4NWKA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-605339 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-n-((1r,2s)-1-((cyclopropylsulfonyl)carba moyl)-2-vinylcyclopropyl)-4-((6-methoxy-1-isoquinolinyl)ox y)-l-prolinamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
188
structure length
188
Chain Sequence
GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV NS3 1a Protease
total genus 52
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwkA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwkA01
1HJ9A 3BTDE 1C1NA 1Z1JA 4UONA 2P16A 1Q31A 1ZTKA 3PYHA 3PV5A 1XUJA 1P09A 3TJUA 3K9XB 1F7ZA 2ANYA 3LGWA 3KL6A 1MH0A 2OBQA 5E0GA 1ELDE 1PPCE 1C4U2 3SBKA 4DVAU 1V2NT 1V2UT 3RC5A 1YPKH 1THRH 4KELA 1G9IE 2WINI 1BTZA 1FAXA 1G32B 1YM0A 1XUKA 2BDHA 2ZDKA 3PLKA 1E0FD 3ZZ4A 3S9CA 1LHCH 1A5HA 3LH1A 2PKAA 4X8UH 1GI8B 4SGAE 2JKHA 1GHAF 4Q2KA 2Y5FA 1P3CA 1C2JA 1QNJA 2J94A 2GD4B 1K28D 3NZIA 2P95A 1L1GA 1TFXA 2ZKSA 1GG6C 1WTGH 1O2UA 3R3GB 2GDEH 2FX6A 2GV7A 1C9TA 4Q7YA 5EW1H 2JH6D 1E34B 4ZXXH 3FFGA 2FDAA 4JYTA 2BLVA 1DUEA 1GBFA 4WF8A 3KNXA 1BIOA 1EJAA 2EI8A 1GJ4H 2VB0A 4MQAA 3U98H 1TA6A 4BTUB 2BDGA 3GYLB 2G00A 2J34A 2ZDLA 1N8OB 3ZZ7A 2CHAC 1NU9A 3UUZA 2FP7B 4H4FA 2IN2A 2GX4A 1FQ3A 2J92A 1GBJA 1SGFA 4I8HA 3EAJA 2ZCKP 5C1XA 3M7QA 4CR9A 1AUTC 1MD7A 2BTCE 2RA0A 4GHTA 2XNIA 3MMGA 3CENA 4M9FA 1HAXB 4UE7H 1TONA 4X2YA 5DG6A 2EA3A 2OC7A 3G01A 2FOGA 5HM2A 1MQ6A 2AGIX 4X0WU 3ATLA 5B6OA 2BDCA 3LC5A 1SGPE 2XBVA 3GCNA 1ABJH 4FXGH 1OWDA 1ETRH 2OXSA 3OU0A 3MTYA 1LHFH 1W8BH 1CBWC 1SGCA 3UOUA 1RJXB 4LZ1H 1ZGVA 3SU5A 3Q77A 4BNRA 3SU0A 1CGHA 1T8NA 5FCKA 3QK1A 1GCDA 3S7KB 3TGKE 5JYIA 1WQVH 1ELAA 1XX9A 1UVPA 4CRAA 2W3IA 1NRNH 1B5GH 6CHAB 2PHBA 1GJ7B 4NIWA 1O2LA 3A80A 3EDXB 1NS3A 3E8LA 1Y3VA 4WH6A 1HPGA 1MTWA 3F9FA 2ZU1A 3M35A 2BY8X 1P2MA 4GSOA 2F9OA 4XOJA 3MH6A 1P2NA 2BYAX 2BZAA 3QX5H 1GI7B 3GCHC 3PTNA 2BQWB 2FYQA 4CRDA 4ABDA 2XBYA 1O2ZA 1V2PT 5LPFA 2FI4E 4NWLA 3H09A 2ZPRA 2OC0A 5C2ZA 3UQVA 1F5KU 2A4OA 1O3FA 2VVVA 1TWXB 1FONA 1XUGA 4DY7B 1RTFB 3VGCB 2PGQB 2VIPA 1D9IA 3V13A 1XM1A 5FBIA 1K21H 1FNIA 1TGSZ 3MNXA 3GCOA 1O3OA 2WPHS 3QWCH 3ATIA 1A3EH 1E38B 4FUHA 1QY6A 1V2OT 1EKBB 4AZ2B 1DX5M 2B5TB 2TRMA 4BXWA 1L2EA 1C2FA 1O2IA 5SGAE 4FVDA 4X1SU 2AYWA 1E35B 5EQSA 4K8YA 2BD5A 4CBOA 3UR9A 2J95A 2JETB 1GHWH 3HK6B 1TGTA 3M3TA 1HAGE 4MPUA 4IC6A 1QURH 1SGIB 3S9AA 2Z9GA 2ANMH 4ABGA 3PLPA 2PR3A 1YCPH 2F9NA 2A45B 4B2BA 2GMTC 2P93A 1FAKH 1KLIH 2VVUA 3ZV8A 2UWLA 5TJXA 3OYPA 1O3AA 2A1DB 2ZU4A 2GGVB 2AGGX 4D7FA 1P2JA 3A82A 3RMLH 1C5ZB 1FY5A 3KF2A 4LXBH 2EI7A 1QFKH 3UPEA 2V3OH 4ZKRU 2BDYA 1QRZA 1FIWA 1LVBA 3CP7A 3O8BA 1Y5AT 2XCNA 1O0DH 1S84A 3GY6A 1AWHB 1SBWA 4WMDA 2A31A 3MNBA 4RN6A 1MCVA 1GJ6A 1RIWB 4CRCA 4YOJA 1MU6B 4FUEA 4TPYA 2BOKA 1NRRH 1BZXE 4ESTE 4DIIH 4BAOB 2NWNA 1AD8H 1GHZA 1UTPA 1T8LA 3KGPA 1T31A 2ZI2H 1QQUA 1BOQA 1O3CA 1TNLA 1VCQA 1ANBA 1ESTA 1WBGB 4IGDA 4Y8YA 3GY7A 3FZZA 1AKSB 1TBRH 1O34A 4X1QU 5FX6A 2BD3A 2FODA 2NU2E 6GCHF 3RLYH 1RIWC 1TPPA 1O38A 2EEKA 1IQLA 1RTKA 3OY6U 4I8GA 2QC2A 1MMJN 1TPSA 4JZFH 3SJOA 4GVUA 3NPSA 1C1QA 4B1TA 1KDQA 2OBOA 1KXCA 5EPNA 1KXEA 1TX8A 1H9IE 3FAOA 1CT0E 5GIBA 3RXIA 1PQ8A 2A2QH 3RMOH 5EODA 1H9HE 2OC1A 1BJVA 2FOEA 5F8ZA 3VXEH 3MNCA 3TITA 1P03A 1LKBA 1FXYA 2GVFA 2GZ9A 1FLEE 2I6QA 2YNAA 5FXLA 4YT6H 2P3FH 1MCTA 2V6NA 1IQGA 2HPPH 3F1SB 1KSNA 5FX5A 3B8JA 4D8NA 2ZO3H 4O03A 4NA8A 1EP6A 1GBDA 1EAXA 1ZRBA 2C3SA 3D49H 1YPHE 3AAUA 3TLOA 3MOCA 4IBLH 2CMYA 3LGYA 4MTBA 5CE1A 1A4WH 5LGOA 2FX4A 1F0SA 3SNBA 1AI8H 4NG9H 1GMHF 1QBOA 2F9VA 1A5GH 1Y59T 3MFJA 4KTSA 2R0KA 2RA3A 3P92A 1TA2A 2IPHA 2BY5X 2Z3EA 4GCHG 1OWIA 1DPOA 1FY4A 4ZHLU 1HIAA 5HXFA 4TYDA 1MTNC 4F4OC 1DSTA 2PWXA 1IQIA 1FUJA 4HFPB 3BTKE 3NUMA 2CJIA 3U1IB 5DP4A 3LJOA 4A1TA 4DJZB 3DA9B 3U8TH 3RUOA 4IC5A 3GOVB 3TK9A 1PPEE 3SHAH 4K1SA 2FS8A 2Q6GA 1GI3A 1CHOG 1KXFA 4D76A 1NC6A 1DT2A 2M5TA 2ANKH 4IN2A 1QL9A 1FIZA 1S5SA 2FMJA 5FBEA 1GGDC 2FLBH 1BMMH 4B2CA 5DP9A 5JBTA 3GY3A 1Q3XA 2ZIQH 3MNSA 1ZMJA 4OGXA 4XE4A 1G30B 1VZQH 1QA0A 3NKKA 4GUXA 2BY7X 3RXAA 1QB1A 2UUYA 5EPYA 4INKA 4QT8C 3E16B 1SFQB 1TNHA 5E2OA 3BG8A 1ZTJA 2QXGA 4BANB 1T4UH 3OX7U 3KQEA 3QLPH 1F0RA 2BZ6H 2ZPQA 4ZHMU 2SGQE 4ZAEA 3O8RA 1GJ5H 1S85A 1ZPBA 2AMQA 2Y82A 3SU1A 1CHOF 1O5AB 1MAYA 3ATWA 2ZFFH 3BTHE 2F9PA 1OP2A 3E1XB 2HRVA 1D3PB 1TMUH 4ABHA 3D65E 3ZYDA 1CBWB 1W7XH 5A8YA 3MYWA 2O8WA 2ZPSA 1BTHH 1QJ1B 1CQQA 4DURA 1MTNB 1YCPK 3LDXH 4KP0A 3B23B 5TCCA 1ZHRA 1V2TT 3RC4A 1CSOE 3RXHA 4U30A 1FY1A 4CREA 3P95A 1AMHA 1N1LA 4A92A 3SNDA 1NPMA 3QUMP 1C5MD 7GCHG 4B6EA 4AFZA 2PSYA 1NU7B 3U8RH 1J15A 1PPGE 3O8DA 5J4QA 4MPWA 1DE7H 2PUQH 1KLTA 1P9SA 4K60A 3RXGA 1HXFH 2QF3A 3BTEE 3N7OA 2ZF0H 1SOZA 2BDAA 1VGCC 1SC8U 1MZAA 4FUFA 2ZHWH 4Y10E 3ZVAA 3L33A 5L2YH 5FHTA 5HGGA 3BTQE 1JMOH 3GDUA 3BEUA 4OS4A 5DPAA 2CGAA 6CHAC 1KDQB 2FI5E 2TGDA 2R2MB 4IN1A 3MO6A 2R3YA 4HGCA 3A81A 1UCYH 2XCFA 4OM9A 2BMGB 3ODFA 5LPEA 3GY2A 3GICB 4GHQA 3ZV9A 1F0UA 1ZPZA 3LOXA 3T26A 1VJ9U 9LPRA 1L1JA 1VGCB 1NROH 4XDEA 4OS5A 5EG4A 3L3TA 4H6SB 1G3DA 1GBTA 2Y5HA 3RM0H 1F92A 1EATA 3JZ2B 2ODYB 