4NVPA

Structure of the cyclic nucleotide-binding domain of hcn4 channel complexed with 7-ch-camp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
200
Chain Sequence
SPMDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Nucleotide Mapping of Hyperpolarization-Activated Cyclic Nucleotide-Gated (HCN) Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 67
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4nvpA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nvpA02
3FE5A 3U10A 4IEUA 2GC0A 3CLPA 3FJSA 2PHDA 2VPVA 2IXHA 4META 1X7NA 4HZFA 5J7MA 4MGYE 4BH9A 4FAGA 4QM9A 1RUNA 3NSTA 1O3SA 2IXIA 2Q4SA 4XFBA 3C3VA 4ZU4A 4BIFA 4XFFA 3R6SA 1NZCA 2B8MA 2GC3A 4YRDA 4I0AA 5HI0A 5I0SA 1VR3A 2D40A 3RZZA 3MZHA 1Q5OA 3CEWA 2D93A 3H1MA 1O4TA 2PTMA 1NYWA 2OZJA 1O3RA 2MPFA 4AVBA 3FX3A 5KHHA 4LA2A 5EFUA 2XLGA 2OPKA 1YLLA 2QJVA 3E6DA 4Q29A 2PQQA 4P9GA 4OLLA 1RL3A 1Y3TA 5J3UA 3GBFA 5JSRA 3FFQA 2ETEA 1CAUA 4JVAA 4B29A 3RYKA 3UKTA 3MDPA 1J59A 3WW2A 4ORFA 1PMIA 1I6XA 3LA7A 4XEZA 1CX4A 5T3NA 3M70A 4YNIA 4KWJA 4Q0SA 1SFNA 4AVCA 1ZRRA 3KMHA 4AQ6A 5JAXA 2XKPA 1CAVA 2XLFA 2QCSB 4LEJA 2PYTA 3NW4A 4Z82A 5BXXA 5KHKA 3LAGA 5CU1A 4WBBA 4DINB 3SCGA 2O8QA 3KSCA 4MZUA 4L2NA 5BY5A 4YARA 1YHFA 1H1IA 2H6BA 3FHIB 5JR7B 1XE7A 4H7LA 1O3TA 1YFWA 2K9ZA 4PIZA 4NVPA 4YYOA 5FCCA 3LZZA 2QVSB 2BNOA 2XKOA 1ZX5A 3E5QA 3E5UA 1CAVB 1NE6A 1QWRA 1Q43A 4RD7A 4IEQA 3E97A 4KU8A 2Y0OA 2XL7A 5FPXA 2H0VA 2EA7A 3IDCB 1EYBA 2ATFA 4IEWA 4XF1A 2P17A 4IERA 3S7EA 1ZZBA 4TLFA 4E2SA 1ZZ6A 2HKXA 4LULA 1CAXA 4ZU7A 5I8TA 4AVAA 3CO2A 1J3PA 3OGJA 3RNSA 4MGKE 4PJYA 5KHGA 1UIKA 3CF6E 3WW3A 3CL1A 3IWZA 4K8FA 5CADA 4I0BA 4EWEA 1RC6A 3HQXA 3RYPA 5I93A 2PAEA 2Q0AA 4PIXA 1ZVFA 4MX3A 3USSA 4XF4A 4HN0A 4O9GA 4HMZA 2F4PA 4F7ZA 2EAAA 2IXLA 2BEOA 4FT8A 3PVBB 2GH2A 2VQAA 4HSJA 1RTVA 1J58A 3SCHA 1J3QA 1TQ5A 3DL3A 5I8YA 1ZRCA 3ES4A 4I02A 2Q30A 4J1XA 1O5LA 3UKVA 2BNMA 2GC2A 3KGZA 2PA7A 4XF0A 3O14A 3QOPA 2OYZA 4BHPA 3WW1A 1L3JA 4WZCA 3BALA 4LA3A 1IPJA 1FI2A 3G7DA 4MGZE 2D5HA 3UKNA 1ZRDA 3CJXA 4EWAA 5EZWA 1YWKA 5C8WA 4R8HA 3S7IA 4FAHA 5E1RA 3EJKA 2UY8A 4R52A 4EWDA 1RUOA 2HJIA 5JCTA 1EP0A 1XE8A 3OCPA 4ZU5A 4N9IA 3DKWA 3LWCA 1PM7A 1UW8A 2C0ZA 5I0UA 2UYBA 2CV6A 4LLOA 4QXKA 1GQGA 1O5UA 3BPZA 1Y9QA 1ZZ7A 4AXOA 1DZRA 4HN1A 3ROUA 3SMHA 4Z07A 2MNGA 4D7SA 1CAWA 1X82A 5KBFA 1WGPA 1SQ4A 4IEPA 3LA3A 1G6NA 3HT1A 1YFUA 5I0RA 1JUHA 4IEVA 2GU9A 4XETA 4XFGA 3RPQA 3D82A 3ES1A 4QX5A 4BYYA 4E2GA 3H3UA 3KCCA 5K8SA 2GAUA 5KHIA 3U0ZA 4MV2A 5F1RA 1WA4A 1QY4A 3SXWA 2I45A 4X6QB 4XFAA 3SCFA 3TNPB 4HVOA 3TNQA 2ET7A 5FPZA 2BNNA 4FBFA 4XFIA 3U11A 3IIAA 1DGWA 4QMAA 4L11A 1V70A 1Q3EA 3KGLA 3RDIA 3DN7A 1UCXA 4UBHA 1FXZA 3PNAA 4D7TA 3EHKA 1GQHA 1UIJA 3EQEA 2MHFA 4EV0A 1H1MA 2QNKA 5LEJA 2GZWA 2IXKA 3OTFA 4OFGA 2CGPA 2XL9A 3I54A 1LB2A 2EVXA 4N9HA 5BUVA 5AVPA 5BPXA 1ZZ9A 2DCTA 2UY9A 4Q0VA 3DV8A 1QXJA 5JSPA 3PLQA 5J48A 5FLHA 4AQ2A 1ZNPA 1CAXB 3H8UA 2PFWA 3M3IA 2ET1A 2OA2A 4O9EA 2IC1A 3NL1A 1CGPA 4I01A 2K0GA 4KU7A 1ZZCA 4MUVA 3SHRA 4IEOA 1QXRA 4MH0E 2XLAA 4IEXA 3OD0A 4XFCA 3H50A 5FLIA 4YSFA 2ZCWA 1YUDA 3WW4A 3E6BA 4UXAA 4I3PA 5FDBA 4PIYA 3NJZA 5FLJA 3LA2A 3NVCA 3MPBA 5D1IA 3EBRA 4KWKA 1YFYA 1WLTA 1FT9A 3I59A 4GULA 3BU7A 1LR5A 2XHKA 4I2OA 4KL1A 2PAMA 4LUMA 4ONUA 5LRSA 5FQ0B 3H1YA 4XFHA 1ZREA 2Z2SB 2VECA 4LUKA 4CYDA 1OMIA 2ZKLA 4Q0QA 1NXMA 2Q1ZB 4HBNA 2B9UA 3ST7A 4E2QA 5I91A 1VJ2A 4I09A 4A2UA 1CAUB 4J1WA 4QM8A 2B5HA 2FMYA 5FQ0A 4IETA 3D0JA 4IEYA 4Q0UA 3H9AA 4XF9A 2PAKA 1OFNA 1J1LA 1VP6A 4EROA 1SEFA 4WVZA 5JSOA 2WFPA 4MGIE 2BYVE 1I5ZA 3HT2A 3I59B 4HVQA 2PHLA 5E16A 1U12A 2CAVA 3H7YA 4Q0PA 3FZ3A 4QGLA 5I8SA 5C6CA 3D0SA 4X6RB 4XF3A 1EPZA 3N4MA 3B02A 3NKTA 3ZDSA 5BV6A 1YFXA 1DGRA 4JTOA 1UPIA 1LKNA 3H3ZA 2Z69A 4QGMA 5CVRA 3RYRA 3ACLA 3IDBB 3QACA 1OD5A 3H1WA 1UD1A 2V09A 2WC2A 4HSLA 4LTAA 1NE4A 2E9QA 3IBMA 4KWLA 3HIFA 2KXLA 3ETQA 1X8MA 3JZVA 5LEKA 2UYAA 2OZ6A 4JTNA 3FWEA 2IXJA 3BCWA 3EO6A 4QGNA 1IPKA 1J3RA 2QDRA 2N7GA 3GYDA 3E6CC 2O1QA 2FQPA 4UBGA 1OI6A 2IXCA 3E5XA 1CAWB 1ZZ8A 2H6CA 1X8EA 4JV4A 1DZTA 1LRHA 2XGXA 3I7DA 2CAUA 2GC1A 3MYXA 3S0MA 4HLTA 3BB6A 3LOIA 4IESA 3L2HA 3H7JA 4HVRA 5I0TA 1RGSA 1O3QA 2BGCA 5LRRA 1HW5A 3ELNA 1ZRFA 1EY2A 1O7FA 4IEZA 3VHRA 4F8AA 5KHJA 1XRUA 2D5FA 3OF1A
chains in the Genus database with same CATH superfamily
2EJRA 4NWWA 4JTAB 1OCZC 1NTZH 2YIAA 1COV2 2YS8A 4QJFB 3POJA 1FJGO 1AJOA 4BMBA 2Y64A 4DV1O 1IURA 4PA3A 1HB1A 2Z5WA 5KHHA 4LA2A 2VULA 4KWUA 1CR7A 2VTXJ 5HV4A 4FXKB 4Q20A 2EIEA 1UY4A 1PO13 3WINE 4GX1A 4P9JA 2Q69A 3K3NA 3MDPA 2BWCA 1PL4A 5IHRA 1I6XA 1NBMG 3KCXA 3EYPA 1YQ5A 1RM1B 3SC7X 5EJ3A 4GKKO 3ETDA 2BTQA 1B6QA 1WLEA 2AHYA 3ZEDA 3AZVA 2D6OX 4WBBA 1GMMA 1TME1 3CMGA 4FQZA 2Y0IA 3SPHA 1VBA1 4H7LA 1O3TA 1JMKC 5LGUA 3LPFA 4QWNA 2X6CA 5FPXA 3SH4A 3KHBA 3IDCB 4LHSA 1XPWA 5IUQA 3S7EA 3RZLA 1W8ZA 1OJHA 3RYFB 3CF6E 3JQXA 1G8WA 1EM1A 4C0HA 5ACA3 4I0BA 4EWEA 5JQGA 3ZSMA 4RYDA 3HQUA 4XJUA 1XB9A 3AYCA 4I0XA 4LOSA 5F6KA 4YG3A 1JBCA 1GAXA 1GZCA 4F6RB 1PVXA 2AH2A 4XPVA 3U1XA 3ES4A 2Q30A 4CEYA 4I9QA 1RB8G 2HBTA 4EN6B 5A32A 4BHPA 2AGSA 3BALA 1SFPA 