4NVPA

Structure of the cyclic nucleotide-binding domain of hcn4 channel complexed with 7-ch-camp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
200
Chain Sequence
SPMDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Nucleotide Mapping of Hyperpolarization-Activated Cyclic Nucleotide-Gated (HCN) Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 67
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4nvpA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nvpA02
1OMIA 3H50A 1YUDA 1UIJA 2GH2A 4Z82A 3I7DA 1OFNA 4MGZE 3ROUA 2PAEA 2GZWA 4Q0VA 1J3QA 3I59B 4ZU5A 3SCFA 5FQ0B 4HZFA 3EJKA 4I2OA 2XKPA 3QACA 4Q0SA 1EYBA 4DINB 5JCTA 2F4PA 1QXRA 1OI6A 4IEWA 2PHDA 4ONUA 2HKXA 2GC1A 1H1IA 1ZRCA 3OD0A 5FLIA 1ZX5A 4H7LA 1DGRA 5BV6A 4XEZA 3FWEA 1O5LA 3D0JA 4F7ZA 1GQGA 2P17A 3I59A 4I0BA 1FI2A 3E6DA 2C0ZA 5FQ0A 5E1RA 1YFUA 1UD1A 2UY9A 1ZZ8A 5BY5A 4EV0A 4J1WA 4AVAA 3IWZA 4XFHA 4HSJA 3MYXA 4NVPA 4HN0A 1YFWA 2Y0OA 1O4TA 5EFUA 3KSCA 4QM8A 1LR5A 1DGWA 4PIYA 2BNNA 2Q0AA 3OGJA 4UBGA 3H3ZA 2PFWA 4K8FA 4LTAA 4IEPA 4MGIE 5J7MA 1GQHA 1J1LA 3CEWA 3FE5A 5AVPA 3CLPA 4QXKA 4FBFA 3VHRA 2XL7A 2XLAA 4LEJA 1ZREA 4I3PA 5C6CA 5BPXA 4I01A 3LA3A 5I0TA 2K9ZA 4IEOA 5E16A 4Z07A 4B29A 3N4MA 2XGXA 4BHPA 4XF1A 2GC0A 2OZJA 2E9QA 2IXCA 4XFCA 4IEYA 5FDBA 4MGYE 1CAVB 3LA7A 1RUOA 5CADA 1O3RA 3KMHA 2Q1ZB 4WZCA 4KU7A 3FFQA 3CL1A 4X6RB 3UKNA 4XFIA 4FAGA 4F8AA 4L11A 4AQ6A 4O9GA 4KU8A 3UKTA 3WW3A 5I0RA 1NE6A 2D5FA 2PAMA 4OFGA 4MX3A 3RZZA 1CAVA 4HVRA 4HN1A 2EA7A 4N9IA 2PTMA 2QDRA 3MDPA 2EAAA 3S0MA 2Z2SB 2CAVA 2ATFA 4LUMA 2BNMA 2FQPA 5JR7B 2D5HA 2D40A 4QX5A 2QVSB 2OA2A 4ORFA 2ET1A 5KHGA 4R52A 1FT9A 3EO6A 1J3PA 2XKOA 3FJSA 2D93A 4FT8A 1ZNPA 1LB2A 3BB6A 4I0AA 1DZRA 1CX4A 2I45A 3H7JA 4HVQA 3HT1A 2IXJA 2IXLA 3EQEA 2OPKA 1VP6A 5CU1A 2B8MA 3DV8A 2XHKA 4X6QB 2H6CA 3ELNA 5KHKA 1NYWA 3IDBB 1Q3EA 1CAXB 4AVCA 4Q0QA 1J3RA 2UYAA 3FHIB 3NSTA 3I54A 4JV4A 4MV2A 1YFYA 3CJXA 1DZTA 4LUKA 2PYTA 5KBFA 1RL3A 3OCPA 3BALA 3LA2A 4WBBA 1UW8A 4O9EA 4IERA 4E2GA 2XLFA 4TLFA 1TQ5A 3UKVA 2GAUA 3SHRA 3FX3A 3E5XA 1VJ2A 3KGZA 3MPBA 1CAXA 5LEJA 2MHFA 4PIXA 3ETQA 2IXKA 4N9HA 5HI0A 1QY4A 4IEUA 2XLGA 4I09A 3IIAA 5FPZA 4AXOA 1ZRRA 4KWKA 4EWAA 1CGPA 3E5QA 5BUVA 1EY2A 2H6BA 4HMZA 3OTFA 3LZZA 2Q4SA 4XF3A 3SCHA 5D1IA 3EBRA 5JSRA 2IXIA 1O3TA 1YWKA 4IEXA 4CYDA 3ST7A 4XF0A 3PNAA 4MZUA 3RYRA 3HQXA 2B9UA 3GBFA 1FXZA 2K0GA 1IPKA 3IDCB 1OD5A 4RD7A 4UXAA 3H1YA 5JAXA 4MGKE 3G7DA 3MZHA 3SCGA 1I6XA 1J59A 1WA4A 3KCCA 2ET7A 5JSPA 3DL3A 1NE4A 5JSOA 2Z69A 4HBNA 3PVBB 3H8UA 5CVRA 5EZWA 5J3UA 1X8EA 5FCCA 3DKWA 3D82A 5FPXA 1ZZCA 3NW4A 1Q43A 2O8QA 4XFGA 3M70A 1YFXA 3R6SA 1JUHA 1QXJA 2QCSB 2B5HA 3E6BA 4JTNA 4I02A 2FMYA 2IC1A 3WW4A 4IEZA 5F1RA 5KHJA 3LWCA 5I8SA 1V70A 3LAGA 3QOPA 1Y9QA 2WC2A 2QNKA 3H1MA 4E2QA 4AQ2A 4EWEA 3B02A 3RYKA 5KHHA 1XE8A 4HLTA 3NJZA 1VR3A 5K8SA 3ACLA 3HT2A 4E2SA 3L2HA 3BU7A 2PAKA 1YLLA 2ZCWA 2BEOA 1ZZ9A 4J1XA 4LLOA 4KL1A 2XL9A 4HVOA 5FLJA 2GU9A 1WLTA 1O3SA 1ZZ6A 4JTOA 5FLHA 4EWDA 1UPIA 1O5UA 1XRUA 3FZ3A 3KGLA 5I0UA 3WW1A 1O7FA 2VQAA 3H7YA 3SMHA 1EPZA 2IXHA 4ZU4A 1U12A 1LKNA 3RDIA 1L3JA 3M3IA 2PA7A 4MH0E 5T3NA 2BGCA 4YSFA 3H9AA 1CAUA 1X82A 4KWJA 4QGLA 3JZVA 1PMIA 3E5UA 4LULA 2OZ6A 1LRHA 4XFBA 2N7GA 2OYZA 4IETA 1WGPA 2BYVE 5I8YA 5I93A 3RYPA 4BH9A 3BCWA 1O3QA 5I8TA 3BPZA 4YNIA 3WW2A 5LRSA 1UIKA 1RTVA 5C8WA 1YHFA 4Q0UA 2BNOA 2ETEA 4BYYA 1Q5OA 4XF4A 3RPQA 1SEFA 1QWRA 3RNSA 3U10A 2V09A 1NXMA 4XETA 4A2UA 5LEKA 2QJVA 4D7SA 3S7EA 2UY8A 1PM7A 3D0SA 4AVBA 5J48A 4PJYA 2PQQA 1X7NA 4UBHA 4KWLA 4FAHA 4LA2A 2EVXA 1EP0A 3HIFA 4D7TA 3OF1A 1HW5A 4MUVA 4META 4XFFA 5LRRA 4WVZA 3NKTA 3CF6E 1SFNA 2ZKLA 4XF9A 1ZZBA 3O14A 4XFAA 4Q29A 3TNPB 3E97A 4QGNA 3EHKA 1RC6A 1H1MA 3U0ZA 2CAUA 4YARA 2GC2A 1IPJA 1RGSA 1X8MA 3TNQA 2PHLA 3H1WA 4L2NA 1UCXA 3ES1A 4QGMA 2MNGA 4OLLA 1ZZ7A 3NVCA 5I91A 3C3VA 3IBMA 4GULA 3USSA 3ZDSA 4Q0PA 2HJIA 2UYBA 4IEVA 1XE7A 2KXLA 3S7IA 1NZCA 3H3UA 4LA3A 5I0SA 3U11A 5KHIA 4HSLA 4P9GA 1G6NA 3GYDA 4ZU7A 1CAWB 3E6CC 3LOIA 4QM9A 4YRDA 2O1QA 3DN7A 3ES4A 2WFPA 1ZRDA 5BXXA 4BIFA 4JVAA 4EROA 2H0VA 3SXWA 2CGPA 2VECA 2CV6A 1CAUB 2MPFA 2DCTA 3CO2A 1RUNA 4QMAA 1ZVFA 3PLQA 4PIZA 1J58A 4YYOA 3NL1A 4IESA 4IEQA 1Y3TA 1ZRFA 2GC3A 2VPVA 2Q30A 4R8HA 1CAWA 1SQ4A 1I5ZA
chains in the Genus database with same CATH superfamily
1OMIA 1QLNA 1WCSA 3FLTA 3FB8C 1SS3A 2VVFA 3IM0A 5FQ0B 5GTHZ 1TEIA 3G6JB 1V0AA 4FPYA 3MIHA 4I3GA 3VBSA 4N23A 3BRCA 1ZX5A 2VBBA 3WQ7A 3GM8A 1AJKA 3WP4A 3FAVA 4JYBA 3H1HH 2C0ZA 1D5NA 4Q4W1 3SEPA 1ZZ8A 1H8HG 4EV0A 2BTQB 5F6LB 2VZVA 3JAKA 2JJ6A 1QQCA 4MVTA 1O4TA 4AEDA 2BBVA 2GALA 3A0HZ 3AP5A 2VXRA 4D6SA 3FE5A 4NIAA 2AACA 4LH6A 1VEWA 4I3PA 2X10A 4K3UA 1DLBA 4DV7O 1FJGB 3BOWA 3UESA 3CJIA 4D7YA 2WZEA 1F23A 1O3RA 4Z1VA 4U3JB 3ABKC 2CUGA 1GNYA 1IX9A 5LK5A 3FD9A 4GKKO 2DYRC 4NIHA 1SQGA 1KMIZ 4JDMA 4OMCA 5IJ0B 5BNNA 3GWKC 2EA7A 2W6IG 3UYJA 4H0LB 4DR2B 2D44A 3W5NA 3V0AA 2C2AA 2R071 4YW2A 1W0PA 2XKOA 4WFFA 2RS12 3SYOA 1VQ7V 1VIWB 3EQEA 3BI3A 1PM9A 2HWD1 1AL22 1KP3A 3DV8A 3LDDA 4E8CA 1OOPB 2QFEA 5AG2A 2DWRA 4AVCA 1EAH2 3T1YB 3I54A 1X9TA 4DRXB 