4NVPA

Structure of the cyclic nucleotide-binding domain of hcn4 channel complexed with 7-ch-camp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
200
Chain Sequence
SPMDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Nucleotide Mapping of Hyperpolarization-Activated Cyclic Nucleotide-Gated (HCN) Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 67
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4nvpA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nvpA02
1QWRA 4MV2A 1Y3TA 4Q0UA 1L3JA 4AQ2A 1ZRCA 3LOIA 5KHKA 4IEVA 2E9QA 1O3QA 4AQ6A 4HMZA 3KGLA 3MDPA 2D5FA 4META 2GZWA 2Q0AA 2UY8A 3ROUA 3M70A 3E97A 2V09A 4PIZA 2K9ZA 1FXZA 5FLHA 1X82A 3SHRA 4I0BA 3SCFA 4IERA 1VJ2A 2BNOA 4QGMA 3D0JA 2OZ6A 4Z82A 2WFPA 3OD0A 3RYRA 2CGPA 3U11A 1YUDA 5I8SA 4YRDA 4QMAA 4EWEA 3LZZA 3H1WA 1QY4A 3OF1A 3RYPA 1DGRA 4QGLA 1NZCA 2MPFA 3S7IA 4XFIA 1O5UA 4YSFA 2XLGA 5LEKA 4XF9A 1GQHA 4D7TA 1CAWA 1RL3A 4IEPA 5JAXA 4ZU5A 4N9HA 1O4TA 1ZRDA 2OZJA 4UXAA 2ATFA 4IEWA 3FWEA 5JSRA 1RC6A 4NVPA 3UKNA 2D93A 5E16A 5T3NA 2PQQA 3MYXA 1VP6A 1SQ4A 3I54A 1YFWA 4HSLA 4E2SA 2KXLA 2IXKA 3LAGA 4IEZA 3EHKA 4LUMA 4XFFA 4CYDA 5KHHA 3SCGA 2K0GA 2VECA 2GU9A 2OYZA 3GBFA 1QXJA 3R6SA 5FPXA 1LRHA 1GQGA 4TLFA 1I6XA 3MZHA 1UIKA 3JZVA 4AVAA 4HSJA 4ZU7A 1X7NA 1YFYA 1WA4A 1J3QA 3U10A 3N4MA 4KU7A 3WW3A 2QNKA 1CAXA 2PHDA 2EVXA 4IESA 4AVCA 1SEFA 5I8YA 3NW4A 4FAHA 2VQAA 4KWLA 2CAVA 4EROA 1NYWA 5FQ0A 3BU7A 5AVPA 4FAGA 4Q29A 3PLQA 1H1IA 4BYYA 3MPBA 1UPIA 4Q0PA 3TNPB 3HQXA 1CAUB 1VR3A 4AXOA 1YFUA 2EA7A 2QCSB 4MGKE 3PVBB 2VPVA 1YLLA 3E6DA 3H8UA 4QM8A 4QXKA 5LRSA 4IETA 5CU1A 1G6NA 2B8MA 3KSCA 3QOPA 1OD5A 4JVAA 4XF0A 1ZRRA 4I2OA 2D5HA 3U0ZA 1I5ZA 4WBBA 1SFNA 3DV8A 4LLOA 4I3PA 1PM7A 4HN0A 1UW8A 1XE7A 1ZZCA 4JV4A 2PTMA 4HLTA 2B9UA 5I0UA 4J1WA 4E2GA 4F7ZA 4X6QB 1Q5OA 2EAAA 5K8SA 4IEOA 5C8WA 2Q4SA 3HT1A 4MGZE 3SXWA 3KCCA 3QACA 5J3UA 1TQ5A 2GC0A 3FX3A 4I0AA 3S0MA 3E5XA 3USSA 4K8FA 1U12A 2XLAA 4ORFA 1OMIA 4EWDA 4OLLA 3HT2A 1O7FA 1CAVA 2QJVA 5BY5A 5LRRA 1OI6A 1ZZ9A 4PIYA 4XETA 1IPJA 2HKXA 2PAMA 1ZZ6A 4XFBA 3CLPA 3BPZA 3IIAA 1CAVB 1CAWB 1WGPA 1J3RA 3LA2A 5FCCA 5C6CA 3ELNA 4O9EA 3E5QA 2UY9A 3EQEA 4XFCA 4EV0A 2UYBA 4UBGA 4UBHA 4Q0VA 3H1MA 5J48A 2B5HA 4HVRA 3I59A 1LR5A 3E5UA 2CAUA 4X6RB 3OGJA 3H7YA 1UIJA 1NE4A 3KGZA 1Y9QA 4P9GA 5BXXA 3ETQA 5EZWA 3H50A 3G7DA 1OFNA 4YYOA 3GYDA 1J59A 4KWJA 3H1YA 2GC2A 3SMHA 4HVQA 3HIFA 2FQPA 2PFWA 2IXLA 4QM9A 1Q3EA 2PYTA 2XGXA 5I0TA 3RNSA 5JCTA 1LB2A 2HJIA 2H6CA 2H6BA 1YHFA 3B02A 4F8AA 4IEXA 3FJSA 1V70A 2MNGA 5J7MA 5FQ0B 3M3IA 1WLTA 3C3VA 2QVSB 2UYAA 2N7GA 2DCTA 4I09A 4XEZA 3KMHA 4FT8A 4MGYE 5JSPA 2Z69A 3BCWA 3WW2A 2XKPA 2GH2A 4KL1A 2I45A 3CEWA 4IEQA 2BYVE 4A2UA 4HN1A 2PHLA 4FBFA 1QXRA 4XF3A 3NJZA 5BUVA 5LEJA 4WZCA 1RGSA 4LULA 4XFHA 3D0SA 4MGIE 1EPZA 5FDBA 5I93A 3IDCB 3IBMA 2XLFA 3NSTA 3NVCA 1LKNA 1J58A 3O14A 1ZZBA 1PMIA 4AVBA 3ST7A 3VHRA 4QGNA 4Z07A 2WC2A 1RTVA 4HVOA 2IXHA 3DKWA 2XL7A 4BHPA 1ZNPA 1J1LA 3BALA 3E6BA 4PIXA 1O3TA 3RPQA 2OA2A 3FFQA 4WVZA 4YARA 3LWCA 2CV6A 1Q43A 4KWKA 3OCPA 3IDBB 4ZU4A 4N9IA 1ZREA 1O3SA 4YNIA 3LA7A 3IWZA 2ZCWA 3NKTA 3E6CC 4IEYA 2IXIA 1XE8A 5FLIA 4MX3A 2O8QA 2PA7A 2PAEA 4JTOA 3WW4A 3RZZA 1CAXB 3D82A 1DZRA 3CJXA 3PNAA 3ACLA 2C0ZA 4PJYA 4R52A 4GULA 5E1RA 1EYBA 5D1IA 3RDIA 4E2QA 2BNMA 5JSOA 1CAUA 2ET1A 3EO6A 3SCHA 5I91A 3UKVA 5CADA 3DN7A 2IXJA 4OFGA 2GAUA 2XL9A 4O9GA 4J1XA 2BEOA 3LA3A 2OPKA 2BGCA 2PAKA 4L2NA 4LA3A 4HZFA 3ZDSA 3ES1A 3FE5A 5BPXA 4LTAA 4MZUA 3FZ3A 4MH0E 3H9AA 4BH9A 4H7LA 2F4PA 4MUVA 5I0SA 4EWAA 2ETEA 3OTFA 2Q30A 4I01A 1O3RA 4I02A 2Z2SB 5HI0A 2XHKA 1UCXA 5KHJA 4XFGA 1O5LA 5KHIA 2O1QA 1FT9A 4Q0SA 5FPZA 1CX4A 1YFXA 3H3ZA 3H7JA 5F1RA 2IXCA 5BV6A 5I8TA 3H3UA 2XKOA 1X8EA 5EFUA 3RYKA 4LUKA 4L11A 1IPKA 2QDRA 3CL1A 1NXMA 1DGWA 2FMYA 3ES4A 5I0RA 4DINB 4XF4A 1RUOA 4XF1A 1UD1A 1FI2A 4XFAA 1H1MA 1XRUA 3I7DA 4LA2A 2Q1ZB 1DZTA 4QX5A 3NL1A 4Q0QA 2P17A 4D7SA 3EBRA 4IEUA 3TNQA 2GC1A 3UKTA 4B29A 3I59B 3DL3A 3BB6A 5CVRA 2IC1A 1CGPA 1X8MA 5JR7B 4RD7A 3L2HA 3S7EA 4BIFA 1EP0A 2BNNA 4LEJA 1RUNA 2Y0OA 1ZRFA 1NE6A 1YWKA 5KHGA 4ONUA 3CF6E 5FLJA 1EY2A 3CO2A 5KBFA 4R8HA 3EJKA 4JTNA 1ZZ8A 1HW5A 1ZZ7A 1JUHA 2ET7A 4HBNA 1ZX5A 2ZKLA 3WW1A 2GC3A 1J3PA 2MHFA 3FHIB 2H0VA 4KU8A 2D40A 1ZVFA
chains in the Genus database with same CATH superfamily
1R1BA 5FWJA 3ZSLA 5KHKA 2E9QA 4R9DA 2KSDA 4UW6A 3OGSA 4S2FA 3OGVA 2AYHA 2MEV2 2GP5A 1XL6A 4BQ4A 2K9ZA 4WVMB 3SHRA 1VIWB 4IERA 3VUOA 3N7MA 2P3YA 4RSUA 3W20A 1Z7S1 1V6NA 3LDKA 4DMIA 4J7ZA 2Q8DA 5KXEA 4QPIA 2QFEA 2W52A 2ZX2A 4XFIA 4YZ1A 4YSFA 2PI5A 3SYAA 1ZRIA 2PMWB 4N9HA 1OZ0A 5IYZB 2W39A 4UXAA 3LDBA 2BGPA 4MADA 3FWEA 1DQ4A 1WLCA 2XQXA 3R4SA 3MYXA 1DLLA 2OT7A 1V9U3 3J81N 2FCUA 2D3OW 1CN1A 3ICXA 1V6KA 1RIRA 3BA8A 4ZS3A 4BCUA 1LRHA 1HLCA 4YW4A 4JI2O 1H8VA 3L2YA 3LQCA 5FPUA 1OUXA 1X7NA 3ETEA 4NWVA 2ZM6O 4KU7A 1M90W 3SYOA 3KZIZ 3DTUB 3UQ8A 3ZXAC 2HWD3 3L73H 4NHYA 2UXNA 4BW9A 2P7TC 5IK7A 4QXKA 1AVBA 4JVAA 3I3MA 4K8ZA 1HDKA 4HN0A 2RG4A 3ABLB 5DN6G 4CUBA 1KS4A 1VQ7V 3AYAA 3S3XA 3N9MA 4MGSA 3VBFA 4ZIBA 1W8ZA 5IJ0A 1AR81 3S0MA 4L87A 4UFHA 