5B1BC 2Q5ZA 1JZ2A 1GZWA 4MGZE 1GBGA 4EWAA 1YWKA 4UFIA 4YW7A 2YI8A 1YJ9V 4QX2A 4N53A 5IJ9B 3OUSA 4EEQA 4I55B 1NA1A 2FL4A 5GKAC 1V9U1 4MVZA 1OH3A 2ZNJA 3ZN4A 3VD5A 3BPSA 3K46A 2RJKA 3VD7A 2QZ3A 1YQCA 4X20B 3MW4A 4WVMB 1H2MA 2N04A 4JHZA 2WSVA 2ODMA 5FIXA 3CCLV 4PD4F 4R8CA 4XILA 2W2IA 4XFIA 3SEPA 3AVRA 2XAGA 3IIAA 2QDOA 3NMBA 2BTOA 3RDIA 1FOD1 2FD8A 3NQHA 3MD0A 4GMP0 1ULFA 4EV0A 2VMIA 5IYCO 4OFGA 2VZRA 2WO1A 4XZPA 3UT0A 4X66O 5FYMA 3AL6A 3DV8A 5LBBA 3FB5C 2WNUC 2RMKB 5F3IA 5IAVA 3ZN5A 4YZ2A 3BTZA 5IFTA 2LTNA 2P06A 3RMYA 3PVNA 2BE3A 2Q7HA 3AKPA 3DKQA 3KCYA 1JTZX 1S2BA 1AILA 4GQ7A 5E89A 1XU1A 2B9VA 3N7MA 4AVVA 5CA1A 5LRSA 3MIFA 4FPYA 2W08A 1ZREA 3O1SA 1OMIA 1XYOA 3FUOA 1GLHA 4PQ9A 1M5IA 4JGYC 2KG7A 4YHHB 4GYCB 4GJYA 5LOVA 4COVA 3WU2Z 3LKJA 3U4XA 4NR1A 1XNQB 3V0AB 3VZLA 1Q6HA 1ZAUA 1WJZA 4HKOA 2Z42A 4LITA 3NAPA 4YGCA 1BT8A 5JMCA 1MA1A 2YU2A 2F43G 1G7YA 1PNFA 3ZDSA 1PKXA 1FMD1 5IYZA 1DTOA 5H9PA 5IWAB 4GT1A 4W4ZA 3FBMA 2HWB2 3H1WA 4IL7A 2W91A 5A3WA 2Z0AA 4NKGB 1RHI1 3I3EA 3POEA 5K0UB 1QOSA 3BCWA 3IN9A 4P9WA 1U5ZA 3WVJA 1VALA 4RGAA 1RIRA 3TRSB 4DRRA 2ZGTA 3N9PA 1NR7A 4B3SB 3POSA 2PI5A 3BA9A 2DWDC 1CAWB 4BB3A 3BRCA 5AC93 4M00A 4B3RB 4FVMA 2HR3A 1VEWA 1FYUA 1NH2B 2IZWA 4GXLA 1WZXA 4AFCA 1FMD3 3ELNA 5K1XA 1KKCA 5H9QA 3NNLA 1UY1A 4JI8B 4CH3A 3JARB 3LUTB 1SLAA 1DLCA 5DZEA 3U10A 5LBQA 1BYHA 1UOGA 1W06A 3LSQA 1Y76A 1GO3F 2J1TA 2Q4SA 4XFBA 3J4UH 4GWNA 1V6KA 4KHPB 3HWJA 3ZYJB 2YI9A 3LB9A 2BPA2 5I0SA 4OMCA 2SLIA 2VCMA 2ZQMA 3MBWA 4B4QA 1Y66A 2WABA 2D93A 5FXZA 1O4TA 2B9ZA 2P3JA 1DYKA 1Y9GA 4FFGA 2HWB3 3ZRSA 3A22A 4E4ZA 2QJVA 3ICXA 2FTKA 4LHKA 3OGIB 5J3UA 5FLXN 3ILRA 3FFQA 4LH6A 2D6KA 4JAUA 2A7WA 4OI0A 2UXDO 4BW5A 3O0WA 1X36A 4XEZA 4JYBA 5C8CC 5C8CA 4YGEA 1E1RG 2XKPA 4OGQB 1PGW1 3BIWE 5BXXA 4AHYA 1ZUQA 1HRV3 3O1OA 2VAUA 2X5IC 1FMD2 1W90A 5FZ8A 1CPNA 1P8JA 3VBOC 3SISA 1XNBA 3Q8BA 2VC9A 3U37A 1BVVA 1CAVB 3GXUA 3L9DA 4DRXA 1MR5A 2Y0OA 4LBLA 2PF4E 3JBG1 3I4IA 4L8QA 4DRXB 4XF1A 4TLFA 4Q1RA 1V9U3 2VUJA 2W92A 4CUAA 4K8FA 4LF8B 1AI5A 4LJHA 5FUNA 3EMRA 2DYRB 3CYOA 4AK3A 5ABJB 2IFRA 2J42A 3CC4V 4Y26A 5L7OB 5IT9N 2Y6FA 2GNMA 4LBOA 2RR11 2B7YA 4BLJA 2D6LX 3RYIB 3C2UA 1GZTA 1ZX3A 3OBRA 2PYJA 1TNRA 4DV3O 2UWCA 4XUQA 2XJUA 3VOUA 1DCSA 4B1MA 4NE9A 3WQ1A 1MZFA 4ZHNA 3ZBHA 1DHKB 3POYA 1V6NA 3Q8EA 3G67A 2R9RB 2F4VO 4X88A 3D3AA 4LXLA 1WLWA 1IPJA 4R6ZA 3K59A 3RVZA 4MO3M 5FKBA 5EZWA 4Q27A 1BCXA 3TYJA 2WNEA 2RE9A 3MV01 2HJIA 1V6IA 3TK1A 4JI6B 1VB4A 3LWCA 1PM7A 1LOEA 1MVEA 2JG8A 1OA2A 3ZXFA 4HETA 3MLKA 1QOOA 2OT5A 4TUYB 1OCOC 5D21A 3HD8B 2EIGA 1WBLA 4LP8A 4CU6A 1ND2A 3BABA 5IJRA 1FXKA 4CEWB 2HHHO 3I3BA 4B7KA 1K92A 3THDA 3H3UA 1HV1A 4DPNA 5BY1A 1PGL1 2Q6AA 1QY4A 4YW3A 4UFZA 2Q9LA 2Y60A 3K5MA 4DY5A 1S2KA 5FUPA 1SQXH 2RN9A 3A4UA 1GOHA 3GF6A 1K3IA 5LY2A 1SBEA 1U5XA 1OQDA 2JEXA 4RWUA 2CTPA 1FXZA 3PNAA 3W58A 2MHFA 2HKOA 1BHAA 1OLME 4LE3A 2R0HA 2XL9A 3I54A 3E83A 1AR63 5L3DA 3C7EA 2J22A 1XMOO 1TVKB 1SC5B 2Q7EA 2IC1A 3VBFB 5JH7A 4LBKA 3M8AA 4I4TA 4PDRA 5E79Z 4XJAA 5DZGA 3PDQA 3OD0A 3LSDA 3E6BA 4YW6A 2EIBA 4AW7A 4A7YA 4W65A 5FDBA 1FOD2 4AFAA 1J1TA 5BNPB 3PMSA 3C90A 1LNQA 1PO12 2D98A 4YGBA 2B1IA 1DQ2A 1XNKA 3AFGA 2XHKA 2QJ1A 4OZXA 2B5UA 1F15A 2E63A 4LUMA 1W03A 5LOVB 1YI2V 2BOJA 5A7PA 4B3MB 2KG7B 5HFLA 4W50A 1JHJA 1TUBB 2ZOEB 2Q1ZB 5CN0A 5CA0A 2WSUA 2CNAA 2ZEWA 1LOCA 3W59A 1W6NB 5LMUB 2ZKOA 1AYM2 4J1WA 2XR4A 1SFYA 5K1PA 2A1XA 2FMYA 5LHIA 1Q56A 1Q8SA 3M8LA 1U97A 3SJAC 5IK7A 3HBZA 1SLLA 1H6XA 3CJIB 4MSVA 1JUIA 1HQLA 4MGIE 3SPJA 4YGDA 2OPWA 4J9ZB 2CAVA 3E8GA 1QR8A 2KSDA 1IXMA 1ODNA 3LFMA 1OCCB 4QKBA 1YFXA 5F2SA 3LEGA 2CK3G 1UPIA 5KLVH 3THPA 1OD5A 1UD1A 4TV8A 3NV1A 5BR8B 3HIFA 1X8MA 3JZVA 3N7JA 4M4PA 2HFEC 1HJGA 3ZRVA 4XCBA 3ZVXA 4C1WA 3KS7A 2W94A 4L9BA 3DC5A 1J3RA 5A6ZA 1BMFG 1D4M2 2ZHNA 1OV9A 3BVOA 1GWKA 1H38A 1QHDA 2E31A 2WZR2 1OKQA 4DV5B 4Y1XA 3ZXLA 4MT8A 3N2KB 1RINA 4Z1VA 1XREA 4LFBB 2OVUA 2XNDG 2BBAA 1R1A3 3WQ0A 2GSYA 4PDWC 3B93A 1KFXL 4P02B 2C6SA 3JD4A 3C8XA 4ZS3A 5JVDB 3VHOA 3VD4A 3VQWA 4FTEA 2WNVA 2PI4A 1CP9A 1ODMA 4GB31 5C4WB 2DCKA 3BUCA 4E27A 2G9FA 2WNVC 1AJPA 3IDEA 4AHXA 4OPAA 2D2CB 1RUE3 5FJHA 2VZQA 5KUKA 2XJPA 2CAZC 5JSRA 3O9OA 2XVKA 3HKCA 3ZFGB 1XL6A 3RYKA 2PQSA 2ZX4A 3RJ2X 3LA7A 3CQOA 1XOYA 4Q4Y1 5J2TA 3LDBA 1X9PA 4AVCA 3L73H 2JG9B 3RGBA 3D6EA 5J1XA 2E26A 4CZZA 1DGWX 2R0FA 2XJRA 4COYA 4L0PA 2WNOA 2H6BA 3PJQA 3T4HB 3FHIB 1PO21 4DOUA 3BN6A 2A0LA 4R4ZA 3CX5F 1QU0A 5C9AB 2Y6LA 3OD4A 1W8OA 4CDUA 3ZYRA 1CAXA 3I3MA 2OUHA 2QQOA 4RHV1 3VDBA 4AGRA 1GV9A 1REFA 5DUXA 3OG2A 4LF6O 2RHPA 3SPGA 3ZHTA 4LFAO 4RQPB 5JJNB 4WFFA 4DK0A 2F4PA 1JU4A 3RI9A 3I97A 1WWYA 5L36A 3D36C 2QWQB 1ENQA 3SCHA 1VBE2 3Q8FA 1NA1C 3ZFEB 1NA1B 5IJ9A 3KT7A 4CDUC 4XXPA 4M0HA 3QOPA 4LBQB 4GX2A 1H8TC 2OYZA 1GNYA 3B7MA 2LW1A 3OEEG 2YXLA 5DAVA 2JKBA 1VBD1 1QIQA 4CCKA 3PURA 3T1HO 1NVPD 2A75A 1M56B 2JEUA 2JDAA 4RGGA 4YVWC 2WZEA 2BOCC 3S7IA 3CRMA 4FLVA 4DO2A 4MHUA 5DUUA 1H2SB 1DIWA 1UKGA 2QQKA 2LW7A 3L74H 4AQTA 1Q86W 2EZOA 3INAA 1ONAA 2TBVA 3SMHA 1CD3G 4GZ9A 3K4ZA 3LDRA 3J26N 1SQ4A 4XFGA 2WLQA 3ON7A 2Y4TA 3ILNA 2QKSA 2QQWA 