4NVPA

Structure of the cyclic nucleotide-binding domain of hcn4 channel complexed with 7-ch-camp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
200
Chain Sequence
SPMDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Nucleotide Mapping of Hyperpolarization-Activated Cyclic Nucleotide-Gated (HCN) Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 67
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4nvpA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nvpA02
1EY2A 4LLOA 4RD7A 4PJYA 3RPQA 3H3UA 2XKOA 4PIXA 4IESA 3KGZA 1FXZA 3IWZA 3H1YA 4XEZA 3E97A 2ET7A 3RNSA 3SMHA 1IPKA 1UCXA 2BGCA 4EWAA 4BIFA 3WW3A 1RC6A 3O14A 4I0BA 2QJVA 4I0AA 4L11A 4Q29A 3I59A 3SCHA 3QACA 4BHPA 4EWDA 2CAUA 1J3PA 5JSOA 4YYOA 2UY9A 5JAXA 4LUMA 4QXKA 4AQ6A 4F7ZA 2PAEA 4Z82A 3DL3A 2IXKA 1GQHA 2F4PA 5J3UA 5KHGA 1OI6A 5LEJA 2ET1A 3HIFA 4XF9A 4XF1A 1ZRFA 4XFIA 2GC2A 3I7DA 1VR3A 2MNGA 4LUKA 1EP0A 1Y9QA 3L2HA 4MX3A 3S7IA 2N7GA 2PHLA 3EQEA 2IXLA 2PA7A 4KWKA 3SCGA 3RYPA 2OZ6A 4DINB 1UPIA 1SEFA 1ZZ9A 5I8TA 1J58A 2IC1A 2PQQA 1NYWA 4B29A 4O9EA 4QX5A 3H7JA 4JTNA 1X8EA 2XLFA 3CEWA 3KCCA 3I54A 3PLQA 3D0JA 4LTAA 1SFNA 1X82A 1I5ZA 5D1IA 3OF1A 5KHJA 3MDPA 4MV2A 4XFHA 3HT2A 4MGYE 1O3TA 2XL7A 2UY8A 4CYDA 1WLTA 3WW2A 3IDCB 3PVBB 1YWKA 5EFUA 1CAWA 2P17A 4IEXA 5EZWA 2UYBA 2XKPA 1CAXA 4PIZA 4UXAA 4GULA 2MPFA 1DGRA 3LOIA 4IETA 1LKNA 3G7DA 3ES1A 3BPZA 4UBHA 2FQPA 2H6CA 4ZU4A 3OTFA 4FAHA 3ETQA 1DGWA 4IEZA 5I0RA 4MH0E 3ELNA 4KL1A 3D0SA 3NSTA 4JVAA 5BXXA 1OD5A 1UW8A 4IEWA 1ZZCA 3E5QA 3MZHA 2GC1A 4F8AA 2OA2A 5AVPA 1GQGA 2V09A 3LA3A 4HLTA 2HJIA 4K8FA 3M3IA 2Q30A 1YHFA 3I59B 2PAKA 3KSCA 4HBNA 1HW5A 3H50A 2Q1ZB 1RTVA 2QVSB 3SCFA 5JSPA 4ORFA 2UYAA 2IXJA 5KHHA 1UIJA 1ZRDA 1CGPA 2ZCWA 1O5LA 4AVBA 3UKTA 4BH9A 3U10A 4OFGA 4O9GA 3UKNA 1I6XA 1X8MA 3ZDSA 1VJ2A 2Y0OA 3KMHA 2GC3A 5CVRA 4Q0UA 5KHKA 3NW4A 4A2UA 4KU7A 3LA2A 3LA7A 2D5FA 3SHRA 4E2GA 1J3RA 1U12A 1RUOA 5E16A 2WFPA 3GBFA 4MGKE 3VHRA 5KBFA 2PFWA 5E1RA 2HKXA 3C3VA 5F1RA 3BU7A 4Z07A 1ZZBA 1OMIA 4YSFA 3IDBB 2GU9A 1Q5OA 3DV8A 1QWRA 2VECA 4ZU7A 2OZJA 4P9GA 4XFBA 4N9HA 2K0GA 3FZ3A 3WW1A 5CADA 4EWEA 3OCPA 2E9QA 1YFXA 2D93A 3OD0A 3QOPA 4LEJA 5FPXA 3ES4A 2GAUA 2KXLA 4I01A 4JV4A 5FLJA 3R6SA 5I0TA 1FI2A 4QM8A 1DZTA 4XF3A 3E5UA 2QNKA 4KWJA 2H0VA 4MUVA 1J59A 1CAUB 1CAVA 1WGPA 5J7MA 4META 1CAWB 4EV0A 2D5HA 1ZRCA 2IXIA 2XLGA 1TQ5A 4I3PA 4JTOA 4XF4A 3MPBA 3FJSA 2CGPA 3D82A 3E6BA 1ZZ6A 2PYTA 2QDRA 2GC0A 2O1QA 1Y3TA 3JZVA 1ZNPA 4BYYA 4I02A 4XFCA 1O3QA 2VPVA 2XGXA 3IIAA 5FQ0B 1NE6A 4AQ2A 2OYZA 3FX3A 5CU1A 1PMIA 3B02A 4X6QB 3U11A 3IBMA 4QGNA 4HVQA 1RUNA 1UD1A 2CAVA 3S0MA 5FLHA 4KWLA 3NKTA 3NJZA 5I91A 3GYDA 4FBFA 5I0SA 4ZU5A 5BV6A 1H1IA 4XFGA 4FT8A 1YLLA 5LRSA 2C0ZA 3RYKA 4Q0PA 3FE5A 5BUVA 2CV6A 2GH2A 1CX4A 2QCSB 3H8UA 2ETEA 4FAGA 1O5UA 4AVAA 1YFWA 5FLIA 1OFNA 2Z2SB 3OGJA 5FDBA 5I93A 4R8HA 3H1MA 5BPXA 4EROA 2Q4SA 3FWEA 1CAXB 1J3QA 3FHIB 5C8WA 1FT9A 3FFQA 1QY4A 2PHDA 2MHFA 1XE7A 4HZFA 1CAUA 1CAVB 4HMZA 4E2SA 1NZCA 1UIKA 3H1WA 4HVRA 4MGZE 4D7TA 3CLPA 5J48A 4YRDA 4IEQA 4LA3A 1QXRA 5FQ0A 3EBRA 3LAGA 4X6RB 5I8SA 2I45A 2O8QA 3RYRA 1LB2A 2EAAA 3LWCA 4Q0SA 3H7YA 4QM9A 3H9AA 1IPJA 4HN1A 4OLLA 3HQXA 4UBGA 1O3SA 3EO6A 5JSRA 2XHKA 1YUDA 4E2QA 5HI0A 2H6BA 3NVCA 3PNAA 2XL9A 4QMAA 4IEVA 1ZZ8A 2K9ZA 4QGMA 4YARA 4MZUA 5LEKA 3EHKA 1ZREA 3M70A 2B8MA 3NL1A 1NXMA 4LA2A 4Q0QA 1V70A 4AXOA 1L3JA 1VP6A 1H1MA 3ACLA 4HSLA 3E6CC 2IXHA 1O4TA 3WW4A 4H7LA 3RZZA 4J1WA 4N9IA 3MYXA 1RGSA 4L2NA 2ZKLA 5KHIA 1G6NA 1XE8A 1ZVFA 2B5HA 4J1XA 2EA7A 3BALA 2ATFA 3E6DA 1NE4A 4IEOA 3HT1A 2PAMA 2B9UA 1YFUA 2Z69A 1RL3A 1O3RA 1O7FA 1ZZ7A 1ZRRA 4ONUA 3UKVA 3RDIA 1X7NA 5T3NA 2XLAA 2BNNA 5I0UA 3TNPB 3DKWA 1DZRA 2BEOA 5JCTA 3LZZA 4WZCA 5LRRA 2D40A 3BB6A 3CJXA 1J1LA 4PIYA 1Q3EA 4I09A 1YFYA 2VQAA 3BCWA 3TNQA 3KGLA 1WA4A 4XETA 3H3ZA 4XFAA 4MGIE 3SXWA 3ROUA 3USSA 4AVCA 4HSJA 2WC2A 1ZX5A 1Q43A 2FMYA 4Q0VA 4IEPA 3DN7A 4IERA 3CL1A 4D7SA 5C6CA 3N4MA 2BYVE 4QGLA 4HN0A 5FPZA 3CO2A 2GZWA 4HVOA 1EYBA 2OPKA 3ST7A 3CF6E 2IXCA 4IEUA 1JUHA 3E5XA 2EVXA 4TLFA 4XFFA 4NVPA 2Q0AA 4WVZA 5BY5A 3S7EA 2DCTA 1EPZA 4WBBA 2BNOA 4YNIA 5JR7B 1XRUA 4IEYA 5K8SA 1LRHA 1PM7A 2PTMA 5FCCA 4I2OA 4XF0A 4KU8A 5I8YA 3EJKA 3U0ZA 1SQ4A 4R52A 1QXJA 4LULA 2BNMA 1LR5A
chains in the Genus database with same CATH superfamily
2DWDC 4GKKB 1NT2B 4GJZA 3F5TA 3IPVA 3KGZA 1AJOA 2XMLA 3CJIB 3OR6C 4UVAA 2AREA 5JR2A 1WWYA 4P9XA 4LORA 1OF4A 4D6QA 4MO3M 1SACA 2ADEA 5CBLA 5JZGC 3MIDA 3RS6A 1BK0A 4QXKA 5FP4A 5BNPC 3IPVB 1F5JA 4HZ3A 5C8CA 4CS2A 2ZR2A 1F4HA 5FZOB 3J7NA 5T5LA 1M57B 2XTAA 3POFA 4MX3A 1W03A 5JQGA 2K1EA 4G2KA 4BQ1A 2QM8A 2JD4A 1Q6IA 1KD7A 1SEFA 3JCIA 4DR1O 1W2AX 4QGPA 3Q8CA 1F7YA 1GNYA 2JVDA 1X8EA 4PA9A 2E7QA 1SC5B 4X1YB 1RUJ1 4XZUG 2WO7A 1WW6A 3BAAA 4RA0A 1LTEA 1SFNA 1KEXA 1D2DA 3AYDA 4A5UB 3AVSA 4CUAA 3TEXA 5GLVA 1F51A 4TUYB 1QQP2 4Y1UA 4ICGA 1QJEA 1PX4A 4UXAA 4DV4O 2BE3A 1WW4A 5L3BA 3JQWA 4X8AA 1DGRA 3PURA 4FP2A 2FBEA 3ES1A 1NQTA 3LEMA 1NS1A 4HT1T 4AG4A 1J95A 5K0UC 4FAHA 5FYBA 2D6PA 4IXLA 3NSTA 2I07B 1OD5A 4WFBV 2XUEA 1Z5VA 4OMCA 2PYJA 3R4DB 3ABZA 