1ELVA 3AK5A 3UY9A 1RTLA 4I8KA 3KN2A 1FPCH 4GLYA 4CRFA 2GCTB 3RXSA 2Z3DA 5AF9H 5K7RA 3RXKA 4Z0KA 3KQDA 3OTPA 5EXLA 3S0NA 4AYVB 4JYVH 1TNGA 5A0AE 1F5LA 1EZUC 3K6ZA 1ZZZA 4YM9A 1FI8A 3KCGH 1YLCA 2JH5D 4ISNA 3SU4A 1AE8H 1C1UH 1BTWA 1DDJA 2HPQH 1C5RA 1AB9B 1Y3UA 2VIOA 3RXTA 2SNVA 1SQTA 3E90B 2F4LA 1RFNA 1MU8B 1EAUA 5F8XA 1YLDA 1GJCB 3AW1A 3PMHB 2G5NA 5A8ZA 1K1NA 2UUKB 2A4RA 4Y79A 3EQ0H 2FWWA 3SUGA 1ANCA 1O2MA 1GI2A 1QRXA 1B0FA 3HK3B 1GMCG 1OYQA 4FU8A 4H6TA 1P02A 4H42U 2BX3A 1SPJA 1EOJA 2VJ1A 1YKTA 2BM2A 1F0TA 1OWJA 6ESTA 1FN8A 1GBBA 1GJ9B 2ZGXH 3BIVH 1VITF 1AHTH 3PWBA 2QXIA 3DFJA 2DE8A 2WPKS 1A5IA 1CHGA 4MVNA 2HVXA 4JZEH 1AWFH 2LPRA 3RXVA 2Y80A 3A8CA 3ZVEA 1AQ7A 4DGJA 3SQHE 1ZRKA 5LH8A 5FPYA 1ANDA 4OS7A 3RXLA 1G3EA 2WV4A 1ZLRA 1KYNA 2K1QA 4INLA 5JDUB 3SW2B 4D9QA 4K69A 4F49A 1G2LA 2O8LA 3BSQA 2ZHDA 1C2MA 4K1TA 2VWOA 5DP7A 1LVMA 1ANEA 2F91A 1S83A 2C8YB 3EGKH 1LO6A 1XUHA 2NU1E 2B9LA 1MUEB 3RXEA 2RCEA 1Y8TA 1AB9C 4BOHA 1BRUP 1UVSH 1P04A 1LQDB 1T7CA 2WYGA 2CXVA 3M37A 4A1XA 1KTTB 3ZZDA 1G2MA 3UR6A 2H9EH 1MKWK 1BBRK 2WPIS 2PV9B 1P11E 4WMFA 3ZZAA 1NTPA 3RMNH 1O30A 4E7NA 2QGRA 1BTUA 1CA8B 1J8AA 3MWIU 1FY3A 1U6QA 3BEIB 1WU1A 1EZSC 4X2WA 2R0LA 1ZJDA 5FPTA 1HV7A 3TGJE 2FESH 4B75A 3A8AA 3GISB 4YZUA 1IQMA 1D6RA 1S0QA 5GNDA 1V6DA 1A1RA 4UFGH 3A89A 1D4PB 1DWCH 1FV9A 1MD8A 2H1UA 2UUFB 3M5LA 3BN9A 5ESTE 1TALA 1W2KH 3LH3A 2GCHG 2OQUA 3LIWA 3V3MA 4ZUHA 1O3HA 2BD7A 3GCHB 2FOMB 3RXMA 3ELAH 2J38A 3PLBA 4J2YB 1UTMA 2C4FH 3RXFA 5GXPA 4ABBA 2G55A 4BTTB 5T6FA 4A7IB 4X1NU 3H7TA 3HGNA 1QL7A 4I7YH 1HCGA 4LZ4B 2I6SA 2SFAA 1QIXB 3SZNA 4XBDA 1TMBH 1ARBA 3ATMA 2R3UA 2HWLB 2SGPE 1C1WH 1CGJE 2FLRH 3SGAE 3TU7H 2AMPA 1WSSH 3A7ZA 2ZHEH 1K22H 1BBRE 2QCYA 4B74A 4E7RG 2BLQA 2ZU5A 1S6FA 1HFDA 1TMTH 3SU6A 5DJ7A 1AO5A 1GGDB 1WAYB 1NRPH 1BCUH 4XBCA 1V2QT 4KKDA 2GCHF 4X6PA 2ZTYA 3V12A 1C4V2 1K9OE 1MQ5A 2FO9A 4AYYB 1W10U 1SI5H 4U01A 4X6NA 5IDKA 1CGIE 1HIAB 4UDWH 4ISIH 2P94A 1BQYA 1A0JA 3P8NA 4MNWA 1SLWB 2SGEE 2WPMS 1C5QA 1V2MT 2FOBA 3P6ZB 1T32A 3RU4E 1O39A 1G3BA 1NFXA 1O2JA 1UTQA 4NIYA 1W0YH 1Z8JB 3MHWU 1LHEH 4KTUA 1J17T 2Z9LA 1Z8IB 3MH5A 1OWHA 3BF6H 4ABIA 2QY0B 4B2AA 1Y3WA 2BD2A 3D23A 1SQOA 2V3HH 3SV7A 1GI1A 2ZFQH 2PKAB 4JK6A 3OY5U 1TNIA 1UTJA 1SHHB 3FVFB 1YPEH 1TRYA 5A0BA 1EAIA 2ZECA 4NSVA 3F9HA 3HGPA 1G36A 1Q2WA 2Y7ZA 1DICA 2VH0A 3QO6A 2YNBA 2ZDNA 4MDSA 1BITA 1XKBC 4X8VH 2ZC9H 4CBNA 3VGCC 2H5CA 3CS0A 3SNEA 1TGNA 3A83A 5JB9S 3MU4A 1C2HA 1V2WT 1O2TA 1DWDH 1UTKA 3ZVBA 5GWZA 1SGQE 5DK1A 1H8IH 2FXRA 2WUBA 2QAAA 3BV9B 2BXTH 2F3CE 1D3TB 2ZCHP 3C1KA 2A7JA 3FP8E 2ZU3A 1D3QB 4WJG2 3RDZA 3SJ9A 2FOCA 3SJIA 1XVMA 2NU3E 5J4SA 1O2HA 3RXCA 4FUGA 3NWUA 2G8TA 1BT7A 1O2PA 5F8TA 4X1RU 1GVLA 1ELBA 3TJVA 4Y76A 5BRRE 1O2KA 2CF9H 5L30H 3ESTA 3ZZ8A 3F9GA 3SJKA 1ID5H 4INHA 3SV6A 1P2KA 2C8ZB 1XXFA 1O3KA 1O3LA 6LPRA 1C2LA 1EZQA 4WVPE 2FOHA 1ETTH 3O8CA 1GMDG 2V0BA 5JB8S 1BHXB 1AUJA 4GAWA 4Y0YE 4NGAH 2G5VA 2IJD1 3BTWE 2OUAA 3W95A 3VXFH 5CHAC 1HAPH 1W0ZU 2XWAA 1EJMA 1EB2A 2R9PA 1INCA 1EQ9A 1NFYA 3RM2H 1AZ8A 4E05H 1SR5C 3E91A 5ETXA 3A7VA 3PMBB 1V2LT 3EA9A 3U8OH 1PYTD 1JOUB 1SGNE 3A87A 3SU2A 2W3KA 3VB5A 1AVGH 3E6PH 3ZZCA 2P3TB 4Q80A 4MNVA 5K0HA 1UJ1A 3K65B 2FIRH 1SOTA 1BHXF 5DO4H 1QCPA 1C2DA 1TE0A 1EOLA 5HMAA 8KME2 5HYOA 4I31A 1C5OH 1F5RA 3SN8A 5B6LA 4Q7ZA 1GBAA 3RLWH 3RXBA 2Z7FE 1NFWA 1C4Y2 1IOEA 3FANA 4AG1A 3S9BA 1NFUA 5DP6A 5ESBA 1CA0C 1D6WA 4LK4A 1E37B 2AGEX 1DLKB 4O9VA 3SGQE 3UIRA 1AU8A 3SI4H 3URCA 1FPHH 1HJAC 1G3CA 2GCTC 3EE0B 4DCDA 1DVAH 1KXDA 1HAVB 4ISOA 4I8LA 3MU8A 1V2JT 3ZZ5A 1AN1E 1TPAE 1K1PA 2BD9A 3V0XA 1A0LA 1M9UA 2XWBI 4ZMAH 3F6UH 3SV2H 1QTFA 4X2VA 1EUFA 3M7TA 4ZKOU 3PROA 5H4IB 5TCAA 4JCNA 1BRCE 2Y5GA 8GCHF 1BBRH 2XC0A 3RXOA 5JBAS 3Q3YA 1JWTA 1HJAB 2ZHQH 4AX9H 4I33A 2ANWA 3PWCA 5A09A 1P2QA 1QQ4A 3ITIA 1ESAA 2SGDE 2OCVB 3M36A 5EU8A 2AH4X 1HXEH 4AGJA 2SGAA 3HKIB 2Y6TA 2BD4A 4K2YA 2ILNA 4YOGA 3VB6A 1O2GH 3A8DA 5A8XA 3Q3XA 4FUDA 1GI4A 3SUFA 2XBWA 1C9PA 4ZXYH 4B73A 2CN0H 5FAHA 4NZLA 1EX3A 1E36B 1C5VA 1QB6A 3DFLA 2VINA 3MU1A 1UVOA 1RRKA 3ZYEA 1SSXA 3I77A 1YC0A 1OXGA 1HAOH 3SV9A 2XBXA 2FTLE 4IW4E 1KIGH 4YO9A 2EI6A 4MLFB 1GCTB 2A4QA 1S81A 2XYAA 1AFEH 1UCYE 1LMWB 1THPB 3H5CB 1ZJKA 4OS2A 1TAWA 1W7GH 4O97A 1TLDA 4ZKSU 2OK5A 1Z6EA 3PO1B 2FPZA 4DG4A 1O3JA 1OP0A 1JRTA 3ZZ6A 2BLOA 1IQKA 1TABE 2ZGHA 3OTJE 1O35A 2W5EA 2BDBA 1FZZA 4Y0ZE 1PPBH 3UQOA 4ABJA 5EQQA 4FU7A 3BTME 1JRSA 3RP2A 3ZZ9A 4U32A 1K1LA 1SLUB 1GMCF 1O3MA 3STJA 1QGFA 1D3DB 1TNJA 1O2WA 4K1EA 1GL1A 2QIQA 4NA7A 1XXDA 1TIOA 2H2ZA 1TOMH 2D26C 1SG8B 2VIQA 3V7TA 2WV5A 3PTBA 2TGAA 2VH6A 3A7WA 1OWEA 2VNTA 2XRCA 3T27A 4OS1A 4K5ZA 2O8MA 1LVYA 1C2GA 1C1OA 2SGFE 1SB1H 1TB6H 1W11U 3SORA 1Z1IA 4MNXA 1KY9A 3HATH 1A61H 1ACBE 3M7UA 1G37A 1YPMH 1XKAC 1WOFA 1C5XB 2P8OC 3FP6E 4HTCH 4OS6A 3GY5A 5F6MA 1PPFE 1YF4A 4UFFH 2A7CA 1N6XA 3T62A 1C1VH 3Q3KA 5EGMA 1GDNA 1AZZA 3FZDA 1TX6A 1MKXH 3A85A 1C5WB 4TY7A 2ZNKH 1JIRA 2FOAA 2PKSB 2JH0D 2ZGBH 5AFYH 1HAVA 4XBBA 1VCPA 2BD8A 1DUAA 1NZQH 1GHBG 4WH8A 4IS5A 3GY4A 1S82A 1PJPA 1C2EA 1WTHD 1ELFA 1GL0E 1O5GH 5L2ZH 1UTNA 1C1MA 1ELGA 3ZVFA 3S7HB 