2GAUA 4YFZA 2VH9A 3ABLB 2E74B 3RWNA 3MIEA 4XFAA 2QFEA 3RYFA 2ET7A 4GKXA 2VOVA 5FYVA 5HBAA 1ND3C 1IZ3A 3G6BA 5JIUA 3VDAA 2R041 2YIDA 4DR4B 1DGWA 5JR2A 3WP4A 1PD3A 2VBDA 3WR0A 3ZX7A 3WDYA 2GV9A 3PUAA 1H1MA 3N9LA 3BOPA 4JGZC 3TN92 4MSWC 4LBNA 2Y6GA 5GONB 3CNAA 2AENA 1N0JA 5DG1A 3MHZA 4FQ4A 3WF1A 3CZUA 2EXIA 2BTQB 4YZ1A 3WT3A 4O4HA 4X1IB 4YW2A 4Y22A 2YMZA 1GFF2 2XLAA 2CGOA 4FPKA 4ZXEA 5IK5A 4CRQA 2WLPA 1I0HA 3OFNG 1FFXA 3HNYM 4WFAV 2YUAA 2ZINA 1DQ6A 2Y6KA 1BHBA 3M3EA 1IKPA 4LO5B 4FFHA 3FAVA 2RDCA 1AXZA 4IV3A 3ABUA 1NXMA 4HBNA 1SQFA 4JI7O 4YZ4A 5J9PC 1JZ5A 3SYQA 1XMOB 1SQBH 4M3CB 1JMUB 4XYXA 4XF9A 4CXYA 1SEFA 1WD3A 4FPLA 5GLVA 2DYCA 3D0SA 3PUSA 2P5OA 3AG2B 1R6TA 4XF3A 4P9PA 4NMIA 4XIOA 2ARBA 1KKDA 4DV3B 4RUEA 1RUF2 2ZX1A 3WF3A 5LBFA 1F23A 3LEMA 1GUIA 2P4VA 2QQUA 2QSAA 3RZGA 5DMYA 2YBKA 1N8RW 3VB9A 3AZYA 1LAJA 3JB4C 5LGNA 2E53A 3CC7V 1QJY2 2H6CA 5GALA 4R9BA 5L9RA 3UT5A 3FFZA 4XIKA 4HLTA 3LOIA 4YVSA 3UT5B 3LDEA 4MVRA 3M3OA 4NIAA 1R3KC 1T6GC 2Q1MA 3OPZA 3HKEB 2DDUA 5AC92 3H8OA 1STMA 4S2HA 4DQAA 3FKSG 4B3SO 3LGRA 5BMVB 1X7NA 3I56V 1FPN2 3CDZB 1GNHA 5EYYA 1QJEA 1HRI3 5KXBA 1S0JA 2ATKC 4I3GA 2JDYA 4EN0A 4ZU4A 1ZA4A 5DQ0A 1DF4A 1DQ5A 4QPGB 1ZBA3 5A7QA 4P08A 1VR3A 1MABG 2YPDA 5KA6A 1MZ5A 3POGA 3VBSB 3TGUH 2XUMA 1LODA 1GOFA 3I5DA 4BQYA 2MPFA 1XNRB 5EFUA 4QU2A 1YLLA 4IXLA 2QEXV 1N36O 1HWYA 4AQYB 5CISA 3ETEA 3W21A 1EV12 4O2AB 4DUZB 3RYHA 3A21A 1PMIA 4IV3B 1RSOB 5HFMA 3N35A 1W6MA 3OUJA 4KWJA 4YJ2B 2OTLV 4H14A 1S5LZ 1EN5A 4FOVA 2BSKB 1WLCA 4LORA 4BR6A 3JATA 4AI0A 4NTYA 3KSCA 1PX4A 2B46X 1FFXB 4UCVA 2V5DA 2ZEZA 4H7MA 4GLXA 1UKRA 4CEYC 4YG6A 4AE2A 2YC0A 2QM7A 4CP9B 3KQRA 4XQDA 1AR81 2GTAA 1SMVA 4B08A 1ZLZA 2EA7A 4ZPIA 3T2OA 3A0RA 3WSOA 3CO2A 1TG7A 3K2OA 3CL1A 2VNOA 1NJIW 1RFYA 2W39A 2CH7A 5DDJ1 3AG1B 4A3ZA 1HQNA 1UZ0A 2Q0OC 3LQCA 4FPEA 3VZOA 4ATEA 1WB8A 4PA9A 5EJZB 4X8PA 2ZA9A 1YXWA 3IGAC 4UXNA 2DCZA 2FCVA 2GH2A 1XC6A 1NZ6A 4HSJA 1QJZA 3OM3B 5CBFA 3K9SA 2LP7A 4MVUA 5FYYA 4O4IA 3AX4A 4PLNA 1QQP3 3K4DA 1CXZB 1L3JA 3HPLC 1F9KA 4QPIC 5FZBA 4O61A 2NLJC 1D4M1 1NCRC 1SZBA 4CE8A 4LWSA 3JAKA 1W28A 2D5HA 2JECA 4XJ8A 4DV2B 3M1HA 1H1AA 4OMDA 4ASMB 1VLNA 4CC6A 1EP0A 1Z2GA 1W8FA 4I50A 1UW8A 4YM1A 2AHZA 2UYBA 1NH2D 4CCCA 4HN1A 3WB1A 1UU6A 4Z07A 1W59A 1UMIA 1WGPA 3KB5A 3QO7A 4XDLA 1PK6B 3HR9A 1YFUA 3VDDA 3ZYFA 1OPOA 4PHZA 2LRPA 1TGOA 1O59A 5K8SA 4QNHB 3NAPC 1WA4A 3VBHC 1ZA7A 4GH4A 4M3CF 4P5HA 3FLPA 4YM3A 3E22A 1Q3EA 4PDWA 1YJKA 1VRH1 4JI5O 1MEC1 4DV7O 1Q8OA 3Q4HA 4DV7B 3FB6C 5FY0A 4CP1A 1RHI2 5GZFA 5L73A 3ABLC 1DZQA 1OVPA 5K9YA 4TWTA 3T4DA 1GH6A 3ATGA 4FFBA 1ASJ3 1SESA 1K5SA 2R7EB 5FZIA 3HR0A 2NM1A 3ABZA 5JOWA 4H3WA 4NWVA 1UNBA 2OKXA 3NRUA 4AFMA 2K0GA 1DQ0A 4BXSV 2DYRC 3NV4A 1AR62 1GN2A 1HNZO 2D7FA 3H50A 3HEIA 5FMOL 1SBDA 4QPIB 4FTBA 4RR3A 2ENRA 2EIMB 2QE3A 4HAMA 2XOMA 2YG0A 3J8F1 4MXWA 1VMGA 4DUYB 1N3PA 3TAYA 1UPGA 3ZHRA 4UI9L 3ZPYA 1PVC3 5J2TB 2GP3A 5J2UB 3LSSA 3DXRB 4FLXA 1V6LA 3HKCB 3IJ4A 1GP4A 1RXFA 4QM8A 2PZSA 4LF5O 4GX5A 4BOWA 1K34A 1XE0A 3B69A 1RVF1 1SQVH 2IVIB 3AKTA 1REDA 5E16A 2W5FA 1LR1A 5KAIZ 1VBA3 2FBEA 3IAQA 2BZDA 3R4UA 4P9YA 1XBFA 4URAA 1X33A 3W9AA 5C8YA 5BR8O 4R9DA 4IT5A 3S57A 3EXUA 4JGZB 1HNWB 4BDVB 3ETQA 4ABMA 2IXJA 5CFCC 4AEDB 2WLNA 3NO8A 3CD6V 3S3WA 3RYCB 4QGNA 4W6XA 3ZM8A 1VBB3 1K5MC 1NI8A 3N2KA 2IXCA 2YFZA 4A41A 4MTGA 4LF7B 1DZTA 2W9XA 5IT6A 5F5IA 2AZ2A 2ZGNA 1DG6A 4IESA 1UYXA 4RGKA 5I0TA 1RGSA 5LRRA 5IY5B 4I50B 1R081 1ENVA 1L7LA 1HQWA 3O0VA 5FZGA 4RS5C 2K46A 2A70A 1YCIA 3FE5A 1PNLA 5GZCA 4JQTA 5C33A 2YY1A 3K4AA 2AGAA 3OBTA 1PV0A 4LK6A 3TB0A 1WCDJ 5SV8A 4AHZA 3CCVV 1DF0A 1N1VA 3SKVA 1AVBA 4E9KA 1FD9A 3JD73 5B1OA 2GDSA 2PTMA 3CJIA 4FCAA 3FX3A 2UXXA 2Z5UA 3OEAA 2XBO1 1S0EA 4OLLA 1MG1A 2FZ1A 2KQXA 5EIBC 4UF0B 5F39A 5A2QN 2WL1A 5CKQA 5IJ0A 1YVWA 2E3CA 1OSGA 3AP9A 3TN93 4BISA 1EN4A 5T3NA 4W6YA 5ACA2 1COV3 4WF9V 1FNZA 3LFIA 1R6KA 4Z82A 5DPNA 1GKBA 4NN0A 2JD4A 3WG3A 3I2GA 4DXTA 4V2VA 5LBCA 5FCCA 4XBQA 1PO22 1Q43A 1AXYA 4P00B 2RJLA 3ZO0B 1RMU2 2W68A 3T1CA 2LROA 4FOQA 1TVKA 1ZZBA 2OIIA 2DBNA 2BJSA 4AVAA 1VE0A 4XJWA 1Z7S2 2YEVA 2QBXA 3VHPA 2GNTA 4Y5Z0 5FFOC 1Q6IA 1LEMA 3IM0A 4N7UA 3USSA 3OB8A 4MVOA 4AHWA 5F2WA 3POBA 1H8TA 3VBOA 2R073 4KMQA 5IFPA 2VQFB 1J58A 4QPGC 3O1VA 1I08A 3ZMTA 4QPGA 2F1MA 3WEZA 3I55V 4P14A 2NZ9A 5FREA 3ITQA 5H2FZ 3ASNB 1VQNV 3JSNA 1QH7A 3WW1A 2DFBA 3SGIA 4SLIA 1N33B 3KT1A 4QXHA 1HDKA 1W0PA 3GZEA 2VZ1A 2XPJA 4CEWA 4MG2A 4LFCB 1CPMA 5CG9A 1I7FA 1ND2B 3BTYA 3HKEA 4FAHA 5E1RA 2ZDIA 1AP5A 1AR91 3VDDC 4KQ7A 3A7QA 3AP7A 1G8MA 4D3WA 3TJTA 2JE8A 4J80A 2E5LB 3X2QC 3C7FA 1QOTA 1V9PA 4JI2B 5A7WA 4EJRA 2Q8EA 3L71H 3LA3A 4GUNA 4DW0A 4JKKA 3NV2A 4U3JB 3ES1A 4Q4Y2 2I45A 5EC2C 3SCFA 1XNAA 5JCOC 3N2GB 2LGWA 1XU2A 2WAOA 3VZKA 1OHHG 4L11A 1JJ2U 2ZR3A 3WG2A 4IIJA 4XAAA 4JGSA 4RAIA 4Y3OA 4D7TA 3EHKA 3T2QA 4UT5A 5EZYB 4CU7A 2VMHA 5L7OA 2QNKA 5A70A 1HRV2 1D2DA 3AXEA 1MS0A 3G80A 5T52A 4KG8A 3PLQA 1DLBA 1SBFA 1S3JA 2OA2A 2HWB1 3B00A 4LF6B 5F8PA 3VBUB 3M7MX 5FO9B 1TVGA 3ZSEA 2ZCWA 2C24A 4FOYA 1HB2A 1V54B 3NVCA 2WO7A 2BVBA 1C5HA 2DTYA 4QB6A 4ISQA 3ZFEC 4ZZ5A 