3O1TA 4I4TA 4K8FA 4QPJA 4A42A 1RTVA 1WCSA 2ITDC 4OI2A 2ZEYA 5DDJ2 5FV3A 2RJZA 2OIGA 2YXSA 2WRAA 1VBE2 2HP8A 1X8MA 3OUJA 3K75B 1DZQA 4KH9A 4AFAA 1BLZA 1T6BX 1WBLA 2IW5A 3B8NA 1KU9A 5KHKA 1UZYA 2D6KA 5LYJB 3LPGA 3NNFA 3WY6A 4Y5TA 5CA1B 1SPPB 5GZCA 4RHV2 2YC0A 1XHXA 4CSWA 3IZOA 2W9XA 2VULA 5IVJA 2A7WA 1QLEB 2ZHMA 4AHCA 5T5OA 2H3OA 1TE1B 1HXS2 2AEZA 1S5JA 1RXFA 1JS9A 2KXLA 2CGNA 1VF6A 3O9OA 1XMQB 1GYKA 5J09A 1CAVA 1WGPA 2V72A 1GUIA 4J25A 5D5PA 3VBHC 4CCLA 4PQQA 2BBVA 4DRXA 3ZXGA 1NT0A 1DCSA 3NKGA 3RI9A 1YQ5A 4GALA 2W1SA 1C5IA 3ON7A 2A7AA 2ZX2A 3ZOIA 4BK4A 1OQEA 4AQ2A 4JYBA 4NKGB 3FX3A 3OGVA 1ASJ3 2BSKA 4XAEA 5EBLC 1F8VA 3JASA 1AYM1 4QGNA 1VQ4V 4BQWA 4OHYA 4FLZA 2NZ9A 5H9CA 3NKTA 3E22B 3AZXA 1Q6UA 1QKQA 4XFGA 1QEXA 1PVC3 5IT9N 3GXUA 1HWYA 4XXPA 3ML0A 5FY5A 2HJFC 3ZIAG 4NHXA 4JAVA 1OBNA 5FPBA 2FHRA 3SJCC 5C8WA 1BE3H 1GN6A 4OQ9A 2YUAA 1O4ZA 1PIV1 1W8FA 3VHOA 4UI9L 1B04A 1XB9A 3AZVA 4LA3A 4L8QA 4FFIA 2I45A 1TVKB 3WF4A 5JLVA 1J5EO 1K45A 2X29A 3OPWA 1GV9A 4GH4B 4NXNO 4P9OA 3CRQA 5BR8O 1HDJA 3J9SA 1ENRA 3PNAA 2V4DA 2B8MA 3NL1A 4Q0QA 5IHRA 5A3PA 1J84A 2LS6A 4IT5A 4RHV3 3VZKA 3WW4A 2ZE8A 2WLMA 1ZWIC 4F83A 3I5DA 3CCEV 1XE8A 1K73W 2DVDA 3GHMA 3KT1A 3BALA 3URFA 5EYPB 1GK9A 1AUYA 1U0AA 4J7KA 1VBE3 1LHUA 5CFDA 4NPRA 4PI0A 4KWUA 2R042 2HWE1 5EYPA 2RG4A 5KXBA 1Y76A 3B8MA 3CYOA 4BE3A 2WLKA 1VRH1 5FAXA 4Q4X2 1PO13 4W4LA 1W8UA 1W04A 4BR6A 1F31A 1DK1A 4X66O 4AVTA 4XFAA 2QBXA 1MS1A 5K1PA 2QM7A 2Q8CA 2VMDA 3UQ8A 4NTWA 3WNPA 5C7GA 3H1IH 3CL1A 1GP6A 2KM2A 2R073 4HYOA 1GAXA 4MT8A 4IEUA 2VY0A 4Y1XA 1S0CA 4XMAA 3BA8A 3R66A 1AR82 2E31A 4IW3A 3U75A 3CRMA 3AYAA 1AYN1 4YHHB 2WFF2 3HKCB 1HQLA 4ATFA 1AP6A 4WM7B 2F93B 1A3KA 1Q7YW 3IM0A 3NXSA 1OCCC 1WD3A 2AYHA 4X1IA 5LATA 5JOXA 3SMHA 4TQDA 5A1LA 4RWUA 5FYMA 2E6VA 2VCCA 4ATEA 4YW4A 4WFHA 2NM1A 3E89A 1PIV2 2Y38A 4RSUA 2ZGTA 5F32A 4L11A 4QX8A 4NIHA 1W6MA 3VBFB 4JDOA 1RUF1 3VDBA 2ZGLA 2IJKA 3ZYFA 1OI6A 1KS4A 1QHDA 1BXHA 5JJEB 3DGEA 3K4DA 3OPZA 3NNGA 3PVEA 3UV9A 4X64O 1Q90D 1PZ9A 3SEEA 4DRXB 2IU0A 4B29A 3FD9A 2E3CA 1QF3A 3TN92 1XOYA 4N8MA 5KAIZ 1SQQH 2Y8KA 2ZQMA 3CRCA 5D1IA 3POEA 2VMFA 2ORZA 2DN9A 1XNAA 4FLVA 1EPWA 4UOJA 1YWKA 3AK2A 5LGTA 2NP0A 3RYHA 5IYZB 4J11A 1UN1A 1KITA 4L9BA 4BMEA 3OBAA 3I2OA 1CIYA 1OSGA 4DS0A 3LDBA 4E9KA 3CJIC 3AG4C 2VBBA 3JD4A 5F5QA 4IGPA 2RHPA 2R9RB 1UWWA 4F6RB 1VEWA 2IXJA 1IKQA 3SKVA 5FZ7A 4OFGA 1SDWA 5LL6Y 5DM6V 4O4LB 4R7CA 3KMHA 4LBQA 3L71H 4A2UA 4I0XA 5G05L 2ZHNA 3BKZA 4JGSA 2XPJA 3OGSA 1YYNA 4I9QA 3DCQA 1K5MA 2FB5A 2W6JG 1I9RA 4COVA 1PO22 4ISQA 1RUG2 4YFWA 4DRVA 1JYWA 1QHTA 1NI8A 1CXZB 4QIWF 2SLIA 3QOPA 3WUDA 1VP7A 4LF4O 5HCAA 4GH4C 3RT3C 2H94A 1IVSA 5LMNO 5T52A 3WDTA 4ARXA 1SRYA 4WM8C 2Q6AA 3OTOB 2JWPA 5A3WA 1OV9A 3MPBA 3FYIB 4PI2A 1H8HG 1MVQA 2XJTA 5FYZA 1OXCA 2QQJA 2D2CB 4DR6B 2KA3A 3GCXA 1V6NA 2EXIA 4YGEA 2P6CA 3FL7A 2XH6A 2QDRA 1EV13 3ZMZA 5LY1A 1K9MW 1Q8QA 4BYYA 4BQ4A 3ZFFC 4BIZA 1REDA 1WJZA 1PMIA 4CP0A 1M1KW 5B1AB 3WDVA 3MV01 2P4KA 4TV8A 5FKBA 4C1XA 1RB8G 4DW1A 1M9NA 1MS4A 3NJZA 5DQ0A 4ZZ5A 3N9MA 3ZS8C 5IWAO 1H1IA 1HR0O 5LRSA 3MIGA 1CX4A 2WZPP 2W47A 4Q26A 5FZFA 1V6OA 2OKXA 4O2AA 2IWGB 1NH2D 3NQHA 3H1MA 2QE7G 4DR1B 4LBLA 3NV1A 3VDCA 3JASB 1FT9A 3IFXA 1YIPA 1JZ8A 2Z79A 4PCRA 4D6SA 1UJWB 4QQLA 4MGZE 1TME2 2YPJA 5ABJB 1WCDJ 3E8HA 1UMZA 1TUBB 3MLKA 1VALA 2RDNA 1ZLZA 1I94B 3OG2A 3C7EA 2XHKA 1UQXA 1GN3A 4X8NA 5LEKA 2P2KA 4DV5O 3WP3A 3WF2A 4P02B 5A7WA 1O4TA 5C8YA 3SYPA 3TBDA 2XJPA 4GKYA 4QPGA 1VQNV 2B46X 1H2KA 1VBE1 5DAXA 1YFUA 4ONUA 4UB8Z 1QCEA 3CJIA 4JGYC 3RVHA 1Q8VA 4JZ2A 1OKQA 1VQ6V 4LXLA 2QE3A 3ZHVA 1WCQA 1J1LA 3BCWA 3TNQA 2JIZG 5EHDA 2UXDB 4RN5A 1NR1A 3OUIA 5ERLA 3VL8A 3S3WA 2HBUA 4Q0VA 1Y43B 4IERA 3ZYJB 4BPZA 4D7SA 3QTCA 1XQ8A 3FX7A 1A32A 5C8YB 1EV11 3TN91 3VDAA 3AK3A 4CDUB 4RS5C 2YROA 3VKNA 3OGGA 1V6KA 3ILNA 4Q8LA 5JR7B 1F23A 2LTNA 2A0LA 2BTOA 1EY2A 1XI1A 1AR62 3BVOA 2ZE5A 5E89A 1KD1W 2J1EA 3LSUA 3ZYPA 2PELA 4YYOA 3OBRA 4NMIA 4EN9B 2WAAA 2VOVA 4YG0A 1GQHA 2F4PA 1VBB1 4IL7A 5C5UA 2IU3A 1AYM2 2ET1A 4NRMA 5F9TA 3T2QA 2HVKC 2GDFA 1Y9QA 1VBC3 5IVBA 2VXJA 3EQEA 2YS8A 2JX9A 3MDSA 1D5AA 1N32O 1QJX1 1MS9A 4NPLA 4ZY9A 3CMGA 3B94A 3RN4A 5I8TA 2RS53 1N8RW 4AEDA 4XJAA 3M8AA 1H2LA 4DUYB 4LWSA 2F4LA 1RIRA 1PO21 4G28B 5DABA 2A75A 3JBG2 2ZAHA 3MDPA 1MEC1 4Q1RA 3IMMA 2O57A 1BEV2 2BQPA 4CYDA 3M3OA 1S1AA 1JMKC 2ZIOA 5L3GA 2C9KA 3G7DA 3UJQA 1WLDA 4UBHA 5FZ6A 4ZU4A 4D0QA 3I2IA 1DGWA 2A6WA 3ZFEA 1U97A 4XDKA 2K46A 1WP7A 3VBUA 3AP6A 1A78A 3LA3A 2HHHO 2HJIA 4ZHQA 2JE7A 3D5OA 2UUCO 1O4YA 1Q82W 1WMDA 2A1XA 4CDXC 4WBNA 2GP3A 4MTOA 4CDUA 1VJ2A 2VQUA 3O1PA 1QLEC 1ZX3A 2QKCA 4PA3A 3LIGA 3D36A 3BN6A 4XQDA 2DUPA 3RJ2X 4MGQA 4ET7A 2E7TA 3OMAB 3T2OA 1QJU2 2YU1A 1R6NA 3NR7A 3K77A 5L3EA 2LRPA 2XBO3 2K0GA 1W6NA 4DR2B 1AYN3 3OD0A 1YO8A 3KQ4B 3ES4A 5J98B 5FLJA 2QNKA 2IJJA 2V5DA 5J7MA 1Q86W 4JV5O 1ZRCA 1WD4A 2D7FA 4LC1A 2A6VA 3FKSG 2K2SA 4UFJA 4OI1A 1JYTA 3SPIA 2CWMA 3ZVXA 5HXMA 2PYTA 2CDYA 5LA6B 3HKDA 4JZRA 2VZRA 1MQTC 4OZOA 1UKRA 2ARHA 3LF7A 3OD4A 3LDDA 3IIIA 2AZ0A 5CU1A 1G8WA 3B02A 5IWFA 1XYNA 3AXDA 4RQPC 2F66C 3U11A 1NTKH 