3KVAA 4IGQA 1GMMA 4JAAA 5DM6V 5GLTA 3B69A 3N7MA 1LESA 1UXZA 2JGDB 2WQZC 4TV8A 2CGNA 1IDSA 5E79Z 2VTXJ 4QJFB 1W9FA 5IY5C 1GTOA 2XOKG 1YZBA 5F8PA 3WF0A 4TQFA 4I50B 5IVBA 4N90A 1US3A 4LBMA 1JA8A 4TUYA 3LSEA 2Q8OA 1IOAA 2N04A 2FTKA 4P9IA 5HXVA 4AXOA 5LASA 4DV3O 3AJZA 3T09A 5D2AA 4YGCA 1US6A 4Y5SA 2ID4A 4C1WA 4TWTA 5FKCA 3CBNA 4MYEA 1IS6A 1YSCA 3PNAA 2PLV2 5JI9A 4UFJA 3WVJA 2CH7B 1LNQA 2EIBA 1PD3A 3ZFFA 2E33A 3GJBA 2JJ1G 1I6XA 4RQPA 1V00A 4N8MA 4LO4B 2BRTA 5KC5A 1XNQO 5L7OA 4HBNA 3JD73 1P49A 1FYJA 2F23A 1RINA 4QPGB 2A7WA 4W50A 1RUH3 4XUPA 4AGRA 1I7FA 5EP9A 3RG0A 2EIJB 2YIBA 1UL9A 4DR4B 5F1RA 1N4CA 4IEZA 4EZHA 2CGOA 4GKJB 1V70A 1F5JA 4OI1A 3JBG1 2QBXA 1M1KW 3HJRA 4DV1O 5DZEA 3JD4A 2DJVA 2HYKA 3CCMV 2DN9A 2AGSA 1PO22 1XU1A 3ACLA 3CYOA 1QJY2 3ZSEA 3ZR6A 5FK7A 2C1FA 3I5DA 1CIYA 4KH9A 4OHXA 1KFUL 2EIDA 2VZ1A 2K2SA 2WO1A 1EPZA 4JGZC 4G3YC 3M3IA 3RDIA 2NMNA 5FO9B 3E5UA 2QSAA 4IHJA 2QQKA 2UU9B 5IVEA 2YV8A 4IV1A 1FMD1 3DCQA 1XNAA 5LOVA 3FN9A 3RYPA 2ITDC 3JARB 3KCYA 3A2FA 2Q8VA 2Z79A 1Y9MA 4AQYB 4L8QA 4JAUA 4BYYA 4K21A 1VBA1 1H4GA 3KG2A 4ZS3A 3MHSC 5C5UA 2RMU1 2QR4A 1QOTA 1CPNA 5EPAA 4UF0B 1HW5A 4NN0A 1W2UA 3FB7C 4OULA 3MIBA 4UFHA 3ZIAG 3O1VA 1RMU1 4Q4W3 3U0ZA 4JYAO 4B7EA 4AZZA 2VY0A 2LW1A 1YTFB 3N9MA 1JMKC 1GWLA 3I55V 3IBMA 1EV12 4QPIC 5DUWA 3HPNA 1SLIA 4RUEA 1L1FA 1YIFA 3HNYM 4IEVA 4XDPA 4N53A 3K06A 1DDLA 1UYYA 4L9BA 4NJ4A 4YRDA 2CDYA 2PYJA 4BIFA 4JGYB 5A3PA 2ZM6B 1SERA 1XNKA 3TXSA 2HEWF 2Q5TA 2XXZA 5FOBB 1L7RA 1PO13 4CEYB 1SQ4A 3VHOA 1RFYA 1PGL1 4OMDA 2PAEA 1GN4A 3SCFA 1MVEA 3EJKA 3BTZA 3VL8A 5FZ7A 4EJRA 4PDRA 4B4PA 1GWKA 1AHSA 5FUIA 3JASB 1H1IA 3IN9A 4M4PA 3BFRA 4CPBA 1RUJ1 3UV9A 3WNLA 1SF9A 5AFEA 3AFKA 5BY5A 1W2OA 2UXBB 1UQXA 3UGGA 3IWZA 5A32B 2JK5C 4FLXA 3M4FA 2YC0A 2NPIA 2B45X 5FJHA 3NV2A 2XNDG 5JCOC 4CP0A 4UBGA 5F39A 3MHZA 2DQ0A 4XBFA 3CZUA 2C6SA 5JXGA 5K7PA 1IBMB 5F5QA 4I01A 3U14A 2YGMA 4A41A 4CDXB 2OZJA 3PIGA 1I0HA 1RUD3 2W92A 4Q4Y1 5CB4A 2UUCB 2EXIA 1RUOA 2YB7A 3C90A 3KV4A 3LSUA 2Z5WA 5CBLA 1BS3A 1OURA 4O9GA 3BUCA 5I0RA 1I3HA 5FZLA 4PLNA 2R062 3T2PA 2WLKA 4MX3A 2X7RB 4HVRA 2YUAA 3RYCB 4NR1A 1FFXB 1H2KA 4TV9A 4ISQA 2EAAA 3VD5A 4B1LA 1S3JA 4IGGA 5DN6G 1APNA 4B3MB 2JD9A 1GP4A 2ATKC 4FJCC 4FT8A 4ITCA 2MK3A 5GZCA 3Q8AA 4K1ZA 1W90A 1ENSA 2UXDB 4B08A 3DC6A 2XBO2 3ON7A 1ZM1A 4FOYA 3SJBC 4HKOA 4NHLA 3ZVXA 4GUNA 1UO9A 2GV9A 1HRI1 1JW6A 1SMVA 2X6AA 3W21A 2PYTA 1RL3A 1CONA 3B94A 3J81N 1G4YB 3GXUA 3H8XA 1IQAA 4TN7A 2OIIA 3Q8CA 3FX3A 1MMMA 4X65B 3A0RA 1RVF1 2ZAAA 2RDRA 2JS5A 2WPDG 5T50A 3OR7C 2YC2A 2RJLA 5K0UA 5ITZB 3ASOB 2YI8A 1CZSA 1JYNA 1O4YA 1K7DA 4COWA 3K3OA 4YZ3A 4AFCA 4QB1A 5JPMB 5IT9N 1FV2A 1AR71 1ZUQA 2RDNA 2VMCA 4MVSA 3F2ZA 1O3TA 5FP3A 2N74A 3R65A 2I2SA 5GLZA 1REEA 2B9UA 4DV0B 2Y33A 3DUIA 5A7WA 4RD7A 4UUJC 4RHV3 4JC1A 1OCRB 3ZPYA 1B35A 5JSOA 5EYPB 1VBA3 1K45A 4O4HB 4JI3B 4LK6A 3LQCA 4JI4O 1PX4A 5FPXA 1UF2C 4XXPA 1NLRA 4CEWA 4NHXA 3POJA 4MW8A 2RMU3 5GM0A 2JWPA 3ZXDA 3LWCA 5FBZA 3QOPA 3ETPA 3OTOB 5DN2A 4EWEA 2J1TA 2WFF2 1Z7S1 3VBFA 1I94O 1KUQA 2EXKA 3DPRC 4YZ4A 3WG4A 1UZWA 3DKQA 2EIKC 5FY8A 3K51A 3INAA 2XJPA 2ES3A 1WP7A 1N1YA 2A6ZA 4LLOA 4KL1A 3A7QA 4EWDA 1R081 1UPIA 1DK1A 3GHMA 4LFAO 4MTGA 1DCSA 3HKCA 5C3OA 1Q8OA 4KWJA 4QGLA 4M4RA 5IHRA 1LNSA 1AR5A 2ZD9A 4MXWB 1V54B 5KUKA 1W3XA 4XFBA 1JJOA 1PGW2 3AM2A 2FDGA 4COZA 1XNDA 4P08A 2F66C 1UIKA 3MGUA 1YHFA 4AI1A 3U10A 4Z2AA 4A2UA 2DOSA 3S7EA 2M7WA 3ZYRA 4GALA 1PK6A 4FPEA 1Y74B 4AVBA 4ICGA 4RS5A 4NPMA 1MQTB 5HCFA 3MAQA 3MIGA 4JKLA 2A71A 4WVZA 2HWF3 3CF6E 1LODA 4XF9A 1E5SA 1EM1A 1WNSA 4W8JA 1UOJA 2PHLA 1UCXA 5BNOC 3W9AA 2F1MA 4QGMA 2V5YA 2BFUL 1SBEA 2RVAA 1WP8A 3USSA 2QQLA 3OMNB 4R9BA 4UB6Z 1ZSPA 2JEUA 4QX1A 3AL6A 3RMYA 1WW5A 3BAAA 3ZS8C 3C8XA 4PBPA 2NM1A 2JG8C 3KVBA 4OZXA 4GAZA 4LF9O 3J7AU 4DOUA 1JYCA 3OPZA 2X6CA 4JAVA 5JJJB 2AENA 1OBNA 3HR0A 5DDJ3 1BBT2 1QLEC 5CBHA 4PIZA 2YXHA 1ZBE3 4FPLA 2LROA 3MUZ1 2WR9A 3RZLA 3ZOIA 2VQEB 5F6KA 4QGPA 2OX0A 3WB2A 4AHYA 5C7GA 4CC5A 1U5ZA 1H8VA 2KG7B 3I7DA 1FKAO 1AYM2 2W68A 4ATFA 5IVFA 2R70A 3RI9A 4DV5B 2TEPA 2VO5A 1QXRA 3VN4A 3HPLC 2A6YA 4XJAA 3KF5A 1DLLA 5F2WA 4WZFA 2BVBA 2WLNA 1FOD1 4LE3A 1PP9H 3X2QB 1RXGA 2VZRA 1MPXA 2VQTA 4QKDA 3AG1C 4K0KB 1XJAA 3BCCH 2G19A 1SBDA 1NKGA 3OW2U 1VQ9V 1GN3A 4HN0A 4A7ZA 4AVVA 4FXKB 4O4JA 1DGWX 1HRI3 1IBLO 2EX3A 2PFWA 3C7FA 2Y8KA 4PELA 4JRAA 4HYOA 3RN4A 4LBLA 3CEWA 1VQLV 1M5IA 4NAOA 4R4ZA 3M99B 1WA6X 1H6YA 2YGLA 4OQ9A 5B3SC 3HB3B 1RUH2 4Y4RA 4XQWA 1ZL8A 2Z42A 3MIFA 4E4HA 5GLWA 3ZN5A 3OMAB 3ZYFA 1WLWA 4OQ8A 4OI4A 3E22B 3NWKA 5FYYA 1MSDA 4CE8A 1S1AA 1VB2A 1REFA 2P3JA 3FUOA 2BP6A 3RZZA 4LE4A 5HXMA 1Q6HA 2PTMA 5KC6A 2B1IA 1YI2V 1GUIA 2ZNJA 4LFBB 3T1CA 1QQP1 1BK1A 2D40A 1OVPA 1W8OA 4NWWA 4AHCA 1SQFA 4CDQA 5HFLA 4BLJA 1VARA 3H1JH 3M1HA 2CTPA 3AYCA 2R1DA 3SPCA 5DAWA 3CP1A 4JV4A 3F95A 5DEDA 1SRYA 2DDUA 4MW3A 1UXXX 2PHUA 2V73A 3IZOA 2GNBA 1PMJX 4DR3B 3KGZA 4CCKA 4DR1O 2EJ7A 2QWPB 2A0LA 1S0BA 4N9HA 5HI0A 1KU9A 3A8TA 3SJQC 1D4M1 3ZXLA 3BYWA 5HPOA 2VGDA 1TVKA 3AMHA 3CEIA 3VGIA 1LOFA 4Q4W2 4YM0A 1G1XB 4CRQA 3M8AA 1CESA 4NTXA 3ZCCA 3VKMA 3OUHA 