4K7JA 1MS5A 2HVJC 4AYUA 1MPXA 3TEZA 4IYIA 3H1LH 1AX0A 5DUWA 5IY5C 4LUKA 2E7QA 1RYYA 4FPHA 1N1SA 4PDVA 3NXSA 2XWJB 1YSCA 5A3UA 3K5LA 3PIGA 4RO2A 4TN7A 3AG3B 4Y22B 5FY8A 3HKBB 5FYSA 4COUA 4O4HB 4X1IA 4IETA 3D0JA 1IOAA 1GNZA 2P3IA 2WYFA 1OCOB 1Q8PA 2HLEA 2ZGKA 3AVSA 5CB7A 3ASOC 1K73W 1WB7A 2RM21 3OUFA 3AJYA 3OAAG 1ZRIA 2JEMA 3H9VA 3LIGA 5CMUA 4OQ8A 1UYYA 2P3YA 4HSLA 5AG2A 5GTHZ 4Q5OA 2OCCB 5LEKA 4PV1B 5JJEB 3OY8A 2DUQA 1BEV2 1MS9A 2AYHA 3E6CC 1AR73 2HP8A 5EXOA 4KBBA 5JXIA 2OUJA 5EV7A 1MQTB 5F7UA 4XDQA 4LF5B 3PIJA 3N36A 3B3QE 3B40A 3JAWB 4IGPA 4FP2A 2LQTA 4CH6A 2JJ1G 4YW4A 4F8AA 1NT2B 3NNMA 1UZVA 2TNFA 2F6BA 3GVMA 4UVCA 2ADQB 2E7TA 3FJSA 3ZMUA 4LLFA 5ERLA 3QO5A 2LW8A 1Y74A 4K40A 1R3IC 5FL7G 1OOPC 3IFXA 1AR5A 4GMP3 2EINB 5JXJA 1JCHA 3GM8A 3H8XA 1BKZA 2UXCB 4G3YC 5D5PA 5HI0A 1XQNA 3OMIB 1B3QA 1Q5OA 2ITCC 4K6BA 3H1MA 3NAPB 4L87A 2ZR2A 2R9IA 2BGPA 2R70A 2XAJA 4DFSA 2FCUA 2EZPA 4B3TB 1ST8A 4MW3A 4JZ2A 5ANQA 1PMJX 4LBEC 1PZ7A 3UM7A 1VAVA 4E4SA 1YF2A 2QCSB 1GWLA 2BFUS 4AGGA 4B8EA 1V6OA 5FPOA 4C91A 4I5SA 1KMIZ 3TEXA 4BZ4A 1XE7A 3CMEV 4ASUG 1QQCA 1L1FA 3MAQA 5FYUA 4WBNB 3I2HA 4XHXA 3GBWA 1UY0A 4WZFA 4IERA 4UCUA 2CL2A 4EN8B 2DVAA 4A5UB 1D2SA 5EBMC 3WNXA 1NKGA 1VIBA 4JC1A 1G6UA 2EIJB 4DK1A 3WV6A 1IPSA 4OVEA 1XHXA 1OD3A 1G4YB 3TBDA 3H0OA 2EAAA 2IXLA 2ZDIC 3WDVA 3PVBB 3UGHA 4WVVA 3JUUA 2IH3C 3D5OA 5FXXA 3LPGA 1EFRG 3PUIA 4XUPA 2F17A 2PLV3 5A9GA 3VKFC 3I2IA 2P4KA 4B3MO 2F4VB 4Q4X2 1W6QA 4OZOA 3JU9A 5F3EA 2WRAA 1VF7A 3ZXDA 2ZNIA 3ABTA 3C7GA 4FPOB 1IDSA 1GN6A 1DGRN 3SEEA 5EBWC 1RVF2 2DYSB 2P90A 5B1NA 2WLKA 4J25A 4Z2WA 4ZHQB 1OZ0A 3KD4A 3R05A 3VUOA 1M57B 3EJKA 3WUDA 2UY8A 4EWDA 4K1ZA 3CSXA 3PJSK 4EQVA 3WCRA 5FNVA 1RUD1 3ZRWA 1GQGA 4AXOA 2JS3A 1F51A 1YI7A 2DU1A 1GZWB 4IDZA 2VOWA 2QQNA 2BQPA 3ZPOA 2WN3A 1JHNA 2YSUB 4J9YB 1QJU2 2G9ZA 3ZSJA 1LTEA 1YQ8A 2WAAA 3KCCA 3D3IA 1VAKA 4CXWA 1KS5A 2WQZC 2XG3A 3SXWA 3TNPB 1HNWO 1PZ8A 4YXWG 1N3QA 2ZE7A 5A3OA 4TV9A 3HPNA 4NRPA 1OHFA 2VZOA 4WBNA 1BLZA 5C3QA 2EF6A 5FUIA 2UU9O 2DE0X 3AG2C 3RMXA 1D7PM 2EVXA 2UY9A 2D6MA 5JSPA 4W8JA 5J48A 3MGUA 2O14A 5J96B 1CX1A 3A0HZ 2RM22 1F7YA 4HT1T 4O65A 1K12A 2ADEA 4I30A 1IS5A 4X62B 1W6NA 4MH0E 2Y34A 3GJBA 5CA0B 1M4UA 3ZYGA 4FM0A 4UWDA 4DR7B 5H9RA 3WNLA 4DR7O 4AGVA 1NQTA 1FATA 1QCEA 1P7BA 1VAMA 4UW4A 5DAPA 4NO4A 2C5DA 2CYFA 1RUJ2 4LIVA 4LFCO 2DJVA 5LATA 1OLMA 5LA0A 1F2NA 1EBOA 1VRBA 1RMU1 4E2QA 2B9UA 2XWBB 4I09A 1RXGA 3OMNB 2X53S 2W46A 1PP9H 4K20A 5J09A 3PVEA 1K33A 1W04A 4WFBV 3IKWA 1FV2A 1Y74B 1X9TA 4CSWA 3WG4A 4AI1A 1OFNA 2WT2A 2EAKA 4FLWA 1N36B 4P9IA 1A32A 1K4DC 5IYYA 4J42A 2I07B 2ZIOA 4QGLA 1PIV3 5I8SA 4KG0A 1B06A 3PTYA 3N4MA 1PHMA 3SDLA 1XNTA 4QU1A 2WC2A 4OI2A 2XQXA 3IDAA 3LSUA 1I94B 1J95A 3RG0A 4HKLA 3SR2C 5HCHA 2ZEXA 1WA6X 2EXKA 4L8JA 4FO9A 1F8VA 2OWOA 5B2GB 2R1DA 2OQ6A 4CA9A 5FTTC 2J1AA 4H2AA 1HB3A 3HN3A 4AHCA 1S0FA 2P5BA 4PCRA 2YFUA 5FYTA 2RDRA 2BGCA 5B5EZ 1GQPA 4COZA 1ZRFA 3THOA 2D3SA 3VKOA 1YDXA 2CTQA 4DR3O 1U5IA 3AMNA 5KMGB 3CLPA 1SA0A 5FPLA 2JDKA 3ZR5A 2B1GA 2KB1A 4KGQA 2BDRA 1RUD2 2J1UA 5J37A 1D4M3 1I5YA 2CWMA 3SJCC 1CWPA 1YO8A 1OF4A 4Y33A 2XVGA 5EJ1B 3ZFFB 3LE0A 4ZI7A 3RZKA 4JYCA 1NYWA 2JDHA 4OHVA 2EIJC 5L3CA 3GNEA 1OH4A 2XT9A 5FJKA 1QEXA 4J7ZA 3OTOB 3MO4A 1VBB1 2XHBA 4RL7A 5CYYA 1NCQA 2ETEA 2NMNA 1JW6A 5BYNA 1NU1H 1WPBA 5JXHA 3VQXA 3CCQV 3WX5A 3AFKA 4IHJA 3CWBH 4UB8Z 3STZC 2OS2A 3UGFA 2D97A 1CAVA 3RVHA 1H8TB 4JRAA 1NCQC 1PM9A 2NR5A 5CU1A 5LP6C 4M0NA 5FZ3A 4PIZA 4X89A 4GMP1 3E5QA 1ZX5A 3E5UA 1NE6A 5FZMA 1AR82 1AYM1 1WW6A 3O5SA 3CCMV 3WF0A 5C8CB 4LE4A 2O57A 1JZ3A 3OYWB 1H9WA 1Y9MA 3X29B 1UZYA 1LCLA 1QJY1 4JTDB 3CRQA 1RUD3 1JVMA 1FXVA 2WAMA 4CU9A 4CDQB 4A6OA 3WQ7A 5I0DA 2XAFA 1IKQA 3CB2A 1T2XA 5KAFZ 3MF6A 4O9GA 5JDBA 3W5MA 3T2TA 3L9JT 1HNXO 1XXNA 3DECA 1TQ5A 2GC2A 4Y1VA 2JXAA 1LHNA 4FZ1A 1KD7A 1RUI2 1RHI3 1AJQA 1F4MA 4ZBMA 2DV9A 1ULOA 1FI2A 1D5AA 4BMEA 4Q8LA 1URFA 2QGNA 4JI7B 2VVDA 3STLC 1POV0 5L3EA 3VZMA 3EHBB 2FHRA 4X62O 1YIFA 3WZ1A 3MFAA 3O12A 1W6PB 2H8PC 4LR4A 3SPIA 3OBAA 1JYTA 3LEKA 3LNNA 5LL6Y 5GW7A 1N3OA 3DGTA 2RDSA 4OPHA 1AR83 5DN6G 1CAWA 3JD1A 1NTKH 4FLZA 4XETA 5FO8B 4FPPA 4GZRB 5EYXA 1KEXA 3K51A 4CC5A 1VQOV 1FYJA 2WWWA 2BNNA 3WF4A 4FBFA 4QMAA 5DM6V 5FKCA 4RSUA 2KA3A 2VNRA 1RITA 1ND3B 5F5QA 4PBOA 4FVVA 1QNYA 3THTA 1O9GA 2CDPA 1WA8A 4DV4O 2PYLA 2Y0PA 2C4XA 1ZWIC 4Q0VA 3LD8A 4CDWA 3AP4A 1R3JC 4OX9B 2EILB 1CGPA 4JI0O 4DR2O 5FZEA 3VBRA 1Y4MA 4IEXA 1HP8A 2YIBA 5FLIA 4XCAA 3I2OA 2GDFA 1BHGA 2P6CA 5IVFA 3POWA 1YFYA 1WLTA 1FT9A 4AR2A 4LO4B 4XDKA 1SKVA 4AEMA 5CAZA 1A8DA 4UFLA 3S3XA 3ZXGA 1TUEB 3MV11 2ZKLA 4LF4B 2VOKA 5I91A 4DXWA 1YI9A 5J2UA 1SLBA 1X4TA 5FQ0A 3DXTA 3PVOA 2Q8OA 3GBGA 5JSOA 1R093 1QNWA 3TN91 3OT7A 1NAEA 5FK8A 2PHLA 1MOFA 1RUI1 3FZ3A 1LENA 1EUTA 1H2NA 1QR9A 4W4LA 4GALA 3AK1A 4WFGA 1JH5A 2ZGPA 5IVYA 2IJKA 2XJSA 2R9AA 4QE7A 4JYAO 2D3RA 3J7AU 2IUWA 4NPLA 3JD72 4XMAA 3DYOA 4AEDA 2N74A 4MGTA 3DPRC 2LS6A 4XOGA 4XUNA 1CIYA 4D7YA 3K3WA 3E5XA 1YRZA 4NAMA 3B4SA 3OR6C 3T2PA 1AYM3 4HVRA 1BEV3 5CFDC 2Y33A 3ZXEA 3EB7A 4LF4O 1TMF2 2W1SA 4GH4B 4CZSA 4DR6B 2Q4PA 4PJ0Z 1GYKA 3WHTA 