1BS3A 4HPKB 2IVIB 2LFRA 1KKDA 4LBQD 4LFAO 2QQVA 2DYRC 3KVAA 5LBBA 1LJ7A 1JU3A 2BWAA 1PL0A 1HB2A 1HJGA 1ODNA 4BIUA 3W59A 5JVDB 1J5EB 1W9YA 1YI9A 4YM2A 1RUH1 4GB33 2MHFA 4HZFA 5FY7A 2LO1A 4NHMA 3QG5A 3N2KB 1UX7A 2VQEB 2Q5TA 5AFBA 1W28A 1Z7S3 2FZ1A 4NAOA 1PNLA 5IK7A 4DB5A 2CTVA 2RE9A 5FXWA 5L36A 1LHVA 1LNSA 3H7YA 4Q4W2 5KWRA 4HN1A 5T55A 4LH7A 5GZGA 3JBG3 4N23A 1ZZ8A 3FBYA 1XNRB 5B1OA 1JCHA 3ZYHA 3A21A 4IDZA 2VMEA 2QTOA 1HLCA 3JARA 1QU7A 4L87A 4XDPA 3IAYA 2GBOA 1H8VA 4PDRA 1G6NA 4J1XA 4X1KB 2QDOA 4MS2A 5C70A 1Y9MA 1TGOA 2B9UA 1R091 4AQTA 3QH7A 4AI1A 5LHGA 1RHI1 3B3QE 2IBZH 4I50A 2XLAA 3SJQC 3VBRC 3AP7A 2XUMA 3DKWA 1XL6A 2BEOA 5F7UA 4JI3O 1FPN1 4O2BA 4LLFA 4FXKB 1G9BA 5EIBD 1RHI3 4WVMB 4DV5B 4MGIE 3RFRA 2WT0A 4YY3B 4TYSA 4DK1A 4MGSA 1JOYA 4IEPA 2CY6A 1UXXX 2OWOA 5FZLA 3GB7C 5C4WB 3NV3A 2Y6GA 3WP5A 3MF6A 1H4HA 4CEWC 1NCQA 4NIAA 1GLHA 5A6XA 1DGRN 5A2QN 4TTGA 3C2UA 3LKJA 1DGSA 4NXMB 3JD0A 3U0ZA 4D8MA 2JB8A 3NWKA 2V1DA 4LULA 4MLOA 2WNVA 1GP5A 4DEVA 1EUTA 2WYSA 1IPKA 4TN7A 1JR9A 2DTYA 2W87A 4Q29A 4YVSC 3VD4A 4H7MA 2OXBA 1ZA7A 4XUPA 2CTWA 1XDCA 1EAH2 1R1A2 3ZMTA 1Z78A 3SPHA 5FO8B 1LOFC 2DWRA 5LGUA 1F35A 3FYEB 1JN2P 1SQFA 4XF9A 4XFIA 2D98A 2HHHB 3WXPA 4BK5A 1VR3A 3GBGA 2GALA 1K7DA 1KXGA 3L2HA 1OLQA 4MXWB 3VBSA 2WNVC 4AI8A 2B5UA 2PHLA 4DINB 1URFA 1VAMA 3J4UH 2R9AA 4B4PA 4B3SB 1NBMG 1NYWA 1K42A 1WAZA 4P00B 3BY6A 1IXMA 3RSJA 3N35A 4JI8B 3A0NA 4CS3A 1MS8A 1VMGA 4YZ1A 1AR4A 1H8EG 2E5LB 2JG9B 1GN4A 4HAMA 1G9DA 1F4NA 1ULOA 1AL22 2FL4A 3BGAA 3RYCA 3PVBB 4B4RA 4Q5OA 1QNYA 2UYBA 1Q8OA 2WNEA 1GH6A 3SYAA 4BU2A 4QPGB 5JI7A 2PN5A 1RUE2 1DQ2A 5FP3A 4DNYA 1FPN2 2ZM6B 3THDA 5FPAA 1NY72 2VNOA 3SNMA 1UX6A 2JICA 2E76B 2XAFA 5LMUB 1XU2A 3WP6A 3Q8BA 4LBQB 3T1MA 5F3GA 4TV9B 1YHFA 1V54C 2UXCB 1V9U3 2DVBA 3SCFA 2R32A 1KP3A 2ZPXA 4FIPC 1JTZX 3FFZA 2D3RA 1T6GC 1AP5A 4O9GA 3T1YB 5CA1A 2AR6A 3N36A 5EJ3A 4N43A 4Y24A 4BWAA 1I0HA 3CCLV 2UU8A 1POV0 1UFIA 3WSOA 1LHOA 3RYFB 3THCA 1OHFA 5F1RA 3W7XA 4X20B 5LHHA 4Z07A 4DO0A 4WVVA 1OVSA 3LSDA 3BODA 2JEMA 1BQPA 3BIWE 2QEXV 4JV4A 3PIJA 2EIKC 2WPDG 3NNJA 4LOSA 3ZYGA 3ZMVA 1V9U1 4CDQC 3V0BA 4DV0B 4PA4A 4XF4A 2VNGA 2CGPA 3X2QB 2GHYA 1HXS1 3OR7C 4ZIBA 3N27A 3VL9A 4EN8B 1TVGA 3O0VA 4XFCA 3E86A 2WLQA 5CZKA 2HEYF 1YI7A 1US6A 1ONAA 2W94A 3WP4A 5BNQA 1DG6A 3TB0A 1W8HA 1DP0A 1IG3A 3BUCA 1NKGA 3W5NA 1APNA 5HCFA 2X7RB 2NNUA 3ZSMA 2WFF1 1EZJA 3ZR5A 3B93A 3T4DA 1ZBE3 1ZBE2 4J9ZB 4JDMA 1SLBA 1MZ6A 3ZKYA 3FFQA 3ZM8A 2RJ2A 1NVPB 3HN1A 1ENVA 3H1LH 5JWPA 3KZIZ 1OOPA 1C4RA 1VBC1 4I50B 4AILC 4MSVA 1H2MA 1Q6HA 5IAVA 4QM9A 1K12A 5FRAA 3KV9A 1IOAA 4WFFA 5ANNA 5FWJA 3MHZA 3PJQA 1NH2B 2WWSA 2E5LO 4KUMA 1L3JA 1H1MA 5BNNA 4I9WA 2AUYA 4HSLA 2YG0A 5CB4A 3RVZA 2XWJB 2WSSG 4H7LA 5CFDB 3ZN6B 4G4FA 1QDCA 2B7YA 2EA7A 3O1SA 1O6UA 1NE4A 4IEOA 4YZ4A 1FV2A 4CH5A 1QDOA 2DCKA 3HB3B 1O3RA 1O7FA 1ZRRA 2OQ6A 4EN7B 4H44B 5BNNC 1VBD1 3ZXFA 2XJQA 5LASA 3H1JH 4KHPB 3JSNA 1XMQO 2J1SA 5KMGB 4K8ZA 2ZGUA 3E2EA 1BEV3 4PIYA 3RZGA 4V1PA 4AGVA 4TZDA 5H9QA 2VZUA 1UOGA 5EIYB 1IDSA 4A6OA 1DDLA 3ABLC 1W8TA 5C6CA 1JU4A 3FBMA 5B4NA 5L9VA 1EYBA 1NKDA 2WFF3 2O14A 2GUZA 2X09A 1R3LC 2PHFA 5EIBC 2WSUA 4EB6A 1IXBA 5ACA1 1FX5A 3JATB 1GTOA 3JARB 2NMNA 2VUAA 2ZDIA 1I08A 4PJYA 1S2KA 2G9ZA 1IS3A 3N7LA 4Y1ZA 4FXGB 1ROPA 2Z5WA 2A70A 4B1LA 2OQ7A 4IHJA 5JXHA 5I0DA 5SV8A 4RO2A 2R7EB 2G19A 3ZHQA 1AL23 2YI8A 5JAXA 3CRAA 4R9CA 2QQPA 2YSUB 3VZOA 1NLRA 2D3SA 3VKFC 5ABJC 3S7IA 3JBG1 1C8NA 4YGCA 3NMBA 1HB4A 3UETA 2ZACA 2RDRA 2QTWB 4Z92B 1ZBA3 4XIOA 3ZX7A 2IC1A 3OM3B 1S0EA 2VRZA 5CAZA 3STLC 2J42A 5IY5C 4N7UA 4OYUA 2E63A 4CDWC 4O4IB 2DV9A 5LA0A 3WVJA 2XL7A 4NWWA 4IEXA 2QQKA 1QXPA 1C5HA 3H9VA 2MPFA 4FFFA 3J8F3 1IS6A 3GWKC 3ZPOA 2KSDA 1Q8IA 2ZGSA 2PHWA 1ZZCA 2XHBA 3WDYA 1PNMA 2VVDA 4PDWB 2DFBA 2HVJC 2JG9A 3ACGA 1OA2A 4LFCB 3HR9A 1YJWV 3BTXA 3VBBA 4LF5B 1XNQO 2FDKA 1CVNA 2Q8EA 3WR0A 2ATKC 4MVTA 3ZLIA 1PVC2 1GWKA 2YV8A 1OH3A 4URAA 4NE9A 4YIOA 2YBPA 1Y74B 4BISA 3HKBB 1NLSA 1RUD2 2YFUA 4W8JA 3ZDSA 3HNBM 1HNZO 2W92A 3DYPA 4OHZA 4YJ2B 2WZ8A 4PQ9A 1ASJ2 3SHRA 5F2SA 5FYCA 1SLTA 3HKBA 4JGZA 4Y22B 4DUZB 2HBTA 4X88A 5IYZA 2VE1A 2UXCO 2V4VA 3VHRA 1TME3 3J7AU 2EAKA 3BU7A 3UYJA 3T1CA 1ZZBA 3DV8A 4UW6A 2YEVB 2ZMKA 4QPWA 4WV8A 1N0NA 4XJ8A 1QQCA 1COV2 5L9RA 5A3OA 2H0VA 4CU9A 2XLGA 2GP5A 4I3PA 3SPGA 3D82A 3I3EA 1BBT1 1W3VA 2UXDO 3E6BA 2A3QA 2DJVA 5A3LA 4UF0A 1O91A 3AM2A 3B40A 2ARAA 4XYXA 5BNOB 2XVGA 3ZFGA 1O3QA 4I02A 1BSMA 2GNTA 5IDJA 4QD2A 2YPDA 5FTTC 4N53C 5AC92 4EKWA 3T0AA 1EV12 4Q4W3 1VBD3 2JIGA 5CA3A 2FD8A 5LW9A 4YW2A 4KWLA 3BCCH 4H13B 2JKBA 5BUVA 4AVSA 3FLRA 1VQ8V 5LP6A 3D3IA 4KBBA 1OF3A 2WO1A 4UFKA 5I93A 4R8HA 4NHYA 1XEQA 2Q8VA 3FHIB 1QY4A 3NAPB 2IH1C 2VCAA 3K5NA 5IVVA 1NZCA 5GZFA 5J2TA 1JOJA 1ULEA 4DXZA 5J48A 4NXNB 4J42A 2HWD3 5FQ0A 1X59A 4A3ZA 3WX5A 4LMFA 1VBB3 1W9WA 3P5BA 1G4YB 2WLJA 4DUVA 2YU2A 4NR1A 2RJLA 5FK7A 2IVJA 5DPNA 2ZABA 4QMAA 2PMWB 4JKKA 1OLMA 4QGMA 5A7WB 1W99A 1IBLO 3B01A 1N33O 1W59A 1AR93 3VHNA 3W58A 1K4DC 3QLQA 4C7UA 3LNMB 2R0HA 4PDWC 4QWNA 1PGL2 4LCUC 2ZOEB 4O7XA 3P32A 1RGSA 2HLDG 2VZVA 2DW4A 5L7OA 3LSQA 1QJFA 