3H1YA 4K9SA 4CUCA 5H9SA 2CTWA 3GGLA 5F3GA 1FXKC 3THCA 5G05L 3B7MA 3ZR5A 5CB7A 3N36A 5FR3A 3AC0A 3E6BA 2J1VA 1AI5A 2VL4A 3VBSC 4NB5A 1O9HA 2WNUB 5GW7A 1XOYA 1PO12 1WW7A 1WPBA 3FBYA 4YVSC 5CG8A 4S2GA 5FWJA 5IK4A 1T6BX 1LHNA 2ARCA 2PELA 3BU7A 5LGUA 3WEZA 2PAKA 1QCEA 3BVCA 4BB3A 4JI0O 1R64A 2OQ7A 3ZFEC 2ZGUA 3TN93 2X6BA 3OBRA 1O3SA 3J7NA 4PDWA 3SQOA 1HQWA 2NZ9A 1UX7A 3FFZA 4Q4X1 3H7YA 3RYFA 1OA2A 1XU2A 4ZU4A 4DW0A 5DUUA 3HKBA 2JRIA 3GDBA 4UCRA 2PHTA 3W7WA 3CJIC 4CU8A 2ZGQA 5FKBA 4NTWA 3BCWA 4MADA 3K4AA 4YNIA 2VVDA 1YDXA 2DF7A 4KQ7A 1W9YA 1VQ8V 1E1RG 2XHNA 4LJHA 3MW2A 1S4CA 5LHHA 1PL0A 3C3TA 3O0WA 4WBNA 3CXHF 5J96B 4JV5O 1RUD2 5FAXA 1DBNA 2JX9A 3OAAG 5CFCA 2ZKLA 5FNVB 3RWKX 1R73A 1FPN1 1ROPA 4X66O 4Q29A 5BNPA 3TNPB 2XR4A 1GNHA 3HAGA 1JMUB 1RGSA 1SDDB 4L2NA 1G9BA 1AYN1 3CDZB 1JYWA 2DYCA 1VF6A 4BK4A 2FB5A 4TT3G 1PNMA 3WNNA 4CXWA 3UGHA 4IV3A 2ZXWC 5I0SA 1AILA 2QQJA 4B4QA 2HH9A 1TZOA 5CEHA 4YVWA 1AJQA 3AKQA 3ABKB 3DN7A 3ES4A 1OZ0A 3ENRA 4EN7B 3NNJA 3TGUH 2DYRB 2DCTA 4JI7O 1F4HA 5DAQA 1GOHA 3WZ1A 3MDSA 5C5TA 3O1MA 2R7EB 2XT9A 1V6IA 3JBG2 1M4WA 3MLKA 2O57A 3EMRA 3O1PA 2YG0A 1EN5A 3AMQA 1RSOB 3RW0A 2Y26A 1OJHA 3OB8A 1P7GA 5L73A 1OFNA 3RZGA 1TUBA 1ULPA 2YUEA 2ZABA 2XKPA 1QR8A 3CCLV 3BIEA 4FLVA 2PHDA 4AFMA 5KA5A 1MZ5A 4J10A 2R9IA 5L7OC 2MEV3 2WLIA 1W2TA 3OUIA 2K46A 2D6PA 2FDJA 2UWCA 2P1BA 2JG9A 3Q4HA 4DMIA 1W0OA 3KT1A 3T4ZA 5IYZB 1VBC1 4CU9A 4TOIA 2H8PC 3VQXA 3AG3C 5IY5B 2JS3A 4DV4O 3FLRA 5IW0A 1LR5A 4YJ3A 3VZLA 3POWA 5FYMA 1LENA 5ISLA 4ISRA 4LIUA 3O1OA 5T5JA 4IXLA 4LEJA 1VBA2 5I0TA 1PIV3 3N4MA 3M7AA 3O0VA 4K8XA 5C8CC 4ASUG 1GH6A 3SYCA 3K59A 3MEPA 4RGKA 1Y6XA 2RMU2 5GLUA 4JI6B 2W91A 1YRZA 5FZBA 1D4M3 1UY0A 1LOGA 5FY7A 2ILMA 1DQ1A 2Q1ZB 2M6YA 3WP3A 1FXHA 1RMU2 4XDLA 4FZ1A 4QHZA 1NE6A 3B2EE 2JIZG 1UZYA 2C5DA 5FZFA 2EZOA 2RDSA 3ABMC 1YHQV 3SLIA 4PDLA 1I1EA 1AR61 2DVGA 2WO2A 2XQRA 4PI0A 5C4WC 5FXXA 1R3JC 3PMSA 1O8SA 5FMDA 4LF4B 3H7JA 4LORA 3I3MA 4FP2A 1JX9A 3KM5A 4BIZA 5JIUA 1Y67A 1OA3A 2A3XA 2P3KA 3P30A 2H6CA 1XHZA 2WKKA 5C9AC 3UL2A 3RMXA 1CAXB 4JI2O 5FPVA 4KHPB 2UYAA 3H8RA 2FDHA 1O59A 3NRUA 5LA0A 5FYIA 4LUKA 1H9PA 2Y6GA 3ZFGA 1KGYA 1YYNA 3ZKYA 1BQPA 5JI7A 4YY3B 4PI2A 1PGL2 3JU9A 3OEEG 4O4LA 1H4HA 2GAUA 5FP4A 4JGZB 3UT5B 2XONA 4JDOA 4JKKA 4B3SO 1BHGA 4LF7B 1C4RA 1Q8SA 2XMLA 3BGAA 3AYEA 5CFDA 4XUOA 4Q4X3 2WIIB 2HWF2 1U5XA 2E31A 3LZZA 3DXRA 2FCVA 5FPBA 1LJ7A 1RUJ2 1O6UA 2WLMA 4CYDA 3KF3A 1UKRA 3I97A 4K7JA 4GXLA 1ZAUA 5FBJA 4LLFA 4NXMB 4FP3A 2A5ZA 1K12A 2ADEA 3SCGA 1OT5A 1HDKA 5HV4A 1ZA4A 3T2MA 3WD5A 4G2KA 5LP6A 3KS7A 4AI0A 4ET7A 3NNGA 1NA1A 4LXLA 4FM0A 2RR11 5C8YA 4QKBA 1MOFA 5FZ4A 2GN7A 1FXVA 5CA1A 1KEXA 2O8QA 4CVUA 5JOYA 3ZRXA 4PBOA 5FZMA 2B5HA 4I02A 2VBDA 3WW4A 4B3TO 2IBZH 1Y76A 5DDJ2 1UOGA 5CBGA 3PVOA 1XBLA 2R9RB 3R0RA 1ZBE2 1PL4A 5JWPA 4MSWC 1SFPA 4QPIB 2B42B 5GZEA 1BL8A 2HVKC 3F7YC 4PA3A 3K5MA 1OKOA 5K8SA 3JD3A 2NNUA 1AVMA 2KB1A 4E2SA 3L2HA 5IWAB 4TZDA 5L3GA 4CP9A 2PN5A 3PVNA 1W28A 1RUF3 3AK1A 4CZSA 2VD7A 2JB4A 4DV2B 1W6MB 5BR8O 5GONA 3D6EA 4HNAA 1M56B 3H9AA 3N7LA 4X1KA 1VAMA 5D8AB 4FPJA 2PI5A 2IU3A 1UZ0A 1LECA 2OYZA 2AH2A 3PJQA 2C24A 1HRI2 5EWSA 3SR2C 1XPWA 3VDDA 1PV0A 3LNNA 4MVQA 2VOWA 1W8NA 2WAAA 3WW2A 2VS0A 1H0BA 3GCXA 5DUXA 3KZIZ 2ZGOA 4XF4A 2AZ0A 2ZE6A 4FM2A 4YGEA 1JYVA 1AR81 2QDOA 1W9TA 1VBD1 1RVF2 2E32A 1PM7A 5LA2A 1NCRA 3WCSA 4LF8B 3K77A 2QQPA 2LFSA 1YVWA 4GX0A 5ABJA 1V6JA 1U96A 1ZZBA 2DVBA 4HPKB 1YJKA 3O14A 1AR72 2UXXA 1K5MA 4Y5Z0 4IE7A 1YF2A 2A3YA 1YI7A 2QKDA 4YARA 2ZE8A 3BKZA 3SJCC 5A3TA 3AK3A 4JZ2A 3WG7C 1VBC3 2GNMA 3NVCA 4LNVA 1ULGA 1C5IA 4FIPC 5AC91 2Y34A 3ZDSA 4A7KA 3P3PA 1IPSA 2DBNA 3USUB 1XQ8A 2UUAB 5LMNB 4HSLA 5JXJA 3RZJA 4BQXA 4DY5A 4EN9B 3I2FA 5CA0A 1CAWB 2ZNIA 3PDQA 2O1QA 3T1HB 2VOVA 1PHMA 5KAIZ 3J7MA 1UKGA 4LKEA 4CUGA 1J58A 4P9LA 4DXSA 3T4VA 4OX9O 4QE9A 4XTMA 3W7TA 4OVEA 1QNWA 2Y0IA 3ZYHA 1O8PA 3H8OA 4UV8A 2GH2A 3WG3A 2VTXA 1M93A 1OUSA 1J3QA 4DUXA 4I2OA 3AKTA 4DR7B 4JF3A 2ZMLA 1CJDA 4ZKIA 1H1AA 4URTA 5FUNA 1R082 4QXBA 4GT1A 4FOQA 4J9YB 1B35C 1RHI1 3ABZA 2GSMB 4GD4A 2WSSG 1ORQC 1JOBA 5CISA 3ZN6B 1V55C 3NV3A 2EULA 1HW7A 3E6DA 5FQ0A 1WMXA 1UD1A 3SJAC 1XNBA 4CEWC 3KHCA 2Y64A 4G9SB 2Y0OA 3U4XA 1HRV1 4CP2A 2BNNA 1HXS3 5KXEA 5FREA 3K46A 1R3KC 3WFVA 4LTAA 4P02B 2QQMA 3QVNA 4MGIE 2F4VB 3C7EA 3VBFC 3LE0A 4CS3A 3WUCA 4BQ2A 1ZREA 5HFMA 2BTQA 1N36O 4NHKA 5EQUA 5E16A 2Z0AA 2YXSA 1K42A 2ZOEB 3LIHA 1YEWA 1DF4A 5A3WA 1HB4A 3O5SA 1VRH3 2E9QA 1WB7A 5JR2A 4GKXA 1AR91 4NIIA 5T5PA 1U0AA 3M7MX 3OY8B 3VQVA 3RYHA 5IDJA 3A4UA 4L11A 1F4MA 2HEPA 3VBOA 3VD9A 2E63A 4DR5O 4Y1YA 1H2MA 3FYEB 4MSVA 2RHPA 3MD0A 4FOVA 1K8AW 4IT5A 3D3IA 1MABG 3S0MA 2D2CB 3SYAA 4U3JA 1EFRG 4IIJB 4K35A 2QM8A 2HHHB 3J26N 4KP4A 4LP8A 2P06A 3BB6A 3EVKA 1C1LA 1WLEA 5IJ0A 3E8HA 3HKEB 1ZBA3 1E79G 1TME1 1QGLA 3HNMA 1PK6C 2ZHNA 3FB6C 1CD3G 2EIKB 3U75A 1J3RA 3FHIB 4CS4A 1YFYA 5FZOB 2O14A 5KBFA 3OMIB 3OCPA 1S0GA 4MVMA 2Y38A 1JYXA 3TK1A 4XBLA 1AI7A 2CTQA 2X5IC 1OOPA 4E4SA 3H1KH 1DYKA 3B00A 3POBA 3ABTA 4O2AB 1RPRA 1BJQA 5BYNA 1GO3F 2DYSC 2EZPA 2WJSA 4GX1A 2WLPA 1FOD2 4FPPA 4E4DX 4LWSA 