1C5SA 1HDTH 5AHGH 2VBCA 1GBLA 2D2DA 2ZP0H 1V2RT 1QB9A 4Y11E 3SHCH 3S69A 3TIUA 1OKXA 1NRQH 1AGJA 7GCHF 1SGEE 2QF0A 1QJ7B 5JPMH 2WZQA 1O3NA 3TPIZ 4ABAA 1T8OA 1O2SA 1Z7KA 2YOLA 4FVBA 2TGPZ 4DT7B 4FU9A 3GDSA 1ZR0A 2ZZUH 2BDIA 3UWJH 1HNEE 3T2NA 1VITH 2LNCA 2GDDA 2ZG0H 4ZHAA 1A3BH 1O5DH 1L4DA 5G4BA 1ZSJA 5DGJA 3SYJA 1SFIA 4JZIA 4Y7BA 1Z8GA 1T8MA 1GDUA 3M61U 1O2YA 3EA8A 5LPRA 4TY6A 4UFEH 1O2OA 1EPTC 3STIA 3UFAA 1OYTH 1YGCH 3QTVH 1BTXA 2HLCA 4AFUA 1ZHPA 4RKJB 1ZMNA 2OC8A 3LPRA 2QXHA 2ZDAH 4ASHA 2ZTXA 1BTPA 1FJSA 2ZGCA 4NSYA 4R8TB 4GPGA 3VEQB 1A46H 1W13U 4CRBA 2WYJA 1BRBE 5HM9A 1OP8A 4UFDH 1GVZA 1J14A 8ESTE 2PW8H 1P12E 3LKWA 3PO1C 2Z9KA 5C1YA 1PQ5A 3H7OA 4WXVA 1TRMA 2ZHFH 1L1NA 2C93B 1HBTH 1P57B 2KAIB 1EXFA 3KIDU 3SU3A 1TQ7B 4JMYA 2VWNA 4M7GA 2HNTC 4YESB 1QR3E 1GI5A 1TGCA 1SL3A 1NESE 2ZFRH 3MH7A 2ASUB 2NU4E 2AEIH 3AW0A 3MU0A 3BTGE 2IOTA 3VB4A 5EXMA 3DUXH 1EPTA 2VVCA 1C5NH 1BUIA 1JXPA 2OQ5A 4HI3A 2AMDA 1TOCB 1GI9B 1GDQA 1UCYK 3TH2H 1FY8E 1GHAG 3QGNB 5BPEA 4X6MA 1FDPA 2GZ7A 5GJ4B 1Z71A 3ZZ3A 1GVKB 1PPHE 4XSKU 1O2RA 1C2IA 2VGCB 5JBBS 3SI3H 2TBSA 2PGBB 2G81E 1O2XA 2C8XB 1WUNH 2Z94A 1GBIA 4NFFA 1O37A 1C5LH 2B7DH 5FCRA 3RMMH 1JIMA 2DE9A 3I78A 2FEQH 2AERH 1IQJA 2J4IA 4BAMB 1O2NA 4YOIA 3TH4H 2ULLA 3GCTG 3LONA 1AKSA 1B7XB 4THNH 4UEHH 2O8UA 1DY9A 1YBWA 3I29A 2W26A 1DS2E 1OWKA 5EQRA 4DOQA 2UWOA 1H8DH 2KAIA 1UVTH 3MI4A 3SOSA 2G51A 3L6PA 3GCTF 1YPLH 3EYDA 3RU4D 1GBMA 2QN5T 1KXBA 1IHTH 1C5PA 4AN7A 1V2VT 3SUEA 3SUDA 1CO7E 2VWMA 2B0FA 2F83A 2OP9A 3SNCA 2ODPA 4B6FA 1EP5A 2ZQ2A 3AAVA 1ZTLA 3RXRA 8LPRA 4ISHH 3TVJB 4Y8ZA 3Q76A 8GCHG 1IQEA 2J9NA 1TNKA 5PTPA 1Y3XA 2ZA5A 1GHXH 1DSUA 1RXPA 2P3UB 1BTYA 4KGAA 1W14U 3VPKA 3R0FA 5GCHF 1VITG 2A32A 1ELTA 4JZ1A 4O3TA 1IHSH 4O3UA 1BMLA 4PROA 5EW2H 1BB0B 1DXPA 3A84A 2BY6X 2GV6A 4ZH8A 1YPHC 2WV9A 1MAXA 3CS7A 1SQAA 5GPIB 1PQ7A 3T5FH 2FYRA 1ZGIA 3LU9B 3LGVA 4LOYH 1RS0A 2ZGJA 3MH4A 1HLTH 2QYIA 5CHAB 3NXPA 3ATKA 3PM3A 4VGCB 1KTSB 4AFQA 2H9TH 2GZ8A 1EJNA 5AVDA 1UTOA 2WUCA 2HGTH 4Z6AH 1WQSA 4ABEA 1TBQH 2DUCA 3RXJA 1K2I1 2Q6FA 4MPVA 1FN6A 1AVWA 1AFQC 2BB4A 1KLJH 1HJ8A 4FUBA 1BRAA 2OLGA 5EXNA 4TPIZ 1QA7A 1YYY1 4B71A 2STBE 2PFEA 2QV1A 4B76A 1O3GA 1OSSA 2P8OB 1DWBH 3QZRA 1EZXC 2J2UA 5JBCS 3ZZBA 3E0PB 3GY8A 2OD3B 1DM4B 2WPLS 2CV3A 1QBNA 1TBZH 2AIQA 2Y7XA 1P2OA 2V35A 2BVXH 4BAHB 2Z9IA 1VCWA 1ELCA 3BTTE 1IQFA 1NN6A 2Y81A 1X7AC 3SO3A 3A7XA 4YLUA 2D8WA 1GBCA 1P0SH 1WCZA 3K2UA 5C5OA 1LCYA 1P01A 1ZPCA 4NCYA 1IQHA 3LT3A 1GJAB 4X8TH 1GBEA 1OX1A 2GKVE 4NFEA 3UNQA 3VFEA 1MZDA 3M5NA 1Y5UT 2TGTA 1N6YA 1DOJA 1FMGA 1J16A 1WV7H 2ZQ1A 4IMZA 3P8GA 4MG3A 1RD3B 3DD2H 1DFPA 4WY3A 3A7YA 2BOHB 1LKAA 5F03A 4SGBE 3BG4C 1GHVH 1MBQA 3RXDA 1O31A 3HKJB 3K6YA 1UK4A 1OPHB 1P9UA 4NZQA 1MTVA 1TX7A 1MTUA 3U9AH 1IQNA 2R2WU 2FZZA 1YPJH 2ZDVH 1L0ZA 1MTSA 1SGDE 1HAHH 2Q1JA 2TIOA 1LHGH 4TWYA 1V2ST 2VIDA 4CRGA 3UNSA 1LPGB 2PKSC 2FS9A 2W7SA 1BA8B 3LGUA 4A6LA 4K8BA 4MNYA 4AB9A 2F9UA 1Z6JH 3UREA 1EB1H 1UVUH 1TPOA 3SV8A 1TQ0B 2Z9JA 4J1YA 5T6GA 1DANH 4Y6DA 1NT1A 1S6HA 1VJAU 5I46H 3BTFE 1MKWH 1A0HB 1GPZA 3W94A 1P05A 1DLEA 3U69H 4BXSA 2ZFSA 2ZEBA 4GCHF 1O3IA 1DWEH 3NK8A 3TJOA 3LJJA 4U2WA 1O5FH 2GP9B 5E0HA 2BX4A 1XUIA 4Y7AA 1P10A 2BQ7B 3SJ8A 1A2CH 1WYKA 5T3HA 1O5CB 2A7HA 3TH3H 5T1VA 1O36A 1GJBB 1TGBA 2PTNA 3E3TA 5E0JA 2JETC 4Y8XA 3QZQA 1SGTA 2UWPA 2Z3CA 1CVWH 3M3SA 1BMNH 2ZFPH 2HNTE 3HPTB 1GG6B 1THSH 1W3CA 1WXRA 1LQEA 1MBMA 1YP9A 1EAWA 3BEFB 2F9BH 1C1RA 2VWLA 1O3BA 2C90B 1P8VC 3BIUH 3LGIA 4E06H 1PFXC 1LHDH 4XFQA 2RG3A 5E8EH 3C27B 3TGIE 2BXUH 3IWMA 1NY22 3A86A 5FPSA 1UHBA 3T25A 2THFB 3TNTA 1XUFA 3ZVDA 1QJ6B 1JBUH 1NM6A 1GWAA 3E0NB 2ZDMA 4K3JA 1UMAH 2VIVA 3QDZB 1CU1A 3SQEE 3U1JB 3PV2A 1C1PA 4TWWA 1GBHA 4CHAC 1LVOA 1YCPM 1Y3YA 2ZU2A 3QTOH 3T28A 3IITA 2NU0E 1P2IA 1CT4E 2FTMA 3P70B 7KMEH 3SGBE 4D7GA 3NCLA 9ESTA 4R0IA 2G52A 2PTCE 3TNSA 1GHBF 2O9QA 3TK6A 1LDTT 1PPZA 5L6NH 1SHYA 5E2PA 1QL8A 2BVSH 5C67A 1O5BB 2XC5A 2VIWA 1AE5A 1LPKB 1V3XA 2Z6BD 1AIXH 3MO3A 4JYUH 3SNAA 5C3NA 5CMXH 3DT0H 1S0RA 4CHAB 1NO9H 2B8OH 2XTTB 5DKMA 4YTAA 1ETSH 1LTOA 1YPGH 2ALPA 3QGJA 3ENSB 3ZVGA 4A5TS 2STAE 1GBKA 6GCHG 2IJOB 3P17H 2ZTZA 5A2MH 2XXLA 4CR5A 4WWYA 3A8BA 1O3EA 5C5NA 3ODDA 2ZFTA 1SGFG 4UD9H 2W7UA 1ORFA 3M3VA 3IG6B 4OGYA 1HAZB 5DP8A 5T6DA 1RGQA 4RKOB 2A5AA 1HUTH 3JZ1B 2WHXA 4BAKB 2PLXA 3MU5A 3RU4T 1CT2E 1OOKB 2H5DA 4AORA 1C2KA 3TK5A 5DP5A 3PMAB 4AB8A 1K1JA 2Q6DA 4MPXA 1ARCA 5I25A 1EASA 2PSXA 3T29A 3RC6A 2H6MA 1UO6A 1OS8A 3LC3A 1F2SE 5C20A 4ABFA 3SZEA 5IYTA 1Z8RA 1GCTC 2A2XH 1O3DA 3B9FH 3TJNA 1J9CH 1GJ8B 2FI3E 1W12U 4CH8B 1C5YB 3OSYA 1O2QA 2BLWA 2GT8A 1AY6H 4X2XA 1ZOMA 1HRTH 1BDAA 3UNRA 1ELEE 2FM2A 1BMAA 3F9EA 3PB1E 1L4ZA 1HAYB 4WMEA 5A0CA 2QXJA 3BG4B 4DW2U 1N8OC 1CE5A 5GDSH 4NIVA 1B0EA 2OTVA 1TYNA 2BVRH 4AOQA 1GJDB 3ZVCA 3UWIA 2HNTF 4BAQB 4YT7H 1V2KT 3PV4A 4AG2A 1GHYH 4VGCC 2CHAB 3RXPA 2HALA 3AASA 1ESBA 2BHGA 2GT7A 2ESTE 1P06A 1SVPA 2OINA 3MO9A 3P8FA 3GYMA 2A5KA 3KHVA 4Y71A 4AGKA 1H4WA 1C5TA 1PQAA 1T4VH 2GMTB 3QN7A 3EA7A 4FUIA 1NRSH 1AFQB 5C1UA 2TPIZ 4RI0A 3F68H 3M5MA 1O5EH 1O3PB 3A7TA 4ZROA 4DIHH 2G4UA 