2OT7A 2Y33A 3HOBA 2KG7A 2GMEA 3AYCA 1ZZ7A 4FP3A 3ZFEC 4LIVA 1CZSA 1V6IA 3GGLA 3N9QA 3ZFEB 1WPBA 1J1TA 4KQ7A 4DR6O 5KXDA 1IBKB 4O4HB 3POGA 3KWVA 2WC2A 1ZX5A 5D8AB 1N3PA 2KKWA 4YM0A 1JYCA 2BYVE 2YICA 5CIRA 4N43B 1AR1B 3E5XA 2DU0A 1UF2C 3E35A 1ZAUA 4WVZA 5L3DA 1QJY1 5EZYB 4F4LA 2GDSA 2UXXA 5JOYA 4JI4O 1LRHA 4XCBA 3RG0A 3LPFA 5FK8A 4Y1YA 4I2OA 2MEV3 1QXJA 3ZO0B 1LR5A 3A0HZ 5KC5A 5A7OA 1NJIW 2XKOA 5FUPA 2CAZC 4IESA 5IATA 3RNSA 2P6HA 1VMJA 2ZXWB 4DZGA 4BIFA 3F5WC 3APOA 1BT8A 1BVVA 4OHXA 2X5IA 3M99B 3DL3A 1U5ZA 4XAAA 1HN0A 4JI1B 3KCXA 1ZRFA 3K3NA 3STZC 1LUVA 4CP2A 2WT1A 3JSLA 1NCQB 2ZT9B 2VGDA 1AR83 1C1FA 2RS52 4MVOA 2PHRA 3QH6A 3RYPA 1JBCA 2FKXA 1PNFA 4AVVA 1V9PA 1Y66A 2A79B 4J80A 1D2QA 4QKNA 1VBC2 1R73A 5FPRA 4O9EA 1YXBA 5FZ9A 3CJHB 4DV4B 5KMGA 2PLV3 1W8WA 3KCCA 5JZGA 1AR91 1S0FA 1K5SA 3D4KA 5LWBA 1X82A 1I5ZA 1XMOB 3N2GB 4OXSA 5KHJA 4XFHA 2E51A 1HX6A 3VBOC 1HRI3 2E7AA 3OGCC 2ZHKA 4EJRA 3ZX6A 2XBO1 3VZJA 1KFXL 3WW2A 4BB3A 2WAMA 1CAWA 2P17A 5F5CA 2XKPA 2Q68A 2VOXA 2DE0X 3FUOA 2EIMC 2QQUA 3L72H 1PGW2 3FC0A 1AR63 1BGYH 5I0RA 5D21A 4NIIA 3D0SA 5FMOL 5JCOC 2VWJA 1OD3A 1X9PA 3AL5A 2FDGA 5FLXN 1Y67A 1W39A 5EJ1B 3T1HB 2YUEA 1UU5A 4GX1A 4FJCC 3WCRA 3KSCA 1HW5A 3H50A 4LITA 3N9NA 4AAPA 3LFIA 4JI7O 1UZWA 2HWC2 1NCRC 4AI0A 1VE0A 3NO8A 1LCLA 5A80A 4BH9A 4C0BA 2UWCA 1EAH3 1R1A3 3ZYIB 1RSOA 3ZEDA 1O9HA 2VZ1A 5C33A 5GONA 2Y0OA 1JHJA 2GN7A 3WU2Z 1AVBA 4COZA 1GFF2 3B00A 5IJ9A 1RUOA 1X9TA 3HVDA 2QWPB 1GM8A 1OQ1A 3GBFA 4JAAA 3OW2U 5FZ0A 3J26N 1LU2A 4P9GA 2EF6A 5EXOA 3ABMB 4LT5A 2E9QA 2D93A 2EIGA 4DIQA 3R6SA 1TUBA 1CONA 3ZJZA 1DZTA 2A71A 2XG3A 4JYAO 3I55V 3W9AA 3WHTA 4U3JB 4QPIA 1QJU1 1G6UA 4OX9B 3H8OA 1WW7A 2HR3A 3N7MA 1FOD2 4XUOA 3AMHA 3NAPA 3VKMA 4AAXA 1ZM1A 1ZZ6A 1ACCA 2BGOA 1AF9A 2ZXWC 3UKMA 2VPVA 3LFMA 2VXRA 5DG1A 4QPIC 5JXJA 4FZ0A 5F2WA 2NR5A 2ARXA 4HVQA 4JZGA 2CDOA 3S0MA 3JD3A 3ZSKA 4QDQA 2BRTA 3MPPG 1LOGA 2YGLA 4OMDA 2JE8A 1KUQA 1F9KA 2BZDA 4FAGA 2JJ6A 4IV1C 3TEZA 5FDBA 2Z2SB 1DIWA 3AMQA 3W20A 1YQ6A 4O61A 4QPIB 2DUQA 2LM3A 4D6TH 5CKQA 5KR7A 1XE7A 1HNZB 3EMRA 3AMMA 3H1WA 5HFMA 5EJZB 4XC9A 3FAVB 3WB0A 3EBRA 3KZ4C 5JVDA 4UF0B 4QE9A 2DYRB 1MR5A 4MSWC 5BNPB 2NLRA 1WA8B 3FB7C 5LCWL 1H2GA 1HN1A 5DDJ3 2WSVA 2H6BA 3USUA 1V54B 2DMXA 4NB5A 1G86A 1NXMA 3JAMN 3VGIA 3P3PA 3VQXA 1PVXA 2WBKA 4MG2A 2ETNA 4Z1MG 1US3A 1AXKA 1RPRA 1ZVFA 2B5HA 2VAUA 4I0XB 3WDXA 4ZHNA 2NLJC 1NCRB 4IE7A 4B1MA 1X7NA 2C9AA 1OFSA 3RMYA 3JAKB 2ORXA 5A7SA 1K8AW 3NJVA 4K35A 4CDXA 3RYIA 1Q3EA 4FZ1A 4PLOA 1JI6A 3KGLA 4X62O 4LE4A 1LODA 4JTAB 3ITQA 3J80N 4W6WA 1COV1 4UWDA 1MZEA 1JHNA 5B1NA 5CA0A 4K6BA 4CRQA 4ES9A 5A6QA 3CF6E 3VBUC 2HEPA 2F4VB 3JD73 4TLFA 2HWE3 1GR3A 5DECA 2Q0AA 1QJZA 4LFBO 1LOCA 4AHZA 2CHHA 1QOTA 4YNIA 4IEYA 1PM4A 2R1BA 1PM7A 3MI8A 5FZBA 5K1XA 3HKEB 3EJKA 4XQWA 1W6OB 3TXSA 4FVVA 3OMNB 4RD7A 2VQTA 3ZXDA 4PIXA 5CKMA 1G9FA 1N1SA 3BTYA 1DGWX 1RC6A 3FHQA 5FUNA 4L92A 3SCHA 3KLSA 4D7YA 4CEYA 2FDJA 5HFLA 4XUTA 3WG1A 4F7ZA 2PAEA 3WG7C 2Y6HA 3I2GA 1EM1A 5C71A 4IV3A 3HIFA 3AKQA 2EXJA 4BA6A 2FDHA 2C26A 3L70H 1Y9GA 5HV4A 1HR0B 2WLHA 4FMTA 2ZGPA 5FY9A 2BFUL 4GIQA 5LOVB 4LF7B 4BQXA 4MVMA 5FUIA 2IJIA 1PMHX 2ADPA 3A4UA 1TMF1 3ZIXA 1PP9H 5HCHA 1N36O 2W46A 3DECA 1HJFA 2WAOA 5LP6B 2D6LX 3WG7B 4XQ4A 3N9LA 4AW7A 5AVAA 1JYXA 4W4KA 5LOVA 3FHAA 2B1IA 4P9WA 4CPBA 3VDDA 5FPLA 3UO2A 5L9BA 1XYOA 3ABUA 1PIV3 1HB3A 3FLPA 2Y6KA 5LA1A 1D4M1 4JI1O 4Q4X1 3ZCCA 3BPZA 1ZBE1 2P90A 3ELNA 1M4WA 1NR7A 2ZJCA 1UW8A 5IT6A 3U1XA 3JD1A 2WNUC 4LF9O 4CCDA 4WCEV 2WWWA 2JDKA 3DTUB 1GQGA 4HLTA 4CCCA 3W21A 3I59B 1XSRA 1RUE1 1K3IA 1SLAA 1AYM3 3ZSJA 4U3FH 3ACHA 2DURA 4A4AA 1NLQA 1NA1B 1O5LA 3LDKA 1RJ8A 1XYPA 2YGMA 4LFBB 5CG9A 5LGNA 4PLMA 2F4VO 2HWF3 3LA7A 2B4KA 4DR7O 3V64A 2D6MA 4BW5A 2PFWA 1PO12 2JJ2G 2DVAA 1DQ0A 2GU9A 4A44A 4DV1O 1QWRA 5BMVB 2JB4A 3K5OA 4QKDA 4X62B 2N04A 3WW1A 1QJY2 1CWPA 2R043 4XBFA 4I01A 1RYYA 2YBKA 4QM8A 2YZ4A 3K9AA 2J7MA 2JE9A 5E6HA 1VIBA 1JQ0A 2P1BA 5D5QA 2XAGA 1DYKA 3R4UA 1A8MA 1DLBA 4K8XA 4JTOA 4ZOLA 2DYCA 1N36B 5L3CA 1GICA 3LQCA 3VKLA 1UY4A 3VKOA 4IGOA 1Y4WA 3O1VA 4FFGA 2TEPA 2ZGQA 4JRLA 3I2JA 1HKDA 3QF7A 4X89A 5IVEA 1SFPA 3PL0A 2AHZA 3HMYA 3POIA 4B4QA 1OOPC 2D97A 2RV9A 4X64B 3O7OA 4QU2A 4AFCA 4LF8O 4DR5B 3DSQA 3NJXA 3GYDA 4ZU5A 2RS33 3SJAC 1HRI1 4FT8A 3AG3B 4XHBA 2DU1A 1U5XA 3IGAC 4OX9O 4V2WA 2J1RA 2QCSB 2ETEA 1SA0B 2PLV1 3VD5A 5FZAA 3ZHUA 4LO8A 1MOFA 2QZ2A 2AHYA 4G27B 5GJ6A 3F7VC 4CXXA 1MACA 3I2HA 1FJGB 1BK1A 4JI5B 5BY1A 4B3MB 1ENQA 5BNOA 5F6KA 2EXKA 1NZ6A 1AXYA 3WF0A 3OOXA 2HJDA 2L35A 1LB2A 5A3UA 4LNUB 1MZ5A 2UUCB 2WLLB 4XBQA 1R1ZA 3I8TA 5F3EA 5J36A 1XBLA 2XL9A 4YG6A 1EN6A 5CN0A 4Y22A 4LA2A 2OIIA 2W1UA 3K08A 1SQPH 2JDPA 2IXHA 1PGW1 4AFMA 3RZZA 4JV5B 4IGGA 4H0LB 3WG2A 4XXAA 3RZHA 5JI9A 3RJRA 1J83A 1N34B 3RDIA 5FZMA 4MTXA 4CDUC 1M56C 1VB2A 3T09A 4O4JB 2QFEA 3KVBA 2W3JA 2OCCC 4YGDA 1GOFA 5IYDO 3CJXA 4UFLA 1M06G 2VQAA 4LR4A 1DF0A 1KJLA 4Z2AA 1WMEA 2Q1MA 5LK7B 2VQ0A 3IMNA 2NMOA 3GZUC 2R6QA 5FPZA 4YJ3B 2RS12 1HP8A 5IJ9B 3H8XA 2VL4A 1JUHA 2DWEC 1E5HA 4OQ8A 3M7MX 2JDIG 4AFBA 2NYYA 3B69A 3C8XA 2VUCA 3RWRD 1LGCA 3POWA 