3TEZA 4OUMA 5JQGB 4AGRA 2QJ1A 1ONAA 3TN91 5L7OC 2J1TA 4C0BA 2PAMA 2FHRA 3POIA 1ZBE1 2WO2A 4H3WA 5B4XA 1VBB3 1NU1H 5C9AC 3V0BA 1KU9A 1CIYA 1D5NA 3B93A 1G9BA 5F3GA 2UY9A 2IVJA 4TQDA 4YY3B 1OCOC 1EV12 2BU9A 4HKOA 3RZHA 2D2CB 3K08A 3K75B 3I59A 1PGSA 3IMMA 1AYN2 3BU0A 1OLRA 1Q56A 5BXXA 4FP2A 5TISZ 1FPN2 1L0NH 4OUEA 3MW4A 2JE9A 5IFTA 2ERFA 3WF0A 2UXCB 4LIUA 1LUWA 1IDSA 3P3NA 1JA8A 2WS91 5T5JA 1VQNV 2XXZA 2F23A 2YV8A 1YYNA 1V9PA 4V1PA 2A1XA 3HKEB 1WP8A 2D7FA 2WABA 4H13B 4HKLA 3AMHA 5E1AC 2RMU3 3MIHA 2O0OA 2XOMA 5FP9A 3B3QE 4LBKA 3UT5A 5I93A 1W6PB 4QX3A 5L3BA 1LKNA 2VOKA 4IV3A 4HYOA 1S2EA 1I5PA 2ZGSA 5DM6V 2ZTNA 1Z5VA 1RXFA 1JH5A 3KF3A 1DLCA 1OFSA 4DUWA 3DYMA 3LWCA 4HXCA 2TNFA 4KWKA 1DGSA 2EIMC 4CDUC 4N9IA 3I2JA 5J36A 3LA7A 4F6RA 4IEYA 2VOTA 3VDBA 2E75B 2EINC 1AZDA 1WN7A 2OIIA 1VP7A 4XUNA 4U7OA 2W2IA 2A73B 1AL21 4PJYA 5F2WA 5FYIA 3T2PA 1X59A 2YICA 2UWCA 2E53A 5EP9A 4O9GA 4TWTA 3O12A 3AG2B 1H4GA 3FE5A 2ZE6A 1VMGA 2VMDA 3DPRA 3ZBHA 3Q8BA 2P5OA 4O4JA 5F2SA 3ZRVA 4I01A 1GFF2 1RUH1 4W4LA 4R9AA 4Q8KA 1XNAA 1FJGO 1GNYA 4DV0O 4Q6GA 4KI5M 1APNA 3SPGA 5AFEA 3A0HZ 2VG9A 1OF4A 1XYOA 4P9PA 2CTPA 3CRMA 5DDJ3 2RM21 3POEA 3CRQA 3JD0A 1NXD1 1BT8A 3Q4HA 2RE9A 4JGSA 3CXCU 4XMAA 4JI8B 3NAPA 4B29A 1QF3A 1YQ6A 5JR7B 4LOSA 1COV2 1PK6C 1TEIA 3RWNA 2JE7A 3SH3A 4WM8B 5KHGA 1LHOA 2Y8KA 1F8VA 2DDUA 1QHDA 4CDXB 1BBT1 3SISA 2VZRA 3FHAA 3N2KA 3HQRA 4HONA 5CAZA 2BP6A 4LBQB 1NR1A 4NXNB 3OUIA 1QOSA 5C8YB 4HK8A 1ZA4A 3IAPA 4LK7A 5F5AA 3USUB 1WLDA 1SQFA 1NCQB 3H01A 3O1UA 1EPWA 2LFSA 2V09A 2JK5C 3PU8A 3IPVA 4QGMA 3ZR5A 2VZTA 3W5MA 2V72A 2FMDA 3ILFA 3KHBA 3WUDA 5ACA1 5C4WA 5LCWL 3UCSC 1Q8IA 5I8SA 2WYSA 1GKBA 1ULPA 5J37A 3A2FA 2IJHA 3H1WA 3RYPA 2W95A 5CA6A 1JX9A 1UXXX 3KZ4C 3VDDB 2XLGA 4XF9A 1GN3A 1GYKA 3WQ7A 1CWPA 2QBXA 4YW2A 4RQEA 5BNNC 1PD3A 4OPAA 4KBZA 4COWA 4MOAA 3RT3C 4FMTA 2RN9A 2CU5A 1J5EB 2PQQA 1MSDA 5CA0A 3UGHA 1XNQO 3QTCA 3O1OA 2R043 3JASA 5IY5C 2PYLA 5A7NA 4CYDA 2CAZC 2LROA 5KHHA 2VZ3A 2YIDA 2A75A 3B4SA 4NHKA 1CJDA 4YZ5A 2XT9A 4JI0O 2CE4A 3Q8EA 1FAFA 5CA0B 3KQ4B 1OKQA 4M0NA 3SDLA 5H9CA 5JMCA 4Y26A 1UY3A 4OZOA 1VBE3 5FBZA 4LF5B 4KWLA 2ZDIA 4X66O 2JE8A 5IYZA 5ACA3 1BVP1 2GMMA 4E27A 5A33A 3E22B 4G4FA 4LT5A 3GZAA 1TZOA 4CBCA 4BIUA 1PM7A 1UW8A 2EZOA 5IT9N 5GTIZ 4J1WA 3DPRC 1P49A 3F95A 4AI1A 1PV0A 1PPJH 3SXWA 3LEIA 4CU8A 5EZYB 1QJEA 3OBRA 4RHV1 4K8FA 4OHWA 2XLAA 4NKGB 4CEWB 4U3JA 4JGZA 5BY5A 1JYWA 3IIIA 4W65A 5LRRA 5FZKA 5A3MA 1VF7A 2V73A 3TGUH 2VTXA 4FPLA 3CD6V 1CAWB 2Q8VA 4W50A 4DR6O 1AR82 2VW0A 4FPEA 1Y9GA 3FX7A 1ZSPA 2EAKA 1QVGU 4QXCA 1RUG3 4CEYC 3GHMA 4FPPA 1PK6B 3BVOA 2BCCH 2CSGA 4O4LB 2CAUA 2BVVA 4X6RB 1DF5A 4C7UA 2D43A 4OZXA 5JJJB 3X2QC 3RYIA 2P67A 4ASLA 3OBZA 1J59A 4HVQA 1WW6A 2HVJC 2FB5A 2HJIA 2H6CA 2R49A 4QD2A 1XXNA 3AFGA 1JR9A 1UYZA 4C0HA 1WLTA 4CUGA 4QPIB 3JBG1 2N7GA 4XZPA 5FZ7A 2JD9A 3CEWA 4P00B 5JI9A 4FPYA 3GJBA 3B09A 3VBOB 2A3YA 1I7FA 1QJY3 5FDBA 2RJKA 2BGOA 4LPLA 1S0VA 2Y0PA 1RHI2 4FCAA 1IQAA 3VBHB 3DKWA 2WT0A 2ZIOA 4YLZA 1RUJ2 2QM8A 3AP5A 3OEAA 2JRIA 2R061 2N04A 1W39A 2Z42A 3ORJA 5T55A 3AZZA 5EV7A 5JH7B 2VO5A 1RJ8A 1V55C 3NKTA 1VRH2 4K0KB 1HNWO 4I7ZB 1BVVA 3TXSA 4LF9O 3PUHA 2Q1FA 5J2UB 1S0GA 3OMAB 2WNVA 2WZR1 4DQAA 4XZUG 3SCHA 2K1EA 3LUTB 1LOGA 1GWMA 2ZPXA 3OUSA 1WBFA 1GN2A 4KUMA 1NKDA 4PI2A 3W9AA 1AJNA 5FNVA 5H9SA 2XAJA 2XASA 2WDBA 4LCUC 5I0SA 1IG3A 5GTHZ 4IDZA 1YSCA 4CDWC 2OXBA 2ETEA 1UCXA 1I1EA 2EXIA 4JKKA 4BQ1A 3ETPA 1NTMH 1H38A 1XNCA 5BMVA 4BISA 2DTYA 3P30A 2OKXA 1T5EA 1LOFA 4DINB 4NTXA 4UOJA 2RS53 1QU0A 2DYRB 1CONA 3AB0A 4RFRB 2VUCA 3ENRA 3PU3A 1LOFC 2ES3A 3VV1A 2H0BA 3I59B 5CVRA 1I5YA 5C3QA 2Q9LA 1THZA 1RUC1 2Q7HA 3O0WA 1IS4A 4Q4V1 2WQ4A 5F2VO 3JAWB 3ZFEB 2FMLA 2QQIA 4BQ3A 1PGW1 3D8CA 4KP4A 2RS32 2GC3A 2VUDA 3RVZA 2OW4A 4O4JB 1P7BA 2D6KA 2QEXV 4BLJA 4AAXA 4YY3O 5LA1A 3ZJZA 4XDJA 2GTAA 1AL23 1RUC2 4GXLA 1HP8A 2ADQB 1KJRA 4P9OA 2J1EA 3N9QA 2GZWA 4XCAA 2Q0AA 1YTFB 4O2AB 1TVGA 4NR1A 4TT3G 4PIZA 2WT2A 4RAIA 4UF0B 2OQ6A 5BYNA 3ZMVA 2VXJA 1UU4A 3L75H 4IE4A 1XMQO 1FPN3 5B1AC 1S55A 3CQOA 2ZZQA 3J8F3 1U0AA 3VBRB 1OJHA 4DV2O 1E5SA 4L99A 3WDXA 2WLIA 3T4ZA 1QR9A 1O5UA 3N9NA 3ILRA 5KXCA 4PF1A 1XSRA 1IS5A 1NA1C 4GALA 1HRV2 1PM9A 1ST8A 1Y74A 5LHIA 4QE7A 5J2TB 1P84F 3ZPYA 2KG7B 1FJGB 3ABKB 2RDSA 3IDEA 3R6SA 3VBFB 3IZOA 2BDRA 2IM9A 3THPA 1UIKA 4YIPA 3SITA 4LNUA 2DVBA 1Y74B 4XUOA 5EYYA 4K6BA 4CU7A 4BQ2A 1IGOA 4DUYB 1GMGA 2UUCB 3LD8A 2NLRA 4FAGA 4IGQA 4FPKA 5T50A 3TNPB 1YXBA 3HPNA 4CDXC 4B3SO 4XBNA 3ZR6A 2Q1MA 2B39A 3QOPA 2JEMA 1LEDA 1OSGA 5FXWA 3ASNB 5C5UA 3JD73 1PIV3 4GKXA 2Y4TA 4R9CA 5B3SC 4JRLA 2LGWA 2YXSA 2ZCEA 2ZX4A 3GCXA 3N7JA 3K3NA 3SYQA 1BS3A 1CAVA 4UFMA 4Q2FA 3G67A 2VMCA 1MQTA 5CBGA 3JUUA 4NYKA 3RI8A 2BWAA 3EQEA 4XFCA 4FLZA 1AJOA 1I08A 3HNBM 4JQRA 4Q0VA 2BTVC 3ZXFA 3E5UA 1DGLA 1ULGA 1W6NA 3UJQA 3STLC 1SLLA 5LY2A 3ETQA 3H50A 1NT0A 4YYOA 1D4M1 2DYRC 5LASA 2VBDA 1QJX1 3HIFA 4KXRA 1PIV1 4YG0A 2M7WA 1LB2A 1G4YB 1QEXA 2QVSB 1HJGA 3WU2Z 2BE3A 4LF7B 5FYBA 4CU6A 2DCKA 4IEQA 1PZ7A 1WD3A 2BOBC 3WNLA 4YHHB 5CB4A 4GKYA 2EIBA 4RYDA 3G4SV 1NCRB 3T1YB 3T1MA 1SLCA 4GKKO 