1KITA 3ZR6A 3HMYA 2PHDA 4CCMA 4DXRA 1PK6A 4ZONA 1WCSA 1RUNA 3NSTA 1R3LC 4RA0A 2WWSA 4JQRA 3ZIAG 1H2LA 2X8KA 3SH3A 4Y4RA 1KS4A 3DXRA 3UETA 5FP7A 1NT0A 2ZIMA 3FD9A 4F6RA 3VLBB 1MEC2 1VRH2 2WLJA 2V73A 5CKMA 5E8AA 4I0XB 3I49A 5CFCA 1S55A 3KF3A 1GP5A 2LM3A 2HWC3 4QPIA 4JDNA 1S77D 5LZ6A 1AR93 1BK0A 2X09A 5JMOA 4G28B 5G05L 3UKTA 2QKDA 4AG4A 4NJ4A 2QQVA 2J7MA 4WM8B 1QJU1 2QQMA 1ZRRA 2QTOA 4YM2A 4KNCA 1L8DA 3RWRD 3RN4A 3QD6A 4QHBA 4NHMA 4X1YB 2WT0A 2BERA 3U07A 3QTCA 1RUG1 1YFWA 2YXHA 5B1AC 4HNAA 4XQ4A 5B1AB 1VBC1 1UY2A 5DUVA 2QA4V 2QVSB 2P7TC 3VBRB 3WG7B 4IEQA 4Q4W3 1YIPA 1Z78A 3E8BA 4TTGA 1UO9A 1C28A 3ML0A 3VQVA 4LULA 4MVSA 1CZVA 1XNDA 4PT6A 4Y1YA 4GH4C 1MQTC 1O9HA 3OGJA 5FZFA 4TSFG 3OPTA 4ES8A 2ZAHA 4AEKA 1A6CA 4CUCA 4MX3A 1X59A 1JYCA 2L9LA 2VQAA 1QMJA 2DBIA 1MVQA 2VW2A 3K04A 5I8YA 1VBC3 2FB5A 5FK7A 2BNMA 3HAGA 2VXJA 4LF9B 2VS0A 3TCUA 1HKDA 1G9DA 3VZNA 2YYOA 4ITCA 4QDQA 1FAYA 4LF7O 2QWPB 3FC0A 4CPBD 3K9AA 2EILC 2RS33 4OYUA 4Z8BA 1W6PA 4LO8A 2RDQA 5F37A 4FFFA 3OEBA 2UWAA 1IS3A 3DKWA 4IGGA 1I1EA 2E76B 5E1AC 2WJSA 5IK8A 1J84A 3M4FA 4GX0A 2QQJA 2RJ2A 5CBLA 3J7LA 1KD1W 2WT1A 5LP6B 2KM2A 3B8NA 1GSLA 1W9YA 1IX9A 2FKXA 2CH7B 4A6SA 4N21A 4E2GA 4E4HA 1V0AA 3U0ZA 3EVKA 1OQEA 4X6QB 3GGLA 3MW2A 3T1HB 1UL9A 1SS3A 2JB8A 1CN1A 3VKMA 4O4JB 5BNOC 2VD7A 4XTMA 1GQHA 1UIJA 4DXSA 1ZTEA 4F4LA 3VHNA 2JS5A 3K77A 1KDMA 1VIWB 4CXXA 3JATB 5F3GA 2RCVA 5EIYB 2BSKA 2K1EA 3B5LB 5BNQA 1TEIA 3NL1A 1OVSA 4KU7A 1D0HA 1ENSA 2M7WA 2Y6JA 4P2ZA 1VB2A 1VMJA 1O4YA 1M06G 4LKFA 2WFF3 5A3NA 1O91A 3AZXA 4RFT0 1VBA2 1W8NA 1RPRA 3CCRV 4XJZA 1UWWA 4AEDC 3RZJA 1PNMA 5DABA 4YIOA 4RHV2 4DEQA 4IHJB 2Q5TA 1MSDA 4HKWA 3R4SA 5A33B 3USUA 1AROP 3G6JB 4QXCA 4D8MA 5DZFA 4GKKB 2UUBB 2A5ZA 2FDFA 1VBB2 3OTOO 4PBPA 3NNFA 5FWEA 3QCWA 2CE4A 3WB2A 3IC7A 5JJJB 4LBJA 4HVQA 1U12A 3JCZA 5C6CA 3MW3A 5LMUO 1EPZA 4ZOLB 2BVVA 4NRQA 2YHJA 5BNOB 2HEYF 1IBLB 1GANA 2Y8KA 3N27A 4C8DA 3QNEA 4CCDA 1COV1 1H8VA 4HANA 1BQZA 2P37A 1JZ8A 3SITA 1AYN2 1GM9A 4FFIA 4I7ZB 5LP6A 2D6PA 1R1A2 3RZMA 3T1LA 5IVBA 3ZYIB 1LRHA 5LMNB 3S0MA 2SBAA 3BB6A 3Q8AA 3OGRA 4LPLA 4X1KA 3ALQA 2DN9A 2VCBA 1W39A 4DXZA 2IFWA 4CDWC 4IE5A 2JD9A 3WG1A 3AYEA 3DSQA 3QO8A 2RS31 1OCCC 4C0BA 3VBHA 1HDJA 2WDBA 3APOA 2EXJA 4RR3C 3WNNA 3FLTA 3ACIA 1NQJA 4IV3C 4KUMA 3AMHA 4MVQA 4UVBA 1C4RA 4P9XA 5FZ9A 1SG3A 3CEWA 5F3CA 4ATFA 5T54A 1J5EB 1LU2A 3MIBA 2L6LA 1O3RA 1VQ6V 4AVBA 1W2OA 5CEHA 3K75B 1XOUA 2CTRA 3RI8A 2WN2A 4FFKA 1RL3A 4MW8A 1D4VB 1Y6XA 4QKDA 3APQA 4LBQA 4B29A 4M4RA 5GLZA 4BCUA 4IUGA 1MMMA 4TXWA 1TE1B 2P4EA 4UB6Z 1W9TA 4MLOA 1HX6A 1HRI1 1C3HA 4Y4YA 4CH5A 3W20A 3ASIA 3LAGA 1XYNA 3NNJA 3SCGA 1LECA 3BODA 4YARA 1YHFA 1H1IA 4K8RB 4X1YA 1UOBA 1XNRO 4Q4V2 2YV8A 3TOJA 2HJFC 2QM4A 2IU3A 4K35A 2W1UA 1AL22 4AQYO 2XL7A 3U75A 1WNSA 4PA4A 4N53C 5FMBA 3DPRA 4FLUA 3W7WA 5FZCA 3SNMA 3I2DA 2TEPA 4GWIA 4EB6B 2VBPA 2WUHA 1FPOA 1WP7A 2D44A 4TSVA 4OHZA 4AVTA 3T0AA 2DW4A 3RYPA 2PAEA 4QB1A 5CFCB 3FB8C 1X50A 5EBLC 1DYOA 4HMZA 2RDNA 1YJLA 1XL4A 4FT8A 1UYZA 1WN7A 4U2AA 1HW7A 1RTVA 2HWF2 1ZRCA 2UUAO 1M4WA 1KBHA 4K0KB 5FYIA 4DIQA 2VZUA 1SPPB 3GCWA 1KYOF 3AG7A 1N33O 1YQ2A 3DYMA 4GD4A 2GUZA 3E8FA 4Y1UA 3E8HA 2GSMB 1PNKA 1AI6A 1UFIA 2GTSA 1GMGA 3M3QA 1G9BA 5C4WA 3O1PA 4CCNA 5FNVB 2BW8A 1UOJA 1RUI3 2VG9A 4JI2O 5CA3A 1BMV1 5A6XA 1ZBE2 4RQPA 1Q82W 1X82A 3ECQA 5I0RA 3RVYA 1VQMV 5FZAA 3RBZA 4QIWF 1IS4A 1K4CC 1RUJ3 4PI0A 1VMHA 2WLLA 2PUSA 3HOBA 3CZJA 1MSWD 2PHXA 3AM2A 5E88A 4CDUB 2EJ7A 2WO3A 3B09A 4YJ3B 3OGSA 5DAQA 1IQDC 5C9AA 3G4SV 4LNUA 3AKRA 4QQOA 5LEJA 4DMIA 2WINB 2YBSA 5BUVA 2Y69C 2DCTA 2NLRA 4QHZA 1NLSA 1SRYA 1C1LA 1DF5A 2AC1A 5A7NA 1WPXA 2JG9A 2V4DA 4KH9A 2VQ0A 4K1YA 2EIKC 3GDBA 4MUVA 4Y24A 2R061 1G9AA 1XNCA 2YDEA 3AKQA 4IEOA 2V1DA 3AZWA 3SPCA 5D8AC 1AR1B 2EINC 2G1MA 1YUDA 3PUHA 4FLTA 2CWSA 2V5YA 4L92A 3BIEA 2W6JG 1WMEA 4YM0A 5JWPA 1UJWB 3NJYA 3WG7C 5LXTB 3GJAA 1RUC2 3RQ0A 5GZGA 5LBEA 1N1YA 2JIZG 3HKDA 4HONA 1MNGA 3V0BB 2Z2SB 2VECA 2CTVA 3KLSA 2F23A 3MLLA 4DUVA 2R1BA 1W8UA 1PO11 1VJ2A 1AYN1 4A2UA 5KXEA 1Q8QA 2VZPA 2WNVB 2QQPA 3WOGA 5H6RA 2IJJA 2XUEA 5JVDA 4PLMA 3MDSA 5L7OC 4Q0UA 1G9FA 2YXSA 4JDMA 4WVZA 1VPHA 2XJTA 4K8XA 2FCTA 1WD4A 2AZ5A 1WA8B 3JALB 2CHHA 2JDIG 1WLDA 4AI9A 4X6RB 1JZ4A 1O6UA 3DTUB 3GWOA 5IWFA 3WQBA 3DGEA 3RFRA 1KXGA 2DYSC 1ND3A 2H94A 1YYNA 1QNMA 4I4TB 3IBMA 3ORJA 3VBFA 2W0XA 4IGQA 1W6OA 3K3OA 4WCEV 4PI2A 3CXHF 3T30A 2WS93 4LO7A 3WUCA 2JGDA 4CUGA 4D6SA 1PK6C 4UCSA 1GN3A 1YQ6A 2A3QA 2OIEA 1UU4A 1ZZ8A 1PMHX 1LHVA 3JAWA 4BQWA 3H1IH 2RQ6A 3J81N 5HCBA 4HXCA 3AP6A 1WW7A 4DR1B 2VMFA 1GK9A 4BPZA 2OCCC 4IW3A 3AK3A 1W3VA 2IWGB 2WKKA 4LT5A 1PL0A 1WMFA 2BCCH 1WCQA 4CS3A 1TME2 1ZSPA 1BVP1 5AVAA 1JS9A 3ZXJA 4CCLA 5EP9A 2JRIA 3QLQA 3O1MA 2ARCA 4Q4V1 2VTFA 2ITDC 1V9U2 1AR72 5K7PA 2ZGUA 1S0GA 4A44A 2BRTA 3BI3A 4YRDA 5CBHA 2JDZA 3MHSC 1JFFA 3N9OA 4K21A 4XDOA 4J10A 4XBNA 4RQPC 4BWOA 2KKWA 2YROA 3UO2A 4TQDA 5IW0A 2OZJA 1W99A 4UCTA 4ZKTB 5F6LB 1NTMH 5KC6A 4BQ1A 5CKNA 5H6QA 5BNPA 3HKBA 1ASJ1 2W95A 5FZDA 1TMF1 1AX1A 1POV3 2GN3A 5M0TA 1CAUA 3DCQA 1F5FA 3QH6A 4W4KA 4DB5A 4ORFA 4AOCA 1BSMA 1CX4A 