1HRI2 4XBNA 2LQTA 4HKWA 4UCOA 2QJ1A 4DV1B 4LK6A 1W6PB 2NQYA 2BNMA 3UGGA 4NOTA 2PLV2 1MG1A 2WN3A 4DR7B 1IPSA 3JUUA 3H1YA 3SYCA 3ZHRA 1VMHA 4AR2A 3N9PA 1AR81 3I97A 4GWIA 4JX0A 3THOA 2BTVC 2BOBC 1J3PA 5JSOA 4IHJB 3BABA 3GWOA 1GNHA 1SETA 1VPHA 1FMD1 5J3UA 4LWSB 4OPHA 2Y6LA 1N3OA 1R1BA 3MUY1 4CP1A 2R70A 1VLNA 1CJDA 4GZ9A 3DC5A 5K0UB 1REEA 2O0OA 2LGWA 1PK6C 5B1AC 4FLXA 1SZTA 4K21A 4Q4V1 2Q1FA 5C3SA 2RM23 2BVBA 4A3XA 4M3CE 1UY0A 2EINC 5CFCB 3C7HA 2ZNIA 3G6EV 3VN4A 3SDLA 3BHPA 3OF1A 2OT5A 4AI9A 2JG8B 3HT2A 1UOJA 4C91A 1H30A 2WA3A 5LBEA 4CUBA 5EFUA 1AJNA 5EZWA 2Q8DA 1OUSA 4Y5Z0 1LKNA 1GWLA 2EZPA 3TN93 2XQXA 1N1TA 1S0VA 2CWSA 2VZPA 5LBCA 3AG1B 4RQEA 4WVWA 4EYUA 4DV2B 2A9HA 1OCZC 5B5EZ 3AFGA 3CS5A 2L6LA 1I5PA 1ENXA 3C7FA 4MVSA 4UB6Z 2XONA 2WZR2 4HETA 2LW7A 2PHXA 5F6LB 4KP4A 1WB8A 2QVSB 4KG8A 1VRH2 4WVMA 4MGTA 4FPYA 5FREA 3IDEA 3DF0A 2H0BA 1CGPA 2B9VA 2JS5A 5EZYA 3S5QA 3TAYA 2PXJA 1ORQC 3UKNA 4UVBA 3K5MA 1MS3A 1P7GA 1VBA1 4RGGA 2HWE2 3I2FA 3AMNA 1FMD3 5JXGA 5CBFA 5ITZB 5FXXA 1SMVA 2P7TC 4JF3A 2CTPA 5E1RA 4FO9A 3M3EA 1RUJ2 1JFFB 4EWEA 4HNAB 5FPXA 4UUJC 3SH5A 5I0TA 1MPXA 3HEIA 3BPSA 1TEIA 1QNWA 1VBB2 3K04A 1B3QA 1S0BA 2ITCC 4H3WA 1UU6A 3D36C 4MVQA 4CTEA 2H8PC 1POV1 3UL2A 2ZNJA 4CU7A 2WINB 3OT7A 3UNPA 1AJQA 4GKXA 3E8GA 1NA1A 1M5IA 2R0FA 2VTXJ 3JZVA 2BFUS 2DCYA 5ACA3 1JZ5A 2OYZA 1KP2A 1VMFA 2Q7GA 4X65O 4YG3A 4X6QB 4S2HA 4LHLA 3OMIB 4UW4A 1N33B 3FN9A 1LEDA 3ETGA 1CN1A 2XOMA 3ZMSA 4HOOA 4WM8B 3FAVA 2V73A 2Q67A 5JH7A 3P6BA 5LBFA 1LU1A 2BJSA 3ZFGB 1Y7BA 1JOPA 2C0ZA 3RYKA 2JDAA 2P4VA 3VOUA 3OGJA 4O4LA 1S0GA 5FBZA 4EROA 3POYA 3UT5A 4Q4W1 3LGRA 1XNCA 3POJA 1Z2GA 4FOVA 3WNXA 1W0OA 1EN5A 1CAVB 4JI0B 4HMZA 2X5IB 1UIKA 4DXTA 3L9DA 4FI9A 1CZVA 4YW6A 4FOYA 4U36A 4YW3A 4YRDA 4XDJA 2YIAA 3LAGA 4M3CA 3JQXA 4DXSA 2O8QA 4GKKO 2DDUA 1ND3C 1AX1A 2XB6C 1YQ2A 1LHNA 2VZTA 4OUEA 5A3TA 4Q6GA 1L1FA 1W2NA 4HKLA 1R64A 3JATA 2JJ1G 1YIFA 3W5MA 3KHCA 3EO6A 1XNDA 5B3SB 2QR4A 1H9PA 1FFXB 1MS5A 3NVCA 1T5EA 1IBKO 1LUWA 4AXOA 4ASUG 3OEHG 2XAHA 3ETEA 3E6CC 5EQUA 3WNMA 4DPNA 5ITZA 1RUC1 1MSDA 4CBCA 1OOPB 2Q69A 3E6DA 4ES8A 1RVF2 4LE3A 3CDZB 3WG4A 3OBZA 1RUI3 1HNXB 3OE7G 4AOCA 4YVWC 3OEAA 3WLUA 3FMGA 1RUC3 3NAPC 1FOD3 1JYIA 5J9PC 1DZRA 5J2UA 3AVRA 4WZCA 5LRRA 1L7QA 1YFYA 1S5LZ 1SCSA 2JDHA 1AZDA 1WA4A 4AI3A 2QDNA 3G67A 4DV6O 5IAXA 2G38A 1C28A 2RDQA 5A3MA 2Q4PA 1OURA 3KB5A 4QHBA 3DN7A 2P3KA 3F7YC 5FY0A 3Q8EA 3VBFC 2VCMA 2JRIA 3QVNA 1XBFA 4CXYA 2Q0OC 2VQFO 1UYYA 3TK1A 1JYVA 1WNSA 3A0KA 4XURA 1F4MA 1X4TA 1GN2A 1SQ4A 4R52A 2CH7A 2VW1A 3U07A 2UXBO 1AI6A 5E88A 2KR2A 5DUUA 1ZBA2 5F3IA 1GRJA 3WW3A 1GU3A 1P8JA 4K3AA 4Z1VA 4GA9A 4CVUA 4BWOA 4PLNA 2M6YA 3SH3A 4RGKA 2D44A 2JK5C 2QSAA 3IAPA 4XF1A 2GC2A 4I55B 3K0DA 1QVFU 3MAQA 5LP6C 2IXLA 2PA7A 1F2NA 1GWMA 3GZTB 3MD0A 4UYBA 4FFKA 1HW7A 3SC7X 1PD3A 1ZZ9A 5F5AA 1B06A 3PVOA 1TUEB 3LSEA 4X65B 4FTEA 2YFZA 4NO4A 3HJRA 5IWAB 1DYOA 5FMOS 1RUI2 4Y20B 1R092 2X53S 5IYYA 2IH3C 1VARA 5H9PA 3ZIWA 3U14A 2HEWF 2QKSA 4X1IB 3W7SA 1O59A 1Q8SA 1QIQA 1ULGA 2I2SA 4HPKA 3G6JB 3ABLB 2HWD1 5HV0A 4EZ4A 3AXEA 4BM8A 1VQ7V 4DMIA 1KS5A 2JGDA 1ND2C 4FFBB 2VBDA 3ASNB 2OA2A 2Y26A 1RINA 3SH4A 5BR8B 1KDMA 3VBUB 1S4CA 1SESA 2BV4A 2AZ5A 1OT5A 3ZFFB 4ZS2A 5JSPA 1JH5A 2HFEC 2BERA 2MEV2 1NG0A 1TNRA 4K20A 4H55A 2OUJA 3T4HB 5GLTA 4LHKA 4R50A 3R05A 1WPXA 4J41A 2Z5UA 1KDKA 1ULPA 3ASNC 1ST8A 4TSFG 2VMGA 4E2GA 5IFPA 3CRRA 5LK5A 2WWJA 5GTHZ 5EBWC 1UY3A 2X8KA 3AFKA 1BQZA 3HD8B 4MGKE 1WP8A 5A9GA 5CB7A 4X8PA 3VBHA 1FXKC 3OB8A 2P06A 2R30A 2ZTNA 3OCPA 1HRV2 4MVUA 2EBOA 4BQ2A 1BBT3 4GWNA 5LBQA 2LUWA 5IUQA 1PHMA 4NUBA 1OH4A 4ZHQB 4CCNA 1XC6A 4GKJB 3CCMV 4XTPA 2IXIA 4Y26A 4QDSA 2A6XA 2WT2A 4FVMA 3TEYA 4FPLA 4CCJA 3CC7V 5FQ0B 1RMU2 2XT9A 4BQ5A 4DUWA 1JA8A 3SGIA 3THPA 1YXWA 3DYOA 3VBHB 1TNFA 3LDCA 4QB6A 3H01A 5I0SA 2VOTA 5BV6A 5FZ3A 3WG3A 4DY3A 1BMV2 4XDLA 1K5JA 2CV6A 5GALA 2VZQA 5C5TA 2N05A 4AVAA 4R4XA 4DW0A 4YW1A 4KG0A 1CESA 5BPXA 3JCZA 1RMU3 1DGLA 3L9JT 2FCUA 1MQTB 4Y4YA 2R9IA 1IURA 5CYYA 4I30A 3OYWB 3ALQA 4E2SA 3WDUA 2RS31 3E22A 1N47A 4XDQA 4JI2O 3OAAG 4MXVA 1GMGA 1OUXA 4FSJA 5I8SA 2RNBA 2DFCA 1VRH3 4A7KA 2GNBA 4LQRA 2YYOA 3GHNA 1RUH2 5HPOA 2XJVA 1PMJX 1BBT2 2RMU3 2HLEA 1YTFD 5KA5A 2GMPA 4IEVA 1TMF3 5LHIA 1LOFA 4EFBA 3M70A 2LP7A 3QO8A 3KV5A 3M2MA 2QKAA 1VBD2 3UK9A 5IK4A 1U5YA 5FZ4A 1BMFG 4O65A 1QVGU 4N53A 1B35C 2X05A 5GM0A 1KBHA 5FMDA 5JIAA 1RUF3 3MIHA 4UW3A 2PAMA 1H6XA 1WBFA 3INAA 5H5NA 3UKVA 2W2IA 1W2UA 5FZDA 1HV1A 4BQYA 1YEWA 1YSCA 3C3TA 2YIBD 1WUVA 4LKDA 5CB4B 3CXHF 2WJSA 3J7HA 2EICA 4AHWA 3MFCA 2VMIA 4YW5A 2OS2A 4CDQA 5E8AA 4M3CB 1FPN3 1RMU1 4DUXA 5KXEA 2F23A 5FYVA 2UUBO 1D7PM 3L73H 4UV9A 3TJTA 4XFFA 4RQFA 2GNDA 2JEUA 4QXBA 2JENA 4LR3A 4PF5A 3SKJE 3AYEA 4XJZA 2OTLV 3CMEV 1NUKA 2XJRA 4FPKA 1QH7A 1YNAA 1TAEA 3PTYA 5JUVA 2R071 3H3UA 1QH6A 4LF6B 4XCAA 2ET7A 3MHHC 1OLRA 2XNDG 2BGCA 2GSMB 5JDBA 1G9AA 3HPLC 2ZMLA 4TOIA 4LNUA 1WA6X 5H6QA 4FLYA 4P9LA 4Y20A 3B4SA 1FYJA 3B77A 2EIJC 2UY9A 2GMMA 4IIJA 1JX9A 2VQFB 2IXKA 3K5LA 2UUBB 2RS13 1FAFA 3J8F2 4CEYB 5ABJA 4XZPA 5LEJA 4H2AA 4LUKA 3M3QA 2ZZQA 3T0DA 4P9PA 