2D1JA 1MKXK 1HB0B 1SGRE 2AS9A 3PMJA 2QA9E 3DHKH 3KEEA 4NA9H 2PUXB 2ODQA 1IAUA 2VGCC 7ESTE 1CA0B 4JZDH 1A7SA 5EOKA 3RXUA 1SLVB 1SMFE 1HGTH 2GTBA 4FUJA 4D9RA 5GCHG 3LGTA 1GI6A 2A5IA 4AFSA 5AFZH 3P8OA 2G4TA 4NWKA 3FP7E 3VB7A 1QBVH 3VB3A 4CH2B 2RDLA 2XW9A 2ZWLH 1UK2A 3KQCA 2BY9X 3M5OA 1O33A 4BTIB 3Q00A 2AIPA 3KQBA 1DITH 2O8TA 4I32A 1SGYE 3UOPA 1P3EA 1H9LB 4JK5A 1K1OA 2H9HA 3D62A 3URDA 1GMDF 2WPJS 1ZSKA 1HYLA 5ABWA 2A4GA 4WXIA 1H1BA 4X8SH 3A88A 4ISLA 2ZCLP 1QRWA 4ZKNU 1DXWA 2C8WB 4X6OA 1K1IA 1XMNB 4KTCA 2BQ6B 4HZHA 1ZYOA 3UTUH 3AVZA 2CF8H 1GMHG 1TRNA 1XVOA 1ABIH 4X1PU 2EC9H 1O2VA 4IMQA 2FOFA 1PYTC 4FUCA 1ZHMA 4RSPA 1K1MA 1UHBB 1ZMLA 1C1SA 1SLXB 1C5UA 1HAIH 5DP3A 1DY8A 7LPRA 1ZSLA 1GI0A 1UK3A 1UTLM 2AFQB 4NIXA 3RXQA 1KXAA 2A0QB 2HOBA 3WY8A 2XC4A 4Q7XA 2ALVA 1Y5BT 2SNWA 1O32A 4I8JA 1EPTB 4A1VA 2P59A 3GDVA 4YLQH 2VU8E 1QHRB 1C1TA 1AVXA 2UUJB 1LPZB 1VR1H 1BJUA
chains in the Genus database with same CATH superfamily
1HJ9A 3BTDE 1C1NA 1Z1JA 4UONA 2P16A 1Q31A 1ZTKA 3PV5A 3PYHA 1XUJA 1P09A 3TJUA 3K9XB 1F7ZA 2ANYA 3LGWA 2WSSD 5C17A 3KL6A 1MH0A 2OBQA 5E0GA 1ELDE 1PPCE 1C4U2 3SBKA 4DVAU 1V2NT 1V2UT 3RC5A 1W0KD 1YPKH 1THRH 4KELA 1G9IE 2WINI 1BTZA 1FAXA 1G32B 1YM0A 1XUKA 2BDHA 2ZDKA 3PLKA 1E0FD 3ZZ4A 3S9CA 5HIZA 1LHCH 1A5HA 3LH1A 2PKAA 4X8UH 1GI8B 4SGAE 2JKHA 1GHAF 4Q2KA 2Y5FA 1P3CA 1C2JA 1QNJA 2J94A 2GD4B 1K28D 3NZIA 2P95A 1L1GA 1TFXA 2ZKSA 1GG6C 1WTGH 1O2UA 3R3GB 2GDEH 2FX6A 2GV7A 1C9TA 4Q7YA 5EW1H 2JH6D 3DSPA 1E34B 4ZXXH 3FFGA 2FDAA 4JYTA 2BLVA 1DUEA 1GBFA 4WF8A 3KNXA 1BIOA 1EJAA 2EI8A 1GJ4H 2VB0A 4MQAA 3U98H 2HLDD 1TA6A 4BTUB 2BDGA 3GYLB 2G00A 1E1QD 2J34A 2ZDLA 1N8OB 3ZZ7A 2CHAC 1NU9A 3UUZA 2FP7B 4H4FA 2IN2A 2GX4A 1FQ3A 2J92A 1GBJA 3KYFA 1SGFA 4I8HA 4ACAA 3EAJA 2ZCKP 5C1XA 3M7QA 4CR9A 1AUTC 1MD7A 2BTCE 2RA0A 4GHTA 2XNIA 3MMGA 3CENA 4M9FA 1HAXB 4UE7H 1TONA 4X2YA 4YXWD 5DG6A 2EA3A 2OC7A 3G01A 2FOGA 5HM2A 4ASUD 1MQ6A 2AGIX 4X0WU 3ATLA 5B6OA 2BDCA 3LC5A 1SGPE 2XBVA 3GCNA 1ABJH 4FXGH 1OWDA 1ETRH 2OXSA 3OU0A 3MTYA 1LHFH 1W8BH 1CBWC 1SGCA 3UOUA 1RJXB 4LZ1H 1ZGVA 3SU5A 3Q77A 4BNRA 3SU0A 1CGHA 1T8NA 5FCKA 3QK1A 1GCDA 1QZ8A 3S7KB 3TGKE 5JYIA 1WQVH 1ELAA 1XX9A 3EE7A 1UVPA 4CRAA 2W3IA 1NRNH 1B5GH 6CHAB 2PHBA 1GJ7B 4NIWA 1O2LA 3A80A 3EDXB 1NS3A 3E8LA 1Y3VA 4WH6A 1HPGA 1MTWA 3F9FA 2ZU1A 3M35A 2BY8X 1P2MA 4GSOA 2F9OA 4XOJA 3MH6A 1P2NA 2BYAX 2BZAA 3QX5H 2HVYB 1GI7B 3GCHC 3PTNA 2BQWB 2FYQA 4CRDA 4ABDA 2XBYA 1O2ZA 1UW7A 1V2PT 2FI4E 3H09A 4NWLA 5LPFA 2ZPRA 2OC0A 5C2ZA 3UQVA 1F5KU 2A4OA 1O3FA 2VVVA 2W6JD 1TWXB 2M2AA 1FONA 1XUGA 4DY7B 1RTFB 3VGCB 2PGQB 2VIPA 1D9IA 3V13A 1XM1A 5FBIA 1K21H 3OAAD 1FNIA 1TGSZ 3MNXA 3GCOA 1O3OA 2WPHS 3QWCH 3ATIA 1A3EH 1E38B 4FUHA 1QY6A 1V2OT 1EKBB 4AZ2B 1DX5M 2B5TB 2TRMA 4BXWA 1L2EA 1C2FA 1O2IA 5SGAE 4FVDA 4X1SU 2AYWA 1E35B 5EQSA 4K8YA 3CNRA 2BD5A 4CBOA 3UR9A 2J95A 2JETB 1GHWH 3HK6B 1TGTA 3M3TA 1HAGE 4MPUA 4IC6A 1QURH 1SGIB 3S9AA 2Z9GA 2ANMH 4ABGA 3PLPA 2PR3A 1YCPH 2F9NA 2A45B 4B2BA 2GMTC 2P93A 1FAKH 1KLIH 2VVUA 3ZV8A 2UWLA 3UAIC 5TJXA 3OYPA 1O3AA 2A1DB 2ZU4A 2GGVB 2AGGX 4D7FA 1P2JA 3A82A 3RMLH 1C5ZB 1FY5A 3KF2A 4LXBH 2EI7A 1QFKH 3UPEA 2V3OH 4ZKRU 2BDYA 1QRZA 2XNDD 1FIWA 1LVBA 3CP7A 3O8BA 1Y5AT 2XCNA 1O0DH 1S84A 3GY6A 1AWHB 1SBWA 4WMDA 2A31A 3MNBA 4RN6A 1MCVA 1GJ6A 1RIWB 2RFKC 4CRCA 4YOJA 1MU6B 4FUEA 4TPYA 2BOKA 1NRRH 1BZXE 4ESTE 4DIIH 4BAOB 2NWNA 1AD8H 1GHZA 1UTPA 1T8LA 4TT3D 3KGPA 1T31A 2ZI2H 3N7EA 1QQUA 1BOQA 1O3CA 1TNLA 1VCQA 1ANBA 5KGOA 1ESTA 1WBGB 3F3BA 4IGDA 4Y8YA 3GY7A 3FZZA 1AKSB 1TBRH 1O34A 4X1QU 5FX6A 2BD3A 2FODA 2NU2E 6GCHF 3RLYH 1RIWC 1TPPA 1O38A 2EEKA 1IQLA 1RTKA 3OY6U 4I8GA 2QC2A 1MMJN 1TPSA 4JZFH 3SJOA 4GVUA 3NPSA 1C1QA 4B1TA 1KDQA 2OBOA 1KXCA 5EPNA 1KXEA 1TX8A 1H9IE 3FAOA 1CT0E 5GIBA 3RXIA 1PQ8A 2A2QH 3RMOH 5EODA 1H9HE 2OC1A 1BJVA 2FOEA 5F8ZA 3VXEH 3MNCA 3TITA 1P03A 1LKBA 1FXYA 2GVFA 2GZ9A 1FLEE 2I6QA 2YNAA 5FXLA 4YT6H 2P3FH 1MCTA 2V6NA 1IQGA 2HPPH 3F1SB 1KSNA 5FX5A 3B8JA 4D8NA 2ZO3H 4O03A 4NA8A 1EP6A 1GBDA 1EAXA 1ZRBA 2C3SA 3D49H 1YPHE 3AAUA 3TLOA 3MOCA 4IBLH 2CMYA 3LGYA 4MTBA 5CE1A 1A4WH 5LGOA 2FX4A 1F0SA 3SNBA 1AI8H 2YMSD 4NG9H 1GMHF 1QBOA 2F9VA 1A5GH 1Y59T 3MFJA 4KTSA 2R0KA 2RA3A 3P92A 1TA2A 2IPHA 2BY5X 2Z3EA 4GCHG 1OWIA 1DPOA 1FY4A 4ZHLU 1HIAA 5HXFA 4TYDA 1MTNC 4F4OC 1DSTA 2PWXA 1IQIA 1FUJA 4HFPB 3BTKE 2K8IA 3NUMA 4I86A 2CJIA 3U1IB 5DP4A 3LJOA 4A1TA 4DJZB 3DA9B 3U8TH 3RUOA 4IC5A 3GOVB 3TK9A 1PPEE 3SHAH 4K1SA 2FS8A 2Q6GA 3FN8A 1GI3A 1CHOG 1KXFA 4D76A 1NC6A 1DT2A 2M5TA 2ANKH 4IN2A 1QL9A 1FIZA 1S5SA 2FMJA 5FBEA 1GGDC 2KCAA 2FLBH 1BMMH 2V7QD 4B2CA 5DP9A 5JBTA 3GY3A 1Q3XA 2ZIQH 3MNSA 1ZMJA 4OGXA 4XE4A 1G30B 1VZQH 1QA0A 3NKKA 4GUXA 2BY7X 3RXAA 1QB1A 4AC9A 5IK2D 2UUYA 5EPYA 4INKA 4QT8C 3E16B 4FETA 1SFQB 1TNHA 5E2OA 3BG8A 1ZTJA 2QXGA 4BANB 1T4UH 3OX7U 3KQEA 3QLPH 1F0RA 2BZ6H 2ZPQA 4ZHMU 2SGQE 4ZAEA 1K0HA 3O8RA 1GJ5H 1S85A 2W6ID 1ZPBA 2AMQA 2Y82A 3SU1A 1CHOF 1O5AB 1MAYA 3F2HA 3ATWA 2ZFFH 3BTHE 2F9PA 1OP2A 3E1XB 2HRVA 1D3PB 1TMUH 4ABHA 3D65E 3ZYDA 1CBWB 1W7XH 5A8YA 3MYWA 2O8WA 2ZPSA 1BTHH 1QJ1B 1CQQA 4DURA 3F2GA 1MTNB 1YCPK 