;  2JMB A;  4FGI B;  1LKE A;  3EMM A;  1GX9 A;  1FE3 A;  3WJD A;  4EXZ A;  2HZR A;  4YH0 A;  3FW5 A;  4AZO A;  1RST B;  3FMZ A;  3D95 A;  1PBO A;  2C4I A;  2OZQ A;  1ZNL A;  4NV7 A;  2OF8 A;  3K3L A;  1I4U A;  1BJ7 A;  5IO7 A;  1IIU A;  1SLE B;  4QGW A;  1GT3 A;  1EIO A;  3NR3 A;  5D4A A;  4NYR A;  3STK A;  2IZI A;  1MDC A;  1SWU A;  2IZE B;  4JHQ A;  3STM X;  1DFV A;  1LNM A;  5C0N A;  5H9L A;  2A5C A;  2CM4 A;  3VE1 A;  1LF7 A;  4ORX A;  3FW4 A;  2XKL A;  2PI3 O;  3OD9 A;  4TJZ A;  2A2G A;  2W2F A;  3SZH A;  3TGA A;  1X8O A;  1GKA A;  5H9N A;  2W2A A;  4GNY A;  4FBR A;  5LJC A;  1OEK A;  4YFQ A;  4DCB A;  4WFV A;  2GJ5 A;  5L8O A;  2G79 A;  1MVG A;  1KT7 A;  4CDE A;  2UZ2 A;  1JMZ A;  2BS5 A;  2G5L A;  2WUT A;  1MX8 A;  4GU8 A;  3CKG A;  1RXK A;  4UU3 A;  3WJG A;  4ID2 A;  1LFO A;  4BQU A;  2AT0 X;  2GH7 A;  5HZ6 A;  1DF8 A;  1HXZ A;  4ON1 A;  1IFC A;  3RZY A;  1SWP A;  3RDS A;  2R56 A;  1Y53 X;  4EDE A;  2IZL B;  5FFH A;  1X71 A;  4IB9 A;  4YFP A;  4GE1 A;  4LZV A;  2BC3 A;  1X89 A;  3FEK A;  4CPF A;  3E3C A;  3QKG A;  1URE A;  1RLB E;  3UEW A;  4ALB A;  1SRI A;  2RD7 C;  4BX7 B;  5F6Z A;  4ZFX A;  4GDZ A;  4O3Y A;  4IB7 A;  3LV4 A;  4QGX A;  2L67 A;  1A3Y A;  1CBQ A;  3T2X A;  4Z28 A;  4EKV A;  1G74 A;  1STS B;  3P24 A;  2A3F X;  3CQR A;  2FHN X;  4NP1 A;  2QM9 A;  1EW3 A;  4BJ8 A;  3PQU A;  4BGF A;  2LBA A;  3KZA A;  2BSZ A;  1YP6 A;  1OPA A;  4RUU A;  1KOI A;  3BDR A;  1TOU A;  3D97 A;  1KZW A;  5HZ5 A;  1O1V A;  3VE2 A;  4CDD A;  1KL4 A;  3KQ0 A;  1QQS A;  3HTY A;  3PP6 A;  2L68 A;  1FTP A;  4KC8 A;  3PK2 A;  2CZU A;  2HLV A;  1SWC A;  4FBO A;  3TGB A;  1EQD A;  4BX6 B;  1TW4 A;  5FEN A;  5CYB A;  5AJB A;  1KL3 A;  2N93 A;  1KT4 A;  2QOS C;  3MBT A;  1LCZ A;  2NP1 A;  1AVE A;  1SLG B;  3O2Y A;  4LZU A;  2RTM A;  3CBS A;  1T8V A;  4O4X A;  1T68 X;  3P6C A;  4K19 A;  3WZN A;  2L5P A;  4TQ2 A;  1W4T A;  1LIF A;  4GKC A;  4OKA A;  1EXS A;  3CKF A;  4UU2 A;  4TNN A;  1SMP I;  2C1Q A;  1JZU A;  2E4J A;  3MX7 A;  5KHP A;  1CJ5 A;  4Z2O A;  1S7D A;  1SLF B;  3FDC A;  3EBK A;  5F7G A;  2RTO B;  2RTP B;  4NW4 A;  1TXL A;  5CHK A;  2IZG