3FAVA 2PLV3 3H1HH 2WBKA 1FX5A 3JD72 4WVZA 3DEMA 4KG8A 4MS2A 3LGRA 4YGDA 2G9GA 1N1VA 3D4KA 1IBMO 2OQ7A 4OVEA 5AG2A 1MPXA 4PJ0Z 3WG7B 1ASJ1 2AZ2A 4ZBMA 1LU1A 3L74H 1DYPA 5L3DA 3BKZA 4HKWA 2ZHLA 3WHTA 5JSOA 3BUCA 3RJRA 4XDQA 1S72V 5DQ0A 5H5NA 2N05A 2QTSA 1H2LA 5FZ3A 1DP0A 4DXRA 1JI6A 2IU3A 3PVNA 1FKAO 3RZLA 4BH9A 1BQ0A 3ZYRA 5GONA 3K4ZA 4UV9A 1DFQA 2B5UA 5H9PA 3N2KB 4BA6A 4XBFA 5F1RA 3I2OA 4LO7A 4LO5B 3H3UA 5I8TA 5LB6A 2E5LB 4LUKA 1WWYA 4K3AA 4YZ4A 3NO8A 3CL1A 3CU7A 3O1PA 1TME1 4FLWA 4AFCA 4FFBB 4X64O 1O9GA 4GT1A 1FPN1 1ZL8B 4FTEA 2W68A 1URXA 3T30A 5EXOA 1Y4MA 2D3PA 3MIFA 4DR5B 4LF8B 3OGCC 1FMD3 1VF5B 5LK7B 2VOXA 2GC1A 1S0IA 2W1SA 2R1DA 1HB2A 2YGMA 4UXNA 2F66C 1W99A 2GH8A 4JI7B 4JI4B 4YW1A 2WIIB 5BNOA 4YVWC 1K3EA 4JTNA 1KGYA 4WBNB 1W03A 4YPJA 1Z7S3 4HBNA 4MVRA 2ZKLA 3WW1A 3KF5A 5EQUA 4XUTA 3FBYA 3FHIB 2YMZA 3T0BA 4LHKA 3AG2C 1UYPA 1D4M3 4DUZO 4QKNA 4Y3OA 1H6YA 3W7XA 2R0FA 5C3SA 5FZEA 1W59A 2E74B 2WUHA 2TUNA 3JAKB 4XYXA 4META 4CZSA 3ROUA 5AC92 1RMU2 2A3WA 4K1ZA 5FLHA 4I0BA 5EWSA 3LFIA 4PDVA 4NJ4A 2XJRA 1ZTEA 5HV4A 4NXMO 4AWDA 1RUE2 2P6JA 4H44B 1VBD3 2ARAA 1QVFU 1HXS3 2ZE5A 1WNSA 4IV1B 2ZMLA 4LBJA 3BIEA 4UCSA 3S7IA 4WM7A 3MBWA 1W6OA 1OUSA 1RL3A 5JAXA 1GQPA 1D5AA 4HG6B 2F4VO 4A6SA 2ATFA 4B3SB 2OWOA 2RDQA 1C4RA 2EIJC 4YJ3B 3OEEG 4ITCA 3DYPA 1UYYA 1NQDA 1QQP3 3VZMA 1RUD3 1WA6X 4XFFA 5CBLA 5IJ0B 3Q8FA 2KM2A 3ZHQA 3FYEB 1XHXA 1QIQA 2O14A 3F7YC 4HSJA 4FTSA 4AI2A 2A0LA 1Q8VA 1BK0A 2DQ3A 1TMF3 4AI3A 1XI1A 3SEEA 2QDOA 2X7RB 4NAOA 5IK8A 2DVGA 2XBO1 4A7YA 1AI4A 1W8FA 1QQCA 1HNXB 3WG2A 4CCEA 3MIGA 3WCSA 3LEKA 1VR3A 3SR2C 3OPTA 1UX6A 3H1KH 1P7GA 4EQVA 2B8MA 1OD5A 2X6BA 4WBBA 3DV8A 4E2LA 3OM3B 1RUF2 4YM0A 2AHZA 2Q67A 4RUEA 1E57A 5JJEB 2EAAA 5B1AB 1TGOA 4LHNA 1GOFA 1K97A 4DW0A 2XPJA 3N9OA 3Q4HB 4ORFA 1J95A 3O1MA 2WN3A 4BOWA 4DV7B 4AE2A 1NJIW 2QJVA 5L7OA 4U7NA 2D6OX 1VBA1 1GOGA 2ZAHA 3M7MX 1CR7A 3LNNA 2WYFA 1GM8A 1FD9A 1KBHA 2A5ZA 4CCOA 4RHV2 4EN9B 1W05A 3E8BA 5G04L 4LJHA 4WM8C 2QGNA 1Y4WA 3E5QA 3L9DA 3WUCA 1W6NB 4IGOA 3VDAA 1FATA 3ZIAG 2GN3A 1IG0A 3OAAG 3OYWB 5LL6Y 1NE4A 2F17A 4NXMB 4DRVA 2GN7A 3RZKA 4MT8A 4O4IA 3VHOA 2AW9A 1XHZA 1XYNA 4NPMA 3M99B 3NV1A 1R3IC 2X53S 1RUG2 3IJ4A 1R081 2VCBA 4IXLA 1E1RG 4LKSA 3M3IA 4X62B 2VZ1A 1CJPA 5GONB 4XEZA 2Q7EA 4IGPA 5ANNA 5JSPA 1U5IA 5FUNA 4DK0A 3JALA 5CB4B 5F32A 4RFT0 4I55A 2BYVE 4N43B 3POBA 1CPYA 3A7QA 4A3ZA 2E63A 2NR5A 2V4VA 2GMEA 1HRV3 4QB6A 4BQWA 1VBA3 4CDWB 1ENSA 1WP7A 2HYXA 3FBMA 4MGIE 3LE0A 2R70A 1DF0A 2AACA 4ZPIA 1ZBA1 1Q82W 2Y69B 2QQPA 1DZQA 5IT6A 1GM7A 2HWB2 3I2FA 5JIUA 4GB32 3DXRB 1W2AX 5FXZA 5F3EA 4A4AA 1D2SA 2VJXA 3FFQA 3C3SA 4U36A 4YG3A 1ZREA 1O3SA 1JHJA 2Q8CA 5DG1A 1JZ6A 1PNFA 1FMD1 5A3OA 5FREA 2PHRA 4M4PA 4CCDA 3WW4A 3RFRA 1POV1 2GNBA 2C6SA 3D82A 3OW2U 4TUYB 4DR1B 5E89A 4O4HB 2R041 3J7AU 4DO2A 1G9AA 3K2OA 1AYM3 3EO6A 1MMMA 2WNEA 3C8XA 3HPLC 5M0TA 4DR3B 2KG7A 4BR6A 1LNQA 1UZWA 3ZMUA 2D44A 2JGDA 2VRZA 1BYHA 5JVVA 2FTKA 4XACA 3GBWA 4QXBA 1NZIA 1DLBA 1UPGA 1XMOO 4DPNA 4P14A 5A7OA 4JDMA 1PNLA 4EYUA 5HV0A 2DFBA 2HWE3 3OSDA 1UYXA 2X05A 2R30A 2M6YA 4KGQA 4Y1XA 3VD4A 1FV2A 1Q8SA 2WINB 3CMAV 4G28B 3CXHF 1RHI1 4TV9A 4O65A 4CP9A 4IL7A 3RSJA 1WCKA 3WNOA 3BTXA 1N0JA 3PL0A 1F31A 4B8EA 1H2SB 1ULCA 2P17A 3CP1A 1G86A 5LGUA 1YJ9V 3EBRA 4IEUA 2IU0A 3UKTA 5LP6A 1HRI1 4INDA 1X8MA 1AYM1 3HN1A 1A34A 1WCSA 4CCCA 2FDGA 2Y26A 4AOCA 4NHLA 1YWKA 3THTA 3CF6E 1RUD1 5KC6A 1VQ8V 4R8HA 1HW5A 3K46A 1JHNA 3J7LA 5ABJC 1N47A 4C1XA 5GM0A 4QQOA 1K8AW 2YIAA 4RGGA 1L3JA 3GZEA 1EV11 2F4LA 2A9HA 2OPWA 3OY8A 3M3EA 5CEHA 3GWKC 4MHUA 4ATFA 2E6VA 2ZAAA 2CY6A 4I50B 5G05L 4LE3A 3D0JA 3AJYA 1CPMA 3JCIA 4HAMA 1JZ8A 1LESA 2HLDG 1KDKA 4FK5C 5FKCA 2JDNA 2XQRA 4X20B 2V1DA 4DV3B 4PA9A 1HV1A 5JH7A 1TVKB 4LF6O 4ZU5A 4FPHA 3VBRA 2YS8A 1MA1A 3TEXA 5B1OA 4DIQA 2RMU2 3UKNA 2YC4A 5FMBA 2ZS6B 5T3NA 3DXRA 1S0EA 1K92A 5D21A 4Y4YA 1B09A 4CDQC 3T3YA 5JCOA 3LAGA 3E89A 1K4DC 4MXVA 4E4HA 1KD7A 1C5IA 1OCZC 3VBOA 1YJLA 4N53B 4K8RB 4JZGA 1H8TA 1YIPA 1YRZA 1MZFA 3AYCA 3GZTB 2ZZJA 3TEWA 3R0RA 1UQXA 2WS92 3ZRSA 4EROA 4ARYA 3BCCH 4OI4A 5EYPB 2YUEA 4KHPO 4BZ4A 2ARXA 5LY1A 1H2GA 3ZKUA 1YFUA 3WP6A 4PCRA 1NG0A 3POJA 4MSVA 5LRSA 4JZ2A 3HEIA 4ZZ8A 3CE2A 4JI6O 4OMDA 4B3NA 4GWJA 3NXSA 3NRUA 5FLXN 2N74A 2RJZA 4QPGC 3WP4A 3R4DB 3BYWA 4A44A 4YIOA 4E2GA 4CZZA 2R072 3JB8A 2CDPA 3WP5A 1H8EG 1C5HA 1VBE2 5FL7G 2WS93 5LBEA 3CCQV 3CCEV 5GALA 3N7KA 3GB7C 3JAKA 3WF2A 4AQYO 2WZPP 3CCJV 2W91A 4IV3B 1O7FA 2PHUA 1PGL1 4AGGA 5D8AB 4P9YA 4PQQA 5FZ1A 1M56B 1KUQA 1D4VB 1OLQA 4EN6B 4JKLA 2RMU1 3MIBA 5LYJB 1CAVB 1J3RA 1BEV2 4L8QA 3NAPC 5T54A 3EMRA 3NJYA 4X20A 1CXZB 2F93B 2Q73A 2DJVA 3MI8A 3ON7A 3VZLA 2BPA2 4M01A 1LHVA 1JTZX 4CEYA 4YM1A 4PA3A 1LJ7A 3D5OA 1C1FA 2VD7A 4PA4A 3POWA 5DDJ1 2JD4A 4P9WA 1PNMA 1IBKB 3J8F1 2E26A 3ITQA 1WMEA 3ZXDA 1VBD2 1SRYA 1O91A 1EV13 1F4MA 3OEHG 4IEXA 1UY2A 1S77D 1BMV2 4OI1A 1N3QA 4KHPB 4XBLA 2XKPA 5EJZB 3NNJA 5A7PA 1WMFA 3V0BB 4QGPA 1AJKA 3ZYJB 1JMKC 3OGGA 2QQKA 3D6EA 3AYEA 2JGUA 3N36A 2RDRA 4GZ9A 1K33A 1ZZBA 5JLVA 1B35C 1FNYA 5JOYA 2YSUB 3NAPB 1RUH3 3OJBA 4BAYA 2WNUC 2JEXA 