3LDXH 4KP0A 3B23B 5TCCA 1ZHRA 1V2TT 3RC4A 1CSOE 3RXHA 4U30A 1FY1A 4CREA 3P95A 1AMHA 1N1LA 4A92A 3SNDA 1NPMA 3QUMP 1C5MD 4B6EA 7GCHG 4AFZA 2PSYA 1NU7B 3U8RH 1J15A 1PPGE 3O8DA 5J4QA 4MPWA 1DE7H 2PUQH 1KLTA 1P9SA 4K60A 3RXGA 1HXFH 2QF3A 3BTEE 3N7OA 2ZF0H 1SOZA 2BDAA 1VGCC 1SC8U 1MZAA 4FUFA 2ZHWH 2JDID 4Y10E 3ZVAA 3L33A 5L2YH 5FHTA 5HGGA 3BTQE 1JMOH 4Z1MD 3GDUA 3BEUA 4OS4A 5DPAA 2CGAA 3FOAA 6CHAC 1KDQB 2FI5E 2TGDA 2R2MB 4IN1A 3MO6A 2R3YA 4HGCA 3A81A 1UCYH 2XCFA 4OM9A 2BMGB 3ODFA 5LPEA 3GY2A 3GICB 4GHQA 2WPDD 3ZV9A 1F0UA 1ZPZA 3LOXA 3T26A 1VJ9U 9LPRA 1L1JA 1VGCB 1NROH 4XDEA 4OS5A 5EG4A 3L3TA 4H6SB 1G3DA 1GBTA 2Y5HA 3RM0H 1F92A 1EATA 3JZ2B 2ODYB 1ELVA 3AK5A 3UY9A 1RTLA 4I8KA 3KN2A 1FPCH 4GLYA 4CRFA 2GCTB 3RXSA 2Z3DA 5AF9H 5K7RA 3RXKA 4Z0KA 3KQDA 3OTPA 5EXLA 3S0NA 4AYVB 4JYVH 1TNGA 5A0AE 1F5LA 1EZUC 3K6ZA 4ZCNA 1ZZZA 4YM9A 1FI8A 3KCGH 1YLCA 3DSOA 2JH5D 4ISNA 3SU4A 1AE8H 1C1UH 1BTWA 1DDJA 2HPQH 1C5RA 1AB9B 1Y3UA 2VIOA 3RXTA 2SNVA 1SQTA 2KX4A 3E90B 2F4LA 1RFNA 1MU8B 1EAUA 5F8XA 1YLDA 2EY4C 1GJCB 3AW1A 3PMHB 2G5NA 5A8ZA 1K1NA 2UUKB 2A4RA 4Y79A 1OHHD 3EQ0H 2FWWA 3SUGA 1ANCA 1O2MA 1GI2A 1QRXA 1B0FA 3HK3B 1GMCG 1OYQA 4FU8A 4H6TA 1P02A 4H42U 2BX3A 1SPJA 1EOJA 2VJ1A 1YKTA 2BM2A 1F0TA 1OWJA 6ESTA 1FN8A 1GBBA 1GJ9B 2ZGXH 3BIVH 1VITF 1AHTH 3PWBA 2QXIA 3DFJA 2DE8A 5HKKD 2WPKS 1A5IA 1CHGA 4MVNA 2HVXA 4JZEH 1AWFH 2LPRA 3RXVA 2Y80A 3A8CA 3ZVEA 1AQ7A 4DGJA 3SQHE 1ZRKA 5LH8A 5FPYA 1ANDA 4OS7A 3RXLA 1G3EA 2WV4A 1ZLRA 1KYNA 2K1QA 4INLA 5JDUB 3SW2B 4D9QA 4K69A 4F49A 1G2LA 3GS9A 2O8LA 3BSQA 2ZHDA 1C2MA 4K1TA 2VWOA 5DP7A 1LVMA 3DCLA 1ANEA 2F91A 1S83A 2C8YB 3EGKH 1LO6A 1XUHA 2NU1E 2B9LA 1MUEB 3RXEA 2RCEA 3PRDA 1Y8TA 1AB9C 4BOHA 1BRUP 1UVSH 1P04A 1LQDB 1T7CA 2WYGA 2CXVA 3M37A 4A1XA 1KTTB 3ZZDA 1FX0B 1G2MA 3UR6A 2H9EH 1MKWK 1BBRK 2WPIS 2PV9B 1P11E 4WMFA 3ZZAA 1NTPA 3RMNH 1O30A 4E7NA 2QGRA 1BTUA 1CA8B 1J8AA 3MWIU 1FY3A 1U6QA 3BEIB 1WU1A 1EZSC 4X2WA 2R0LA 1ZJDA 5FPTA 1HV7A 3TGJE 2FESH 4B75A 3A8AA 3GISB 4YZUA 1IQMA 1D6RA 1S0QA 5GNDA 1V6DA 1A1RA 4UFGH 3A89A 1D4PB 1DWCH 1FV9A 1MD8A 2H1UA 2UUFB 3M5LA 3BN9A 5ESTE 1TALA 1W2KH 3LH3A 2GCHG 2OQUA 3LIWA 3V3MA 4ZUHA 1O3HA 2BD7A 3GCHB 2FOMB 3RXMA 3ELAH 2J38A 3PLBA 4J2YB 1UTMA 3N99A 2C4FH 3RXFA 5GXPA 4ABBA 2G55A 4BTTB 5T6FA 4A7IB 4X1NU 4FOUC 3H7TA 3HGNA 1QL7A 4I7YH 1HCGA 4LZ4B 2I6SA 2SFAA 1QIXB 3SZNA 4XBDA 1TMBH 1ARBA 3ATMA 4Q63A 2R3UA 2HWLB 5F53A 2SGPE 1C1WH 1CGJE 2FLRH 3SGAE 3TU7H 2AMPA 1WSSH 3A7ZA 2QE7D 2ZHEH 1K22H 1BBRE 2QCYA 4B74A 4E7RG 2AHME 2BLQA 2ZU5A 1S6FA 1HFDA 1TMTH 3SU6A 5DJ7A 1AO5A 1GGDB 1WAYB 1NRPH 1BCUH 4XBCA 3WWBA 1V2QT 4KKDA 2GCHF 4X6PA 2ZTYA 3V12A 1C4V2 1K9OE 2J98B 1MQ5A 2FO9A 4AYYB 1W10U 1SI5H 4U01A 4X6NA 5IDKA 1CGIE 1HIAB 4UDWH 4ISIH 2P94A 1BQYA 1A0JA 3P8NA 4MNWA 1SLWB 2SGEE 2WPMS 1C5QA 1V2MT 2FOBA 3P6ZB 1T32A 3RU4E 1O39A 1G3BA 1NFXA 1O2JA 1UTQA 4NIYA 1W0YH 1Z8JB 3MHWU 1LHEH 4KTUA 1J17T 2EQNA 2Z9LA 1Z8IB 3MH5A 1OWHA 3BF6H 4ABIA 2QY0B 4B2AA 1Y3WA 2BD2A 3D23A 1SQOA 2V3HH 3SV7A 1GI1A 2ZFQH 2PKAB 4JK6A 3OY5U 1TNIA 1UTJA 1SHHB 3FVFB 1YPEH 1TRYA 5A0BA 1EAIA 2ZECA 4NSVA 3F9HA 3HGPA 1G36A 1Q2WA 2Y7ZA 1DICA 2VH0A 3QO6A 2YNBA 2ZDNA 4MDSA 1BITA 1XKBC 4X8VH 2ZC9H 4CBNA 3VGCC 2H5CA 3CS0A 3SNEA 1TGNA 3A83A 5JB9S 3MU4A 1C2HA 1V2WT 1O2TA 1DWDH 1UTKA 2YMSB 3ZVBA 5GWZA 1SGQE 5DK1A 1H8IH 2FXRA 2WUBA 5FL7D 2QAAA 3BV9B 2BXTH 2F3CE 1D3TB 2ZCHP 3C1KA 2A7JA 3FP8E 2ZU3A 1D3QB 4WJG2 1YLNA 3RDZA 3SJ9A 2FOCA 3SJIA 1XVMA 2NU3E 5J4SA 1O2HA 3RXCA 4FUGA 3NWUA 2G8TA 1BT7A 1O2PA 3KYGA 5F8TA 4X1RU 1GVLA 1ELBA 3TJVA 4Y76A 5BRRE 1O2KA 1SQRA 2CF9H 5L30H 3ESTA 3ZZ8A 5C94A 3F9GA 3SJKA 1ID5H 3VG8A 4INHA 3SV6A 1P2KA 2C8ZB 1XXFA 1O3KA 1W0JD 1O3LA 6LPRA 1C2LA 1EZQA 4WVPE 2FOHA 1ETTH 3O8CA 1GMDG 2V0BA 5EJ1A 5JB8S 1BHXB 1AUJA 4GAWA 4Y0YE 4NGAH 2G5VA 2IJD1 3BTWE 2LP6A 2OUAA 3W95A 3VXFH 5CHAC 1HAPH 1W0ZU 2XWAA 1EJMA 1EB2A 2R9PA 1INCA 1EQ9A 1NFYA 3RM2H 1AZ8A 1YY3A 4E05H 1SR5C 3E91A 5ETXA 3A7VA 3PMBB 1V2LT 3EA9A 3U8OH 1PYTD 1JOUB 1SGNE 3A87A 5DN6D 3SU2A 2W3KA 3VB5A 1AVGH 3E6PH 3ZZCA 2P3TB 4Q80A 4MNVA 5K0HA 1UJ1A 3K65B 2FIRH 1SOTA 1BHXF 5DO4H 1QCPA 1C2DA 1TE0A 1EOLA 5HMAA 8KME2 5HYOA 3N7DA 4HG6A 4I31A 1C5OH 1F5RA 3SN8A 5B6LA 4Q7ZA 1GBAA 3RLWH 3RXBA 2Z7FE 1NFWA 1C4Y2 1IOEA 3FANA 4AG1A 5KEDA 3S9BA 1NFUA 5DP6A 1COWD 5ESBA 1CA0C 1D6WA 4LK4A 1E37B 2AGEX 1DLKB 4O9VA 3SGQE 3UIRA 1AU8A 3SI4H 3URCA 1FPHH 1HJAC 1G3CA 2GCTC 3EE0B 4DCDA 1DVAH 1KXDA 1HAVB 4ISOA 4I8LA 3MU8A 1V2JT 3ZZ5A 1AN1E 1TPAE 1K1PA 2BD9A 2RDEA 3V0XA 1A0LA 1M9UA 2KCYA 2XWBI 4ZMAH 3F6UH 3SV2H 1QTFA 4X2VA 1EUFA 3M7TA 4ZKOU 3PROA 5H4IB 5TCAA 4P00A 4JCNA 1BRCE 2Y5GA 8GCHF 1BBRH 2XC0A 3RXOA 5JBAS 3Q3YA 1JWTA 1HJAB 2ZHQH 4AX9H 4I33A 2ANWA 3PWCA 5A09A 1P2QA 1QQ4A 2JIZD 3ITIA 1ESAA 2SGDE 2OCVB 3M36A 5EU8A 2AH4X 1HXEH 4AGJA 2SGAA 3HKIB 2Y6TA 2BD4A 4K2YA 2ILNA 4YOGA 3VB6A 1O2GH 3A8DA 5A8XA 3Q3XA 4FUDA 1GI4A 3SUFA 2XBWA 1C9PA 4ZXYH 4B73A 2CN0H 5FAHA 4NZLA 1EX3A 1E36B 1C5VA 1QB6A 3DFLA 2VINA 3MU1A 1UVOA 1RRKA 5HIYA 3ZYEA 1SSXA 3I77A 1YC0A 1OXGA 1HAOH 3SV9A 2XBXA 2FTLE 4IW4E 1KIGH 4YO9A 5EJZA 2EI6A 4MLFB 1GCTB 