B;  4WBK A;  1SRE A;  4U9C A;  2RTB B;  2KTD A;  3RDO A;  2IZJ A;  3Q6L A;  2FR3 A;  1VWB B;  1N43 A;  1IW2 A;  5HA1 A;  2CZT A;  2ZAG A;  4CPI A;  4Y59 A;  4A60 A;  1BSO A;  1N9Y A;  4OMW A;  1Y55 X;  3MVF A;  2WWP A;  4MIR A;  5HA0 A;  1JJJ A;  1YWB A;  3NX1 A;  2WPU A;  1SWD A;  4Z6J A;  2CAM A;  2F09 A;  3ZI8 A;  2VFB A;  2I5V O;  3B2K A;  4HPB A;  2POA A;  3DSZ A;  5AJC A;  3P02 A;  1KL5 A;  3T6L A;  5H9K A;  1JMX A;  2AL0 X;  5D8J A;  1SWF A;  1SWB A;  3OE3 A;  2XST A;  1NBX A;  1NQM A; 
#chains in the Genus database with same CATH homology
 2AIM A;  2JQG R;  4B55 A;  5JH3 A;  4BS6 A;  2DCC A;  1QDQ A;  3HWN A;  3PNR A;  1GX3 A;  2VHS A;  1NB3 A;  4DMX A;  2FRQ A;  4Q8H A;  1POP A;  1VJV A;  3TNX A;  4QBB A;  1SNK A;  1XKG A;  3H7D A;  1PIP A;  2F1G A;  2CB5 A;  3P5W A;  5EF4 A;  3LXS A;  4OEL A;  2E02 A;  2AUX A;  1MEM A;  2DC7 A;  5K16 A;  1SP4 B;  4ZUX U;  1AIM A;  3BCN A;  2IPP B;  4AXL A;  3OF8 A;  2ACT A;  1AYW A;  1Y4H A;  3KSE A;  3N3G A;  3OIS A;  1ATK A;  5CVN B;  3MTN A;  2DC8 A;  3OVX A;  1W5R A;  4CDD B;  2DC9 A;  3BWK A;  1S4V A;  2OP3 A;  3IEJ A;  1U9V A;  1VSN A;  2YJ2 A;  4FIP A;  4X6I A;  1BGO A;  2R9O A;  3RVW A;  1QOL A;  1YK8 A;  4P6G A;  2B1N A;  1PE6 A;  4RY2 A;  4DMY A;  2HHN A;  2HH5 A;  1PPN A;  2HXZ A;  3P5X A;  3F5V A;  1K3B B;  2FO5 A;  1AU0 A;  2DJG B;  3CBK A;  3N4C A;  3KWZ A;  2P86 A;  3P5U A;  2C0Y A;  1E2T A;  1MS6 A;  3NHE A;  1KXR A;  4W4U A;  1NPZ A;  3MOR A;  2YJ9 A;  4N4Z A;  1DEU A;  3IUT A;  3H6S A;  3IMA A;  4GUZ A;  2DCB A;  2BDL A;  3ZUA A;  1Y08 A;  2FT2 A;  2GHU A;  1F2B A;  1THE A;  1NB5 A;  1M6D A;  5J94 A;  4MZS A;  4CDF B;  2NQA A;  1GEC E;  3IV2 A;  2Y6E A;  1FH0 A;  4YYU A;  5PAD A;  1AEC A;  3H8B A;  2XU1 A;  1PPD A;  3RVV A;  1STF E;  2HD5 A;  3B79 A;  1U9Q X;  2OUL A;  1EWP A;  1TU6 A;  3F75 A;  1U5I A;  6PAD A;  1JQP A;  3BC3 A;  1W6F A;  2H7J A;  5JA7 A;  1CQD A;  1CS8 A;  3CH3 X;  2Y5B A;  2DZY A;  2CIO A;  2R9C A;  1EWL A;  1F2C A;  2PBH A;  1ZCM A;  3E1Z B;  1F29 A;  5CVO B;  1U9X A;  3S3Q A;  4YYQ A;  4PAD A;  4I07 A;  1X9Y A;  3K8U A;  8PCH A;  1NL6 A;  2FQ9 A;  