3OYWA 2DVDA 4MGSA 4XABA 4YNIA 1GRJA 2P3KA 1W0JG 3CCSV 3N9QA 1O4ZA 5T5LA 4DR1O 1FOD3 3NV3A 5JZGB 2Z79A 4LMFA 1NZIA 5KHKA 4HK8A 4FPCA 1LOFA 5JIAA 2VMGA 3H1HH 1M1KW 2K9ZA 5LMNO 4YYOA 2OT7A 2ZMLA 1DU3D 1N34O 3K08A 4DZGA 3S5AA 5D8AB 5L3GA 1QBZA 5D8AA 1S76D 1HN0A 4EYUA 1J3PA 4AL9A 4AF9A 3RNSA 5D2AA 4FTSA 5DDJ3 5CADA 2QZ2A 1CPYA 4O7XA 1RC6A 1EN6A 2BOIA 4K3UA 2PN5A 2W87A 4ISRA 3SQOA 5LW9A 1JA8A 1PGSA 5HV0A 1Q8VA 2Q0AA 2YC2A 1FXKB 4XF4A 1KUQA 4BXFA 5EZYA 5C4WC 2A79B 4JI0B 4LK7A 2JG8B 3OUIA 2F93B 4OXSA 1AJKA 4NIHA 4FPFA 1I9RA 1NCRB 1UX7A 4RS5B 4YFWA 4X66B 5FZ6A 2ARXA 1S5HC 4X65O 2RS13 3VL9A 1COWG 5KMGA 3K5NA 5JPMB 4N23A 4GB32 2HJDA 3AJZA 3ABMB 4JI4O 2IJHA 2OW4A 2UUBO 1UPSA 1QJX3 5FBZA 2ZM6B 2JDNA 1Y4WA 3ZMNA 5FMOS 1XILA 3PMEA 2BP6A 2JWPA 3CJIC 3PU8A 1NLQA 3BPZA 3RYIA 1IG0A 4NIGA 3CKHA 4BQ2A 4CBCA 3CCEV 4D7SA 1JPXA 3WF2A 3HNMA 3F95A 4TLGA 2OXBA 1VQ8V 2G4IA 3AL5A 1ZBA2 2PMWB 1JUHA 2BFUL 2GU9A 3KKYA 2VCAA 5KHIA 5F1RA 1YNAA 1LEDA 1XYPA 4NIIA 1YITV 3L2YA 3KHCA 1XNQO 4JRLA 2RNBA 4UW3A 1S1AA 4JGYA 3HBKA 2AREA 2VO5A 5JVVA 2ORXA 3CIHA 4UBHA 2LO1A 4PF5A 2VWJA 4SBVA 1WCKA 3OTFA 5A7SA 2CGPA 4E2LA 1C8NA 2VGDA 2NP0A 3E1F1 2ZGOA 1RUE2 3BGAA 4HPKA 4JF3A 3SYPA 3H8UA 2XBO3 1H4HA 3A8TA 1W6OB 4AI2A 1AVMA 3BKZA 4FMTA 1QXRA 3KZIZ 3WNOA 4Z92B 4JI3B 4GB33 5L9VA 5JOZA 2JDPA 2ETNA 2L35A 3MICA 4I3PA 2B39A 1AUYA 4DV0O 2CUGA 2JE7A 1RM1C 4HYOA 2D3OW 4JI3O 1NY72 1EAH2 3RW0A 4I2OA 4QPKA 3V0AA 5GZDA 4XFHA 3J7MA 2ZE8A 1UYPA 2YGMA 1AI7A 2RM23 1VQKV 3ZSLA 1OURA 5FOBB 4NHKA 4UF0A 2QQLA 3DC6A 3UCSC 5A1AA 1ACCA 2FDJA 2HEWF 4BIOA 3WDTA 3CS5A 2W47A 2Q67A 2VTXA 3JARA 5GM0A 1CEZA 4AILC 4E8DA 1OCZB 1OFSA 3MIGA 3OUHA 1ZYBA 2DCJA 3H3ZA 1E5RA 5CVRA 4HG6B 2AUYA 5ISLA 3VBSC 2F66C 1W8HA 2Y48A 2ZPXA 4LF8O 4GWMA 4S2GA 2JGDB 5LWBA 3TETA 3GYDA 2O1QA 2JIGA 5K0UA 1R091 1LOBA 4UCOA 4X64B 2I74A 3BOWA 2AZ0A 1BE3H 3H7JA 3ZRWB 3L2HA 1W8WA 1M93A 5JLVA 3MIDA 2ZABA 1WW5A 4Q2FA 5DXDA 5BXZA 4MTFA 1XRUA 3ILFA 3RYCA 4Q4X3 4IEUA 4DUYO 5CZKA 4FPJA 2GNBA 2J1VA 2C2AA 4ZZ8A 4FAGA 1OA4A 4QM9A 3NJVA 5C3SA 4LKEA 4BIFA 1RUG2 1W6QB 3B8MA 1M90W 3WDWA 2RMU3 3ACHA 5C8YB 2GC3A 2O0OA 3HB3B 5C71A 4DV0B 1EV11 5CA1B 2FZ2A 3HKDB 4JPRA 2Q8DA 3OSDA 1S2EA 1QLEC 5HCFA 1DYPA 4QQLA 4MGQA 3T1YO 2A6ZA 2XLGA 1N32B 1XSQA 1R1ZA 2Y4UA 2PQQA 4Q4X1 4K3AA 1R1A1 2EICA 1Z0HA 3CMAV 4LKSA 1YJNV 1SPPA 4JVAA 1R083 5A32B 3DXUA 4LO6B 4QHOA 1V55C 2XHNA 3ZHVA 3OR7C 4Q1PA 5CB4A 1M9NA 3P1IA 4NAOA 3ABKB 1R092 1QF3A 3NW4A 3W7SA 4Q4Y3 4XXAA 4NB5A 3WLUA 4WM8C 2P34A 3ZYHA 4RR3B 4OUSA 5JQGB 2ZAAA 5HPOA 2RS32 2A3WA 3LZZA 2VMEA 2ZD9A 1Q90D 1I3HA 3CRRA 4YJ3A 1QWRA 1E57A 5FPBA 1VBD2 4UFJA 4KU8A 3AK0A 2XOKG 1I5XA 1K9MW 1KQRA 5TISZ 2IH1C 2QWOB 4YY3B 2WLLB 2R072 2WWUA 3AK2A 4MGKE 1QLNA 3RWKX 3QH7A 3B9IA 1DQ4A 4BLIA 1PGW2 3UJQA 4GKYA 4X20A 3Q4HB 4ES9A 3WHUA 4F7ZA 4CS4A 1QVFU 2OIGA 5AFBA 2A7AA 3LDCA 4EKWA 4J1XA 1OC1A 4A4AA 4NXMO 3P3NA 1LOFC 2UUCB 4NHXA 4FIPC 4HZ3A 4R9AA 1VARA 4Y20A 2K9PA 3K06A 1WUVA 1F4AA 4N90A 2DU0A 1ZRDA 3ZS8C 4Z1MG 2QM8A 5SV5A 4FSJA 3O0XA 4MXVA 1RUOA 3AG4B 4ZU5A 2XB6C 4MVTA 1R64A 4JI1O 1CESA 1ZZ7A 2DUOA 2M6YA 1EUUA 1KP2A 5EC1C 1F31A 1K5QA 1MQTA 3N7LA 3M7AA 4XUOA 4BE3A 2ZXWB 4R50A 4BYYA 4EB6A 1UAIA 1LHUA 2Y26A 4X65B 4HFSA 3WB0A 3ABMC 3OY8B 1ZL8A 4HVOA 1APNA 4A3XA 2WS91 4O4IB 4CVUA 1ZBE3 5IK4A 4X1KB 4NXNB 3IMNA 3U14A 4F3JA 3DN7A 2RMU2 4PF1A 1UCXA 2QTWB 3V56A 1UU5A 4S2DA 4KFMA 1RUC1 3T09A 4EN7B 1AP6A 3RZHA 5FAXA 4N9HA 1A78A 5BPXA 1XMQO 5JUVA 3POFA 4H44B 2F95B 2X05A 4XDPA 4X8AA 3MF9A 3MEPA 5LA6A 1ENXA 4XFCA 2XVLA 1S4CA 2HWF3 3WW4A 4KBZA 2VU9A 4X9QA 3VBBA 5G04L 2WIIB 1K97A 2EXHA 2JJ2G 4IL6Z 3BU7A 1YIJV 1JODA 5LK7B 1LR5A 4JI4B 4ARYA 1HR0O 1C8M2 5B4NA 2CTWA 5C3OA 2X5IB 1RUJ1 1W6MB 5KUMA 5EYPB 1UOFA 2X29A 2ZHMA 5HXVA 4O2AA 3B94A 4PLOA 5FPVA 3H1KH 4DR3B 2WLIA 4DUZO 3PL0A 5F9TA 3AG3C 2PHTA 3J7HA 1XUQA 2VRZA 1RJ7A 2DVFA 5CFDB 4K0KO 1VQ9V 2C1FA 4D94A 2JJ6A 1Q6UA 4HL0A 5FYCA 1K5JA 4Y1ZA 2IBZH 3ZN6A 1KJRA 2RMU1 4QD2A 1GN4A 3CRCA 1OUSA 2JGUA 1SLIA 2HLDG 1QLEB 2D43A 1QQP2 1H2KA 3QVNA 2MW2B 2ZZJA 3IT8A 4KWLA 4TWKA 3ZN1A 4JYAB 3IB3A 3N2GA 4JTNA 1JJOA 5FP3A 2PHWA 2WZ8A 3KV9A 4P9LA 4XURA 2FMDA 2HBUA 3D8CA 2DURA 1HNZB 1BK1A 3JAMN 2XASA 1US2A 4XJ9A 2YIBD 1OI6A 3AMMA 3UKMA 3BVCA 3X2QB 4XBLA 2GC1A 1S0CA 2ZE6A 2FMLA 3AG1C 4DR6O 4RQEA 4B3NA 5BNOA 2WS92 1AR71 4AAXA 1POV1 1W2BU 1JYIA 1OCRB 4OI4A 4QKNA 3ME2A 3I2JA 5B1BB 1G1XB 4MGYE 4GJZA 5GLTA 5IAXA 3VGIA 5BNPC 4A45A 2VNGA 2RS51 1LOGA 4DEVA 1JZ7A 2B4KA 2BTVC 3ASNC 3FHQA 4IE6A 3NWKA 5FZ1A 4NHYA 4XFFA 1BJQA 5A3TA 5JXGA 1JYVA 4O2BB 5C3RA 2UXDB 1Q8IA 3ZN6B 1JU3A 5FZHA 2P22C 4I0AA 3PTRB 5GJ6A 4PQQA 3RZZA 2Q7GA 4G2KA 5JOXA 2AACA 1SLCA 4YPJA 5B3SC 3W7UA 3BFRA 4Q29A 5FO7B 1BQPA 4E8CA 1A34A 1F35A 3O1UA 3KG2A 3GBFA 5BNNC 2F4LA 5B66Z 2A9HA 1VQ4V 2IU0A 4OQ9A 4TZDA 1FXHA 1NG0A 2XMLA 3FAVB 2EIMC 3B9CA 5JAXA 2XLFA 4WVWA 2KR2A 3FHAA 3M99B 2XBO2 2H3OA 3G71V 3KV5A 2DVGA 4DS0A 4NOTA 4QX7A 4L2NA 1UX6A 5AFEA 3L72H 4YZ5A 5JR7B 1PVC1 5JI9A 4H55A 5IDJA 2CY6A 1PVC2 4B4PA 1B04A 2XKOA 2GH8A 2QE7G 2HVKC 4O4JA 1REEA 1W9FA 2HWC2 3JB8A 4IEWA 2NYYA 1JZ6A 