3AZYA 3AKSA 1N33B 4GH4A 4HT1T 3LSUA 4FJCC 2JVDA 3VBSA 3AJZA 1G9CA 2ZCWA 5CKQA 1SKVA 4WVVA 1R6TA 1HNWB 3KKYA 3VBHC 4DR7O 5BY1A 1W8UA 1GZWA 2NPIA 3AG7A 1IVSA 2B42B 1H6XA 4LBQA 2FD8A 3IM0A 2A6YA 3K06A 4RQPB 1SQGA 2UUBB 3PJSK 3RS6A 3GHNA 4J7KA 2DYSC 4B3MO 4LP8A 4JAUA 4FO9A 3JASB 4JASA 2Y69C 1W0NA 1MABG 4LFAO 4LA3A 3OR7C 5T5OA 4MZUA 3USUA 1NTZH 3T4VA 4EE2A 2ZR3A 1WBLA 4PDWB 3P3PA 4JHTA 1XREA 3I2KA 4CDQB 3G6BA 3STZC 4RQPC 3HR9A 1O3RA 2A06H 2Z4FA 3A0NA 2VCAA 5D2AA 1R083 4TXWA 2GBOA 2JJ1G 3U14A 1N4CA 3RYKA 3I55V 1JYTA 2WA4A 2LGQA 4UUJC 1MZ6A 5IK4A 1ND2C 1PL4A 3UYJA 3BOWA 2HVKC 4RS5B 5A7WB 1RUE3 1WUVA 1Y9MA 2XVGA 2WA3A 4LA2A 5A9GA 1LODA 2GMPA 2JG8C 5DMYA 1PX4A 4LQRA 5LWBA 4NXNO 4OPHA 4YGCA 2RHPA 1BE3H 1JYCA 2W47A 3UT5B 3WQ0A 4GAZA 4QHZA 3F5WC 4PHZA 2YDEA 2Y6HA 3EJKA 2DF7A 1HWYA 4K35A 1DYKA 2LQTA 1VAKA 2MHFA 2H0VA 4Q4W2 1NCRC 2ITCC 3O7OA 3ZSJA 1MNGA 3VD3A 5L3FA 1VPHA 1F15A 3LCPA 3PTRB 2E32A 2EICA 4ZKTB 1NT2B 5LA2A 5A6YA 1GOHA 2PI4A 4CPBA 2A7WA 4QDRA 2WLLB 2JIGA 2DV9A 4WFBV 3AZWA 3E22A 1RUF3 5F8PA 2XWBB 4O4IB 4UFZA 1VJ2A 1W6QB 2OZ6A 1W2NA 5L73A 5A7QA 1PVC1 3ASIA 1HQNA 4P5HA 3RYRA 3M3OA 1BBT3 3ZXLA 2V7QG 4QT6A 1HXS1 3MV11 4P9XA 3PTYA 4QGLA 3NWKA 2VS0A 3LF7A 1URFA 1UMIA 4XABA 4QQPA 4XQDA 2D93A 1HB3A 3FN9A 1VP6A 5ITZA 2QQWA 1QQP1 3KD4A 4IEZA 1G9DA 2VR4A 2OUJA 3VBOC 1GQGA 1YC61 3J7NA 4ZU7A 1HRI3 1NUKA 5LZ6A 3N4MA 1QLEC 2QNKA 5FRAA 1RUF1 2A71A 3NW4A 2CHHA 1KEXA 2X5IC 3PMEA 1NYWA 2HWC1 1YLLA 4YW6A 4FVVA 1KRIA 4B4QA 4IETA 1YI7A 1OH4A 1Z78A 5JXIA 2EIKC 4JZRA 3O1RA 1O59A 4E8CA 1NA1B 4X8NA 5AC93 5IAVA 3TRSB 2AGAA 2P5BA 3HT1A 3RWRD 5JR2A 3QACA 2CTRA 3OTOO 4EZHA 5LMUB 4CDQA 1M1KW 1UF2C 4ZI7B 1NY72 2W94A 3VBHA 3LSEA 1RJ7A 1SFPA 1Q7YW 4JI1O 2VQTA 3WHUA 3K59A 3RWKX 1C1LA 1ND2A 4XURA 4JYCA 4N43C 4BU2A 4FTBA 4AI8A 5JMOA 1WB8A 2OVUA 1VBE1 4M3CE 3B8NA 4N53C 3M3QA 1GZ9A 4K9SA 2YPJA 4ZONA 4K1YA 4GQ7A 4FXKB 4YVWA 2OCHA 1XNRO 2B5HA 3TWIA 1V6OA 1DCSA 5IYYA 1L8DA 3VBUB 1OVPA 1W06A 2VQUA 3M2MA 1NCQC 2HWC2 5I0TA 1OXCA 4F4LA 2D6NA 4CU9A 3PUIA 1YHFA 4DR5O 1KD1W 4XW3A 2WL1A 3VN4A 4MW3A 2ID4A 2GNMA 1M4WA 3T0AA 5KXDA 2Y38A 2ZM6B 4XF3A 3GGLA 5LEJA 1MS0A 5C8CB 4BQYA 5IJ9A 4YFZA 3RG0A 4FVMA 3D0SA 4QKDA 5ERLA 2XJVA 4OCTA 3WT3A 5FMDA 5AFBA 1QBZA 3IDCB 3N27A 2FBEA 5IYBO 3CC7V 3SNMA 4TV8B 2PUSA 4P9IA 3EXUA 5BNNA 4LWSB 2JDHA 3RPQA 3LDDA 4M0HA 5T5LA 4DV7O 3B40A 1K5JA 4QIWF 1EUTA 4CP9B 3JAWA 1Y6XA 2ZKOA 1QDCA 1IXMA 4U3FH 4Z2WA 3C2UA 3TCUA 4CS3A 1NTKH 3R66A 1PMHX 1SQQH 4Q20A 1TUBB 3G6JB 5E1RA 1W0OA 4DR7B 3UKVA 1W8WA 5LBCA 2XNDG 2FDIA 4FOQA 5CKMA 4DR4B 3LA3A 1AJPA 2AZ5A 3FLPA 1N36B 4P9JA 4LBMA 3UO2A 3AX4A 3J80N 1S76D 3FZ3A 5IVVA 4SLIA 4AAPA 3RYHB 2WNOA 5EYXA 1GU3A 3WNXA 3OFNG 3CBNA 4YVSB 4LKDA 4IE7A 4JYBA 1POQA 3GJAA 2CL2A 5KUMA 2D6PA 2XHKA 1JZ5A 3DF0A 3AP7A 5EJ3A 1O5LA 2WNVB 2Q5TA 3WG3A 4DUYO 3SJQC 3H7JA 1GNHA 1MZ5A 5EFUA 4L11A 2Y6LA 1HIXA 3JD4A 2P1BA 1NXMA 1PO11 4H33A 4DXWA 5I0RA 4XF4A 4I50A 4N7IA 1V6IA 4UI9L 4E4ZA 3CRRA 1UWWA 2Y4UA 1XRUA 4GLXA 3VDDC 3AYDA 2VMHA 2A3QA 1GNZA 2CNAA 3Q8CA 1BMV1 3JBG2 5FBJA 4AEDA 4PDWC 1TG7A 4LNUB 4URAA 4H0LB 1N3OA 3AG1C 3DGTA 4B3RO 2PYJA 5FLJA 2ZX0A 2ZEWA 3HR0A 1B3QA 5HCFA 1SF9A 4X65B 3X2QB 1MS3A 3NV4A 4CDUA 5K1XA 3MDSA 1HNZB 1ENXA 2QQUA 2AR6A 4J9ZB 3SJCC 1DGRN 1C8NA 5FZLA 4Q27A 5DZFA 4JDOA 5HXMA 1UZ0A 4NUBA 4B4PA 3CCUV 2IZWA 1AP6A 1BMFG 5F3IA 4DR3O 4JYAO 5IVCA 1JU3A 4WBNA 5C9AB 5J1XA 5FZHA 3WG1A 4NIIA 2FDJA 5DAVA 1FXZA 1OLMA 1VF6C 4RQPA 3WXPA 2YG0A 2P4VA 4Z82A 3VQWA 1V6MA 2B7YA 2J42A 3AKQA 4NIGA 4QMAA 4EWEA 2DMXA 1DGRA 5LK5A 2MPFA 5C8CA 5GZGA 4Q1RA 5FYSA 4DV5B 1GQHA 2UWAA 3IPVB 5HFMA 1FV3A 1NLQA 1HRI2 1ZBA3 3AVRA 1IKQA 3ETDA 1UOGA 3NNFA 2JDIG 1Q6UA 4X9QA 1F35A 4FPFA 4JKMA 1OC1A 4LOTA 3D36C 5B1BB 5KA6A 3WG4A 1NCRA 4LUMA 4UF0A 1G9FA 1TVKA 3KCXA 2Y33A 3IAQA 3D36A 1O4YA 3IC7A 1WA4A 4N43A 1CAXA 1LHWA 2EVXA 4AVCA 2WFF2 1LGCA 2BZDA 4AHWA 2WLQA 2Y60A 1SBDA 4Q29A 2HHHO 2FKXA 3MPBA 5JXGA 1B06A 1UPIA 4PBPA 1CAUB 1XDCA 4QX1A 1HQLA 4J6GA 4CTEA 5EYPA 3WOGA 1ZRRA 5F7UA 1DYOA 1I5ZA 2VMGA 1SFNA 2VAUA 1FFXA 4KFMA 1YI2V 1OLME 1ZZCA 4JV4A 4YM3A 4HLTA 3ACGA 2ZGTA 1KB9F 1S0BA 2IJIA 2R9IA 1PO21 3LEGA 4CH3A 3UGFA 5KAFZ 5FPVA 4YVSA 1QJX2 1OKOA 2GDSA 4OLLA 3CCRV 2DTWA 5K7PA 1OA2A 3K4DA 4M3CF 1IPJA 3HKCB 3HJRA 1V6LA 4OHXA 3MUY1 1SESA 5FZAA 4XJWA 4GIQA 4UYBA 1WGPA 2DVFA 5AVAA 3ZYPA 4XC9A 2P3KA 3ZVXA 3NKGA 1KFUL 4QDSA 3W7SA 1XNRB 4GMP1 4FQZA 3M4FA 4DXZA 2ODMA 1K5QA 1NQJA 1YO8A 1Y9QA 2LALA 1QU7A 4UFKA 4GZRB 3SH5A 1OFNA 1B6QA 1BBT2 1BZWA 4AEKA 3FUQA 1NCQA 1FXKC 5CN0A 2HEVF 3B02A 1X4TA 3ZRXA 5DZEA 5CG8A 4MVTA 1IURA 2ADEA 1JZ2A 2YI9A 1BEV3 2DCJA 4MSWC 2QZ2A 1UMHA 4KL1A 3ZFGA 1PKXA 1JJOA 1LOCA 4A7ZA 1DIWA 5BUVA 1HR0B 4ZHQA 5LOVA 2WLLA 2KQXA 3OMNB 3JARB 2XLFA 3K0GA 5DUUA 2VUJA 1UL9A 2VBPA 4FLTA 5T52A 5FFOC 4AVVA 4AZZA 3TYJA 4BB3A 3CRCA 5FOBB 5B3SB 1PO13 4PIXA 4ISRA 5ISLA 1XYPA 4YARA 2SBAA 2R9RB 4H37A 3THOA 4RS5C 3S5AA 4W4KA 3ABMC 3UETA 4B3TB 4BQXA 1JYXA 4G3YC 3N2GB 1XSQA 4TZDA 5JWPA 2GSYA 2IJKA 1VQOV 1XMQB 1QH7A 1N34O 2NMNA 4COVA 2F4VB 4IYHA 4LR3A 2OT5A 1S0CA 3J7MA 2JG9C 5BNNB 2XB6C 4Y5TA 