1I5XA 1AROP 4I50A 2BFUS 1FJGO 4FO9A 4RA0A 4NAMA 5EYYA 2F43G 5T5LA 3T4DA 5DG2A 4X1IA 4Y3OA 5F37A 2JDKA 2LTNA 4LHNA 3OD4A 4QXHA 4YG0A 1V6NA 2BJSA 2X05A 2GTSA 2F4LA 2Z69A 3OGVA 3D82A 1FATA 4FPKA 2HJDA 1JVMA 4X9QA 2KKWA 5FZKA 2W1SA 2FMYA 4DR2O 5BNOB 1UYPA 4BQYA 3HR9A 1WJZA 1W6QB 3AP6A 2FDIA 2SBAA 4KG8A 2RS11 5FY5A 3B02A 2Y6HA 1J1TA 1VR3A 4W6WA 1NVPD 1N34O 2CWMA 1POV1 1W05A 4LQRA 5JXIA 1CQ9A 1H2LA 1SA0B 2JG8B 3ABLC 3A0NA 4LBOA 4HVOA 5FLJA 1Z0HA 2F6BA 2GU9A 5JZGA 3AKPA 1SZXA 3T1YO 5EJ1B 2FBEA 1HR0B 1DQ6A 4CCDA 1QVGU 2XJQA 1L3JA 3IPVA 5DECA 2RM21 4P9XA 4XJ8A 4O4IB 4ZHQB 4ZPIA 2BZDA 1W6OB 1OA4A 2N05A 4WVVA 4I30A 3OPTA 1O3QA 4MVOA 4DS0A 3K4ZA 4UB8Z 1P8JA 4GZRB 1WBFA 2VCAA 3SPGA 3VD4A 1D2QA 4JQRA 3AG1B 4DXTA 2PQQA 4I0XB 3RS6A 4PHZA 1BE3H 1D4M2 3P5BA 3CKHA 1KYOF 2FD8A 1AP6A 2DU1A 1POV0 1JYTA 1JHJA 1RIRA 5ACA1 2BTVC 1JUIA 5D5QA 1UWWA 1KJLA 1IPJA 1F5FA 1LU2A 3AZVA 1NOVA 4B4RA 3V65A 5B3SB 1C57A 1HRV3 1RUI1 1TMF1 3K57A 4JTCB 3RZMA 4AFAA 3WSOA 2XUEA 2KXLA 4CXYA 2JENA 5FYHA 1XYNA 2GTAA 4QHOA 2ZMKA 1ZRDA 1QJY1 1XMQB 3GZUC 2GMMA 3L2YA 3SXWA 1WCQA 2QTWB 1HJGA 3ICXA 1RYYA 4CCOA 3ZMOA 1I5ZA 1W3VA 1UIJA 4JGYA 1YJLA 1YJNV 1ZYBA 4ZZ5A 2UU9O 3S5QA 4Q0SA 3WQBA 1UNBA 4XCAA 4CEYA 2HKXA 2ZX1A 2GDSA 3LFIA 4Q4X2 4AQYO 4DRRA 1TGOA 1IS3A 2ZS6B 1GQGA 5IVVA 3ZRVA 2P17A 1XSQA 4HZ3A 5J2UB 3ZIWA 4X64B 3MYXA 5EFUA 3JASA 1BLZA 2Q5ZA 2XJUA 3LNMB 5A9GA 1AXYA 4GWIA 5A32A 2EXJA 1OF3A 4B29A 5IVJA 2WLLB 2GC0A 4WCEV 4HAMA 5LYJA 4L99A 2LJ2A 2IXCA 3LA7A 4RN5A 2QM7A 3KMHA 4N43C 3OM3B 1ZLZA 2DCKA 2VU9A 3ECQA 1FPN2 3SGIA 2HWB1 4LBQB 1ALYA 1R6KA 4YM1A 4GKKB 4CDXA 4NIGA 3WW3A 1FXKB 2DVFA 1VQOV 4EN8B 3RZKA 1AYN2 1P84F 2A6WA 3HQRA 4PCRA 4ASKA 1IVSA 2ZM6O 4XUQA 4P5YA 2WWSA 3W7UA 3VBSB 2Q73A 1VPHA 3O1UA 1MS8A 1NX9A 3L9JT 3WQ0A 3FAVB 3VQYA 4Q0QA 3ETEA 1V9U3 2VMEA 5JVVA 3ZFEB 4AEDB 4AEKA 4NROA 3E35A 2NLRA 1POV3 4J7ZA 4JGSA 1VQNV 2CU5A 5IUQA 2PXJA 5KA6A 2XB6C 2UXBO 5A7SA 4PA7A 2F95B 2ZGLA 1VF6C 2XVKA 1DQ2A 4XILA 3CJIB 2CE4A 4IV3C 4HK8A 1PZ7A 1SLLA 4DV3B 1FAFA 2CDOA 3WHTA 1Q82W 1GRJA 4DV6O 1IBMO 3BPSA 4YVWC 2AHYA 2IXIA 3LDEA 2OYQA 4FSJA 3CXCU 3AMMA 4MZUA 1ASJ1 1VBC2 1XSRA 1H2GA 3HQXA 4UCTA 1RUE1 5ITZA 2ODMA 1OD5A 1MEC1 1BVVA 2UUCO 1WA4A 3W5MA 3CRQA 3WDYA 1US2A 2P90A 5EBMC 5C3PA 2A7AA 5C3RA 2JJ2G 4YW5A 1ZZCA 2YROA 3FHAA 4BIUA 5J1XA 2DUPA 1YXWA 1KKDA 4NRPA 4XOGA 4JTNA 3GBGA 1V6MA 4DUYB 1DYOA 1Y9QA 5E89A 3BTYA 3G6BA 1I9RA 4B3MO 1S77D 4LOSA 4QB6A 2ZXWB 5FL7G 4W6YA 4CDUC 4YW7A 5IE9A 5EIBD 4RR3A 2UXDO 1RUI3 5H9PA 4XTPA 3VUOA 3N9QA 1XOUA 1AR62 4XCBA 3LDBA 1ULDA 5FLHA 1PNGA 3FZ3A 4BMBA 4TUYB 3SMHA 4BR6A 5T3NA 3QD6A 3NAPC 4AILC 1PPJH 3VBRC 1LRHA 2NN4A 1GM8A 2PHXA 2JDYA 5LMUB 2VMDA 2JDHA 4QX2A 2HR3A 5I8YA 4UCOA 5FJKA 2QWQB 1UYXA 4QDSA 1R6TA 1NR7A 3QG5A 2XVGA 3OEHG 5A7QA 4XVHA 5F3EA 2V09A 4XETA 5L7OB 2EF6A 1OCZB 4GKYA 3I2JA 3ZXFA 1SZTA 4UBHA 3CCVV 1VRH2 4DV0O 3T1MA 2FKXA 4XYXA 4LT5A 4NTYA 2BOJA 5T5OA 1DFQA 1SFNA 3AG3B 4JI5O 1GAXA 4CCCA 2V72A 2XUMA 1UPSA 4JI3O 4JYAB 2QZ2A 3NV4A 3B9CA 4LPLA 4DB5A 2QEXV 1OQ1A 1A8DA 1UJWB 2VRZA 3F5WC 5C8CB 1Q7YW 3U11A 3DYOA 3ZMVA 2CHHA 4Y4YA 2WSUA 2OIGA 4C91A 4ZU7A 4P14A 2RR12 3KV5A 2R30A 3WF3A 3VBUC 4EROA 1ZBA2 3ZYPA 3Q8BA 4YG6A 4S2DA 2XHBA 3SEEA 2DMXA 2P6HA 5TISZ 4IHJB 1IQDC 2UURA 1KECA 1TVGA 3VZNA 2LGWA 1RUG3 4WM7C 5CFDC 4IV1B 5BNQA 3ABMB 4BW5A 4UYBA 4RO2A 2ZGSA 1IG0A 5C4WB 2OVUA 1HQNA 3ROUA 2P5OA 1OCOC 1PGW1 1W0JG 3BEHA 1YJWV 4FFGA 3FBMA 3APQA 2VZUA 4IYIA 1U5YA 1C8NA 3FYIB 2F4PA 2G9FA 1IG3A 4GZ9A 4K6BA 4A42A 4ZBMA 5A3LA 1W39A 3ZYIB 2KG7A 3QO7A 4AHXA 5BV6A 5FRAA 1AR4A 1C8M3 3S6PA 3D0JA 2C26A 2ZZQA 1O4ZA 4L0PA 3U1XA 5B1AC 4OHVA 1Q81W 2VZOA 2CTRA 1J83A 1QHTA 1QXPA 2FZ2A 2GSYA 1IXMA 1L0LH 2PYLA 1IXBA 2WN3A 5CNAA 3PUQA 4J6GA 1AR82 2ARXA 3BVOA 2F17A 4YZ5A 4W65A 1K5JA 1HJFA 2Y6JA 1THZA 3BA9A 4MGYE 4PA6A 1VMGA 3MW3A 2V4DA 4XMAA 2VZTA 5DG1A 4FOWA 3FFQA 2VXJA 1GBGA 5IAXA 1SZBA 4FAGA 4P2ZA 2B9VA 1L8DA 3WT3A 2CK3G 2OWOA 3E22A 4HFSA 2JDZA 4FQ4A 3WNMA 5AC92 2JDPA 3WR0A 3JSNA 2YU1A 2FQPA 3WDUA 2W5FA 3LD8A 4CCMA 1W04A 2VQEO 3AB0A 4H13B 1GU3A 1UN1A 3TEYA 1QHDA 2IM9A 3WF1A 5IK5A 5KHKA 1EUUA 1QJX3 3ORJA 4ZIBA 2W1UA 4DV5O 2ZIOA 3G4SV 3AYDA 2KR2A 5FYVA 4OHZA 3H42B 3FLPA 1K5MC 4TLFA 5A3UA 4D6QA 4K0KO 4X20B 4O61A 3JCIA 1UMHA 3VDAA 2E26A 4I09A 4EZ4A 3M3EA 4EWAA 1RHI2 2WT1A 3OTFA 1IS4A 1ENVA 4RWUA 3JD71 2Q4SA 1VQMV 4OYUA 1RM1C 1RUH1 4INDA 4BXFA 4IEXA 1S5LZ 4QX8A 3P32A 3HBKA 4ES8A 3H1IH 5A1AA 2Y6LA 2ZMNA 1HRV2 3DC5A 2VWKA 1QU7A 5JAXA 1W8FA 4A44A 4TV9B 2VQFB 4LKSA 5JPNB 3B93A 3PUHA 1JZ8A 1NE4A 2AHZA 4CDWA 2ZT9B 3DF0A 4B1MA 4MTFA 3O9OA 4Y26A 1VP7A 4JI4B 5TSWA 1OQEA 2E53A 2J1UA 1NQTA 3WDVA 2FZ1A 3NJYA 1UOFA 2IC1A 3WG7B 2VMFA 2ARBA 4LFBO 1AR92 1KS4A 3VKOA 5KMGB 1I94B 1AVBA 3RYKA 5KHHA 1XE8A 1N1VA 4A3XA 4BQWA 2CL2A 1AL0G 3ZHSA 4BK5A 1JJ2U 3LDKA 2XL9A 4J7KA 2WNUA 5EK0A 4RQEA 2X29A 2ZJCA 1OPMA 5I0UA 4LFAB 2XWBB 1D4VB 1SLBA 5JQGA 3S3WA 3ZO0B 3L75H 2BGCA 2WL1A 3R4UA 2CDPA 3QO5A 1TME2 4U2AA 2WZPP 4Z92B 2ZEXA 2P5BA 2Y4TA 3K75B 3MW4A 3UKMA 2D6KA 2HBUA 5IJ9A 1YQ8A 2WQ8A 1KRIA 4QT6A 5C8WA 3MFAA 2D3RA 4JRLA 1E5HA 