4DR4O 5DDJ1 3ILRA 2VO5A 4LKSA 3ZSLA 2P3IA 2OPWA 4YM3A 3HKEA 5FP7A 2VOWA 2W0FC 5JMCA 2RMU1 5C9AC 5J37A 1GSLA 3IJ4A 2HWF1 5C8CB 1YF2A 4JGYA 1IGOA 4PT6A 4CC6A 1FKAO 2QWRB 3AG4B 4CPBD 2X6AA 4QHOA 1ZL8B 1M56B 4JASA 1JJ2U 4WF9V 4MGYE 4E4HA 1O3TA 4LBOA 1WLTA 4RS5B 3IT8A 4TWKA 4P2ZA 1TG7A 1V6JA 2IZWA 4GMP1 4JGZB 3CCQV 1MEC3 4HANA 4R6ZA 4WFEA 4IUGA 1M4UA 1XUQA 2GUZB 1LGBA 3T0BA 1K33A 1RHI2 3E8BA 3AP9A 4A7ZA 5AVPA 2RVAA 1D4M3 2Q30A 4LK7A 4RQPB 4S2GA 3ZFFA 4QAWA 1QJX3 4ORFA 2ZX0A 3JD2A 5BNOC 1H8TB 1RUC2 2GSYA 4Y5SA 1NY71 1E5IA 3AB0A 2ZS6B 4N43C 2RS51 4RGAA 5DMYA 3DPRC 2HEVF 4IV1A 4LF8B 4GUNA 2ZGRA 3LA2A 4M4PA 2D5FA 3DC6A 3ZDVA 3CHXA 5KBFA 4WM8A 2ZINA 1E57A 4N9HA 4FPEA 4INDA 3PIGA 2RS32 2YBSA 3KM5A 1CD3G 1MNGA 1KKCA 2ZEZA 1L8DA 3OFNG 5A7PA 3GZAA 4UCUA 4NRQA 4UFHA 4GYCB 1J59A 4B3TB 1ODMA 4XTMA 2VNVA 4J7ZA 1SLCA 5K0UA 3FJSA 2VNRA 5FYUA 3Q4HA 2CGOA 2BU9A 3V0BB 3P3NA 5JPMB 3SEPA 4AF9A 1XNTA 1MZFA 2GC0A 1Y3TA 2CK3G 2EALA 2HWB1 2WUHA 3AEIA 3HKCA 3T2TA 3LUTB 5F3CA 1KQSU 2JIJA 1Q8PA 3OY8B 4TSVA 1W6QA 3ETDA 4C0HA 5CG8A 5CNAA 1QJY3 3RVYA 3SYOA 1R3KC 1W9FA 4Q0PA 5C3RA 4ZXEA 2GH2A 3H1HH 2ARCA 5FLIA 5B3SC 5KUKA 2PY5A 2BVVA 2XVLA 4N90A 5T54A 1UU4A 1S76D 1YQ8A 4AFDA 2ZBJA 4QHZA 1KJRA 1OLME 4LBEC 3RQ0A 3I49A 2EJRA 4LF9B 1VQ9V 1QR8A 3CSXA 3CCVV 4E27A 5L7OC 1W9TA 5H6RA 1CIWA 4DO2A 4GZRB 2LGQA 2NPIA 4XABA 5FYTA 1IPJA 3AC0A 2FCVA 3VZLA 5FIXA 3WV6A 3GALA 3T2MA 3S57A 2JECA 1AYN2 4IIJB 4S2DA 2K9ZA 3UCSC 4LKEA 4NHLA 4OULA 4RUEA 4DV2O 1SFYA 2W91A 2TBVA 1THZA 1RUJ3 1V70A 5L73A 2JS3A 5J2UB 1QOOA 4K7JA 4B3RO 2AZ2A 3MYXA 4L2NA 3WB1A 2Y48A 5FY1A 4TT3G 3ABKC 1HDKA 1V55C 4DXRA 2XWBB 4CZZA 5C9AB 1XQNA 3DKQA 5A33B 1NZIA 3WNNA 3GDBA 3G71V 1M90W 1G7YA 5I0UA 4BAYA 3TNPB 2LROA 3WCSA 1BHGA 4EQVA 3J81N 4UXNA 2D40A 5B1BC 4ZBMA 1UYXA 1S72V 4XHXA 4P08A 4RS5A 3RMXA 4K40A 1AL0G 3ROUA 3USSA 1YVWA 2R49A 2UURA 1OVPA 4M4RA 4HSJA 1YDXA 5FNVA 1UAIA 4LIUA 1X36A 4A45A 4XMIA 1C8M1 4GX0A 2GZWA 1JZ2A 2OPKA 2F95B 1S77D 1ND3A 1H6YA 2FCTA 4CU8A 1UZVA 4UCVA 1W05A 1H1AA 3DYMA 2HWB3 1JYNA 2Z42A 2A6ZA 1XRUA 3CP1A 4K3UA 2IFRA 1RM1B 5FCCA 3JXSA 3HPNA 3A22A 1WLEA 2AH2A 1V9U2 3RGBA 3DPRB 2NN4A 3ME2A 1EZVH 1UMHA 3UT0A 1WA8A 5GZEA 4JI5O 4MW3A 1FJGO 4ZPIA 4BXFA 4EN6B 3I59A 1M93A 4EWDA 1ND2A 4AQ6A 3ASIA 4OUSA 4DOUA 2WQ8A 1RUE3 3CWBH 2I74A 1LGNA 5LMNB 1EFRG 4JI0O 2YHJA 5FJKA 2OZ6A 1NOVA 2FTKA 2A3XA 5GLZA 1XHZA 5A1AA 3ZN0A 2JXAA 3HQUA 2W1QA 4I5SA 3PLQA 2VZ3A 2ES3A 1MSWD 3D0JA 3OUHA 4MV2A 2B9ZA 2LJ2A 5SV5A 1RFYA 1MMMA 2BBAA 1C8M3 2TNFA 1N1VA 3K58A 1PK6B 1E1RG 4O4HA 4XOGA 3ABMC 2TUNA 4FOQA 1GO3F 1R6TA 4JKLA 5CA6A 5FP8A 5JVVA 2M7WA 1CPNA 3QCWA 4F8AA 5CBGA 4XJWA 3A2FA 2P34A 2BUKA 2R061 1V55B 1OCOB 4ZI7B 1YJKA 2FMLA 2PAKA 3ZRXA 2IJHA 2Q9LA 4ISRA 5KLVH 3BOPA 1UIJA 1W2OA 4ITCA 1KFUL 3UJOA 3AG2B 4PA6A 2O8OA 5LY2A 3O1UA 2BOJA 5F37A 1DF5A 5JXIA 1AR72 2WLIA 2ZGMA 1EN4A 4JTCB 5FZEA 2ZM6O 5IVCA 4DRRA 2ZEWA 3PUHA 4J10A 5TSWA 3IC7A 3LB9A 3BU0A 4YSFA 1AI7A 1MA1A 1QGLA 1ZRIA 4XFBA 5GTIZ 4AEJA 2X6CA 5FWEA 1UL9A 4RQPA 2AW9A 1SG3A 1LECA 1VBA2 3PU3A 3OJBA 4GT1A 1Y6XA 4DR4B 1I3HA 5LB6A 3AZWA 3JAKA 1YJNV 4B7EA 4I55A 2XQRA 2ZAAA 1VBA3 1TQ5A 3EXAA 4AE2A 3RYIB 4JRAA 1WLCA 4YVWA 3CZJA 3CU7A 4MYEA 2VD7A 4DXWA 4I4TB 1S2BA 5E1AC 1H9WA 3OYWA 2AGAA 2XGXA 3LCPA 1XSQA 4I7ZB 1CJPA 4DY5A 3O1OA 4Y1VA 2XJSA 2WZEA 3AP5A 2DBIA 5H9RA 1KYOF 3N2KA 4X1YA 1NAEA 1HQNA 3FE5A 5G04L 2Y64A 4KGQA 3ZYBA 3CC2V 1LOBA 1UOFA 4OI0A 5JH7B 3MO4A 4Y33A 1RITA 3Q4HB 2WNVB 4V2VA 3VQVA 3A23A 3FWEA 4UW5A 3WNLA 1UY2A 1GANA 2ZGKA 5FY4A 4FLUA 3ETPA 4BZ4A 3AJYA 4Q8KA 1S55A 4JPRA 2EILC 2W5FA 1C8M2 2RM21 1C1LA 4OCTA 4Q4V3 2B42B 2DVFA 2P6JA 4IQPA 2VQEO 1US2A 3KHBA 3AK1A 3VBSB 1W6QB 4QKBA 2XOKG 1NCQC 1WW5A 2ID4A 1RUG3 1YJLA 1JZ7A 2HYKA 3R65A 4EEQA 1YI2V 1U96A 3AMPA 4I3GA 4KMQA 3QD6A 4AK3A 1KC8W 2JG8C 3WUCA 3OBTA 4GX5A 5CA0B 5BYNA 2WWUA 1RUI1 2BTQA 2BP6A 4CDQB 1G9CA 2ERFA 1W8ZA 5J2TB 1IX9A 3VDDB 3J7MA 3RBZA 2B39A 4AEDB 2IUWA 1NX9A 4RAIA 3T1LA 5GZDA 5BMVA 1FAYA 5IK5A 1S2EA 4F6EA 3VBRA 2XR4A 3I56V 1S0JA 4YIPA 3ICXA 3EXUA 3LE0A 1QJU3 4C90A 4CEWA 3LDRA 4QGLA 4QX0A 2RQ6A 4MHUA 4B3NA 4BIOA 4LBMA 4JHZA 1EUUA 3N7KA 3V56A 3VUOA 4ZI7A 5KA6A 3K46A 4CDWB 3GBWA 3TOJA 1QNMA 2V7QG 2WDBA 4XF0A 2G9FA 4CA9A 1JZ6A 5FZOA 2VUJA 2WS93 2C24A 1XNBA 3AG2C 1FXZA 4XEZA 3V0AA 4JQRA 2JEXA 2VW2A 3PJSK 1I1EA 1GZWA 4HFSA 4NN0A 3JCUZ 3UGHA 3V65A 3CX5F 1YZBA 4QXCA 1IHMA 1LAJA 5IW0A 3O0WA 3K79A 5KHGA 4CUCA 3KF5A 3CCUV 3I7DA 2F1MA 2Z3YA 1ULFA 2OVUA 3E83A 2N74A 3SCGA 5C8CC 2WLNA 4BLJA 2VC9A 4M01A 4L99A 1TME1 3ZRVA 4GD4A 1R3IC 2RS11 5DAQA 3WINE 1MABG 4KNCA 2BSKB 1GP4A 5DN6G 3S30A 2JDZA 4YWAA 2F43G 2UU9B 4A7YA 4FQ4A 2MW2B 5DAPA 1UYZA 4FQZA 4LBNA 1YRZA 2UY8A 3EB7A 4Q4Y2 3U4XA 3JD72 3DPRA 3POSA 4DUYO 3VBSC 3GJAA 4AEMA 1SF9A 1GNZA 5JJJB 1AVMA 5EYXA 2VOKA 4NYKA 3AKSA 1FPOA 3AL6A 4BLIA 2WIIB 3WHUA 3E5QA 1GZCA 2XDVA 4U2AA 5DZFA 4PF1A 4FM0A 1ZSPA 1HNWO 2Q7HA 3BEHA 3SYQA 5A32A 3APQA 4W4ZA 1XXNA 4LO5B 2HWD2 5KHHA 4CZSA 1HIXA 4TLGA 4QX1A 4IL6Z 2W08A 3I3DA 4Q4V2 4JI7B 2PI4A 1R3JC 3WF3A 5LYJA 4DFSA 4KU7A 2RMKB 4GH4A 1A6CA 3B5LB 3NNMA 