4R8CA 4AQSA 4I4TA 1OH3A 1PZ8A 4N23A 1TAEA 3BOPA 4ICGA 4P30A 3BA9A 2BOIA 2P6HA 2NN8A 1QHTA 3JD2A 3B69A 3BN6A 4JI5O 2GV9A 1N33O 3H1JH 2XHNA 2VTXJ 1C57A 3H42B 1ZL8A 4PA7A 1S5LZ 2UXDB 4Q0SA 4S2DA 3K57A 1EN5A 5IVBA 2B4KA 1REFA 4WVWA 4PT6A 1PNKA 3N2GA 4QE9A 1T6GC 2Z79A 1QLNA 4XF1A 2X6CA 4CCLA 3KM5A 5LA6B 3WX5A 3APOA 3ABMB 2R72A 1QNYA 4AEMA 5A3TA 1BCCH 1RMU1 4O4LA 3TNQA 3DSQA 1WCDJ 3M7AA 1X36A 2VQ0A 4H14A 4FM1A 3FC0A 4PLMA 3O0VA 1G8MA 3OGIB 4AEJA 2ZBJA 4J25A 5B1NA 3P32A 4ONUA 2PHXA 3LFMA 1EY2A 1ZZ8A 3N3HA 4LE4A 2WLHA 5CBFA 1L0LH 2ZGMA 3M1HA 4YJ2A 2FDKA 2D40A 1OHFA 2X6AA 1N36O 4I30A 3FAVB 3ACHA 3HKDA 2C9KA 4AQ2A 2ZA9A 1RSOA 4LF7O 1VIBA 2YI8A 4HMZA 1ULDA 4JGYB 4LLFA 3ZSKA 4XMIA 2UY8A 1PIV2 2A3XA 4ATEA 1HDJA 2B1GA 3MW2A 1XOUA 2CGPA 1SS3A 1S4CA 5I0DA 2XMLA 1N1SA 5DAWA 1SZTA 3W7WA 4ZKIA 2AH2A 4BK5A 3FD9A 2EILB 3RMYA 4EEQA 2OYQA 4FPJA 1AHSA 4K7JA 4CEWC 1TUEB 5L9BA 5BR8O 4QQ2A 3ZHUA 2O8OA 3I56V 2D3RA 1YVWA 1LENA 4HPKB 5EPAA 4DEVA 3JAMN 1F23A 5FYUA 2ZIMA 4JI8O 3CYOA 4E2SA 4HSLA 3SPCA 3FFZA 2K0GA 2GU9A 2OYZA 3UV9A 3KVAA 3GBFA 3OE7G 2Q8EA 4TLFA 4J41A 3H8OA 4AVAA 1KFXL 3U10A 1BHGA 3E2EA 2RDCA 1JBCA 2VZVA 4NTYA 4L8JA 4FFFA 4FAHA 3ZHVA 3BU7A 5AVPA 3W21A 5CFDC 1UFIA 3ZYBA 1WPBA 3WF3A 3P6BA 4WM7B 3KHCA 3KCYA 1VQ9V 3H8UA 4QM8A 1VQPV 2X5IA 3WLUA 4I3PA 2L6LA 1ENRA 4LO8A 3ZFFA 3AP6A 3VKFC 4BXSV 1DQ1A 1UY0A 4NIDA 4R6ZA 4ZHQB 1WLEA 3HAGA 3CC4V 5FPOA 3RJ2X 3TN93 3RVHA 3BABA 3W59A 1JOPA 1VRH1 1RFYA 4LH7A 5KXBA 4AEDC 1ACCA 3TN92 2BTQA 5BZBA 1E5RA 3IIAA 2E7AA 3LA2A 2ZXWB 2R7EB 4BMEA 1UPSA 3BIWE 3JD1A 2LW1A 3ELNA 1W2OA 4O9EA 5C70A 3CPWU 2OIGA 5E79Z 4EFBA 5LA6A 1NKGA 4DV3O 4UBHA 4UAPA 3F7VC 4HANA 3FB6C 1JPXA 2H8PC 4Y22A 1RUE1 1CZVA 1WMDA 1VQKV 4QPKA 1IBKO 3POFA 1AYN3 4D0QA 1AR62 3ZO0B 5IYDO 4JTAB 5C93A 4NE9A 4PBOA 2EJRA 4YZ3A 4LKFA 2LW8A 4CP2A 1V70A 4IW3A 4GX0A 2DCTA 2HH9A 3MFCA 5FZ9A 4MGQA 5K1PA 3SQOA 3ABLC 3ZN0A 1CZTA 4FFGA 4FQ4A 1EAH3 3WEZA 1ULFA 4ZOLB 2VUAA 4XPVA 3E83A 2JWPA 3KLSA 5FYHA 2HWF2 5F39A 3IBMA 3FYIB 4QJFB 3IC9A 2K2SA 4BQ5A 3NVCA 2LO1A 2YU1A 4FOYA 2JDPA 1K5SA 3VGIA 4QGNA 2BOCC 2WFF1 4DV6B 4PI0A 3TEYA 3AK1A 4Q4V3 1J1LA 4C91A 1TNFA 1BEV1 4BJ0A 1OQEA 3G80A 4S2HA 5JPNB 1D0HA 4YW5A 1GZCA 1XMOB 4LNVA 2Q0OC 3NMBA 4I3GA 3E6CC 3O1VA 4AFBA 1XE8A 1RMU3 3OPZA 4PF5A 3ACFA 2GUZA 1QOTA 4KBBA 2ENRA 4GUNA 3PNAA 1RVF1 5IWFA 2R071 3SLIA 1ND3B 2GP3A 1ZA7A 2BGCA 1M06G 2PAKA 3ZDSA 3RZGA 3ES1A 4J7JA 3H1IH 3ZN4A 4AVTA 1OT5A 4B1LA 2XOKG 4DK1A 2AEZA 3H9AA 5FXXA 3BEHA 2IH1C 2F4PA 1CP9A 4AI0A 2QM4A 2ZE7A 5C71A 1M5IA 1ND3C 4QB1A 3VQXA 4GMP0 2Z2SB 1NLRA 5H9RA 3T2OA 4GJYA 5LATA 3ZFEA 5FZIA 2IFRA 5BV6A 3K5NA 5FY5A 5CFCB 3LEMA 2OX0A 2UURA 5FP7A 4IHJA 1JUIA 4QQLA 4JAVA 2YY1A 1W6OB 2IUWA 1RINA 4JAAA 2BBVA 3VQYA 3MAQA 1H1MA 2PN5A 3NL1A 1W3VA 2C4XA 2DYSB 2VMEA 1AX2A 2V5YA 4XTPA 1SMVA 3SEPA 1FOD3 4X1KA 1OCOB 1UKGA 2QWRB 2DU1A 4NROA 3H9VA 2RVAA 1BJQA 2QE7G 3RZMA 1JUHA 1K34A 1LAJA 1PVC3 2Q4PA 3ZPOA 5A6ZA 2WPDG 2E76B 2EIJB 2ZACA 3VQVA 1AR72 4MV2A 1MVQA 1Y3TA 4EN8B 4JTCB 5FNVB 2GSMB 5FYTA 2PY5A 4UW5A 2NQYA 2PQSA 2VQEB 2UU9O 4LF5O 3I8TA 3ABUA 4OULA 3K03A 1U5ZA 3OD0A 4L92A 5C4WC 2VU9A 2NMOA 3ZEDA 4DOUA 4WVMA 5H2FZ 3D3IA 1I94O 3V56A 3LZZA 4LBOA 1PO12 4PA6A 1WW4A 1N32O 3OF1A 1ASJ3 4LHSA 4BXFA 4CUCA 2ARBA 1CAWA 4IEPA 4R7CA 3UJOA 3O65A 3AMMA 1PMJX 5JSRA 1POV0 3BPSA 4Y5Z0 1QJU3 1ULOA 3SPHA 5GJ6A 1YFWA 3B9IA 4JGYC 4DR2O 4AG4A 1DBNA 1JN2P 1SBEA 2WSUA 3M8LA 1GR3A 1EFRG 1QXJA 1TNRA 3SYPA 4E8DA 5DZGA 1DQ6A 1NBMG 2P6CA 3DYOA 4J9YB 3B94A 2KB1A 4Q5OA 2B46X 3FB8C 4G2KA 1VAMA 4KG0A 4NN0A 1Y7BA 2YXLA 5I8YA 5DAPA 4DV6O 3HBZA 5F9TA 1YDXA 3LDCA 3RN4A 4CA9A 4UCVA 1YIJV 1OOPA 1MS1A 2IWGB 2F6BA 2DUOA 4I0WB 2HG5C 5FPBA 5EZYA 1BKZA 1G6NA 3OUJA 3ZN6B 3VZOA 2IVIB 3NNLA 4XXAA 5FO7B 4LLOA 1AILA 4DR1O 2HFEC 4RHV3 1VBB2 2G9ZA 4LORA 3QD6A 4QPIC 1VB2A 4X6QB 3ZX6A 5DAXA 4IEOA 1KC8W 1IOAA 4ZOLA 5B4NA 2Q69A 5A3PA 1NR7A 2GC0A 2XBO3 4CC6A 3HVDA 3USSA 4EFEA 4IIJB 3GCWA 2NN4A 3AEIA 2OCCB 4XDOA 1W2TA 5JDBA 3PJYA 2D3SA 2K46A 3MW3A 1Z7S2 4O7XA 3KVBA 5KX5A 5LBQA 1YI9A 1E5HA 2JG8A 5HCBA 3N9LA 3LKJA 1FXVA 4ET7A 1V55B 5DXDA 1GAXA 2Y0IA 2WQZC 2ZDIC 1JS9A 2HR3A 2ZKNA 4BDVB 4TUYA 2R6QA 2Y34A 4YW7A 1FXHA 5FK7A 5BNPB 2XG3A 3OGJA 1FS0G 4P08A 1FPOA 2BFUL 1UJWB 3G71V 1CPNA 3S57A 1SPPA 1DG6A 1R1A3 2Y6FA 4O2AA 3MHHC 4TLGA 4UWDA 1R091 4JV5O 4R50A 4JX0A 1OA3A 5BMVB 1A6CA 4CS2A 4JGZC 4FIPC 4IE0A 4BMBA 1JZ3A 4HN1A 4DUZB 2PHLA 2P2KA 4QQHA 5L9VA 1KP3A 2XJUA 5A32B 4WFEA 3NSTA 2WZEA 4LFBB 1W28A 3ST7A 2XBO2 2DWDC 3WDWA 2YGLA 2B9ZA 1AYM2 1GP6A 1ZNPA 2W08A 3ILNA 1X9TA 1FAYA 1AI7A 3RMXA 3BI3A 3ZS8C 1T2XA 1LHUA 1LECA 5FZ8A 1OQDA 4XTMA 3U37A 3SH4A 2JIZG 2GNTA 3B9CA 2ZINA 1W0JG 4N90A 3JD3A 1OF3A 4ES8A 3AG3C 1FMD2 4WFFA 2YBPA 2MEV3 4MVOA 2WWUA 1YCIA 1XNQB 1KITA 3LPGA 2ZGRA 4M3CB 1OPOA 2ET1A 5I91A 4BE3A 1OURA 2BEOA 2JS5A 4HZFA 1QNWA 3LIGA 3GDBA 4JI6B 3K0DA 5CZKA 1C8M2 3JYCA 1ZYBA 4H7LA 4K40A 2P3IA 3QH7A 1AYN1 2Q30A 2A7AA 1XEQA 4QPYA 1V54C 1SA0A 3BTZA 5FZBA 3AK3A 2CYFA 1G7YA 5FPZA 2WLIB 2UXBB 3B77A 4UVCA 2GUZB 1IPKA 4UFLA 2FMYA 2MK3A 4NPRA 4CE8A 2LM3A 5FY9A 2E7TA 