3QH7A 1B35B 4EYUA 3VBOC 2DFBA 4KWUA 3QTCA 1N47A 1V55B 4UFLA 5EYXA 1GSLA 5F3IA 3CB2A 3DTUB 2PUSA 2EVXA 1AI6A 1QKQA 5BXZA 3OF1A 4CEWB 2V7QG 2YIBD 1PVC1 2YBSA 3K3NA 1R3LC 3NKTA 2W39A 4HG6B 3SKJE 1LHOA 5EBLC 3LUTB 4X1YB 1I08A 3IAYA 3E97A 1HN0A 1UMZA 1G6UA 2GC2A 2UXNA 3E8BA 4OPAA 4LIVA 3VBFB 5LL6Y 2KA3A 1QJFA 1KDMA 2VMHA 4ARXA 2CSGA 1K4DC 4YIOA 4OLLA 3OG2A 4A3ZA 3N9PA 1VMJA 5FNVA 4XW3A 3WY6A 1LGBA 1PMHX 3LPGA 1NTKH 1NTMH 4XMIA 1PO11 1ZRIA 4M3CE 1JPXA 1QU0A 5LBCA 4BCUA 3LOIA 4IYHA 3BA8A 4JVAA 2E76B 1AX0A 5L9VA 4AI8A 4QXCA 3ILFA 2YFZA 4M00A 1BT8A 3ZSKA 1L0NH 1XDCA 3ZDVA 2EBOA 1UY4A 2GC3A 5FZ6A 2XPJA 3E2EA 2EICA 4YM3A 2DU0A 2ZGMA 5BMVA 3KV9A 4Q0VA 2QE3A 1FFTB 2YXYA 4HETA 1YNAA 5L3DA 2HWC3 1PK6B 3E89A 4ONUA 1XQNA 3WP6A 4YIPA 3D3AA 2JDUA 2YY1A 4PLMA 4WVMB 3MIEA 4AHWA 2QQIA 1S76D 1O5LA 3MO4A 2RM22 4QQPA 2QWRB 1POQA 1PKXA 2HWE3 3ACIA 1RUD1 2X5IB 3VHNA 3SPHA 5FLXN 3IAPA 2B39A 3WP5A 3SH3A 3LSSA 1WN7A 1J5EO 2DYSB 2W1WA 2LM3A 3PU8A 2PHRA 5BPXA 4P5HA 4ASMB 5IYZA 4GH4C 1DTOA 1EUTA 2YXLA 2UWBA 4BA6A 2OCHA 1W8TA 2XH6A 1OC1A 1M06G 4O2BB 1G8WA 2XG3A 3B3QE 1JQ0A 4Q8KA 5JZGC 3W20A 4AAXA 4C1XA 1VQ6V 1COV3 2RDCA 2RNBA 2L6LA 5ACA2 4Y1VA 3OUFA 1T5EA 4CU7A 2R043 1NG0A 3CX5F 1AJNA 2VZSA 4D6TH 1AX1A 1RUI2 5LY1A 1TMF2 1R1BA 3OE7G 1VBE1 2CAVA 2UXCB 1AXKA 1W0NA 1FT9A 3PTYA 5HCHA 2D93A 2R72A 4MGSA 2YEVB 4UXNA 2EINC 3OUSA 3AG2C 4Q1RA 3TCUA 1LOBA 4CPBD 5F7UA 1VQPV 2WS93 2A6XA 4LF5O 2AUYA 5FZGA 3VQWA 4GX5A 3ABLB 3H9VA 2D6MA 4WBBA 1JFFB 4OI2A 2RCVA 4O9EA 2ZEYA 3O7OA 3I2DA 3GCWA 4MT8A 4UI9L 2FL4A 3JALB 4YZ2A 5A6QA 1CAXA 2MHFA 3ETQA 3T4HB 2A70A 2BGPA 1SDWA 4YLZA 4XUNA 3T2QA 1ZL8B 5FPZA 2RDQA 4RHV1 1AZDA 2E75B 4FPHA 4KG0A 4DO0A 4JYYA 1QOOA 5DZFA 4I9QA 4UCVA 1F4NA 4AVSA 3UT5A 2XJVA 3UT0A 2OQ6A 4XAAA 1QF3A 4J9ZB 2X09A 3RYRA 4N7IA 5E1AC 1DGRN 4LKDA 5H2FZ 2BGOA 4JI6O 2SLIA 5CIRA 1R093 5EC2C 3KCCA 4IGOA 4FPOB 4M3CF 4Y1XA 4HKWA 3K5OA 1ACCA 4QX3A 1X8EA 5FCCA 5H6RA 4CH5A 3AKSA 3GNEA 2UUBB 4LO6B 2RS51 1CN1A 3ACGA 1WA8B 5L3CA 1QJU3 1PVC3 4Y20B 5KHJA 3L74H 4QB2A 2QNKA 4X88A 5B66Z 1RUG2 3OEBA 4SBVA 4HKLA 1E57A 1NCQC 2QQVA 1DGLA 2HWB2 3LSQA 3VD3A 4BWAA 1OHHG 2Y69C 2WNVC 1RJ8A 4OZOA 3WF4A 1NH2D 1M56C 4KHPO 4QPIA 5F2VO 5D8AC 3WX5A 4V2VA 3SPJA 3LEMA 2WWJA 4KGQA 2D7FA 1DQ4A 1W59A 5LATA 4DZGA 4YY3O 2B9ZA 1CAUA 2VOKA 1TVKB 5FYZA 2KM2A 4Y5TA 4MVZA 5SV5A 4Q4V1 1RITA 4H2AA 4XJ9A 1WCDJ 3HD8B 1XHXA 5FYSA 1LGNA 4LF7O 5LA1A 1LHVA 3PHMA 2VCBA 1PNLA 2HWF1 3GZTB 1BZKA 4IE0A 5LRSA 3QH6A 3ZSJA 4B3RB 2ZKOA 4CCEA 3LGRA 1F51A 3ACHA 5DMYA 1RUC1 5GZDA 4I4TA 3K5NA 1BK0A 1O91A 2D3OW 4JV5B 1NBMG 2JVDA 2ZEZA 4YXWG 1LHWA 4XFFA 4NXMO 4WFGA 1MNGA 4YJ2B 4CC6A 2ZDIC 4X66B 4X8PA 3CE2A 3THTA 1X8MA 2W08A 1QH7A 1ASJ2 3HMYA 1RUE2 3ZLIA 5I91A 3C3VA 1NUKA 1MEC2 5DDJ1 3HKDA 3ZBHA 1ZBE1 5JCOA 2OUJA 3WDTA 2UYBA 2W87A 3ASNC 4LA3A 3KQRA 2GMEA 1JOJA 1F8VA 4YG3A 3N3HA 1I5PA 4N43B 4AHZA 3UJQA 3RYFB 1N3QA 4D69A 3RBZA 3HKBB 1HNXO 2CAZC 4LF6O 4GWMA 4IE6A 1RUNA 4JI7B 1UY1A 1ZVFA 1TUEB 3USUA 1OLQA 4DV2O 1N32B 4FLWA 1XNRB 1CAWA 2O8OA 4QWNA 1QNMA 5CN0A 4FLUA 3AZZA 4O65A 1WLCA 2ZHLA 1UY2A 1UU6A 3D36C 1LOCA 4RSUA 1QBZA 3W59A 2GZWA 1AL23 3W7SA 4MO3M 1VBE3 1EYBA 1N33B 3KV6A 1EAH3 1OI6A 3G6EV 1S2KA 1JH5A 3MHHC 4PQ9A 3A0BZ 4I0WB 3S30A 3JUUA 3CRCA 1MSWD 1H6XA 3DXTA 1W2BU 4JHZA 4JI1O 2DVDA 2PQSA 4ES9A 1BGYH 2YYOA 4Q26A 4HSJA 1REDA 1BCCH 4DV4B 2DCZA 4DO2A 4H14A 1DIWA 2Q0AA 2Q1MA 4LF8O 2Y0PA 3OGJA 3RYIA 2Q1FA 4F83A 4HT1T 4QQ2A 4BIOA 3PUIA 4U7NA 3O0XA 2VUJA 2P7TC 3ZN6A 3U37A 5A80A 2ZGKA 1SLTA 4IV3B 1DU3D 2XLAA 3S5AA 4CZZA 4Z07A 2JIGA 3EHBB 3ITQA 1CP9A 1EZVH 4RR3C 3MUY1 4XF1A 4YVWB 1HNZO 1OXCA 2YPJA 1LUVA 2RMKB 3KT7A 4YZ1A 2DBIA 4XFCA 3MLJA 1B06A 1T6GC 3WINE 5H9CA 3D8CA 2UUAO 4FTBA 4M3CB 4F8AA 1UYZA 4X62B 2Q7EA 2JKBA 1K5SA 3T1HO 2WZ8A 2QDRA 5FMCA 4XIOA 1NJIW 4H37A 5JVDA 1KD7A 2Z2SB 4RYDA 2ATFA 2KD7A 4PJ0Z 1GOFA 3K79A 3OY8A 4A5UB 4R52A 4ORFA 5B1NA 3FJSA 3VZMA 4K8RB 2DTYA 2I45A 3I3BA 1PO23 4UVAA 2RS53 2RG4A 2WLIB 2E74B 5A3NA 5G04L 1PNKA 4CDUB 3I56V 2XAHA 4DR7O 4Z1MG 2JG9B 2XWJB 3Q4HB 4QX7A 1EN4A 5FZ9A 1JU3A 3CJXA 1UMIA 2ZX4A 3OR6C 3HWJA 4BWOA 3HKEA 3ZYBA 2XLFA 1TQ5A 3DPRA 3GBWA 2WZR3 3RFRA 3MPBA 2Q4PA 3P6BA 3NAPB 1GZWA 5T55A 3VBRB 2HLEA 3CJHA 2E7TA 4FLTA 5CMUA 1ZRRA 2Z4FA 3PJYA 4CH4A 1VLNA 3OUJA 1YWKA 1URFA 4O2AA 4Q4V3 1OH4A 2ZX0A 5JOXA 4Q8LA 4E2LA 2UWAA 1Z5VA 3IDCB 1H38A 2R0HA 1WD3A 4RL7A 1FX5A 4L87A 1X9PA 3DL3A 5CVRA 5LCWL 1RUC3 4QQHA 2CWSA 4P9YA 5ERLA 3M70A 4BM8A 2XTAA 1JUHA 2TBVA 2QCSB 3K04A 4D3WA 3TN91 1UPGA 3AYAA 1EV13 1FNYA 2BDRA 4B3TB 4E2QA 5F5AA 4DK0A 1QH6A 4XIKA 1OLRA 1QDOA 5EIBC 2HHHO 4RGGA 4AWDA 4HANA 3DYPA 4HLTA 2IJJA 3RWRD 1DP0A 2EXHA 3KQ4B 4CH6A 3BIWE 5BNOA 3VBUB 1W6QA 1WLTA 2DWDC 1NY71 1ZZ6A 2HWC2 4JTOA 3TXQA 5DAXA 2IXHA 2VCMA 3LDRA 5CFDB 4G28B 4WM7B 3FL7A 3DXRB 2A06H 1W6PB 4FVMA 2ZKNA 4AOCA 5IAVA 2AYHA 4FCAA 1OCOB 2D6NA 2VULA 4BE3A 1VAKA 1SQQH 1SQBH 1ENRA 2AXTZ 4NUBA 3JATA 5JMCA 3C2UA 4ZHQA 2BV4A 4CH3A 4JPRA 1YITV 1XI1A 5LEKA 3W58A 3H01A 5J48A 5C8YB 5FWEA 5CA1B 1EP0A 1MS5A 4D7TA 5B1AB 2OCCC 5CKMA 4J42A 1COV2 3JD72 2WYSA 1TAEA 1Y76B 