2A4QA 1S81A 2XYAA 1AFEH 1UCYE 1LMWB 1THPB 3H5CB 1ZJKA 4OS2A 1TAWA 1W7GH 4O97A 1TLDA 4ZKSU 2OK5A 1Z6EA 3PO1B 2FPZA 4DG4A 1O3JA 1OP0A 1JRTA 3ZZ6A 2BLOA 1IQKA 1TABE 2ZGHA 3OTJE 1O35A 2W5EA 2BDBA 1FZZA 4Y0ZE 1PPBH 3UQOA 4ABJA 5EQQA 4FU7A 3BTME 1JRSA 3RP2A 3ZZ9A 4U32A 1K1LA 1SLUB 1GMCF 1O3MA 2LELA 3STJA 1QGFA 1D3DB 1TNJA 1O2WA 4K1EA 1GL1A 1WDIA 2QIQA 4NA7A 1XXDA 2CK3D 1TIOA 2H2ZA 1TOMH 2D26C 1SG8B 2VIQA 3V7TA 2WV5A 3PTBA 2TGAA 2VH6A 3A7WA 1OWEA 2VNTA 2XRCA 3T27A 4OS1A 4K5ZA 2O8MA 1LVYA 5C0TA 1C2GA 1C1OA 2SGFE 1SB1H 1TB6H 1W11U 3SORA 1Z1IA 4MNXA 1KY9A 2IPQX 3HATH 1A61H 1ACBE 3M7UA 1G37A 1YPMH 1XKAC 1WOFA 1C5XB 2P8OC 3FP6E 4HTCH 4OS6A 3GY5A 5F6MA 1PPFE 1YF4A 4UFFH 2A7CA 1N6XA 3T62A 1C1VH 3Q3KA 5EGMA 1GDNA 1AZZA 3FZDA 1TX6A 1MKXH 3A85A 1C5WB 1E1RD 4TY7A 2ZNKH 1JIRA 2L74A 2FOAA 2PKSB 2JH0D 2ZGBH 5AFYH 1HAVA 4XBBA 1VCPA 2BD8A 1DUAA 1NZQH 1GHBG 3F0PA 4WH8A 4IS5A 3GY4A 1S82A 1PJPA 1C2EA 1WTHD 1ELFA 1GL0E 1O5GH 5L2ZH 1UTNA 1C1MA 1ELGA 3ZVFA 3S7HB 1C5SA 1HDTH 2VBCA 5AHGH 1GBLA 2D2DA 2ZP0H 1V2RT 1QB9A 4Y11E 3SHCH 3S69A 3TIUA 1OKXA 1NRQH 1AGJA 7GCHF 1SGEE 2QF0A 1QJ7B 5JPMH 2WZQA 1O3NA 3TPIZ 4ABAA 1T8OA 1O2SA 1Z7KA 2YOLA 4FVBA 2TGPZ 4DT7B 4FU9A 3GDSA 1ZR0A 2ZZUH 2BDIA 3UWJH 1HNEE 4ACBA 3T2NA 1VITH 2LNCA 2GDDA 2ZG0H 4ZHAA 1A3BH 1O5DH 1L4DA 5G4BA 1ZSJA 5DGJA 3SYJA 1SFIA 1KMHB 4DT4A 4JZIA 4Y7BA 1Z8GA 1T8MA 1GDUA 3M61U 1O2YA 5KECA 3EA8A 5LPRA 4TY6A 5CDFE 4UFEH 1O2OA 1EPTC 3STIA 3UFAA 1OYTH 1YGCH 3QTVH 1BTXA 2HLCA 4AFUA 1ZHPA 4RKJB 1ZMNA 2OC8A 3LPRA 2QXHA 2ZDAH 2KCOA 4ASHA 2ZTXA 1BTPA 1FJSA 2ZGCA 4NSYA 4R8TB 4GPGA 3VEQB 1A46H 1W13U 4CRBA 2WYJA 2F43B 1BRBE 5HM9A 1OP8A 4UFDH 1GVZA 1J14A 8ESTE 2PW8H 1P12E 3LKWA 3PO1C 2Z9KA 5C1YA 1PQ5A 3H7OA 4WXVA 1TRMA 2ZHFH 1L1NA 2C93B 1HBTH 1P57B 2KAIB 1EXFA 3KIDU 3SU3A 1TQ7B 4JMYA 2VWNA 4M7GA 2HNTC 4YESB 1QR3E 1GI5A 1TGCA 1SL3A 1NESE 2ZFRH 3MH7A 2ASUB 2NU4E 2AEIH 3AW0A 3MU0A 3BTGE 4P02A 2IOTA 3VB4A 5EXMA 3DUXH 1EPTA 2VVCA 1C5NH 1BUIA 1JXPA 2OQ5A 4HI3A 2AMDA 1TOCB 1GI9B 1GDQA 3OEHD 1UCYK 3TH2H 1FY8E 1GHAG 3QGNB 5BPEA 4X6MA 1FDPA 2GZ7A 5GJ4B 1Z71A 3ZZ3A 1GVKB 1PPHE 4XSKU 1O2RA 1C2IA 2VGCB 5JBBS 3SI3H 2TBSA 2PGBB 2G81E 1O2XA 2C8XB 1WUNH 2L6OA 2Z94A 1GBIA 4NFFA 1O37A 1C5LH 2B7DH 5FCRA 3RMMH 1JIMA 2DE9A 3I78A 2FEQH 2AERH 1IQJA 2J4IA 4BAMB 1O2NA 4YOIA 3TH4H 2ULLA 3GCTG 3LONA 1AKSA 1B7XB 4THNH 4UEHH 2O8UA 1DY9A 1YBWA 3I29A 2W26A 1DS2E 1OWKA 5EQRA 4DOQA 2UWOA 1H8DH 2KAIA 1UVTH 3MI4A 3SOSA 4XRNA 2G51A 3L6PA 3GCTF 1YPLH 3EYDA 3RU4D 1GBMA 2QN5T 1KXBA 1IHTH 1C5PA 4AN7A 1V2VT 3SUEA 3SUDA 1CO7E 2VWMA 2B0FA 3DSGA 2F83A 1NBMD 2OP9A 3SNCA 2ODPA 2J98A 4B6FA 1EP5A 2ZQ2A 3AAVA 1ZTLA 3RXRA 8LPRA 4ISHH 3TVJB 4Y8ZA 3Q76A 8GCHG 1IQEA 2J9NA 1TNKA 5PTPA 1Y3XA 2V3MA 1SKYE 1GHXH 1DSUA 1RXPA 2P3UB 1BTYA 2ZA5A 1W14U 4KGAA 3VPKA 3R0FA 5GCHF 1VITG 2A32A 1ELTA 4JZ1A 4O3TA 1IHSH 4O3UA 1BMLA 4PROA 5EW2H 1BB0B 1DXPA 3A84A 2BY6X 2GV6A 4ZH8A 1YPHC 2WV9A 1MAXA 3CS7A 1SQAA 5GPIB 1PQ7A 3T5FH 2FYRA 1ZGIA 3LU9B 3LGVA 4LOYH 1RS0A 2ZGJA 3MH4A 1HLTH 2QYIA 5CHAB 2XOKD 3NXPA 3ATKA 3PM3A 4VGCB 1KTSB 4AFQA 2H9TH 2GZ8A 1EJNA 2JJ1D 5AVDA 1UTOA 2WUCA 2HGTH 4Z6AH 1WQSA 4ABEA 1TBQH 2DUCA 3RXJA 1K2I1 2Q6FA 4MPVA 1FN6A 1AVWA 1AFQC 2BB4A 3FO8D 1KLJH 1HJ8A 4FUBA 1BRAA 2OLGA 5EXNA 2J5UA 4TPIZ 1QA7A 1YYY1 4B71A 2STBE 2PFEA 2QV1A 4XD7D 4B76A 1O3GA 1OSSA 2P8OB 1DWBH 3QZRA 1EZXC 2J2UA 5JBCS 3ZZBA 3E0PB 2K0QA 3GY8A 2OD3B 3KQ5A 1DM4B 2WPLS 2CV3A 3U28C 1QBNA 1TBZH 2AIQA 2Y7XA 1P2OA 1S6LA 2V35A 2BVXH 4BAHB 2Z9IA 1VCWA 1ELCA 3BTTE 1IQFA 1NN6A 2Y81A 1X7AC 3SO3A 3A7XA 4YLUA 2D8WA 1GBCA 1P0SH 1WCZA 3K2UA 5C5OA 1LCYA 1P01A 1ZPCA 4NCYA 1IQHA 3LT3A 1GJAB 4X8TH 1GBEA 1OX1A 2GKVE 4NFEA 3UNQA 3VFEA 1MZDA 3M5NA 1Y5UT 2TGTA 1N6YA 1DOJA 1FMGA 1J16A 1WV7H 2ZQ1A 4IMZA 3P8GA 4MG3A 1RD3B 3DD2H 1DFPA 4WY3A 3A7YA 2BOHB 1LKAA 5F03A 4SGBE 3BG4C 1GHVH 2KCPA 1MBQA 3RXDA 1O31A 3MQKC 3HKJB 3K6YA 1UK4A 1OPHB 1P9UA 4NZQA 1MTVA 1TX7A 1MTUA 3U9AH 1IQNA 2R2WU 2FZZA 1YPJH 2ZDVH 1L0ZA 1MTSA 1SGDE 1HAHH 2QF4A 2Q1JA 2TIOA 1LHGH 4TWYA 1V2ST 2VIDA 4CRGA 4F55A 3UNSA 1LPGB 4RT1A 2PKSC 2FS9A 2W7SA 1BA8B 3LGUA 4A6LA 4K8BA 4MNYA 4AB9A 2F9UA 1Z6JH 3FKSD 5C0UA 3UREA 1EB1H 1UVUH 1TPOA 3SV8A 1TQ0B 2Z9JA 4J1YA 5T6GA 1DANH 4Y6DA 1NT1A 1S6HA 1VJAU 5I46H 3BTFE 1MKWH 1A0HB 1GPZA 3W94A 1P05A 1DLEA 3U69H 4BXSA 2ZFSA 1EFRD 2ZEBA 4GCHF 1O3IA 1DWEH 3NK8A 3TJOA 3LJJA 4U2WA 1O5FH 2GP9B 5E0HA 2BX4A 1XUIA 2J97A 1P10A 4Y7AA 2BQ7B 2KR7A 3SJ8A 1A2CH 1WYKA 5T3HA 1O5CB 2A7HA 5T1VA 3TH3H 1O36A 1GJBB 1TGBA 2PTNA 3E3TA 5E0JA 2JETC 4Y8XA 3QZQA 1SGTA 2UWPA 2Z3CA 1CVWH 3M3SA 1BMNH 2ZFPH 2HNTE 3HPTB 1GG6B 1THSH 1W3CA 4Q4LA 1WXRA 2GJGA 1LQEA 1MBMA 1YP9A 1EAWA 3BEFB 2F9BH 1C1RA 2VWLA 1O3BA 2C90B 1P8VC 3BIUH 3LGIA 1VKYA 4E06H 1PFXC 1LHDH 4XFQA 2RG3A 5E8EH 3C27B 3TGIE 2BXUH 3IWMA 1NY22 3A86A 5FPSA 1UHBA 3T25A 2THFB 3TNTA 1XUFA 3ZVDA 1QJ6B 2KM0A 1JBUH 1NM6A 1GWAA 3E0NB 2ZDMA 4K3JA 1UMAH 2VIVA 3QDZB 1CU1A 1E79D 3SQEE 3U1JB 3PV2A 1C1PA 4TWWA 1GBHA 4CHAC 1LVOA 1YCPM 1Y3YA 2ZU2A 1H8HD 3QTOH 3IITA 3T28A 2NU0E 1P2IA 1CT4E 2FTMA 3P70B 7KMEH 3SGBE 4D7GA 3NCLA 3OFND 9ESTA 