1N32O 4E2SA 2V7QG 2WFF1 5GONA 1H4GA 1BGYH 1URXA 4DV1B 1JX9A 2XH6A 3PJYA 3P5BA 5A6YA 4C7UA 3HQXA 5FV3A 4PIXA 4ZIBA 5FZKA 2E51A 4M01A 5KX5B 2BEOA 4DUXA 4WM8A 3UV9A 2X10A 4I02A 3UKVA 1I5PA 1EAH1 1ZL8B 1TNFA 1RUF3 5IVJA 4NUBA 2HWD2 4DV4B 1LHOA 2A3XA 3NNGA 3S30A 2JENA 4TYSA 3SYAA 1DDLA 3P32A 3G7DA 4A7KA 2J1SA 5JI7A 3N7KA 2ZMKA 4Y5TA 2ZX3A 1GZ9A 1JYWA 3C3TA 1M56C 4QXKA 2ZGSA 4P30A 4D69A 2NN8A 4JCKA 1GWMA 2CSGA 2DMXA 4JI6O 3UJOA 1SZTA 2VW0A 5FMDA 4OULA 4RQFA 4Y20B 1Y67A 1W2TA 5HXMA 4B1LA 5JZGC 4QAWA 2UU9B 1IHMA 4Q26A 3U11A 5CG8A 4NXMB 4JGZA 4XACA 5FZ0A 3VN4A 4WM7C 3F2ZA 5IE9A 1TAEA 3KV4A 3W7XA 1AZDA 5EK0A 4BJ0A 5A80A 4CH4A 2VQUA 3ZX6A 3QBQA 4X64O 1UXXX 3H3LA 3ZMSA 1KFUL 5AVPA 2ZXQA 2FYUH 3EXAA 4WM7A 1CAXB 4FK5C 2X6AA 3VL8A 1JXNA 4KI5M 2VW1A 1Q81W 3VBRC 1SF9A 4R9CA 1VF6A 2C26A 4B4RA 4JZRA 4UXAA 3LF7A 5FLJA 4J6GA 4GA9A 4PA7A 3MPBA 1W0OA 2X6BA 1FX5A 3V64A 2GN7A 3M3CA 2Q8CA 1MEC3 2YZ4A 2PAMA 3ACFA 2WWJA 3ZXAC 2K2SA 5FQ0B 5CB4B 4MHRA 3UK9A 1IGOA 4COWA 4N8MA 5ITZB 2R49A 2HWF1 1JYNA 1ULDA 3LDDA 3ZFGA 1AL21 3ZHSA 4WFHA 1WBFA 1S0IA 3WNPA 4XUTA 2PHUA 4TOIA 5FXVA 3R66A 3LDKA 4FFBB 3HT2A 5FY5A 2JKXA 4Q0PA 1QDCA 2RS52 3NKTA 1HR0B 2ZGRA 2J1EA 5FY1A 3L75H 4H0LB 3E22B 3GZTB 4OCTA 3AMQA 3KVAA 2HWE3 4E4DX 2IJIA 2VZTA 2ZZQA 2JVDA 2UYAA 2DVBA 4YG0A 2XAHA 3I3QA 4EFBA 1UMZA 1NVPB 4BW9A 2QDRA 4GKJB 2N7GA 3E35A 3VDDB 3WFVA 1W3XA 4AI8A 2P2KA 4XC9A 3P3PA 2RR13 3K0GA 4JV4A 5IWAO 2CAUA 3MYXA 1NS1A 1UXZA 3OJBA 3VZJA 1F4NA 2VOTA 3RSJA 1HXS3 1O3QA 2HYKA 4JI5B 2AEZA 3KT4A 5J36A 1O7FA 1VBC2 4WV8A 3T4ZA 5EPAA 4CPBA 3H01A 2YXYA 1BMV2 2J1RA 4DY3A 1SERA 1GP6A 2ARHA 1CZSA 4EZHA 2VPVA 4DRVA 5FYHA 3WY6A 4YLZA 1CIWA 1RP3B 4LWSB 1OT5A 4BWAA 1O3SA 2AXTZ 2IXIA 4TV8B 4QX1A 4FOWA 1LHWA 1KC8W 1QDOA 1NZCA 1E1QG 1GICA 1HNXB 4PA6A 1HRV1 3IAPA 2LALA 2PXJA 5FZ7A 2IW5A 1RPOA 2QWNB 4FXGB 5KX5A 1NKDA 2GHYA 4ZS2A 5K4LA 3FLRA 3O1RA 5DDJ2 3OE7G 4KHPO 5C5UA 1HN1A 5L3FA 3E6DA 1AL23 1UN1A 4P9GA 4GCZA 4OHYA 3JQWA 4ASKA 2Q68A 2ID4A 4UFHA 1N47A 1SDDB 2JK5C 3D4KA 4FLYA 5C7GA 1SFNA 4UW6A 3KMHA 4AQ6A 2DQ3A 1B35B 5LASA 2BBVA 4JX0A 3I2KA 1Z5WA 1OXCA 4CP9A 4LEJA 2HYXA 5L19A 3VQYA 2NPIA 4S2FA 2UUAB 1LU1A 4IV1A 1W9WA 4JV5O 2PY5A 3WCSA 3T4VA 2YU1A 3WDXA 3WNMA 4YZ3A 5BNNA 3IIIA 2ZX0A 3IPVB 2UURA 1IBKO 1DBNA 1BQ0A 4RD7A 4CDXC 1OLRA 2RV9A 4YJ2A 2H0VA 1EYBA 2ATFA 3IZOA 5JH7B 1PIV2 4PELA 3RYHB 1DGLA 4ZU7A 1VF6C 1QVGU 3IWZA 2VVEA 1YTFD 1GU3A 2GMPA 4LCUC 5CA6A 1V6JA 1SACA 2I2SA 3BA8A 3ZMVA 1DP0A 4A42A 1A8MA 3T3YA 3J8F3 5BZBA 4JGYB 1OA3A 4MYEA 3AMPA 3DL3A 1FNYA 3ZLIA 1O5LA 4I9WA 1RUG3 5JOYA 2VMDA 3GZUC 1CJDA 3FYEB 3O14A 2ZS6B 3ZJZA 2HWE2 3IMMA 1TME3 1RUH3 2BWAA 4LA3A 1OPMA 1NQDA 4QX8A 3CU7A 3AKSA 2Z4FA 5ABJC 5BMVA 4R8HA 2YC4A 1UZWA 2UXNA 2VXRA 4HOOA 3ZFFA 2VCCA 4Q4W2 5JCTA 1XE8A 4XTPA 4K9SA 1YEWA 1QKQA 1AR61 2CV6A 4LLOA 2EIKB 4AWDA 4ZY9A 5FWJA 2VNVA 4HK9A 1P49A 4R4XA 2HWE1 4L99A 5FPRA 4IQPA 4H33A 4BQXA 2CGNA 4IYHA 3JD0A 1JR9A 4CDQA 3RPQA 3O65A 2VUDA 5A3MA 5IVEA 2QTSA 3POIA 1EAH3 4LQRA 4QDRA 4NTWA 2YB7A 3VD9A 4RS5A 1NCRA 5FPZA 4CCOA 3ZRXA 5L3BA 4H37A 3ZHUA 2Y6HA 3O1TA 3FX7A 3B77A 4D6RA 1TA8A 5FBJA 1WW4A 2VWKA 5IYBO 2UXBB 4OI1A 4QE9A 5LCWL 2QQIA 4N43C 5DAWA 5FOJB 1LUVA 1ZZ9A 1KRIA 2YUEA 1EZJA 3VKLA 1YTFB 2ILMA 2NNUA 1PNGA 5CFDA 5FR3A 4G4FA 4AQ2A 3MFCA 2PFWA 1O8PA 5EIBD 4YIPA 5H5NA 3BEHA 1S72V 5TSWA 3SHRA 5GLUA 1SQQH 1KU9A 3C7OA 1NCQB 1KJLA 5EYPA 1QJX1 2HHHB 2QR4A 4J11A 1XI1A 4NRMA 1FAFA 1LGNA 3EBRA 4KWKA 3VV1A 3O7OA 3JYCA 2JX9A 3I2FA 1V55B 3V65A 2R042 4ZI7B 4KL1A 1FS0G 1VMFA 2DTWA 1GTOA 4RN5A 5FYZA 1SETA 1JI6A 4OX9O 3H1YA 5L9BA 5GTIZ 1AL0G 2GALA 4Q0QA 3ST7A 2GMMA 1T5EA 5IATA 1HB4A 1CAUB 2ZEYA 4YHHO 2VM9A 1XSRA 4CEWC 3W5NA 1G9CA 1N0NA 2X7RB 4N43B 2B5HA 4OHXA 3ZOIA 1OUXA 3RRDA 3H9AA 2HEVF 3NKGA 1J1LA 4J7JA 4DV5O 3OGVA 3ZXKA 4QKFA 2BYVE 3I59B 4U36A 3I3DA 1IQAA 2WYSA 1AR92 3H7YA 1JFFB 3D36A 1FKAO 5BV6A 4XBFA 3CBNA 4JTOA 1SZXA 4Q4V3 4QGMA 3ACLA 4DR5B 1DGSA 4NYKA 4Q4W1 3QG5A 5LA2A 2EBOA 3NR7A 1Y76B 3FWEA 2Y38A 3ZKYA 3WP5A 5J98B 3SYCA 4GIQA 5FYBA 1DQ1A 4I0WB 1W9SA 1IPKA 2UU8A 2MK3A 3R0RA 3ACGA 4UVAA 1X8EA 2Q8VA 4AQSA 4CP2A 2LFSA 1P7GA 2ZTNA 4DV6O 5CBGA 2DCYA 2W3JA 4JAAA 2R043 4LC1A 1HW5A 4TV9B 3FL7A 1U0AA 2OX0A 1EY2A 2ERFA 4IEZA 1DLLA 3SJQC 2A6VA 5FY4A 2R30A 1BXHA 3OEHG 2IXHA 1GM7A 4OUMA 2QUOA 4META 2RS11 2WO2A 1N1TA 3MPPG 4C90A 1VRH3 1L0NH 4BQ5A 1DK1A 4IGOA 1ROPA 2YICA 1NXD1 3HN1A 2NQYA 5JCOA 3AP5A 3A0BZ 4A7ZA 3W7TA 4NXNO 3R6SA 1VQ5V 5IYZB 2YGLA 3ZFEA 3SKJE 2D40A 4JAVA 2VZ3A 3DUIA 3MZHA 2GNDA 1EZVH 3JALA 1XQ8A 2ZT9B 1ALYA 1R73A 4XVHA 4ZHQA 1FPN1 1W2NA 4AZZA 3K03A 5AC91 5DAXA 4NIDA 4CDXB 5FP9A 1Y3TA 1FXKC 1E5IA 4KP4A 3APBA 3T08A 3UYJA 3A0KA 3WW2A 3G6EV 3S6PA 3KWVA 1RVF3 4KXRA 3V0BA 4Q0SA 1THZA 1BZKA 4R7CA 2ADDA 4BA6A 5F5AA 3UQ8A 2IM9A 3I8TA 2P6HA 4GKJO 2JICA 1EV13 4DINB 5KXDA 2O8QA 2ZACA 3J80N 4XZUG 2RJZA 1HV0A 2VMCA 2WLHA 4X8NA 2XONA 2LJ2A 2BNOA 3CJHA 4UV8A 1UF2C 3CPWU 4CDQC 5T55A 3E89A 3H8RA 1ULEA 1US6A 5I8TA 2LGQA 3DYPA 2ZM6O 4PJYA 5KHGA 2MEV3 1VP7A 3GWKC 1XBLA 5I93A 2RG4A 3HJRA 1FFTB 2P6JA 3Q9OA 4HN0A 4DYLA 1FPN3 2R16A 3ZFFC 