1C28A 1RC6A 2CAUA 3TRSB 3K9AA 4GIQA 4FTSA 5EBWC 3RVYA 2WT2A 1ZZ7A 3A22A 1ND2A 1CZTA 4GULA 1K33A 4JI8B 4BDVB 5L9BA 3TOJA 2YI9A 2RQ6A 3N7JA 4DXWA 3B01A 5FZHA 1QJEA 5GONB 1SQVH 2R063 1GFF2 1S5JA 3BN6A 4HNAB 3SPIA 3GF6A 1GK9A 3R4SA 1KJRA 5K4LA 4GMP3 1T2XA 3UETA 1ZRFA 1LU1A 2C9AA 2MEV1 2OW4A 1XREA 2WRAA 1O9GA 2BQPA 5FZAA 1WW4A 3WG1A 4MGZE 3AXDA 5LA6B 1PZ8A 3I59B 4FZ0A 1GOGA 3ZHTA 3QACA 4TYSA 1B09A 3K03A 1S0JA 4YW6A 4TQDA 2Q8EA 4IEWA 4X89A 3TB0A 1ZRCA 1R1A3 4PF5A 3E1F1 1H30A 2Q67A 5JXHA 1PIV1 5E1RA 4W6XA 3IMMA 4B8EA 3JD2A 1K5MB 5J09A 2XQXA 3VBHC 1IHMA 3H3ZA 1HB2A 4QAWA 4K8FA 3TAYA 2R1BA 3I8TA 1MS4A 1J1LA 1N3OA 2ZACA 2AEYA 4F4LA 4A6SA 3PVEA 3ZXGA 4AAPA 3AZWA 1YC61 3AEIA 5CA0B 4TWKA 1RM1B 3AX4A 3BTAA 1MG1A 4WFEA 4IEYA 2ZPXA 1QJU2 1PVC2 2W95A 3CL1A 4WM8A 1RXFA 3UKNA 4XFIA 1YCIA 3G80A 1WLDA 2WLLA 3UO3A 4KU8A 3WCRA 3OGRA 3WNOA 4FTEA 4DR5B 1JZ7A 3CPWU 1L7QA 3B09A 4HN1A 1OLMA 2P2KA 3NNMA 5J37A 5FY4A 4EEQA 5IVCA 2BNMA 2ETNA 2QVSB 2OA2A 5KHGA 1F9KA 2AREA 1W8WA 4FXGB 1FXKA 1LB2A 2ZA9A 2PZSA 4ZOLB 2RV9A 4DEVA 2GUZB 4F6RB 5CU1A 4UV9A 3ELNA 4AEDC 2JIJA 4YGDA 1KBHA 2R0FA 3IMNA 4MS2A 3DGTA 1GN6A 1OH3A 4BZ4A 2LRPA 4W4LA 5FO7B 1UW8A 4CCLA 1A34A 4YVSA 3UKVA 4AGGA 2Z3YA 3NJVA 4KGGA 2HFEC 3SH4A 1W2NA 4X64O 1CR7A 1F2NA 2EIEA 2RE9A 1R3IC 4IEUA 3K9SA 3QNEA 2WO3A 3SH5A 3ZFEA 1XYPA 3IIAA 1D0GA 2H6BA 3ZJZA 2V1DA 3VZKA 4WVWA 2YDEA 3AZXA 4E4EA 3RWNA 4U36A 5D1IA 5J2TB 3TBDA 2LFRA 5BNNC 3RYHB 4ZXKA 1HX6A 3K4DA 4DUVA 3VBOB 1IS5A 1K3IA 4DUZB 1FXZA 3PN1A 1W6NA 3H0OA 1ZA7A 4LH7A 4PV1B 1HLCA 2FMDA 1FD9A 3WNPA 2C4XA 2ZTNA 5J3UA 1NQDA 2LP7A 3JAWB 3G67A 4AGVA 5FFOC 4D94A 2IJKA 5JH7A 4I9WA 1RUF1 5EJZB 2QKSA 4QPKA 3OYWB 3H1MA 2VM9A 3K0GA 4H33A 4R8CA 4Y22A 1URXA 3I2IA 3ML0A 2FDKA 1NAEA 2P6CA 1N34B 3ZHVA 2BSKA 4ZI7B 4M0HA 1GZTA 3CCUV 3F7VC 3VKNA 2J7MA 1ZZ9A 1VBE2 3NMBA 1BBT3 1SHWB 2VMIA 2A75A 3WW1A 1U12A 1LKNA 4Z8BA 3AP9A 3IJ4A 5KXDA 5EZYB 1RJ7A 1AYM3 1A6CA 1GLHA 4LWSB 4KI5M 3ZFFC 3FC0A 4XAEA 3N2GA 3ME2A 5FYCA 5L3EA 4RQPC 5I8TA 4EB6B 4X1IB 4G4FA 4IW3A 2Z5UA 1OCZC 3B8MA 4RGAA 1LULA 1QWRA 2QWNB 5A1LA 1WB8A 1DYPA 3CC2V 1GANA 4IQPA 3HN3A 5LK7B 3ATGA 4FAHA 3C7GA 5EHDA 4MUVA 5ANQA 3WUDA 4RHV2 2BWAA 4E8DA 5L9RA 2HP8A 2G1MA 2XVLA 4XFAA 4BQ5A 1BKZA 5LA9A 1H1MA 2VMGA 3B5LB 1MR5A 2P6JA 3CCQV 1BHBA 3I3DA 4QIWF 5KX5B 4AQSA 1CPMA 4GH4B 2DUQA 4DUYO 4BQ4A 1XE7A 1K5QA 4COYA 5GZFA 1DZQA 5JZGB 3E6CC 5KLVH 1SPPA 3WXPA 3IPVB 4CA9A 2RS52 5C8CA 3OFNG 4IV1C 4BQ1A 1IBKB 1IKQA 5A6ZA 3GALA 4A6OA 4I55B 2XAFA 1N3PA 3THPA 1XXNA 4MOAA 3SC7X 2RS33 1KITA 4IGPA 4Q2FA 2Y60A 3TETA 5CZKA 2LALA 3PIJA 4FFBA 3ASIA 1K4CC 1K92A 2EINB 3LFMA 2WZR2 3AG2B 2E5LO 5LMUO 1BMV1 3E8FA 1HXS1 3LPFA 1VQKV 3I49A 5C4WA 4OGQB 1YIJV 4XEZA 2XASA 4Y1UA 2YBKA 4GCZA 4UVBA 5HV0A 3IB3A 4OXSA 3KHBA 2UY9A 3R66A 1KKCA 1W06A 3TEWA 4Q4V2 3UM7A 1VRH1 4NVPA 5CKQA 2HLDG 2VQ0A 2X0LA 3J7HA 5C9AA 1XNCA 2P3IA 2ZGTA 5LBBA 2ZR2A 4N53C 4DW1A 3CLPA 1V6OA 3WLUA 3T0AA 5E6HA 4YHHB 5JOZA 1RUC2 4LFCO 4BHPA 2WBKA 1U97A 3O65A 5K1PA 1CAVB 3JQXA 3SYPA 3WV6A 2GP3A 5A7NA 5DUVA 1HB1A 1WMDA 1SESA 4KU7A 3KCXA 3KZ4C 5T52A 2VNGA 3LOBA 3JCZA 4P30A 4JYCA 2PAMA 1ZBA1 5FZ3A 4OFGA 2QGNA 2D43A 4WF9V 3ZSMA 2NLJC 3NKGA 1F7YA 3AMNA 3I3EA 3OSDA 3NNLA 1NZ6A 4BOWA 1DZRA 4EN0A 4HVQA 1NVPB 3AZYA 1NCQB 2B46X 1S2EA 2WYFA 1ND3A 2IFWA 3OGIB 4OUMA 1GZCA 1Q90D 3IDBB 1XMOB 4KNCA 2BOBC 3OEAA 4C90A 2J1AA 1UFIA 5CA3A 1SCSA 4AK3A 1YO8A 2Y69B 4HONA 4GYCB 3ZMUA 1YQ5A 2WNVB 5A33A 4R9DA 2R073 2GHYA 1S0EA 4BISA 3IAQA 3MV01 1LOEA 2GN3A 2JXAA 2ADDA 2HWD3 4FMTA 2NP0A 2OXBA 5FZIA 2XLGA 1JN2P 5LYJB 5E88A 1KB9F 2L35A 5FMBA 1W2AX 5BUVA 1EY2A 2AR6A 2YIDA 4DV6B 2ENRA 1W8ZA 3SKVA 4X20A 1JCHA 3ILNA 4XF3A 5JSRA 3V0BA 2W0XA 1YQCA 2G9GA 3CS5A 3GHNA 5FY9A 4D6RA 4QPWA 1UAIA 1SLAA 5FY0A 3CHXA 3MZHA 3WOGA 3AG4C 3CQOA 5APAA 2W46A 4NPRA 5H9QA 5HBAA 3H8UA 4M01A 4AFDA 3HBZA 4GWNA 4R4XA 3THOA 2D97A 3BOPA 2Q68A 5J9PC 1H8TA 1PM4A 1QXJA 2QZ3A 1A32A 5I8SA 3N2KA 3A21A 4UW3A 4AQ2A 2HJFC 3ASNB 3SDLA 3B4SA 1J95A 4TSFG 4DXRA 2Q6AA 1UX6A 2DCYA 2P4EA 3DGEA 4UVCA 4PF1A 1Q56A 3NO8A 3RGBA 4E9KA 3ZXEA 2LW8A 5K0UC 5KMGA 1LOAA 1JODA 4URAA 3H1LH 1XRUA 3JBG3 1HWYA 1Z5WA 1R1A2 2ZHKA 1G86A 4R9AA 2LQTA 4QKFA 3I4IA 2AZ5A 4QX0A 1JZ6A 2H3OA 3N9LA 1SETA 4NRMA 4AI2A 1WGPA 5LY2A 3NXSA 1Y9GA 5EXOA 1KQSU 2WQ4A 2HBTA 3TEZA 4J11A 2R16A 2BCCH 1J84A 2BNOA 3IKWA 1FYUA 1LHUA 1SEFA 1NXMA 1MS3A 1HNWB 4D7SA 3L9DA 2UY8A 4GB31 1FMD3 2VW0A 4KBBA 4META 5DAVA 2VBPA 2B4KA 4JI5B 2VQFO 1D0HA 4JHTA 4S2HA 4IL6Z 5AFBA 3CCEV 1H8EG 1A78A 4UFZA 1MZFA 4JKMA 2DTWA 4RR3B 2WDBA 2HVJC 4X1YA 3UCSC 1BXHA 1YJ9V 1MS1A 2JEXA 5KHIA 3PTRB 1PZ9A 1RMU3 3I3QA 1OHFA 3CIHA 4DR6B 1SLCA 2W1QA 2CGPA 3S3XA 2VECA 5FZDA 2IH1C 2ERFA 2IVIB 4GJZA 5L36A 3TN92 1Z78A 4DYLA 3B40A 4IEQA 2IW5A 5FXWA 1Y4MA 4R8HA 5LWBA 4CXXA 1XB9A 5FZEA 1TNFA 4Z82A 5IYDO 3STLC 5FXZA 2GP5A 5A3OA 5JOWA 4RS5C 1D7PM 2XOMA 2A73B 2JKXA 3STZC 1AF9A 4YFWA 5JCTA 1UY3A 2W3JA 3B8NA 5FV3A 1LR1A 1NY72 2EIMC 3GJAA 1FNZA 3OD0A 3HN1A 4MTOA 1QDCA 4C0HA 4I5SA 5FMOL 2HG5C 4QQOA 4J1WA 1JZ2A 1Q86W 4XFHA 3AMPA 5GKAC 2P4KA 4SLIA 1SACA 4DRXA 3THDA 