2VM9A 1VE0A 3V0AA 1L1FA 1DZTA 3AMNA 1F4HA 2WLKA 3RYFA 1F4NA 3WG7C 5JXHA 1AR93 1NQTA 3DL3A 4P9LA 5BNOC 3L2HA 2FDHA 1W04A 2YC2A 1O8SA 2EALA 4MVQA 5CNAA 3ABKC 4IE6A 3T1LA 2DQ0A 3E8HA 3UT0A 4XQWA 4CUAA 4COZA 3AMPA 4OI0A 1WA8B 2RS33 1PGW2 4Y1UA 4Z1VA 1HN0A 1ZVFA 5L7OB 3K5LA 1F4AA 2UXCO 2QTWB 5C3PA 1PVXA 2WO7A 1K5MC 3WD5A 2X29A 1AR1B 4NIHA 3E97A 4LFAB 3OUFA 2CWSA 4MTFA 4UCUA 5FPAA 1S5HC 2MW2B 3AP9A 2HWC3 2SLIA 1AX0A 4X64B 2RS52 1O8PA 2F1MA 1MOFA 5JZGA 2XJPA 1V00A 2JDZA 3ZFEC 2V4DA 2WLNA 3S5QA 2DOSA 1SLIA 3J26N 5FJKA 3ABTA 4C90A 2HLEA 2OZJA 3ZM8A 2EXHA 3ZXGA 3AXDA 4GB31 2ZGLA 2PXJA 4ASKA 4CRQA 3VD7A 1ZBE3 3EB7A 2A70A 2VZOA 1BGYH 4CCKA 3D3QA 4NB5A 3NR7A 3QO7A 3ZRWB 2XJQA 3K48A 2J7MA 3KV6A 5BNPC 3WW3A 5LW9A 1LNSA 3ZKYA 2V5DA 4CCNA 3AG1B 4JPRA 1SLAA 1QGLA 1W2UA 4Q4Y2 4BYYA 5FMCA 3RQ0A 1CEZA 4MGKE 4ASMB 2J1RA 4QNHB 1Z0HA 2CTQA 5JIAA 4UFIA 3WDVA 3CNAA 1XE7A 4C1WA 1AL0G 4LF6B 3AMQA 3ZDVA 1Q5OA 2HWD1 3WDUA 3VBFC 3SKJE 5D5QA 3FX3A 3HWJA 4DUXA 4LBQD 1KYOF 4W8JA 4EWDA 1RB8G 2R1BA 1LU2A 1KKDA 1P8JA 4HPKA 1VQ6V 1AXKA 4E4EA 4LBLA 4NWWA 3MIDA 4U3JB 2LUWA 4D6TH 4AR2A 3VKMA 2WWWA 1OOPB 1QJU2 2JS3A 3AZXA 2LW7A 2PGGA 1YJKA 5C3RA 1AF9A 5APAA 1LULA 1ODMA 1PHMA 1YQ2A 4Y4RA 3H8XA 4NIAA 5K0UB 3KGZA 3J8F2 4Q4X2 4ZY9A 1RUI2 4LH6A 3K9SA 3SMHA 5C33A 2FQPA 2IXLA 3QLQA 5JXJA 3MD0A 3RNSA 5J2TA 3KG2A 3VZNA 5CBHA 1VARA 2VXRA 1GP4A 1R082 1R1A1 1W9YA 3Q9OA 4I09A 2W3JA 5EC2C 1AUYA 1HV0A 2VZPA 5FYCA 2R042 1IPSA 2WWSA 4LF9B 2GNDA 4A2UA 1XNDA 1K5MA 2Y6GA 4CDXA 5ABJB 3POSA 2F43G 1UU5A 2YROA 5C9AA 3ECQA 4I0XB 2WLJA 3T09A 3O14A 4PQ9A 3VHPA 3FLTA 3ZYIB 2WC2A 1C3HA 3DGEA 2IXHA 4CEWA 1SDDB 2W0XA 2XDVA 4BHPA 1Q86W 2QA4V 1LGBA 2Q5ZA 3QO5A 4LITA 5CFDB 1YEWA 4DV2B 1NLSA 1BZKA 3U07A 3G6EV 2YZ4A 2FCVA 5JCOC 2PA7A 3GBGA 3IMNA 1BK1A 5CFCA 1BHAA 1CAXB 3X29B 1VRBA 3CHXA 5EK0A 4FM0A 3B8MA 2ZR2A 3B2EE 4J80A 2ARCA 1RVF3 1UX7A 1SETA 3POYA 5D1IA 2BNMA 3HBKA 2NP0A 1YNAA 3QNEA 1OCRB 5A6QA 2JKXA 2IXJA 1RYYA 5CG9A 1NAEA 1EN6A 4BWAA 2OPKA 5IVFA 5JPMB 1MEC1 5JI7A 4RO2A 2VQFO 4MH0E 4W6WA 4TV8A 1GRJA 3VZJA 2X10A 2HWE1 1LGNA 4QHBA 1C8M3 3JD71 3K51A 4XUQA 2ZABA 3I3DA 2P90A 3L72H 1JYVA 1E1QG 4D94A 4XUPA 3SJBC 5K9YA 3L70H 2PLV1 3VKLA 3ES4A 1S1AA 4AEDB 1R73A 3JCUZ 4KH9A 3WV6A 4Q4X1 3M3CA 2QUOA 4X8AA 3ZMOA 2Q1ZB 4B3TO 2ZX3A 2ZD9A 4Q0QA 2XAQA 1SFYA 5BNPA 1VRH3 5J98B 4CCMA 1ZWIC 2B45X 1QLEB 1L7RA 3A8TA 4NMIA 3ZYHA 2L9LA 3OBTA 4NTWA 4X88A 3A0KA 4TSVA 1PK6A 4IV1C 1H2NA 5FY7A 1NE6A 2YBKA 3WF1A 1RUH2 4CP0A 3J9SA 5DAQA 2ITDC 3KQRA 3VBSC 5FR3A 4FLUA 1H30A 5CA3A 2E33A 1GO3F 2ZOEB 1EAH2 3LOIA 2IW5A 2QSAA 1MS8A 2QQNA 5LA9A 2QDNA 1AB3A 2NZ9A 5LBBA 1V54B 4OYUA 1PO22 1OOPC 1FOD2 3WNNA 2BWCA 1F5JA 4JYAB 1X82A 3ZFGC 4DRXA 4QX7A 2PF4E 3IKWA 4TSFG 4AFAA 3ZYFA 3JSLA 1J5EO 1JZ7A 1QY4A 3CJIA 4Q4V2 5A3UA 4HNAB 2I07B 5E88A 1YZBA 2AUYA 3AZVA 2VY0A 4UT5A 3VD5A 4UCTA 1MR5A 4QU2A 3T1YO 3CJIC 2R063 5A1AA 5KUKA 5J96B 3I49A 1BCXA 4S2GA 4OHYA 4IIJA 1MACA 2RM22 2LTNA 2Y48A 1R3KC 1GANA 1GK9A 3S6PA 1N8RW 5FPXA 2WWJA 2VE1A 5FZOB 1SZXA 3POGA 1MS4A 1WW7A 3K77A 1IBMB 5FY8A 4I4TB 5KA5A 1IS6A 3T4DA 1B35B 3LB9A 4K0KO 4QX8A 3F5TA 1CESA 2JG9A 1W9WA 4PLNA 5FJHA 2R073 2WAMA 4QHOA 3CJHB 5HXVA 1KMIZ 1QKQA 3ASOC 4OMCA 5IJRA 3E6DA 5CU1A 2FDFA 4IHJB 3MFAA 2RS31 4YG6A 1QXPA 3CDZB 2BQPA 4MLOA 4R4XA 3VKNA 1XQNA 4JCKA 2B9UA 5C4WB 3DXTA 4O2BA 4MVMA 2FCTA 5J09A 5C8WA 5FZMA 4YXWG 4MGZE 2Z3YA 5J3UA 4CDWA 1NX9A 3RRDA 2FZ2A 4WF9V 4I0AA 4CDUB 1A3KA 1AR73 1SLTA 5FMOS 2HWF3 1OBNA 3C7HA 3HT2A 4Q4W3 2ORZA 5E8AA 2EINB 3H3LA 4MVUA 1NA1A 1SQPH 3BPZA 2ADDA 5D8AA 5CIRA 4LBEC 5IAXA 1COV3 1QNMA 1NS1A 2BW8A 4WM7C 2JDAA 4Q8LA 4URTA 4EV0A 2UYBA 4WCEV 1J83A 2QQJA 4MW8A 1AR63 5LXTA 1RUI3 3H0OA 4JC1A 3H7YA 4JI7O 3IT8A 5H6QA 3ZSEA 1WD4A 2XUEA 3H1YA 2YXYA 3LSQA 2G38A 1AR4A 3AG3B 2IJJA 3JATA 2A6VA 1EZVH 4GH4B 3HKEA 3HD8B 4K21A 3WF4A 5J7MA 5FQ0B 4YJ3A 3K3WA 1RUG1 4B7EA 1EBOA 2RR11 4FFHA 2HHHB 4BK4A 4OI2A 2CGOA 4UW3A 3WW2A 1EUUA 2P22C 5GLTA 4SBVA 2IFWA 3GXUA 4EN0A 3TB0A 4TQFA 1RM1C 4YFWA 1JJ2U 4AQYB 1K7DA 1POV3 1JODA 1OQ1A 3ZMNA 3QF7A 1R64A 4BM8A 3PUAA 4DR4O 1AI6A 2Y6JA 3ZIWA 1UU6A 5CMUA 5DPNA 5FZ4A 3IDBB 4ZU4A 1Y76A 5DUWA 1MQTB 5GZDA 5FLIA 2PAEA 4H7MA 3BRCA 3MPPG 3RZZA 1DU3D 4KGGA 1N32B 2J1UA 3NJVA 3THDA 1VBC3 2QZ3A 2EIEA 5FYYA 2HWD2 4UCOA 1JYIA 5AC91 2JKBA 1WAZA 4OFGA 2EULA 4AF9A 4CVUA 4L2NA 5L3EA 2QQMA 4CXXA 5BPXA 1XE0A 1S2KA 1OV9A 1AJQA 1A8MA 2ZJCA 1N0NA 4XILA 4RR3C 1MS5A 4XIOA 1MVEA 1SACA 3JQWA 4IL6Z 3MV01 4GWIA 5IVEA 4I02A 5HI0A 2R062 5F6LB 3S30A 5CA1B 3QCWA 2O1QA 5EBWC 1UAIA 4DNYA 1ORQC 4CP1A 2PHTA 4JF3A 2BTQB 2AC1A 3VBRC 1XL4A 5FP8A 2JICA 2YHJA 1YQ5A 4B1MA 2W1UA 3F2ZA 2AREA 2BBAA 2D6LX 4A41A 1CGPA 1US2A 2VVDA 2ARHA 1W0KG 1COV1 1O6UA 1ZM1A 1H1AA 4I0XA 4O61A 1AR83 5A3LA 3ZN5A 4NHXA 1QH6A 3CO2A 5K4LA 5KBFA 3U78A 1SERA 1ENQA 2E5LO 2ET7A 3BTAA 1UXZA 3AG4B 2UUAB 4FSJA 3TAYA 1U5XA 2LS6A 1S0DA 1C28A 5EBMC 2VMIA 4QPGB 3U4SA 3KGLA 4DY3A 5DUVA 4KMQA 3ZRWA 3OT7A 4C8DA 1VBC2 2VTFA 5IY5B 4AW7A 2WQ8A 3M70A 2YEVA 1NH2D 3DXUA 1QR8A 4XJ8A 5JVDB 2WN2A 3GM8A 1MEC3 1GUIA 2WFPA 1GWLA 1YUDA 4LXLA 2W87A 