4R0IA 2G52A 2PTCE 3TNSA 1GHBF 4TSFD 2O9QA 3TK6A 1LDTT 3UB0A 1PPZA 5L6NH 1SHYA 3WWFA 5E2PA 1QL8A 3OE7D 2BVSH 5C67A 1O5BB 2XC5A 1H8ED 2VIWA 1AE5A 1LPKB 1V3XA 2Z6BD 1AIXH 3MO3A 4JYUH 3SNAA 5C3NA 5CMXH 3DT0H 1S0RA 4CHAB 1NO9H 2B8OH 2XTTB 5DKMA 4YTAA 2KFWA 1ETSH 1LTOA 1YPGH 2ALPA 3QGJA 3ENSB 3ZVGA 4A5TS 2STAE 1GBKA 6GCHG 3W1EA 2IJOB 3P17H 2ZTZA 5A2MH 2XXLA 4CR5A 4WWYA 3A8BA 1O3EA 5C5NA 3ODDA 2ZFTA 1SGFG 4UD9H 2W7UA 1ORFA 3M3VA 3ZIAD 3IG6B 3WW7A 4OGYA 1HAZB 5DP8A 5T6DA 1RGQA 4RKOB 2A5AA 1HUTH 2KZ4A 3JZ1B 2QF5A 2WHXA 4BAKB 2PLXA 3MU5A 3RU4T 1CT2E 1OOKB 2H5DA 4AORA 1C2KA 3TK5A 5DP5A 3PMAB 4AB8A 1K1JA 2Q6DA 4MPXA 1ARCA 5I25A 1EASA 2PSXA 3T29A 3RC6A 2H6MA 1UO6A 1OS8A 3LC3A 1F2SE 5C20A 4ABFA 2PP6A 3SZEA 5IYTA 1Z8RA 1GCTC 2A2XH 1O3DA 3B9FH 3TJNA 1J9CH 1GJ8B 2FI3E 1W12U 2JJ2D 4CH8B 1C5YB 3OSYA 1O2QA 2BLWA 2GT8A 1AY6H 4X2XA 1ZOMA 1HRTH 1BDAA 3UNRA 1ELEE 2FM2A 1BMAA 3F9EA 3PB1E 1L4ZA 1HAYB 4WMEA 5A0CA 2QXJA 3BG4B 4DW2U 1N8OC 1CE5A 5GDSH 4NIVA 1B0EA 2OTVA 1TYNA 1MABB 2BVRH 4AOQA 1GJDB 3ZVCA 3UWIA 2YMSC 2HNTF 4BAQB 4YT7H 1V2KT 3PV4A 4AG2A 1GHYH 4VGCC 2CHAB 3RXPA 2HALA 3AASA 1ESBA 2BHGA 2GT7A 2ESTE 1P06A 1SVPA 2OINA 3MO9A 3P8FA 3GYMA 2A5KA 3KHVA 4Y71A 4AGKA 1H4WA 1NBME 1C5TA 1PQAA 1T4VH 2GMTB 3QN7A 3EA7A 4FUIA 1YWUA 1NRSH 1AFQB 5C1UA 2TPIZ 4RI0A 3F68H 3M5MA 1O5EH 1O3PB 3A7TA 4ZROA 4F48B 2G4UA 4DIHH 2D1JA 1MKXK 1HB0B 1SGRE 2AS9A 3PMJA 2QA9E 3DHKH 3KEEA 4NA9H 2PUXB 2ODQA 1IAUA 2VGCC 7ESTE 1CA0B 4JZDH 1A7SA 5EOKA 3RXUA 1SLVB 1SMFE 1HGTH 2GTBA 4FUJA 4D9RA 5GCHG 3LGTA 1GI6A 2A5IA 4AFSA 5AFZH 3P8OA 5CHBA 2G4TA 4NWKA 3FP7E 3VB7A 1QBVH 3VB3A 4CH2B 2RDLA 2XW9A 2ZWLH 1UK2A 3KQCA 2BY9X 3M5OA 1O33A 4BTIB 3Q00A 2AIPA 3KQBA 3NRLA 1DITH 2O8TA 4I32A 1SGYE 3UOPA 1P3EA 1H9LB 4JK5A 1K1OA 2H9HA 3D62A 3URDA 1GMDF 2WPJS 1ZSKA 1HYLA 5ABWA 5EJLA 2A4GA 4WXIA 1H1BA 3F0OA 4X8SH 3A88A 4ISLA 2ZCLP 1QRWA 4ZKNU 1DXWA 2C8WB 3F2FA 4X6OA 1K1IA 1XMNB 4KTCA 2BQ6B 4RT0A 4HZHA 1ZYOA 3UTUH 3AVZA 2CF8H 1GMHG 1TRNA 1BMFD 1XVOA 1ABIH 4X1PU 2EC9H 1O2VA 4IMQA 2FOFA 1PYTC 4FUCA 1ZHMA 4RSPA 1K1MA 1UHBB 1ZMLA 1C1SA 1SLXB 3PRBA 1C5UA 1HAIH 5EIYA 5DP3A 1DY8A 7LPRA 1ZSLA 3OEED 1GI0A 1UK3A 1UTLM 2AFQB 4NIXA 3RXQA 1KXAA 2A0QB 2HOBA 3WY8A 2XC4A 4Q7XA 2ALVA 1Y5BT 2SNWA 1O32A 4I8JA 5DSFA 1EPTB 4A1VA 2P59A 3GDVA 4YLQH 2VU8E 1QHRB 1C1TA 1AVXA 2UUJB 1LPZB 1VR1H 1BJUA
chains in the Genus database with same CATH topology
1HJ9A 3BTDE 1C1NA 1Z1JA 4UONA 2P16A 1Q31A 1ZTKA 3PYHA 3PV5A 1XUJA 1P09A 3TJUA 3K9XB 1F7ZA 2ANYA 3LGWA 2WSSD 5C17A 3KL6A 1MH0A 2OBQA 5E0GA 1ELDE 1PPCE 1C4U2 3SBKA 4DVAU 1V2NT 1V2UT 3RC5A 1W0KD 1YPKH 1THRH 4KELA 1G9IE 2WINI 1BTZA 1FAXA 1G32B 1YM0A 1XUKA 2BDHA 2ZDKA 3PLKA 1E0FD 3ZZ4A 3S9CA 1LHCH 1A5HA 3LH1A 2PKAA 4X8UH 1GI8B 4SGAE 2JKHA 1GHAF 4Q2KA 2Y5FA 1P3CA 1C2JA 1QNJA 2J94A 2GD4B 1K28D 3NZIA 2P95A 1L1GA 1TFXA 2ZKSA 1GG6C 1WTGH 1O2UA 3R3GB 2GDEH 2FX6A 2GV7A 1C9TA 4Q7YA 5EW1H 2JH6D 3DSPA 1E34B 4ZXXH 3FFGA 2FDAA 4JYTA 2BLVA 1DUEA 1GBFA 4WF8A 3KNXA 1BIOA 1EJAA 2EI8A 1GJ4H 2VB0A 4MQAA 3U98H 2HLDD 1TA6A 4BTUB 2BDGA 3GYLB 2G00A 1E1QD 2J34A 2ZDLA 1N8OB 3ZZ7A 2CHAC 1NU9A 3UUZA 2FP7B 4H4FA 2IN2A 2GX4A 1FQ3A 2J92A 1GBJA 1SGFA 4I8HA 3EAJA 2ZCKP 5C1XA 3M7QA 4CR9A 1AUTC 1MD7A 2BTCE 2RA0A 4GHTA 2XNIA 3MMGA 3CENA 4M9FA 1HAXB 4UE7H 1TONA 4X2YA 4YXWD 5DG6A 2EA3A 2OC7A 3G01A 2FOGA 5HM2A 4ASUD 1MQ6A 2AGIX 4X0WU 3ATLA 5B6OA 2BDCA 3LC5A 1SGPE 2XBVA 3GCNA 1ABJH 4FXGH 1OWDA 1ETRH 2OXSA 3OU0A 3MTYA 1LHFH 1W8BH 1CBWC 1SGCA 3UOUA 1RJXB 4LZ1H 1ZGVA 3SU5A 3Q77A 4BNRA 3SU0A 1CGHA 1T8NA 5FCKA 3QK1A 1GCDA 3S7KB 3TGKE 5JYIA 1WQVH 1ELAA 1XX9A 1UVPA 4CRAA 2W3IA 1NRNH 1B5GH 6CHAB 2PHBA 1GJ7B 4NIWA 1O2LA 3A80A 3EDXB 1NS3A 3E8LA 1Y3VA 4WH6A 1HPGA 1MTWA 3F9FA 2ZU1A 3M35A 2BY8X 1P2MA 4GSOA 2F9OA 4XOJA 3MH6A 1P2NA 2BYAX 2BZAA 3QX5H 1GI7B 3GCHC 3PTNA 2BQWB 2FYQA 4CRDA 4ABDA 2XBYA 1O2ZA 1V2PT 5LPFA 2FI4E 4NWLA 3H09A 2ZPRA 2OC0A 5C2ZA 3UQVA 1F5KU 2A4OA 1O3FA 2VVVA 2W6JD 1TWXB 2M2AA 1FONA 1XUGA 4DY7B 1RTFB 3VGCB 2PGQB 2VIPA 1D9IA 3V13A 1XM1A 5FBIA 1K21H 3OAAD 1FNIA 1TGSZ 3MNXA 3GCOA 1O3OA 2WPHS 3QWCH 3ATIA 1A3EH 1E38B 4FUHA 1QY6A 1V2OT 1EKBB 4AZ2B 1DX5M 2B5TB 2TRMA 4BXWA 1L2EA 1C2FA 1O2IA 5SGAE 4FVDA 4X1SU 2AYWA 1E35B 5EQSA 4K8YA 2BD5A 4CBOA 3UR9A 2J95A 2JETB 1GHWH 3HK6B 1TGTA 3M3TA 1HAGE 4MPUA 4IC6A 1QURH 1SGIB 3S9AA 2Z9GA 2ANMH 4ABGA 3PLPA 2PR3A 1YCPH 2F9NA 2A45B 4B2BA 2GMTC 2P93A 1FAKH 1KLIH 2VVUA 3ZV8A 2UWLA 5TJXA 3OYPA 1O3AA 2A1DB 2ZU4A 2GGVB 2AGGX 4D7FA 1P2JA 3A82A 3RMLH 1C5ZB 1FY5A 3KF2A 4LXBH 2EI7A 1QFKH 3UPEA 2V3OH 4ZKRU 2BDYA 1QRZA 2XNDD 1FIWA 1LVBA 3CP7A 3O8BA 1Y5AT 2XCNA 1O0DH 1S84A 3GY6A 1AWHB 1SBWA 4WMDA 2A31A 3MNBA 4RN6A 1MCVA 1GJ6A 1RIWB 4CRCA 4YOJA 1MU6B 4FUEA 4TPYA 2BOKA 1NRRH 1BZXE 4ESTE 4DIIH 4BAOB 2NWNA 1AD8H 1GHZA 1UTPA 1T8LA 4TT3D 3KGPA 1T31A 2ZI2H 3N7EA 1QQUA 1BOQA 1O3CA 1TNLA 1VCQA 1ANBA 1ESTA 1WBGB 4IGDA 3F3BA 4Y8YA 3GY7A 3FZZA 1AKSB 1TBRH 1O34A 4X1QU 5FX6A 2BD3A 2FODA 2NU2E 6GCHF 3RLYH 1RIWC 1TPPA 1O38A 2EEKA 1IQLA 1RTKA 3OY6U 4I8GA 2QC2A 1MMJN 1TPSA 4JZFH 3SJOA 4GVUA 3NPSA 1C1QA 4B1TA 1KDQA 2OBOA 1KXCA 