1AI4A 1XL6A 1B6QA 4WVMA 4IEPA 2JGDA 4XDKA 3AP7A 1VQ4V 1GQHA 4UOJA 4AFBA 5T54A 4FBFA 2JECA 2K9PA 3POEA 1RUJ3 2PGGA 1VE0A 2X5IA 4M0NA 2WUHA 1WCUA 5J98B 3FHQA 1YTFD 4X8NA 5LBFA 3CNAA 3D5OA 4NXNB 2XJSA 1JXNA 1W0KG 1EPWA 5FP8A 2ZGPA 3ZIXA 3DXUA 1SFYA 1B04A 2YC4A 2CH7A 1UZVA 1C3HA 1DLCA 4O2BA 1VBB1 4AF9A 2ZGNA 1QR9A 2XDVA 3AK2A 4Q4Y3 3AL5A 2QJ1A 5JR7B 1V9U1 2D5HA 4QPGA 1Y4WA 3EO6A 4J80A 1ZNPA 1SG3A 4I0AA 2VH9A 1CX4A 1ZX3A 2TNFA 5CA6A 3RT3C 2IXLA 4QDQA 2QDNA 1EN6A 3FB5C 3A23A 1CJPA 4NPLA 4XABA 1Q3EA 4LMFA 3NSTA 4QPJA 1G9CA 2YEVA 4YW1A 5C70A 2ADQB 3ZX6A 1V6LA 4UAPA 2MEV2 5KXCA 2NMOA 2ZHMA 1K97A 4BXSV 3SHRA 2QQUA 2QQNA 1VMHA 5LZ6A 1LGCA 4PIXA 2NN8A 1G9DA 1D2SA 3EFFK 1ND2C 3N9NA 2VE1A 4LBJA 4FFKA 5IYCO 1JFFA 4BU2A 4IDZA 4DY3A 4KWKA 2P34A 3RQ0A 1NU1H 1X59A 1BCXA 4P9JA 3JALA 3HVDA 1JS9A 1PIV2 3EBRA 4PD4F 3ZHRA 5A7OA 2BBAA 1RVF3 3JARA 1ONAA 3GBFA 4YM2A 3URFA 1X36A 1CIWA 1COWG 1NR1A 4MGKE 5CBFA 5JSPA 4CDQC 4XBNA 3U78A 2OCCB 1AR73 4Y24A 1OFSA 2GDFA 1WW6A 4AVTA 4UF0A 1H2SB 4GWJA 5IWFA 1E1QG 1YFXA 4GB33 4ZZ8A 4DR4O 1GMGA 5LXTB 4JTAB 4GKJO 4DIQA 5C3QA 2OS2A 2UXCO 5B1BB 2PY5A 1HV1A 4COVA 2RS32 3FX7A 3AJYA 1GP5A 1WA8A 4F3JA 3JCUZ 4Y20A 1YLLA 1PGSA 2WA4A 4J1XA 3KD4A 4CU6A 3CCRV 2QKCA 1XNTA 1YQ2A 3T0BA 4D8MA 4JQTA 5FOJB 4YFZA 3PU3A 1Z7S3 1LOFC 3LKJA 5IK7A 1S0CA 1GKFA 5EV7A 3JZVA 3ZRWB 5FZ0A 2ZXQA 3EB7A 4LC1A 2V4AA 1SBFA 1IURA 4DK1A 4LNUB 1R083 2E51A 2YZ4A 4TTGA 1Q6UA 4MGTA 1RTVA 4WM8C 3ZN0A 4Q0UA 5LGNA 2ETEA 4PLOA 1PVXA 3CWBH 1UOBA 1AP5A 4CDWB 2QJVA 4AQTA 2D6LX 4EQVA 1X7NA 3BTXA 4ZS2A 1WCKA 1XUQA 4XJZA 3VBHB 1DHKB 3DEMA 2XAGA 4PA4A 4FI9A 1NZIA 3OBAA 3R4DB 4XQ4A 5L3BA 4DV7B 2IWGB 4XZUG 2OKXA 2UUBO 3ETDA 5A3MA 3VKLA 4RQFA 4JZRA 4PDWC 4YJ2A 1RUG1 2OT7A 4J25A 1W9SA 1X33A 1Q8PA 4P9GA 1KXGA 3LEKA 2HEVF 1V6KA 4QM9A 3M3OA 5JQGB 3SISA 1RB8G 1CEZA 2H0VA 2CV6A 2R32A 3CO2A 3FUQA 1M9NA 2Q0OC 1RUF2 2DVAA 3ZSLA 5C93A 1QOSA 4AEMA 1AB3A 2R072 3K2OA 4FVVA 1KD1W 2VR4A 4N43A 1TG7A 3H50A 1C8M1 5L19A 3RYCA 1FFXA 5IJ9B 3RI8A 3GWOA 4HK9A 4XBQA 5FYTA 1VBB3 2R9AA 5FPUA 2HWD2 1G7YA 1M90W 3B77A 2DW4A 4DINB 3JAKB 5CFCC 4XUTA 2GC1A 5FXVA 1S72V 3T2TA 5FK8A 1CPYA 2DURA 2WAMA 5GZGA 5BNPC 5FPLA 1GWMA 1H9WA 3GVMA 3H3LA 4B3RO 4XZPA 4AVAA 2XAJA 5FPAA 3D3QA 5L3FA 1DGWA 1NQJA 3UNPA 1QJZA 1FAYA 3ZMTA 3K08A 5LGTA 1F15A 4DUWA 3MI8A 5CG9A 4A45A 1FOD3 1J5EB 1LUWA 1JTZX 4QXKA 3BHPA 4P00B 4CBCA 1VRBA 2YICA 2XGXA 1GM7A 4JASA 4OI0A 4RFRB 1RP3B 4FQZA 4LO5B 5BNNB 1OCCC 3QO8A 3J8F1 3JB4C 3JXSA 2GH8A 3OGCC 3KWVA 3V0AB 4CSWA 3CRAA 1XNQB 4AI9A 5FZCA 3IIIA 1WKYA 2VUCA 3UKTA 4AR2A 1A8MA 4V1PA 3MF9A 3WNXA 4B3NA 2E6VA 4X8AA 1QJX1 2ADPA 5BMVB 2EIGA 3MDPA 2DCJA 2D6OX 3T30A 4H3WA 5CYYA 5EYPA 5BY1A 4O4HA 4M3CA 2JDNA 4DV1B 1IGOA 1BSMA 1N32O 1XNRO 1S55A 3ZXKA 3WG2A 4FK5C 1ST8A 5DABA 3RVHA 3BU0A 3MBWA 2JGUA 3CRRA 2JG9C 2BW8A 2YIAA 4FM1A 4TV8B 3APOA 4XDOA 2CNAA 1KQRA 1XBFA 3ZM8A 1SKVA 4LF5B 1N33O 2OT5A 1QQP3 1DZTA 3Q8EA 3BALA 2Q9LA 4QQLA 1LTEA 5IK8A 2DWEC 4IERA 4E2GA 3VBBA 1NXD1 3JSLA 4C0BA 2DUOA 4CDUA 4X65O 2IZWA 3E5XA 4UCSA 2FYUH 2D3SA 3TEXA 1AR1B 5LEJA 3RVZA 2JE7A 2ZIMA 1BMV2 1K3EA 2WO7A 3CC4V 1QY4A 4MHUA 1FMD2 1HXS2 3K48A 2Q8DA 3ZFFB 4UT5A 4N21A 2FCUA 1VMFA 4LK7A 3POFA 4KBZA 4NRQA 1WD4A 4MXWA 4RQPB 3BODA 4LHSA 2VQUA 1ULOA 4XDQA 3NAPA 1QMJA 3VBRA 4XF0A 1M57C 2Y6KA 1CZVA 2FHRA 3ETGA 3MFCA 4NYKA 3P1IA 1STMA 1WAZA 3K58A 1L7LA 3IC9A 4JDNA 3V64A 5K1XA 5IT6A 3AK0A 4MLOA 5LB6A 2JD4A 2EILC 1Y74A 2ZQMA 3ZN4A 2E7QA 2D3PA 1MQTA 4X62O 1Y7BA 2VVEA 5FPRA 1UZZA 1N1SA 3I2KA 2ZE7A 3OTOO 3ZFGC 5C3SA 4OUSA 4QHBA 3HQUA 3KB5A 3POYA 1JBCA 1MS0A 1PX3A 3A0KA 2W0FC 3HT2A 4JCKA 2W47A 4F6EA 2Y48A 4MVRA 1BYHA 1YI9A 2YPDA 3SYQA 1NKDA 4K3AA 1X50A 2OIEA 3PJSK 3M3CA 5IVYA 5FP9A 1HV0A 5LOVB 2JICA 3NV1A 4C7UA 1MZ6A 5H9RA 2PA7A 4L97A 1JYIA 4NO4A 1GNZA 2A1XA 2N7GA 3VBUA 5GTIZ 1ULCA 1SQXH 4IETA 4R50A 5I93A 4BH9A 1SQPH 1BEV1 3BPZA 4MG2A 5F2SA 3RJ2X 4GX2A 3QBQA 4WM7A 5LP6C 1DF0A 1HQLA 1NA1C 1OUXA 4UCUA 1W6PA 1Q5OA 4ZONA 2B1GA 2WN2A 3FMGA 3M3QA 3CCJV 2YFUA 1ULEA 4PJYA 5D21A 4KWLA 4XHXA 4LA2A 2VOTA 5EJ3A 4RUFA 4R7CA 2CY6A 3EYPA 4LR4A 4YW3A 2DE0X 3U07A 2I74A 4N53B 2JDIG 5IATA 3TNQA 2VZPA 3LF7A 2A3WA 1ND3C 2NR5A 2EALA 2Y4UA 4KUMA 5FYBA 4EFEA 4NHMA 4Q4Y2 4Q0PA 5A70A 1NZCA 3RSJA 2NQYA 2LO1A 4NWVA 4KXRA 1FPN3 3EXUA 3LB9A 4PA9A 1R6NA 3MIDA 5LHGA 1OKQA 3LEGA 3I2HA 1AXZA 1AYN3 1HNXB 1F35A 4J7JA 3VL9A 4LF6B 1CAUB 1GR3A 3J8F3 3DSQA 2QQOA 3VDDC 2HWC1 1Y66A 4IESA 2YS8A 2QUOA 4BJ0A 3ZPOA 3CCSV 1VIBA 3D4KA 2Q30A 3VZOA 2O0OA 3AVRA 1GZ9A 2HWE1 4ZXEA 1VF7A 3J7LA 4O7XA 2WSVA 5FIXA 4DNYA 5HCAA 1UU5A 1NCRC 2VAUA 1ULFA 2ZEWA 4WFAV 3C3SA 2PF4E 1V9PA 2P3YA 4I4TB 4C8DA 5ABJC 4UFIA 1HP8A 1IKPA 3ZHQA 3S57A 5IJRA 2ZZJA 5A7PA 2IUWA 3FWEA 3CMEV 3VKFC 4HOOA 5LA6A 3ALQA 3C7HA 4F7ZA 2RJZA 3I59A 3IC7A 1YFUA 2VJXA 2IVJA 4JI1B 1W03A 1H8TC 2BOCC 4PIYA 4QE7A 2RJ2A 2CTVA 5FPOA 5CB4B 1COV1 4NIDA 4N7UA 3HKDB 2WWUA 2R041 3VHRA 3LA3A 1G9FA 4FPGA 4IEOA 2VZQA 3APBA 2UU8A 4XXAA 1HNZB 4GB32 4RFT0 4HL0A 5LW9A 1OLME 5BZBA 1FS0G 4WZCA 1AX2A 3VLBB 4GLXA 4JI8O 1K9MW 1OV9A 3HNBM 3AG4B 3UO2A 2QTSA 4BMEA 3AG7A 