3CH2 X;  1KFX L;  5CHV A;  3IOQ A;  2R6N A;  3ERV A;  3BOW A;  1U9W A;  7PCK A;  4C5P A;  1YVB A;  1DF0 A;  2PRE A;  1CB5 A;  1ME4 A;  2G6D A;  4N79 A;  4PP1 A;  2E03 A;  3WXG A;  4FK5 A;  3QJ3 A;  1YAL A;  1KFU L;  2DCD A;  3O0U A;  3BPM A;  1AYV A;  3D9W A;  3I3T A;  3KWB X;  5CVM A;  2AU1 A;  2E01 A;  3PDF A;  2GFO A;  4BSQ A;  2FYE A;  9PAP A;  2AYO A;  2R9N A;  3KW9 A;  2F7D A;  2YJB A;  4XR7 A;  2XU3 A;  3K24 A;  1GLO A;  3O1G A;  4BQV A;  3D6S A;  2BDZ A;  1MEG A;  4YVA A;  1MHW A;  3LTW A;  4NV8 A;  2DZZ A;  3USV A;  3CBJ A;  3IHP A;  4XUI A;  1PBH A;  2JQF R;  4QRX A;  2FUD A;  4W5C A;  4OEM A;  3KX1 A;  4HWY A;  1PXV A;  4PI3 A;  2IBI A;  1YT7 A;  3H89 A;  1PPO A;  5A24 A;  1CSB B;  3BPF A;  2YJ8 A;  2OZ2 A;  3HHI A;  3I06 A;  2VFC A;  4BPV A;  2NQG A;  4W5B A;  4I04 A;  4QRV A;  3PBH A;  1AU3 A;  1F2A A;  4X6H A;  2ARY A;  4YYW A;  2ATO A;  1HUC B;  2DC6 A;  2G7Y A;  2DCA A;  5F02 A;  1ZIV A;  5CHT A;  2AVW A;  2NQD B;  1MDW A;  5EGW A;  2G8E A;  2PNS A;  2E00 A;  3H8C A;  2XU5 A;  3OF9 A;  3S3R A;  1CTE A;  1KHQ A;  3KFQ A;  3C9E A;  2DJF B;  1IWD A;  2VHF A;  1QXP A;  4NV7 A;  4FJC A;  2P7U A;  3RVX A;  1ME3 A;  4AXM A;  3WXE A;  3HHA A;  3QSD A;  2FRA A;  1CPJ A;  4QH6 A;  3KKU A;  2WBF X;  2AS8 A;  4YYS A;  1EWM A;  2AYN A;  3MHH A;  3PW3 A;  2O6X A;  4N8W A;  2P0R A;  3V6E A;  4YYR A;  2YJC A;  2XU4 A;  4BS5 A;  1ICF A;  1AU4 A;  2AUZ A;  4Q8G A;  1EF7 A;  1Q6K A;  4MZO A;  1PPP A;  3OVZ A;  1MIR A;  2FTD A;  3K9M A;  3MHS A;  1BY8 A;  1YK7 A;  3U8E A;  4KLB A;  5FPW A;  4BGF A;  3GCB A;  4I05 A;  3QT4 A;  2BSZ A;  4P6E A;  1EWO A;  1PAD A;  2PAD A;  4CZW A;  4G54 A;  4QRG A;  4PP2 E;  1CVZ A;  2G8J A;  1GCB A;  1AYU A;  1GMY A;  3DF0 A;  2NQI A;  1TLO A;  4YYV A;  1TL9 A;  4K7C A;  1W4T A;  4MSX A;  4CDC B;  4WA6 A;  2R9M A;  3LFY A;  3AI8 A;  1QMY A;  4YV8 A;  1KHP A;  4X6J A;  1PCI A;  3HD3 A;  1NQC A;  4CDE B;  1NLJ A;  1O0E A;  2R9F A;  1BQI A;  1A6R A;  1CJL A;  1BP4 A;  3WXF A;  3N3K A;  2VFB A;  1ITO A;  2B1M A;  1AU2 A;  3P5V A;  3M99 A;  3V6C A;  1CV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...