3ZRWB 3ZBHA 5LXTB 2PHTA 1DTOA 2G1MA 1IZ3A 1OMIA 2EIDA 2MEV1 3G80A 3VBOA 2Y6JA 2EIJB 3FZ3A 3C7GA 4FFBA 2XAQA 1VB4A 5C4WC 1YFXA 5T50A 2PQSA 4DR5O 2GAUA 3LEKA 3O5SA 1DFQA 3LEIA 1BJQA 1H0BA 4NTYA 4MUVA 4N7IA 3BFRA 5AC93 1UPSA 2ZDIC 4IYIA 4QPYA 3MFAA 5A1FA 2WLIB 4Q1PA 4BOWA 5H2FZ 2OX0A 4GCZA 5JIUA 4WBNB 4NHKA 2MK3A 4L8JA 1ZNPA 2FDIA 5DG2A 3D6EA 1S5HC 3IB3A 1COWG 4XILA 4J7JA 3PDQA 3RYCB 2BGPA 3VHPA 1KQRA 2HKOA 1W0NA 3IBMA 2ZE6A 5F5IA 2P37A 3OUFA 3P1IA 4DV3B 3LD8A 3DEMA 1QJX2 1KGYA 4UT5A 3JD71 4FLTA 4QKFA 1DQ4A 4B3RB 4CCMA 5GONB 1XNRO 1CAXB 4LOTA 4QJFB 4JI2B 3TEWA 2X6BA 3CE2A 3I4IA 1L7RA 4LF7O 3WQ0A 3ZXKA 4M0HA 4DR3O 4EFEA 1MEC2 4LJHA 1BMV1 4JKMA 4FTBA 2D3PA 3Q9OA 2XASA 3HKDB 3K4ZA 3U4SA 4NRPA 2QQOA 5EWSA 5CFDC 3LWCA 1F15A 3OY8A 3VD7A 5JJNB 3M3CA 2WO3A 1AROP 5FNVB 3WT3A 1YUDA 5H9SA 4L97A 5HI0A 3AJZA 1GQPA 5D8AA 4COWA 4YARA 4MZUA 1ZREA 2Y4TA 4X66B 3ACLA 2PF4E 5ISLA 1K92A 1AILA 1OA4A 3N3HA 4J1WA 1OCRB 4FOWA 4N9IA 1FATA 3MEPA 5KHIA 1SBDA 1PM9A 2HWC1 2BDRA 3JB8A 4N53B 3K3OA 3OGIB 1AR71 1ZTEA 2HWC3 2IM9A 4GKJO 4UCTA 4OPAA 2UXNA 5A6YA 5FOJB 2CTQA 4C1WA 2RJKA 4H33A 2JG9C 4CH6A 4ASLA 4RFRB 1K3EA 2QWOB 1O8PA 1Z7S1 1RM1C 1WCKA 1OCRC 4FPHA 2ENRA 4CCOA 3K4AA 4GWJA 1A34A 2HYXA 2LW8A 1JODA 3MHSC 3X29B 4TUYA 4GQ7A 1RP3B 4QNHB 2HG5C 5FKCA 2YXHA 3A8TA 5GKAC 5FPUA 1UO9A 3WDWA 1VRBA 1FOD1 5DUVA 1QQP3 4W65A 3JYCA 2IFWA 2Q7EA 2FDFA 2GTAA 4X1KA 4LPLA 3OEEG 4NXMO 3T08A 3VQWA 3T4ZA 4XJUA 1BHAA 1T2XA 5K8SA 4NWVA 2PTMA 2PI5A 2A3YA 4B7KA 4WM7A 1STMA 3K0GA 4NTXA 3JU9A 1ASJ1 4FTSA 2B45X 2BTQB 1UZZA 2ZX4A 3E97A 2WABA 2XXZA 3RZMA 4KBZA 3O14A 1OJHA 1DQ6A 1YTFB 4FPFA 4EZHA 4DR3B 4Q4Y3 4BHPA 3U78A 4PBOA 2VH9A 2AC1A 3ZN4A 2WQ4A 4LUMA 1S0IA 4A41A 3H0OA 1XJAA 3MIFA 3PMEA 1QLNA 4PHZA 1YQCA 1VQ5V 3PJYA 3GM8A 2DQ3A 2N7GA 4LBKA 3ZXAC 1E79G 4A6SA 3OGRA 4QT6A 1UPIA 2P5BA 3ZHTA 3VZMA 3HBZA 4HKOA 1W6MB 4CDWA 2CDPA 4QQOA 5A32B 5JOWA 3OTOO 1EBOA 3CEWA 3VD9A 3GVMA 3PN1A 1YCIA 1SHWB 4LTAA 4YVSB 2OIEA 3UGFA 5KX5A 1SLLA 2WNOA 1RUH3 3RZLA 2OTJV 2VS0A 5A7QA 3I2KA 1GKBA 4BQ3A 2WYFA 4OHVA 3RZJA 5F2VO 4YGBA 4IETA 3AX4A 1AXZA 1OCOC 5FYHA 4MH0E 3OPTA 3TXQA 5J1XA 4KL1A 4UFIA 5BXXA 4CEYC 3AZZA 4EN0A 1Q81W 3NV2A 1GBGA 5LA9A 1RSOB 1HV0A 3CCJV 3I2DA 3WEZA 3ATGA 4AI2A 5EC1C 3CKHA 3MICA 3ECQA 3J7LA 3IDAA 1RPOA 1Z0HA 2XAJA 2DF7A 3KV4A 4CUGA 1B35A 2QQMA 2Q1ZB 5A7NA 2QGNA 5BNNB 2FZ2A 1ZRDA 2ZCWA 5FXZA 4GXLA 3THTA 2E53A 2VM9A 3U10A 2VVEA 4DV3O 4QX3A 5A6ZA 1NTZH 3A7QA 3G6BA 4Q0UA 3I3MA 3NW4A 2C2AA 4PDMA 1B35B 1OC1A 5C3QA 3LDEA 3JALA 1AI4A 2WFPA 3BTZA 5B4XA 3K03A 3C3VA 1WN7A 1HNWB 1B09A 1AR92 3B2EE 1VQLV 1ULCA 1XOUA 1E1QG 1LULA 2DTWA 1R6KA 5CKNA 5CADA 2BOIA 4LEJA 2Y4UA 3BA9A 3K9SA 2KG7B 2ADDA 4GMP3 1NA1C 1VQMV 1CQ9A 4DV0O 4GAZA 4Q4X3 3HAGA 1X50A 3ZXEA 4EV0A 2VJXA 1D0HA 2D6OX 2WN2A 5CISA 1I5YA 3E1F1 4RL7A 4PA7A 2EJ7A 1UMIA 3BIEA 5EPAA 3M1HA 1ZUQA 5FXVA 3NJYA 5L3FA 1C3HA 5CFCA 4BXSV 2CU5A 5FBJA 4YW7A 5C93A 2VUDA 2E32A 1RUNA 4E4SA 2CAVA 3MLLA 2Y0PA 1DQ5A 4YZ5A 1LNQA 4ZZ8A 3AG7A 1XL4A 1XMOO 5BZBA 3SR2C 1PPJH 1N0JA 1W8OA 5GW7A 1V0AA 3H8UA 3R0RA 3DGTA 1O5UA 4JAUA 1YFWA 3VZNA 3KKYA 1SCRA 3BTAA 4XUNA 1SQGA 2VWKA 4LHSA 1CEZA 1AR61 3ZRSA 4YVWB 2PHDA 4ZOLB 2ZA9A 4P30A 5K9YA 2DCJA 5LZ6A 1I94O 3WNOA 5LMUO 4K9SA 5FO9B 2OYQA 2QQIA 1NQJA 3CQOA 2WZR1 5EYYA 1KB9F 3M4FA 2UUAO 4CDXB 4Q2FA 1BZKA 2XVKA 1UKGA 1COV3 4AEDC 4OLLA 2B1GA 4CS4A 3UT5B 4IE5A 2QQNA 4CCKA 4HL0A 4QE7A 1NQDA 2WQZC 2RDCA 1KMIZ 3B9CA 4DV6B 4JI8O 1VP6A 3HWJA 1D4M2 4RFT0 4C8DA 3ENRA 2EZOA 3O12A 1VIWB 5JOZA 5T5PA 2E75B 2W0XA 1RUD3 4QQPA 4RR3B 1PL4A 1YC61 3N9OA 3BRCA 3T2PA 1RL3A 1XNKA 1I5XA 5IYCO 5FMCA 4E4ZA 1BVP1 2E26A 1SZXA 3T30A 2VVFA 3J8F1 5JCTA 3BB6A 4FFHA 4I09A 2EULA 2R16A 4GLXA 2VZSA 4PV1B 2P22C 1SBEA 1DQ1A 1HXS3 4B3MO 1Q43A 1OCZB 1JJOA 4QQHA 4B3TO 2VR4A 1L0NH 1UYPA 1GM7A 1L0LH 3N4MA 3CO2A 2Y69B 4TWTA 1CZTA 4HVOA 2IXCA 3W7TA 4W6XA 2YMZA 4WZFA 2YIDA 3CIHA 2AGSA 4MXWA 2CE4A 3L74H 2DCTA 2F17A 5A33A 5K4LA 4GB31 3MW3A 1NVPD 3RYHB 2SBAA 1DHKB 3PUSA 2A5ZA 3IWZA 1PV0A 1H4GA 3S5AA 2W95A 4JGYB 1CPMA 2ZCEA 4NIDA 1FNYA 4PELA 1IG0A 5DAVA 2QJVA 5FZ1A 5DAWA 3DXRA 4I0AA 1NXD1 4SLIA 3CCSV 1W6NB 4YZ2A 1WKYA 4QB1A 3CJHA 2K9PA 1QMJA 5FPVA 5T5JA 4AHYA 1ND2B 1PX3A 5JQGB 3VV1A 4DV7O 1EP0A 4HG6B 3FB5C 1SZBA 1BYHA 1D2SA 4ZS3A 4KWKA 4AGGA 4UFZA 1JZ4A 4LFAB 3D3AA 4E8DA 4QXHA 2W52A 4NROA 1PGL1 1W2BU 4JTNA 4XJ9A 4TXWA 4COYA 3C7OA 5DN2A 1SDDB 1XU1A 2EINB 4F6RA 3C3SA 5CFCC 3VBRB 3PVNA 4MHRA 3I3QA 3M8LA 4HNAA 3IDCB 4UCRA 4PIZA 2XHNA 4GULA 2RCVA 4FM2A 4X20A 2H6CA 2JDUA 3ZN5A 3ETQA 2Q5ZA 4ASKA 1N4CA 4M3CF 2VTXA 3GZEA 4BDVB 3ZRWA 1GMMA 5CEHA 1ZA4A 2J1UA 2GC1A 1JMUB 2A3WA 2D6NA 5FJHA 5HCBA 4E4EA 4BW9A 5IFTA 2V09A 2W1WA 4IE4A 1FFTB 1MVEA 2HWB2 3FB8C 1AHSA 5A3NA 4OUMA 3H1KH 2RR12 4WFAV 2ZKNA 1P7BA 4PDWA 5DXDA 4LBJA 2C4XA 5FZKA 4SBVA 4R9AA 3OSDA 3JAWB 4JI6O 4NIGA 2GC3A 4LF6O 5CVRA 5FYYA 2JGDB 2R062 4GB32 3T4VA 3R4SA 1H2NA 3LIHA 1J3RA 1UZ0A 1W06A 4E4DX 2HKXA 1KECA 2EIKB 2Y60A 1OKOA 5EP9A 3CBNA 4KHPO 3IDBB 4JTDB 1Q5OA 2WS92 4ZU7A 4Z8BA 5KX5B 3DXTA 2Y69C 1R083 2P67A 5HBAA 4LNVA 2AACA 1FI2A 4XF3A 2JG8A 