3ZN1A 4N9IA 2WWWA 2WS91 1DG6A 3HEIA 1DF5A 2E3CA 3LCPA 4LUMA 4CTEA 2FDFA 4QX5A 1CWPA 4COUA 4NE9A 3T3YA 4S2FA 1Z7S2 2FMLA 2G4IA 4XURA 3KLSA 3GZAA 2IXJA 3JYCA 4NKGB 5JMOA 2OPKA 2Q8CA 1VP6A 1NYWA 3ZMSA 1Q8IA 4GQ7A 1HDJA 3G71V 1NH2B 5B4XA 3ZMNA 1AR63 3EXAA 3ACFA 1K34A 1D5AA 5K0UB 2PHWA 2IU0A 3WU2Z 4QPYA 4XJWA 4ZOLA 3RYIB 2VOXA 2QQWA 2VC9A 4MXVA 2GUZA 3CRMA 4F6RA 2WLJA 4CCJA 1QNYA 4NMIA 4DR3O 1R1ZA 2IXKA 4I7ZB 3B9IA 2XAQA 1W9WA 3T2OA 4DQAA 3NQHA 1CGPA 5A7WB 1R091 4YW4A 2AW9A 3VDCA 1P7BA 1TNRA 1JU4A 4DPNA 5KUMA 4XACA 3ST7A 2OTLV 2V4VA 3UQ8A 3CU7A 2K0GA 1QJU1 1BEV3 4UWDA 3N27A 4A7YA 5JVDB 1N8RW 1WWYA 5J2TA 5FZ1A 1ODMA 1XILA 4CUAA 4W4KA 1JZ3A 5DQ0A 4Y1ZA 1CX1A 2ZBJA 2HEYF 2W52A 1BVP1 5F5CA 2RN9A 2BE3A 1FPOA 3KT4A 2TUNA 2VUDA 4XHBA 3J80N 2L9LA 2W94A 4UFKA 3MICA 5JJNB 1OOPC 1UU4A 3JAWA 1JR9A 2RR13 3HKCB 2XJRA 1JI6A 4LF9B 2V5DA 1VBB2 2ZCWA 2BEOA 3DPRB 1NLQA 1LAJA 1GN2A 3OYWA 2PMWB 1V9U2 1C5HA 1GZWB 3MF6A 3P3NA 3KGLA 3CJHB 3U4SA 1O7FA 1GP6A 5FMOS 4LKFA 4ZI7A 3C7OA 1G9AA 3IDEA 1Q8QA 4FPCA 4AYUA 3VV1A 4AL9A 5DPNA 3JAMN 2BYVE 4LBEC 1EZJA 2A79B 4RS5B 2P37A 2W2IA 1RSOA 1K73W 4WV8A 2VNVA 1E5IA 5B1OA 3SNMA 1JZ5A 2EIMB 4Q1PA 2AGAA 3WB0A 3RPQA 5EZYA 4FLYA 3RNSA 2WLQA 3E8GA 3X29B 2VG9A 4GA9A 4H55A 1IBLB 5GLVA 4EB6A 4DUZO 3NJXA 4ZY9A 1N0NA 1S0DA 4QPGC 4V2WA 5FUPA 1BHAA 2EIJC 1OQDA 3ZXJA 1AR83 4Q20A 2ORZA 4RAIA 1VBD3 4XJUA 2C9KA 1ENQA 2MNGA 1YXBA 2PI4A 5LBEA 3IT8A 2BERA 2HJIA 1OVSA 3H3UA 2JB8A 3WF2A 4AG4A 3QLQA 1TA8A 2KSDA 2Q7GA 3I2OA 3GYDA 4KFMA 2RJKA 1KC8W 5KX5A 5FO8B 2DFCA 1AL21 4ARYA 3AXEA 4GH4A 2MPFA 2W6JG 3LSDA 4BLIA 4G27B 3VHPA 1EAH1 5AC93 2H94A 3NL1A 1NT2B 1Y3TA 1YIPA 1QQP2 2ZE5A 4EN6B 2VPVA 3PL0A 1QLEB 4P9OA 5EC1C 3T08A 4ABMA 5DZGA 5D5PA 1N1TA 2WNEA 4ZU5A 4I55A 3JATB 4HZFA 4FFFA 2ITCC 3CD6V 2MW2B 4O4JB 3M2MA 1W99A 5FLIA 2LW7A 1LEDA 5KXBA 1DGRA 3CSXA 4PQQA 5CAZA 4FFHA 2VCCA 5GALA 4I0BA 1FI2A 1KDKA 5KR7A 5KWRA 2ORXA 1AJOA 4DR1B 5A6YA 2VZ3A 3VZJA 4D0QA 5B5EZ 2PLV1 1YFWA 1VF5B 4QM8A 2JE8A 4P9PA 4NOTA 1GV9A 1ND2B 1RHI3 3UGFA 4JGZA 5AVPA 1VAVA 2Y6FA 1OPOA 2K9ZA 1A3KA 4CUBA 2X8KA 5JDBA 1XL4A 4KMQA 3ABUA 2HYXA 3AFGA 2X53S 5F5IA 5FDBA 2WNOA 2BVVA 4WFHA 5CADA 1DQ0A 1GICA 2VNOA 3ZEDA 3OGGA 4K40A 1KS5A 5FY1A 3N9OA 4AQ6A 4JGYC 2AEZA 1PO21 3UK9A 2D5FA 4CDQB 3RRDA 2I07B 2A6VA 1CAVA 3I2GA 1Z2GA 1IBKO 4CEYC 1JOPA 3AKRA 4E4ZA 1SCRA 2WAOA 1NTZH 4IE5A 3O1SA 2ET1A 1AR93 4K20A 4OHWA 1JOYA 4EKWA 5C33A 4LF4O 1GM9A 3HT1A 2WLHA 3ZYGA 2DV9A 2WZR1 4MVUA 3L73H 2XHKA 4JI0B 4X6QB 3DYMA 1WZXA 1M4UA 1KFXL 4XE9A 1C1FA 4ATEA 1WMEA 4U3FH 3AP4A 1XEQA 1NCQA 1S0FA 5C71A 1C8M2 4LR3A 2A9HA 3GZEA 1TME3 3TWIA 4JZGA 1W6MA 2WNVA 5IYBO 3ZX7A 2AZ2A 1KP2A 4IL7A 4PDMA 5D8AA 4IE4A 4HMZA 5AVAA 4DXZA 4R9CA 4CDXC 4ZKTB 3SCHA 2GNTA 2Q7HA 3PUSA 4WM8B 4YHHO 2F93B 2QA4V 2GNDA 1IPKA 1EV11 3G7DA 5HCBA 1DGSA 5JUVA 3L70H 4ASLA 3OBZA 4MTXA 1RPOA 4LCUC 4OPHA 4YWAA 1HKDA 1IZ3A 5ANNA 3PVBB 4AEJA 3DKWA 4LITA 1S2BA 3NW4A 4LO8A 3JD1A 3R6SA 4CS2A 2YSUB 4HPKA 3J8F2 1BQ0A 3LAGA 2WC2A 2VWJA 3QCWA 4UW5A 4PDWB 2ZDIA 2XJTA 4Z2WA 3NJZA 2E7AA 3POGA 4U7OA 5IWAO 1OF4A 4UW4A 2LGQA 3WNKA 3K5LA 1QJX2 2ZCEA 4YVSB 1XMOO 5FP7A 3LIGA 3L71H 3CC7V 4IUGA 4ZHNA 1VALA 5A6XA 4DRVA 2RS13 2EAKA 2OPWA 2ZAHA 2VW2A 4YSFA 3NR7A 2OTJV 1X82A 1BMFG 1N0JA 4AE2A 4QDRA 1MVQA 1XYOA 4LULA 2OZ6A 4PT6A 1SC5B 3ASOC 2BOIA 3CZJA 5JJEB 3O1RA 4WBNB 5FTTC 2BPA2 1W6NB 3J9SA 5CFCB 4EFBA 4DFSA 1BZWA 2RM23 3ZKUA 3O12A 5BNPB 3D36A 3RZHA 1FV3A 5DXDA 4LHKA 4XQDA 3VOUA 1LEMA 2OUHA 1OCRC 3N7KA 4OUEA 3HIFA 5SV8A 2QE7G 3FKSG 5LRRA 5JH7B 3RJRA 1GKBA 3T1LA 4BAYA 3EHKA 4Y22B 2YHJA 2R061 3H1WA 2PLV3 2ARHA 3Q8FA 3R05A 1Q6IA 3ZYJB 2IFRA 4L8JA 1HB3A 2BSKB 2BWCA 4GMP1 3VB9A 4PDVA 3S7IA 1Q8VA 5LMNO 4HXCA 4Q6GA 1OCCB 2R49A 4K8ZA 4GJYA 3LDCA 5ACA3 2IJHA 2LS6A 5IFPA 5BXXA 2CYFA 4AW7A 3IGAC 1I5YA 2XBO1 1TUBB 4K1YA 4QMAA 1TMF3 1XE0A 5FZ8A 2KQXA 5LHIA 3VDBA 2H0BA 1QVFU 4OHYA 4P9WA 1R1A1 3AVSA 3N2GB 2WT0A 1V54C 4QU1A 1YUDA 1CVNA 4LOTA 4FPFA 1XC6A 1QJY3 1F31A 1MZEA 4TLGA 2YU2A 2E5LB 4IIJA 4UFMA 4JI2B 2JEMA 1OD3A 3CMGA 5EIYB 4AI3A 3WHUA 3HOBA 1ODNA 4YJ3B 3TYJA 5B2GB 1P4RA 2GMPA 1ENXA 4H7LA 3LEIA 4LBNA 1HIXA 4L92A 3JQWA 1MQTC 3JB8A 3M8LA 2WINB 4B3SB 1HNWO 5FZOA 4GMP0 2YMZA 3KSCA 4XDJA 2QM4A 1GQPA 3WDWA 1BEV2 2DQ3A 3E86A 2F4VO 2YBPA 4BPZA 3ILRA 5J7MA 4DEQA 5I0DA 2XL7A 5C6CA 5JLVA 1NS1A 1GYKA 4LFCB 4LO7A 5IFTA 1SPPB 1MS9A 3ZXAC 4QD2A 2HKOA 4MHRA 1M57B 4BW9A 2ZINA 2J22A 2WFF1 3NNFA 4X6RB 3QF7A 1F4AA 2J42A 3CMAV 1D2DA 5A1FA 2EILB 2IJIA 4DR6O 3Q9OA 4FFBB 1E5RA 3E83A 3W7XA 4MGQA 3O1TA 4QKNA 4TSVA 1J3PA 3V56A 1U5IA 2BU9A 2HWB3 2ARAA 3ZFGB 2J1SA 5GJ6A 2GBOA 3OPWA 2B8MA 4O4LB 1NLSA 3ZHUA 2G38A 3OOXA 1W8HA 4MV2A 1HN1A 3POIA 4XC9A 5F9TA 3X2QC 5BR8B 1S0VA 3BABA 5C9AB 3LA2A 3PMEA 2J1EA 2ZGRA 1WBLA 4A4AA 3VD7A 1Y43B 5E8AA 2HWE2 3BY6A 4LBKA 1SA0A 2JG8A 1VJ2A 5M0TA 1YQ6A 3ZRSA 1WPXA 1JZ4A 1B3QA 3WQ1A 2JDAA 2A3QA 2AC1A 3E5QA 3OT7A 2B5UA 4J41A 5H5NA 4O4IA 5J36A 5KAFZ 4FFIA 2VUAA 4YPJA 1W6OA 2W9XA 5LP6B 4JTDB 1NA1B 1W8UA 3L72H 1G8MA 4TXWA 1VBD2 1CXZB 3JD0A 3OBTA 2QKAA 1DQ5A 4WFBV 4UXAA 1WUVA 5A2QN 4NXNO