5GKAC 1I9RA 1NZCA 5A6XA 5LEKA 2HYKA 1NZ6A 4D7TA 1RSOB 3CCSV 1QMJA 2WT1A 2I2SA 3LNMB 3WINE 1UN1A 5FO8B 2OTLV 4IEWA 1RC6A 4LF4B 2G9FA 4NVPA 1SBFA 3HQUA 1W3XA 4COYA 1RP3B 4JI1B 1BLZA 1V9U2 2RMKB 1KQRA 1QQP2 3B5LB 4LFCO 4XHXA 2ORXA 4RWUA 3AL5A 2XR4A 2RDNA 1H9PA 3K5OA 3JQXA 4TV9B 1QJX3 4O4HA 4MG2A 4A42A 2DUQA 4X1YB 4HETA 5LHGA 2CAVA 1PP9H 1QDOA 4MVSA 1AXZA 2VNRA 4Q0PA 3EYPA 2EA7A 3ATGA 3R65A 4XIKA 3CMEV 1AR91 1AX1A 4YGEA 2GHYA 3CJIB 2W46A 2ZE8A 3DCQA 1US6A 1K12A 4RR3B 3INAA 5FZDA 4QPGA 5I0UA 3I2HA 4F7ZA 1WJZA 1DQ5A 5LOVB 1GWKA 3I2GA 2ZGQA 3ZHTA 4AILC 5JOWA 3E5XA 3V0AB 5FMOL 4XDKA 5B66Z 3T0DA 2J1VA 1FFXB 3BODA 2VWJA 1ZZ9A 2GALA 2XONA 4FOWA 2RV9A 3ALQA 5SV5A 2ETNA 3RYHA 2XAFA 2H94A 4TWKA 2UUAO 1VBC1 2W0FC 1H2KA 1WZXA 1U5YA 2JG9B 1XC6A 3AKTA 1ZBA2 5H6RA 1LR5A 2BUKA 3PUQA 4RR3A 2DURA 3ZOIA 1XJAA 1STMA 1H8HG 3CEIA 3WVJA 2DCYA 5DDJ2 4CC5A 2YYOA 1WPXA 2PYTA 5JCTA 3O1SA 3LSSA 2QM7A 3O5SA 1SDWA 5L19A 3C7GA 4YGBA 4PDMA 4MGYE 2QWPB 1NH2B 1ALYA 3KB5A 1V6JA 3WB0A 4FBFA 2YIBD 3NJZA 2BVBA 2G1MA 4WZCA 4LULA 2RCVA 4XFHA 2C9AA 3RGBA 4RUFA 5KR7A 4R4ZA 1AXYA 4AVBA 3E8GA 3T2QA 1RTVA 4UB8Z 3HNMA 1Q90D 4PD4F 3RYCB 4M4RA 1GICA 4NPLA 1XOYA 1JCHA 2ZEYA 2CWMA 1QOOA 1LUVA 5FYZA 2RJLA 2B1IA 1W8OA 2DBNA 1AR92 2O8QA 5HCHA 1EM1A 5KAIZ 4E9KA 1DZRA 4FP3A 4OX9O 4BIOA 4GULA 2QKSA 3VB9A 1K4CC 3RDIA 5A3NA 4KNCA 4QU1A 4LIVA 2C26A 4G9SB 4Y20B 4GB33 1HKDA 1TMF2 1BHBA 2D6MA 1W0PA 5FV3A 5KX5B 4AK3A 5EBLC 1P4RA 4QKBA 4ZXKA 2YC0A 1GKFA 5GLVA 2KR2A 3MLJA 4MUVA 1A32A 4EWAA 4GX2A 4LKEA 4Z8BA 2HKOA 1RM1B 5KHIA 1E5IA 4BW5A 1XBFA 5A7SA 3H3ZA 4PDLA 5B2GB 5KWRA 5LHHA 4DV1B 1JU4A 4FI9A 2OS2A 4UVAA 4PELA 3OMIB 1GN4A 2DU0A 3Q8AA 1ASJ2 2NLJC 1NOVA 1F2NA 4JV5B 1U96A 3KS7A 3LDRA 4X62O 4E4DX 2HJDA 2WO1A 1Z2GA 2J1AA 5FPLA 2WSSG 4HOOA 4IYIA 3OPWA 3BB6A 4AVSA 4COUA 5K0UA 1JVMA 4RD7A 5CISA 1XBLA 5LYJA 1EP0A 4Y33A 5L3GA 3VOUA 2YXHA 1N1TA 1RUNA 1RUC3 4DV4B 4UW4A 3IAYA 3AP4A 2WAAA 3TBDA 4YJ2B 2JDMA 5K0UC 3OG2A 3OUHA 2BSKA 4MXWB 2QKDA 1ZX5A 5BNOB 3K79A 3KV5A 2YIBA 3ETGA 2XTAA 1QWRA 1YJWV 3ZXKA 5IDJA 3WDTA 5LA0A 3FHQA 3MDPA 1QJZA 1AROP 2RS13 2VZUA 3ZN6A 3PHMA 3ZIXA 2P3JA 4N7UA 3SCFA 3K58A 1VQLV 4XAAA 2L35A 4ABMA 1HW7A 3CZUA 4DXSA 4EN7B 1TA8A 2PLV2 4TYSA 4GX1A 5FZFA 2OIEA 3ASOB 3RZJA 2J22A 1EN4A 1IBLO 1ZRDA 1X9PA 5FO9B 4K3UA 4GKKB 1ENVA 2YBSA 4PDWA 1SQ4A 1A8DA 3I54A 2KXLA 4YVWB 2Y64A 1MSWD 1C8M1 1PM4A 1TE1B 4PLOA 4XJZA 5DEDA 4AI9A 3SCGA 5DN2A 1R3LC 1SQXH 4JI3B 2NNUA 1J3QA 2CDOA 3WB2A 1W8NA 1R092 1SEFA 4JI3O 5C5TA 4Q4X3 2W6IG 2WZR3 5A3WA 4AHCA 1UKRA 4Z2AA 3HQXA 1HXS2 1DDLA 3PVBB 4FPOB 2VPVA 4MXWA 2D5HA 2CK3G 1DHKB 5A1LA 4L0PA 4D6SA 1HRV1 3MO4A 2IH3C 3WNMA 3OYWA 2ADPA 5BXZA 2VVFA 3JU9A 1RUJ3 3AFKA 1VLNA 5D5PA 3EVKA 1XNTA 3I3QA 3HKBA 1AL22 1R093 3OBAA 3JXSA 2XWJB 4BLIA 1OMIA 3UKMA 4NHMA 1AR71 4OX9B 3QH6A 3RVYA 2Q8OA 1O9HA 2P4EA 1OI6A 1KDMA 2HKXA 4XFBA 4CH4A 3EFFK 3OTOB 4OXSA 1FYJA 3UESA 1UZYA 1IZ3A 2UXXA 4YM2A 1TUBA 2VH9A 3JBG3 4RN5A 1XQ8A 5D8AC 2XJSA 5IE9A 2VMFA 4QXHA 5J48A 2RS51 2VCMA 1COWG 2EJ7A 4GYCB 4XJUA 1NVPD 1GZWB 5DG2A 3I2IA 4QWNA 3PIGA 2PELA 3GYDA 1IS3A 3FL7A 5F5IA 2GC2A 3WDYA 2X0LA 4QM9A 1Q3EA 2XGXA 5F5QA 1PNGA 3IN9A 4F8AA 3KT4A 2VBBA 2QE3A 1GH6A 3ASNC 4XQ4A 2Z69A 4JI2B 2P37A 1ZBE2 2I45A 2XVKA 5IJ9B 1YITV 3UGGA 2R16A 4LMFA 4OHVA 4AHXA 5FWEA 2ZMNA 4X89A 3GWOA 2QQLA 1J58A 5FXVA 3CRAA 5JQGA 1YIFA 2CTWA 3TK1A 3B7MA 1HQWA 2ZGOA 3E6BA 2WLMA 3WQBA 2UUBO 3O0XA 2OA2A 1H4HA 2WRAA 4GWMA 3AKPA 5FKBA 2CV6A 5A7WA 1GBGA 2NM1A 2JDKA 4YNIA 5CB7A 3DECA 1O4ZA 3WP3A 1NY71 2X09A 1K3IA 1YTFD 2E51A 4JTOA 3OB8A 2TEPA 1TME2 2RS12 2JDUA 4R9BA 4BPZA 4FZ1A 3ACLA 1RXGA 5FPRA 2VGDA 1CAUA 1Y76B 3DN7A 1OPMA 3FB5C 2GAUA 3KT1A 3MEPA 1FXKA 2Y6KA 5EC1C 3RYIB 4FZ0A 2QTOA 3OGRA 1GN6A 2OTJV 2RS11 3WNPA 1Q8PA 4QB2A 4XCBA 4AQTA 3U1XA 3MF9A 3HN3A 2JGDB 3S3WA 3CKHA 3N7LA 5FZCA 1VF6A 4AHYA 3TETA 1SLBA 1VQ5V 2HP8A 3LSDA 1PX3A 2CH7B 1S2BA 1R1ZA 3FMGA 3EXAA 2Z5WA 1Q6HA 1XPWA 2MEV1 2A79B 4B3MB 2AEYA 3W7TA 5IWAB 4YHHO 3VBUA 5FZ0A 4EB6B 3FKSG 5J2UA 4MYEA 3DPRB 3GZUC 2QDRA 1REDA 3RW0A 4B08A 3NV2A 2VZQA 1BL8A 2WO3A 2AENA 1CZSA 1DF4A 4JQTA 1OD3A 2RQ6A 1N3PA 3EHBB 4QDQA 3I7DA 2EIMB 1VQMV 5F6KA 1UY4A 4JGYA 4HL0A 2JEUA 2DE0X 1JQ0A 2IC1A 3FB7C 4OQ9A 5C3OA 4NRMA 4BIFA 1ND2B 2DVAA 3TOJA 3KV4A 1AVMA 4HK9A 1SG3A 2A6ZA 5L3CA 2DWRA 4A3XA 3QBQA 2ZX1A 5JUVA 4DV0B 4LO4B 3UK9A 4RQFA 4HZ3A 4OUSA 5EJ1B 1KECA 5T5PA 4FOVA 4RA0A 1HJFA 1HNXO 1JMUB 2UU8A 4K8XA 1JOYA 1SHWB 3C90A 5J9PC 2VW1A 2D5FA 5JOXA 4F3JA 4D6QA 3VDCA 2ZT9B 2W6JG 4W6YA 1RUI1 4GWNA 2OCCC 3VLBB 4GA9A 3GNEA 4ES9A 5DUXA 4X1YA 5FYVA 1CX1A 1MG1A 4B7KA 1VEWA 4D8MA 2DUPA 5C7GA 4TN7A 1VB4A 2BSKB 2CH7A 4OQ8A 1CVNA 4X1IA 2YFZA 2BOJA 4CSWA 1ZUQA 4MHRA 1JOJA 3APQA 3C7EA 3R05A 2ZGPA 4GX5A 4UB6Z 2BRTA 1IBLB 4MGTA 2IXKA 3JATB 1S3JA 3VHNA 2EILC 2WR9A 5IFPA 2FL4A 2VECA 2EBOA 3JCZA 3AK2A 4WM8A 3CS5A 3A23A 4O2BB 2EZPA 3SYCA 4ZHNA 3MGUA 3E35A 4H55A 3FUOA 2QKAA 5IW0A 2PHDA 1DK1A 1CIWA 4IESA 1W8TA 3RYFB 2VQAA 4XJ9A 3T1CA 2VOVA 2KA3A 4DS0A 4IT5A 3KSCA 3H1LH 4I2OA 3WNKA 2D98A 4D6RA 1W6MB 2P06A 1CQ9A 1WMXA 3VL9A 5L9RA 2HWB3 2JIJA 