5EPNA 1KXEA 1TX8A 1H9IE 3FAOA 1CT0E 5GIBA 3RXIA 1PQ8A 2A2QH 3RMOH 5EODA 1H9HE 2OC1A 1BJVA 2FOEA 5F8ZA 3VXEH 3MNCA 3TITA 1P03A 1LKBA 1FXYA 2GVFA 2GZ9A 1FLEE 2I6QA 2YNAA 5FXLA 4YT6H 2P3FH 1MCTA 2V6NA 1IQGA 2HPPH 3F1SB 1KSNA 5FX5A 3B8JA 4D8NA 2ZO3H 4O03A 4NA8A 1EP6A 1GBDA 1EAXA 1ZRBA 2C3SA 3D49H 1YPHE 3AAUA 3TLOA 3MOCA 4IBLH 2CMYA 3LGYA 4MTBA 5CE1A 1A4WH 5LGOA 2FX4A 1F0SA 3SNBA 1AI8H 4NG9H 2YMSD 1GMHF 1QBOA 2F9VA 1A5GH 1Y59T 3MFJA 4KTSA 2R0KA 2RA3A 3P92A 1TA2A 2IPHA 2BY5X 2Z3EA 4GCHG 1OWIA 1DPOA 1FY4A 4ZHLU 1HIAA 5HXFA 4TYDA 1MTNC 4F4OC 1DSTA 2PWXA 1IQIA 1FUJA 4HFPB 3BTKE 2K8IA 3NUMA 2CJIA 3U1IB 5DP4A 3LJOA 4A1TA 4DJZB 3DA9B 3U8TH 3RUOA 4IC5A 3GOVB 3TK9A 1PPEE 3SHAH 4K1SA 2FS8A 2Q6GA 3FN8A 1GI3A 1CHOG 1KXFA 4D76A 1NC6A 1DT2A 2M5TA 2ANKH 4IN2A 1QL9A 1FIZA 1S5SA 2FMJA 5FBEA 1GGDC 2KCAA 2FLBH 1BMMH 2V7QD 4B2CA 5DP9A 5JBTA 3GY3A 1Q3XA 2ZIQH 3MNSA 1ZMJA 4OGXA 4XE4A 1G30B 1VZQH 1QA0A 3NKKA 4GUXA 2BY7X 3RXAA 1QB1A 5IK2D 2UUYA 5EPYA 4INKA 4QT8C 3E16B 4FETA 1SFQB 1TNHA 5E2OA 3BG8A 1ZTJA 2QXGA 4BANB 1T4UH 3OX7U 3KQEA 3QLPH 1F0RA 2BZ6H 2ZPQA 4ZHMU 2SGQE 4ZAEA 3O8RA 1GJ5H 1S85A 2W6ID 1ZPBA 2AMQA 2Y82A 3SU1A 1CHOF 1O5AB 1MAYA 3F2HA 3ATWA 2ZFFH 3BTHE 2F9PA 1OP2A 3E1XB 2HRVA 1D3PB 1TMUH 4ABHA 3D65E 3ZYDA 1CBWB 1W7XH 5A8YA 3MYWA 2O8WA 2ZPSA 1BTHH 1QJ1B 1CQQA 4DURA 3F2GA 1MTNB 1YCPK 3LDXH 4KP0A 3B23B 5TCCA 1ZHRA 1V2TT 3RC4A 1CSOE 3RXHA 4U30A 1FY1A 4CREA 3P95A 1AMHA 1N1LA 4A92A 3SNDA 1NPMA 3QUMP 1C5MD 7GCHG 4B6EA 4AFZA 2PSYA 1NU7B 3U8RH 1J15A 1PPGE 3O8DA 5J4QA 4MPWA 1DE7H 2PUQH 1KLTA 1P9SA 4K60A 3RXGA 1HXFH 2QF3A 3BTEE 3N7OA 2ZF0H 1SOZA 2BDAA 1VGCC 1SC8U 1MZAA 4FUFA 2ZHWH 4Y10E 3ZVAA 2JDID 3L33A 5L2YH 5FHTA 5HGGA 3BTQE 1JMOH 4Z1MD 3GDUA 3BEUA 4OS4A 5DPAA 2CGAA 3FOAA 6CHAC 1KDQB 2FI5E 2TGDA 2R2MB 4IN1A 3MO6A 2R3YA 4HGCA 3A81A 1UCYH 2XCFA 4OM9A 2BMGB 3ODFA 5LPEA 3GY2A 3GICB 4GHQA 2WPDD 3ZV9A 1F0UA 1ZPZA 3LOXA 3T26A 1VJ9U 9LPRA 1L1JA 1VGCB 1NROH 4XDEA 4OS5A 5EG4A 3L3TA 4H6SB 1G3DA 1GBTA 2Y5HA 3RM0H 1F92A 1EATA 3JZ2B 2ODYB 1ELVA 3AK5A 3UY9A 1RTLA 4I8KA 3KN2A 1FPCH 4GLYA 4CRFA 2GCTB 3RXSA 2Z3DA 5AF9H 5K7RA 3RXKA 4Z0KA 3KQDA 3OTPA 5EXLA 3S0NA 4AYVB 4JYVH 1TNGA 5A0AE 1F5LA 1EZUC 3K6ZA 4ZCNA 1ZZZA 4YM9A 1FI8A 3KCGH 1YLCA 3DSOA 2JH5D 4ISNA 3SU4A 1AE8H 1C1UH 1BTWA 1DDJA 2HPQH 1C5RA 1AB9B 1Y3UA 2VIOA 3RXTA 2SNVA 1SQTA 3E90B 2F4LA 1RFNA 1MU8B 1EAUA 5F8XA 1YLDA 1GJCB 3AW1A 3PMHB 2G5NA 5A8ZA 1K1NA 2UUKB 2A4RA 4Y79A 1OHHD 3EQ0H 2FWWA 3SUGA 1ANCA 1O2MA 1GI2A 1QRXA 1B0FA 3HK3B 1GMCG 1OYQA 4FU8A 4H6TA 1P02A 4H42U 2BX3A 1SPJA 1EOJA 2VJ1A 1YKTA 2BM2A 1F0TA 1OWJA 6ESTA 1FN8A 1GBBA 1GJ9B 2ZGXH 3BIVH 1VITF 1AHTH 3PWBA 2QXIA 3DFJA 2DE8A 5HKKD 2WPKS 1A5IA 1CHGA 4MVNA 2HVXA 4JZEH 1AWFH 2LPRA 3RXVA 2Y80A 3A8CA 3ZVEA 1AQ7A 4DGJA 3SQHE 1ZRKA 5LH8A 5FPYA 1ANDA 4OS7A 3RXLA 1G3EA 2WV4A 1ZLRA 1KYNA 2K1QA 4INLA 5JDUB 3SW2B 4D9QA 4K69A 4F49A 1G2LA 3GS9A 2O8LA 3BSQA 2ZHDA 1C2MA 4K1TA 2VWOA 5DP7A 1LVMA 3DCLA 1ANEA 2F91A 1S83A 2C8YB 3EGKH 1LO6A 1XUHA 2NU1E 2B9LA 1MUEB 3RXEA 2RCEA 3PRDA 1Y8TA 1AB9C 4BOHA 1BRUP 1UVSH 1P04A 1LQDB 1T7CA 2WYGA 2CXVA 3M37A 4A1XA 1KTTB 3ZZDA 1G2MA 1FX0B 3UR6A 2H9EH 1MKWK 1BBRK 2WPIS 2PV9B 1P11E 4WMFA 3ZZAA 1NTPA 3RMNH 1O30A 4E7NA 2QGRA 1BTUA 1CA8B 1J8AA 3MWIU 1FY3A 1U6QA 3BEIB 1WU1A 1EZSC 4X2WA 2R0LA 1ZJDA 5FPTA 1HV7A 3TGJE 2FESH 4B75A 3A8AA 3GISB 4YZUA 1IQMA 1D6RA 1S0QA 5GNDA 1V6DA 1A1RA 4UFGH 3A89A 1D4PB 1DWCH 1FV9A 1MD8A 2H1UA 2UUFB 3M5LA 3BN9A 5ESTE 1TALA 1W2KH 3LH3A 2GCHG 2OQUA 3LIWA 3V3MA 4ZUHA 1O3HA 2BD7A 3GCHB 2FOMB 3RXMA 3ELAH 2J38A 3PLBA 4J2YB 1UTMA 3N99A 2C4FH 3RXFA 5GXPA 4ABBA 2G55A 4BTTB 5T6FA 4A7IB 4X1NU 3H7TA 3HGNA 1QL7A 4I7YH 1HCGA 4LZ4B 2I6SA 2SFAA 1QIXB 3SZNA 4XBDA 1TMBH 1ARBA 3ATMA 4Q63A 2R3UA 2HWLB 5F53A 2SGPE 1C1WH 1CGJE 2FLRH 3SGAE 3TU7H 2AMPA 1WSSH 3A7ZA 2QE7D 2ZHEH 1K22H 1BBRE 2QCYA 4B74A 4E7RG 2BLQA 2AHME 2ZU5A 1S6FA 1HFDA 1TMTH 3SU6A 5DJ7A 1AO5A 1GGDB 1WAYB 1NRPH 1BCUH 4XBCA 3WWBA 1V2QT 4KKDA 2GCHF 4X6PA 2ZTYA 3V12A 1C4V2 1K9OE 1MQ5A 2FO9A 4AYYB 1W10U 1SI5H 4U01A 4X6NA 5IDKA 1CGIE 1HIAB 4UDWH 4ISIH 2P94A 1BQYA 1A0JA 3P8NA 4MNWA 1SLWB 2SGEE 2WPMS 1C5QA 1V2MT 2FOBA 3P6ZB 1T32A 3RU4E 1O39A 1G3BA 1NFXA 1O2JA 1UTQA 4NIYA 1W0YH 1Z8JB 3MHWU 1LHEH 4KTUA 1J17T 2Z9LA 1Z8IB 3MH5A 1OWHA 3BF6H 4ABIA 2QY0B 4B2AA 1Y3WA 2BD2A 3D23A 1SQOA 2V3HH 3SV7A 1GI1A 2ZFQH 2PKAB 4JK6A 3OY5U 1TNIA 1UTJA 1SHHB 3FVFB 1YPEH 1TRYA 5A0BA 1EAIA 2ZECA 4NSVA 3F9HA 3HGPA 1G36A 1Q2WA 2Y7ZA 1DICA 2VH0A 3QO6A 2YNBA 2ZDNA 4MDSA 1BITA 1XKBC 4X8VH 2ZC9H 4CBNA 3VGCC 2H5CA 3CS0A 3SNEA 1TGNA 3A83A 5JB9S 3MU4A 1C2HA 1V2WT 1O2TA 1DWDH 1UTKA 2YMSB 3ZVBA 5GWZA 1SGQE 5DK1A 1H8IH 2FXRA 2WUBA 5FL7D 2QAAA 3BV9B 2BXTH 2F3CE 1D3TB 2ZCHP 3C1KA 2A7JA 3FP8E 2ZU3A 1D3QB 4WJG2 3RDZA 3SJ9A 2FOCA 3SJIA 1XVMA 2NU3E 5J4SA 1O2HA 3RXCA 4FUGA 3NWUA 2G8TA 1BT7A 1O2PA 5F8TA 4X1RU 1GVLA 1ELBA 3TJVA 4Y76A 5BRRE 1O2KA 2CF9H 5L30H 3ESTA 3ZZ8A 3F9GA 3SJKA 1ID5H 3VG8A 4INHA 3SV6A 1P2KA 2C8ZB 1XXFA 1O3KA 1W0JD 1O3LA 6LPRA 1C2LA 1EZQA 4WVPE 2FOHA 1ETTH 3O8CA 1GMDG 2V0BA 5JB8S 1BHXB 1AUJA 4GAWA 4Y0YE 4NGAH 2G5VA 2IJD1