2BV4A 2BOBC 4XHBA 3M2MA 1J3QA 1CVNA 2ZHLA 2E6VA 2EALA 4UUJC 4XF0A 5KA5A 3AEIA 1F5JA 3WDUA 3D3QA 5GLWA 4AFDA 4WVMA 2W6IG 2ARAA 1W8TA 2A3YA 3OBZA 1IBMB 3CJXA 4JDOA 1RJ8A 3TEWA 5KWRA 4R52A 5DECA 1L7RA 1R1BA 2A06H 4N9IA 5EHDA 4I55A 5I0UA 2JDUA 4N53B 4AI3A 2VUCA 3RT3C 3BCCH 2ZJCA 1O5UA 1Y9QA 1LGCA 3ROUA 4F6EA 1A3KA 3FB7C 4UW5A 3BTAA 3WD5A 4CCJA 2MNGA 3GALA 2GUZB 5KBFA 4URTA 2HH9A 1MZEA 3HT1A 3EFFK 4JASA 4FP3A 3CEIA 1S5JA 3AXDA 2G38A 1FV3A 4P5YA 1KP3A 3DF0A 1C8M3 1BL8A 1SDWA 4CEYB 2W52A 3T2MA 5FP8A 1C57A 2BU9A 3LOBA 1SHWB 3CJHB 3CCUV 5EQUA 2EX3A 5A7OA 3EQEA 2GZWA 1C5IA 4EZ4A 1RUF1 1E5SA 1LJ7A 3UL2A 3E2EA 2PLV2 2R72A 1CQ9A 5A6QA 2LUWA 3TEYA 1ZNPA 5A3LA 2ET1A 3M3IA 5T5PA 2VVFA 3MUY1 1H30A 2JDMA 2VY0A 3J7NA 1H6YA 1K45A 4YSFA 1TUBA 4NROA 2JE9A 4IE7A 4CDXA 5T50A 1H8HG 4NHLA 3I59A 4MOAA 4JI1B 1GR3A 3OW2U 1V54C 1FJGB 4UOJA 3H42B 1VBE3 4N43A 5FY7A 1PGL2 4CYDA 1JQ0A 3N9NA 1PIV1 2UXBO 2PGGA 2P1BA 1OF3A 3FYIB 4H13B 3K0DA 4FZ0A 4LBQD 4UCRA 2PAKA 3SLIA 3VKNA 4JHTA 3ZKUA 2WFPA 3LNMB 2XXZA 3P6BA 4FPGA 4HPKB 1R6NA 5LHGA 1LULA 3ZYPA 3TXSA 2AW9A 3ZFGC 4AAPA 2H0BA 1RMU3 3ETPA 4JYYA 3F7VC 1PX3A 1K7DA 1DGRA 3WXPA 2BGOA 2Z69A 3QACA 2V72A 4J41A 1IG3A 1NE4A 3VBUA 3C3SA 2KXLA 1HIXA 1KECA 2ORZA 1B09A 4BK4A 3BYWA 1H8EG 2V4VA 2B45X 2DOSA 1H0BA 4YY3O 3OGCC 2VJXA 4DR2B 4QX3A 2ZHKA 4ZXKA 1WP8A 2VE1A 2FQPA 4UFKA 4PDMA 4BM8A 1NX9A 2WQ8A 4V1PA 3WP3A 1UY3A 4W6WA 1POQA 3I7DA 4FM2A 5APAA 1UZZA 1DFQA 4TUYA 2UUCO 4Y5SA 5FPAA 4U3FH 3B01A 4QPJA 1KGYA 3BY6A 1D5NA 4OUEA 4DR4O 1MZ6A 2D5FA 2ZGQA 4YVWB 2GC0A 4U3JA 1AJNA 4HZFA 5LB6A 4BH9A 2WSSG 3F5TA 3CP1A 3ZSKA 1WKYA 3C3VA 5FZ4A 2YBPA 4LHNA 2WPDG 3FUQA 3ASOB 4UFMA 3TWIA 3JASB 4ZOLA 1XJAA 5IYDO 1XEQA 3ZYBA 3GCXA 1JYXA 5ABJA 2WFF2 1BBT2 4MTOA 4PDLA 3MLJA 5C9AC 4QQ2A 2CU5A 2HWC1 3AB0A 1SLTA 1JN2P 1J59A 1C1FA 2QKCA 4BIUA 3M70A 3THCA 4UYBA 4MS2A 4QPYA 1M57C 3VBOB 1QHTA 1ZBE1 2PYTA 2HWD3 4LFBO 3FN9A 5LA9A 1VQPV 2WA3A 2WBKA 4XAEA 2R062 3DEMA 4E4EA 1EPWA 2YEVB 3WNKA 1KB9F 4BQ4A 2B42B 3MIHA 5JZGA 4CU8A 4IIJB 1U5YA 3K48A 3OGGA 3MUZ1 1AR4A 3A2FA 2P17A 3VBUC 1R082 1ZZ6A 2HKXA 1HXS2 4JTCB 1I94O 1JOYA 3KZ4C 3WW3A 2YPJA 4IE4A 1YXBA 2QDNA 4IV1B 5LK5A 1HJFA 2LFRA 1QJY3 5A7WB 1JOPA 2DQ0A 1MS1A 1Z7S3 1IBMO 3UO3A 4DR5O 2D3PA 1BBT3 4JZGA 1OOPA 3ENRA 4G9SB 1ULCA 4RUFA 3BU0A 4WZCA 5A3PA 4O4LA 1W2UA 5HCAA 1AXKA 1K5MA 3UKNA 1Z5VA 5LA1A 5C8WA 5DN2A 2FDKA 3MHHC 3CE2A 3HNBM 4CCEA 3P30A 3HQRA 4TT3G 3L70H 1QQP1 3SYOA 2C0ZA 3ZCCA 2PLV1 1Y43B 2VZSA 3AG4C 1MS4A 5A1FA 2BUKA 3MI8A 2XTAA 3VDCA 1LNSA 4U7OA 4QX5A 3ZIXA 2OTJV 5F32A 4MV2A 1US3A 2V4AA 2E5LO 1WMDA 5LY1A 3TNQA 4NPRA 2HWD1 2PHRA 2JG9C 3JSLA 4AEJA 4JI8O 1IBKB 1V70A 4MVMA 3JXSA 2Z3YA 3E86A 1SCSA 3ZN0A 3IPVA 1U96A 2QWRB 4LH7A 5BNNB 2EIDA 3IC9A 1GOGA 4LBMA 1MS3A 1IXBA 4B7EA 4IV1C 2AR6A 5KC5A 2NMOA 5FMCA 2Y69B 2WLMA 4BQ3A 3T1MA 4BIZA 3ZDVA 2A71A 1QXPA 5FLHA 1WMXA 1ENRA 1B35A 2XJVA 2ZX2A 2X0LA 2ZCEA 4I01A 1ZZCA 1OBNA 4EFEA 5IJ0B 3T1YB 1CJPA 1YJWV 5D5QA 4L97A 3AC0A 4HNAB 2DUPA 3LIHA 1WAZA 3LA2A 4EE2A 5EWSA 4XQWA 2VL4A 2WZR1 5LXTA 4TQFA 4JV5B 2O8OA 3UNPA 1KQSU 5LYJA 1QJFA 1AHSA 2W1WA 1W0KG 4YW1A 4QT6A 1B35C 4LOTA 4INDA 2R32A 2KD7A 3RJRA 1XHZA 1QU7A 2DWEC 2NN4A 3N3HA 4BK5A 5H9SA 3Q8CA 5IVVA 2WNUB 4QGPA 3RS6A 3BHPA 3A0NA 2HEPA 2GMEA 4IEYA 1VP6A 5F5CA 4EROA 1QH6A 4MXWB 4N7IA 5A1LA 5JPNB 1MACA 2A6YA 2QKAA 3AYAA 4YW5A 2R6QA 3PN1A 4LNUB 4K8ZA 1NLRA 3IAYA 2JB4A 4FM1A 3IDBB 2FDIA 1VBD3 2E9QA 3CHXA 2CDOA 3R4DB 3K57A 5FZOA 3QF7A 4WM7B 5IVCA 1UQXA 2TUNA 4LFAB 3T0DA 2VR4A 1W2AX 1BEV1 4UAPA 4UBGA 1P4RA 2R071 4ICGA 4AVSA 4GAZA 2XGXA 2OQ7A 3KVBA 1HLCA 1P84F 4PDWB 3H1JH 2PELA 4LR3A 1OQ1A 5CIRA 3TXQA 2PHFA 3OMAB 4YWAA 3VHRA 3N9MA 2WQ4A 1K3EA 2CDYA 4LF9O 4UV9A 1LGBA 2OCHA 4CTEA 5FZOB 5C70A 5FZLA 5J7MA 1CZTA 2DWRA 5H9CA 1YZBA 3GHMA 1SCRA 1ND2C 1YC61 5DG2A 1RUH1 3R65A 1S0VA 1PO23 2B8MA 4LHLA 4RFRB 5ITZA 2XAQA 2JG8C 1VF5B 4B3TO 3VBFC 3K58A 1KDKA 3JD2A 5T5OA 2UXCO 1IBLO 1K8AW 1AF9A 1PZ9A 1NR1A 2VUAA 3KV6A 2OPKA 1BCCH 3JAKB 4ET7A 4MTXA 2ZKNA 1V6MA 1L7QA 4EN9B 2WNUA 4LKDA 1NUKA 3ZIWA 5KXCA 5ACA1 3J8F2 4XE9A 2GP5A 2JIJA 3DPRB 1RUC3 3ZHQA 1TZOA 3KM5A 2A6XA 3K79A 4QXBA 5LYJB 2ZBJA 3AYDA 4LNVA 4GWJA 3F7YC 4D0QA 3CRAA 1C8M1 1RUH2 2XDVA 5F2VO 4MZUA 5BY5A 5C93A 3PUQA 2VQFO 4D6TH 3S5QA 1F4HA 4NPMA 4RHV3 1ULGA 1TMF3 1D0GA 4NVPA 1AX2A 4JKMA 3ETGA 3E97A 3WP6A 1VQ7V 2W0FC 2XJQA 1GKFA 5E6HA 4DV6B 2ZGMA 4AFBA 1H2GA 4C1XA 1L0LH 4CDWB 1LESA 5FPUA 2D6NA 5KR7A 4NTXA 2ES3A 4Q8KA 3A23A 1UIKA 2FDHA 2WZPP 3SH5A 3NJXA 2WR9A 4J7KA 2RR12 1ULPA 4D6QA 1Y7BA 1ZVFA 4KGGA 2Q1FA 3AZZA 3ZMZA 1JOJA 3PU3A 4QB2A 5FP4A 3J9SA 5ANNA 1RSOA 3CCJV 3CXCU 3KGZA 2PA7A 4XDJA 1S0BA 1JOBA 4G27B 1QJX2 1N4CA 3SJBC 2DF7A 1YHQV 3JBG2 3VBHB 4V2WA 4ASLA 3VD3A 1MS8A 4Q6GA 1BZWA 3JCIA 2IVJA 2N05A 2C9KA 1S0DA 3OOXA 4MADA 3B2EE 3OCPA 2W1QA 1RUE1 4QQPA 1DZRA 1VBE1 4QQHA 3U78A 4U7NA 3FMGA 4F83A 4QDSA 1K5MB 3GHNA 4IEPA 1G6NA 2ZE5A 2E33A 1NY71 4IEVA 1J5EO 3D82A 3LCPA 4ARXA 4DO0A 3URFA 4O4LB 4DNYA 3UESA 3ZMOA 1V00A 1LUWA 1OOPB 1Z7S1 1QGLA 2OYQA 2VQEB 2VQEO 3KGLA 5CNAA 4YVSB 1E5HA 4BAYA 1QJU3 4QX0A