5FK8A 5KMGA 1D7PM 5H9QA 1X50A 2UU9B 1AR61 4DW1A 2C1FA 3WQ1A 4CXWA 1VBA2 4GKJB 3SPIA 2AGSA 1PVC2 2CDYA 1HX6A 2JECA 2WKKA 3CLPA 4EJRA 3QO8A 2FZ1A 2ZNJA 1RUJ1 2YUAA 4GKJO 5IHRA 4Z92B 4XDPA 4DO0A 5C6CA 1GSLA 2F95B 1JZ4A 3I97A 4X8PA 1UZZA 3ZXEA 4NO4A 4IV1A 1WLWA 1Q81W 1GMMA 2RR13 5LMUO 3CB2A 1JFFB 3A0RA 4HVRA 5E6HA 4LC1A 4XHBA 1W6MA 3ZMZA 2VNVA 3NNMA 4N53A 1LOAA 4KWJA 1K5MB 2PFWA 3PJQA 4D3WA 5F37A 3T2MA 2HEWF 3FJSA 5FYMA 4F6EA 2UYAA 5HFLA 1BSMA 4GCZA 2LFRA 4D69A 1ZX3A 1QJFA 1W6PA 4JI0B 1PO23 2VL4A 2BERA 3ZX7A 2ZHNA 1SQVH 1SA0B 3MLLA 1J84A 2DN9A 3W5NA 4NRQA 2VW2A 3D3AA 4J11A 4P02B 4YW3A 2R0HA 5JZGC 1HB4A 3I3BA 4XVHA 4WFHA 3KV9A 1H2MA 3A21A 1KJLA 4B3RB 1PMIA 3VHRA 4Z07A 3BALA 1O3TA 4A5UB 1GV9A 2VQFB 3PURA 3CX5F 1E79G 1ZLZA 4X1IB 1UY1A 3VL8A 4X66B 3ZN1A 2HBUA 3PUSA 3ZFFB 4BIZA 1Q8QA 5GLWA 4YZ2A 4CEYB 5ACA2 3W7UA 5A33B 4R52A 4RGAA 4PV1B 5DECA 1W6QA 2QWOB 4GMP3 5CADA 1FFTB 4DV1O 4YWAA 2XL9A 4EZ4A 1QJY2 2VNGA 2OUHA 4P5YA 4H2AA 4Y20A 1Z5WA 2AXTZ 1R3JC 1TMF1 5ITZB 4LFCB 2VWKA 2EXJA 2WNUA 4GH4C 1XU2A 2VULA 1XILA 1SZBA 2YFUA 1OCCC 1NVPB 4XFAA 4DRRA 3KWVA 4QX5A 4LWSA 5DABA 1I5XA 2Q68A 1H9WA 3GF6A 2RR12 5A80A 2QKCA 4Y22B 2QR4A 4LEJA 3NNGA 4W4ZA 2XVLA 3DC6A 1KP2A 3BY6A 4GD4A 4LFBO 3C7FA 5IVYA 1D4M2 2Q6AA 1ZZ7A 4Q4W1 5KLVH 1W9SA 1AI5A 3O9OA 1X33A 1J3PA 1UOFA 1OVSA 2RNBA 1K42A 4NRPA 4Q0UA 4Q26A 3V64A 4IEVA 4XBQA 1O3QA 3AL6A 4MTXA 4BWOA 2ZXWC 2VZSA 3JSNA 1DGWX 3B01A 4DUVA 4V2WA 2UXDO 4WFAV 2VVEA 3JB4C 2BNOA 2ZEXA 5LGTA 2PZSA 1DQ0A 1WCQA 4DYLA 2E3CA 4TTGA 4RL7A 1G1XB 3FLRA 3U11A 4ZXEA 5IVJA 4QPWA 2HEPA 4QX2A 5FY4A 4RS5A 3ZHRA 4I55B 2EXKA 1O4TA 1VALA 2WAOA 1W2BU 1QCEA 1YQCA 2HWE2 1S5JA 1UO9A 5B5EZ 4U2AA 3EHKA 3IDAA 1F7YA 2TBVA 1I6XA 3WR0A 2A6XA 3JZVA 5FOJB 2ZHKA 4DEQA 3HNYM 2C2AA 1RVF2 3U4XA 2JJ2G 5FQ0A 2EIDA 3I5DA 1H1IA 2JDYA 4KQ7A 2DW4A 2G19A 4AXOA 1JYNA 4B4RA 3VKOA 2WLPA 1YXWA 1B04A 3IFXA 1MEC2 4UVBA 4XF0A 3U75A 1ZAUA 3U0ZA 2LJ2A 3KT7A 3PVEA 3NQHA 1LHNA 1YHQV 4IGGA 1I94B 2PTMA 4E4SA 4JGZB 3A4UA 3K4AA 1KQSU 4Q4Y3 1NI8A 1HB1A 3CCLV 1TQ5A 1AP5A 4WV8A 1GP5A 2R9AA 2BJSA 2YPDA 4UCRA 4G27B 4Y24A 3LDEA 2LP7A 1LOBA 1XNKA 4CPBD 3JARA 5C8YA 4Y1ZA 4DR2B 3CCVV 2WSVA 2Q7GA 5LP6C 1R6NA 2QWQB 1DTOA 3MHSC 2KD7A 1W9TA 3I2DA 3ME2A 4DR6B 3MICA 3OD4A 4JI5B 1Y67A 1HN1A 3H1MA 1LTEA 4ASUG 4FFKA 5FZ6A 5A32A 1UIJA 3CIHA 1AR5A 2EX3A 3OR6C 4CH5A 1WKYA 4MVZA 4AHZA 3G7DA 1ROPA 5GLZA 5IYCO 4HFSA 3UNPA 2J1SA 4FLVA 2R32A 3HKDB 4FFBA 4MTGA 3ZCCA 3HOBA 4Y1YA 3KMHA 4FT8A 2VNOA 5IATA 3IB3A 1EAH1 1R6KA 3BCWA 2DWEC 2RM23 3BFRA 3BGAA 4ARXA 3CCMV 2UXBO 1OCZB 2QQOA 3LPFA 3APBA 1EPZA 4A6OA 1IXBA 5L36A 2BFUS 3HKCA 4JRAA 2ZEZA 3WFVA 1IQDC 4D7YA 1GZTA 1US3A 4HVOA 1RPRA 1LCLA 4A45A 3A0BZ 3SKVA 4J42A 3K5MA 2W9XA 2X5IB 4XE9A 3BVCA 3WB1A 1WA8A 2DCZA 3THCA 2AHYA 2E7QA 1PL0A 5ABJA 1Q43A 2ZGNA 4F83A 4UV8A 5BR8B 3IWZA 3AG4C 4J10A 3AK0A 5LMNO 3C3TA 4LR4A 3AKRA 5IK5A 1W8HA 1UMZA 4EB6A 5GW7A 5CFCC 3CJXA 3GALA 1H8TC 1G6UA 1OA4A 5FZGA 1PZ9A 5FUIA 1BXHA 2YU2A 2W5FA 2XAGA 4PDRA 4J1XA 5HCAA 4IE5A 3T1HB 3E8FA 1I3HA 1GLHA 2HWF1 5JJNB 1UNBA 3OEBA 3PIJA 1Q8OA 4X65O 3VBBA 5B1BC 3K9AA 3P5BA 4N21A 4ISQA 5C8CC 4DB5A 3OTFA 2H3OA 4FPGA 2VOWA 1IHMA 4L97A 3ZSMA 1RPOA 1FT9A 4AYUA 4XDLA 3DC5A 3DKQA 2IXCA 2O57A 4OGQB 1X8EA 4IUGA 3LOBA 4IV3C 1DGWA 5F5CA 4LF8O 4I5SA 2I74A 2JENA 1V9U1 3W58A 1YJNV 4FPCA 4V2VA 5GZEA 1OHHG 4LK6A 3WSOA 4D7SA 5GZFA 1MQTC 3TXQA 5FTTC 2P4KA 4RGKA 1V0AA 3S7EA 1H0BA 2W1WA 4FLYA 3TJTA 2WJSA 1ZRFA 1ULEA 4XJAA 3VZKA 1N1YA 2XJTA 2XUMA 1KS5A 1VBD1 4JHZA 4Y5SA 5TSWA 1Q6IA 3N9PA 4WFGA 3OOXA 3DUIA 1EZJA 1JW6A 5LBFA 2EIKB 1I0HA 1W9FA 4CXYA 3PN1A 1QJY1 3ZLIA 1ZRCA 1BQPA 3CC2V 4AQ6A 4Z1MG 1YF2A 2JB4A 1FNZA 4EKWA 5FP3A 1GM9A 3B00A 4LHLA 1TME3 2ATKC 4CS4A 2ZXQA 3URFA 3MLKA 3UL2A 1UOJA 4XXPA 4HNAA 3MHZA 4YRDA 4A7KA 4JTDB 1LEMA 2ZGKA 4IQPA 3SC7X 3E1F1 2G4IA 5IUQA 4CH6A 3SGIA 1OCCB 4Q4Y1 5A2QN 1IKPA 4F6RB 1A78A 2WFF3 1QJU1 2JJ6A 1VMJA 3NV3A 3I4IA 4Q1PA 2YB7A 4LO6B 3H8RA 5E16A 3T1HO 4QPJA 2K9PA 3ML0A 3CMGA 2WNUB 1F51A 5LP6B 1K73W 4YVSC 1FYUA 5JVDA 4QKFA 1N34B 3GVMA 4DY5A 3A22A 4AFDA 5KMGB 2PHFA 2YEVB 3MZHA 2XHBA 2WNVC 3P1IA 1OCRC 1XB9A 1YFYA 5CYYA 2C24A 1D2DA 3WY6A 4M00A 4N8MA 4W6XA 2HJFC 1R1A2 2EF6A 4XAEA 2HBTA 1F9KA 3PLQA 1ND3A 2XAHA 4I9WA 3MUZ1 1LR1A 2C5DA 1Y66A 3I3EA 2QCSB 2IBZH 2UUCO 5EIYB 3VD9A 5HPOA 3ZHSA 3LIHA 1J1TA 3N35A 5CFDA 1D0GA 1B35A 4Y1VA 1Y43B 2P34A 5HBAA 3MF6A 1JXNA 2D97A 3AC0A 5K8SA 2WZR2 3VBUC 3ZXJA 2Q4SA 3KCCA 1XUQA 3L9JT 5LMNB 2VC9A 1LOEA 1U12A 3M8AA 3PDQA 4FFIA 3ZFFC 4QX0A 1SCRA 4ZS2A 1KXGA 2JG8B 4PIYA 4XETA 2UWBA 4I9QA 3WZ1A 1L7LA 1ZZ6A 3BTYA 2VCCA 3L71H 2CTVA 3WCRA 3MIEA 1RUD2 2WZ8A 2DYCA 5FCCA 1G8WA 5KC5A 2DFCA 1S0FA 5FZOA 5JOZA 3AVSA 2JB8A 4K20A 4FLXA 2FYUH 2DBIA 5JZGB 1REEA 2V4AA 3QVNA 4UBGA 3RI9A 1U97A 2HEYF 5IWAO 1WW5A 2W1QA 1H8TB 2VQEO 4P2ZA 4P9GA 3IGAC 3ZMTA 5EZWA 3BAAA 5FIXA 5FP4A 2XH6A 2GDFA 3E86A 1WB7A 4AFMA 2H6BA 5GLUA 4NOTA 2MNGA 3K04A 3C3VA 4CCJA 5FAXA 2Z0AA 1M56C 4FM2A 2GH2A 1DQ2A 5A1FA 5CA1A 1S0JA 5A70A 2ILMA 4DXTA 3J7HA 1ODNA 1M4UA 1JOBA 1QXRA 2NYYA 2BV4A 2KKWA 4ZZ5A 1FXKB 1RGSA