2JGUA 1DLLA 3E5UA 3CMAV 4KWJA 1XNQB 1QOSA 1CAUB 3KG2A 4META 3JB4C 2D5HA 4ZKIA 3PUIA 4O2AB 4Y3OA 4Z2WA 2QWQB 1U5IA 1VF5B 2ZGOA 2Y6FA 5TISZ 2VG9A 3LNNA 4QX7A 1FXKA 3ZMOA 4K1ZA 1FMD2 1QBZA 4AL9A 4RR3C 4CP9A 5IJ0A 4AZZA 2W68A 3WB2A 5C3PA 4JHTA 3AK0A 3SLIA 1VQOV 5I91A 4FBFA 4PDVA 4PDLA 5IK8A 1K4CC 5IJ0B 5F8PA 4JYYA 1CPYA 2AXTZ 2VMHA 4JGZC 5KAFZ 4LO7A 1TA8A 2DYSC 5APAA 5EC2C 4XW3A 4Q27A 3V0AB 1K5MC 2YC2A 3K2OA 2Q8OA 4PJ0Z 1GZWB 3I3BA 3AZYA 1NU1H 2BWCA 4K0KO 2WKKA 4X9QA 4K0KB 4D7TA 2GN3A 3BOWA 1QXRA 1Y76B 3KT4A 4FM1A 3VLBB 2P5OA 2WNUA 5FYIA 2Y34A 3C90A 3D8CA 2YXLA 3H9AA 1F5FA 4LFCO 3NNLA 1GM9A 1AI5A 4E2QA 1L7LA 1ULDA 2ZGNA 4XE9A 1M57C 3K3WA 5C3OA 4MVRA 1SERA 3WOGA 1XPWA 4R4ZA 2KQXA 3F2ZA 3CCRV 1CP9A 3ZSEA 2YY1A 4CU6A 4RHV1 2YDEA 4H37A 3EFFK 3ACFA 2WS91 4R9DA 2ADQB 3EHBB 1WB7A 2QZ3A 4QX2A 2ZHLA 1HRV1 5CBHA 1AL21 2ZR3A 5A70A 3SPCA 4M00A 1B6QA 2A6YA 4ASMB 2G4IA 1GOHA 5FZ8A 5IYBO 3X2QC 4LH6A 1YJ9V 4O2BB 3O1MA 5IVFA 2BCCH 5FR3A 4XETA 4K1YA 4MTFA 3ZXJA 2QA4V 4ZKTB 1IS4A 4XIKA 1LOEA 2ARBA 2FMYA 1Z5WA 4HK9A 1SLIA 3LOBA 2R1DA 1DU3D 2GTSA 2CL2A 4BCUA 1BKZA 1K34A 3ST7A 1WMXA 4QU1A 5FMBA 5BY5A 2EX3A 1EPZA 4TV9A 5FZCA 1R081 4HK8A 1VQKV 2BNOA 2JDYA 1TZOA 3MIBA 3S6PA 4YZ3A 5FZHA 4LKFA 4IV3B 3T3YA 2JKXA 1BZWA 2GV9A 2X10A 3W7WA 1S0DA 4QB2A 2WLLA 4H14A 3TETA 1UCXA 4EWAA 1RXGA 4JQTA 2WA4A 2DVGA 2ODMA 4BMBA 1POQA 5KXCA 1AR73 1CX1A 3QACA 3SQOA 2CAUA 3KCYA 2C5DA 2RDSA 3TGUH 3S3XA 4IE0A 1S3JA 4CH4A 5AC91 1FXHA 3A0BZ 4R8CA 1QU0A 1W6OA 2P3YA 5B66Z 1W0JG 3Q8AA 3WQ7A 2MNGA 4JYAB 3MIEA 3K51A 2UWBA 3RI8A 3GNEA 4AYUA 2OCCB 3FB6C 3MBWA 1DBNA 3ASOB 1G1XB 1W0KG 1YITV 3L2YA 4IE6A 1EAH1 1R1A1 1LEMA 1J58A 3IAQA 2PQQA 4JI3B 2CH7B 5JPNB 4AQSA 4IYHA 2ZXQA 2XLFA 1REFA 3I54A 3ZYRA 4MADA 2OCHA 2PGGA 1VQPV 5KUMA 3LEGA 2WO2A 4ZXKA 3CNAA 4YJ2A 5LA6A 2JD9A 2A06H 1YHQV 3BYWA 3GF6A 1CAXA 3KD4A 2ILMA 4OZXA 1FNZA 5FP9A 1AX2A 3ACIA 4IEZA 4P9JA 2DYSB 3SISA 4DR2O 4JVAA 3WZ1A 3T1HO 1OZ0A 1LOAA 2OUHA 3MZHA 2PZSA 2DCZA 4TQFA 5AG2A 2F6BA 3GJBA 1K97A 1W9SA 3ZPYA 1W0PA 5C4WA 1JOBA 4HBNA 4JDNA 5FOBB 4FK5C 4UVCA 3PUQA 2UYAA 5AFEA 3DUIA 1P84F 3G4SV 1RUG1 3CEIA 1RVF1 4L0PA 1I7FA 4E2LA 3UKTA 3JAWA 4AEKA 5DZEA 3TRSB 1BCCH 1AR5A 4PBPA 1I6XA 2EILB 1K5MB 5DEDA 1OPOA 1JXNA 1IS5A 4P9IA 3M7AA 1BHBA 1E5SA 2QQWA 4CE8A 1UNBA 1LHWA 1X33A 1W3XA 2VECA 3VDDC 3T1YO 2OZJA 2WL1A 3WD5A 2HH9A 1RJ7A 4CXWA 3W7UA 1PK6A 4XPVA 1RUF2 5L19A 3ZFGC 5D2AA 4D69A 3BI3A 3ILFA 4FPJA 3H42B 1LESA 1H38A 4I0WB 1CAWB 4J9YB 3O0XA 2G9GA 1Z7S2 3IKWA 4QDRA 1V6MA 2ZE7A 1GOGA 1JW6A 3PHMA 5FYSA 3ZMNA 1TMF2 2ZX3A 1HQWA 1VF6C 3AG1C 3MF9A 3IIAA 1DYPA 4PD4F 2RMU2 2ZMNA 4CP9B 2QM4A 3NV4A 1UY1A 3P30A 3K48A 1N32B 1W90A 5FLHA 1N34O 4N21A 3AG3C 1UOBA 2QQLA 4IGQA 2UU9O 4J6GA 3B7MA 3HN3A 3H8RA 1KRIA 1YLLA 1ENSA 4MW8A 1BCXA 1C57A 4U7OA 3SITA 1W8NA 2YI9A 1JVMA 5IY5B 1SA0A 1OFNA 2DBNA 3HBKA 2E33A 2Q4SA 3OUSA 3B9IA 1P4RA 2KD7A 4DK0A 3N7JA 1CAUA 1V00A 4IV3C 4URTA 2EIBA 4HVRA 3WNKA 4IEQA 2CSGA 3VBFA 1PGSA 4UFMA 4JCKA 1FS0G 3CC4V 3RYRA 5E79Z 3POBA 4GJYA 2CYFA 1SQVH 1PKXA 3K59A 4BJ0A 5FO7B 4UBGA 1O3SA 4JI6B 5JSRA 1JFFA 4YHHO 1R082 1IQDC 1D0GA 3KV6A 4IV1B 3ZHSA 2XBO2 5DZGA 2Y0IA 4AHXA 4U7NA 3APBA 4AWDA 2JDMA 1DLCA 1QQP1 1D4VB 3VD3A 4RYDA 4O4JA 4LP8A 2WZR3 3SPJA 2BW8A 2V4AA 1ZYBA 1GZ9A 1AB3A 4OGQB 4COUA 3ZN6A 3KF3A 2ZKLA 2R063 1OA3A 3ZN1A 3HT1A 4D94A 1SBFA 4ARYA 4QPGC 4XACA 3F95A 3HQRA 2J1VA 4CH3A 2RR13 5T3NA 5FY8A 2BNNA 2VCBA 2DUOA 3CPWU 1VAKA 1XE0A 4EB6B 2GNMA 4KXRA 3RZKA 4B3SO 2GH8A 5M0TA 2RR11 3QBQA 3QO5A 3NRUA 3H3ZA 3WF1A 4ZONA 4MOAA 1ZL8A 4XDOA 3SXWA 4AVCA 4E8CA 3BVCA 4DYLA 3RWKX 1LR1A 1A8DA 4MVZA 5C9AA 5JZGB 1QR9A 4YJ3A 3MUZ1 4HN0A 1XREA 2RM22 1LENA 2UXBB 2D43A 1PVC1 4DUZO 2PHUA 2EVXA 2XJUA 3CZUA 4NVPA 2WLPA 3S7EA 4WBBA 5HXVA 4YXWG 4YLZA 4DV7B 1IQAA 5I8YA 5IJRA 2V5YA 1OHHG 3USUB 3DXUA 3CXCU 5IE9A 2X5IC 4LLOA 3OEBA 3RPQA 4LF5O 2W6IG 1H8TA 3PTRB 3VQYA 3ZMUA 4OHWA 5FZIA 4KFMA 1DF4A 4I0BA 1AX0A 1ND3B 1OCCB 3CD6V 3FLTA 2VTFA 4W50A 1R093 1PZ7A 4W6YA 1GZTA 4Z82A 3H3LA 4D6RA 2R072 4QPKA 3PUAA 3E8FA 4UCSA 2LFSA 4JI4B 4YM1A 3HNMA 3LSSA 4CC5A 4YY3O 4AQYO 4B8EA 2Z0AA 1IBMO 2J1AA 2P4EA 3ZR6A 3MV11 3N2GA 2EIMB 4FLWA 2A73B 4DQAA 2LALA 5LXTA 3ORJA 3QNEA 1PNKA 3MW2A 1N1YA 3VBOB 4LHNA 4LO6B 3H7JA 4QX5A 4EE2A 3IN9A 4NPMA 4K8RB 3RYFA 2FYUH 4GMP0 1K5QA 4FPOB 5FZGA 4R9BA 4XUQA 5GLUA 1YIJV 1AJKA 4HONA 1URXA 2Z4FA 4U3JA 4UAPA 5JMOA 2ZX1A 2VZOA 3LOIA 1JUIA 5J96B 2LW1A 4GWMA 2FQPA 3OTFA 2BOCC 2PYLA 1ZBA1 5D8AC 4AQYB 3D3QA 1IBMB 4IEWA 2EXHA 1Y4MA 4O4IA 1FYUA 4RUFA 3MLJA 4FPPA 3TYJA 2C6SA 5LA2A 3M3IA 1SPPA 3U37A 1O8SA 4DEQA 2YEVA 1FXVA 4S2FA 3ASOC 4AVBA 2DQ0A 4P9YA 1N3QA 3QO7A 4G3YC 2ZKOA 3JALB 1W2TA 3TWIA 3PU8A 3ABKB 2R041 4KI5M 2UUAB 2ZZJA 1U12A 3AKRA 4AGRA 2VW0A 3AKPA 5E16A 3HNYM 2CUGA 4QQ2A 1O9GA 1PZ8A 2JDNA 2QWNB 1GKFA 3KQRA 4M0NA 4TV8B 4F3JA 3VB9A 5FPOA 1RUD1 4B08A 5ANQA 4YPJA 2VU9A 5IVYA 2D3OW 4Q4Y1 3RWNA 1Q56A 1H8TC 4FPGA 3AP4A 1RVF3 1VAVA 3GCWA 2QTSA 5F39A 3KT7A 5EBMC 1UPGA 1P49A 2YC4A 1WZXA 3EVKA 2YB7A 4P5YA 5CMUA 4JYCA 2WNUB 3UESA 2O1QA 3WQBA 1MS0A 1NE6A 3B09A 1JPXA 1AJPA