4NWKA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-605339 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-n-((1r,2s)-1-((cyclopropylsulfonyl)carba moyl)-2-vinylcyclopropyl)-4-((6-methoxy-1-isoquinolinyl)ox y)-l-prolinamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
188
structure length
188
Chain Sequence
GSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 1a Protease
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwkA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwkA01
4X2VA 1S0QA 1TNLA 2OC0A 3TVJB 3TJOA 1Z71A 4O03A 2FLRH 1SGQE 2OUAA 3BTFE 1XUIA 2BVSH 1S6FA 1TRYA 3O8RA 1VITG 1O2RA 2G55A 3ATMA 4LOYH 1ZSLA 1G3EA 1P03A 3A7YA 2WHXA 1PYTC 3VFEA 3S9BA 3RDZA 1BDAA 1CQQA 2EC9H 5A8ZA 1AIXH 1LHDH 1DUAA 3MNCA 2AERH 1MCTA 4IC5A 3SJ9A 3M61U 1K21H 1K1PA 3EA9A 2PTNA 4GSOA 3IWMA 3QK1A 3VB5A 3CS7A 3KEEA 4YLUA 5EOKA 1PPEE 5DK1A 5JB8S 5SGAE 1DY8A 1W12U 2WPJS 1S84A 1LVYA 1NPMA 4K69A 1FY1A 1BRUP 1PQ5A 3ODDA 1UTLM 1TMBH 3FFGA 1IAUA 3D65E 3P92A 2BVXH 1JXPA 2STAE 1Y5BT 3RXSA 4SGAE 1NU7B 1GJDB 1J15A 1WUNH 1W3CA 4FU7A 3OYPA 1H4WA 2WPKS 3T5FH 1ZGIA 8KME2 2A5IA 1G32B 1C2KA 4LK4A 1GGDB 2HGTH 1E0FD 4A1XA 2ZHQH 1L1JA 4A1TA 3R3GB 1GBTA 3JZ2B 5EPNA 3AW0A 4ZAEA 3SW2B 1FPCH 4X1NU 2QCYA 1CHOG 1FJSA 3A88A 4UFGH 1ZMLA 3TLOA 3QO6A 4KKDA 4IC6A 4X6MA 2ZI2H 3BIUH 7GCHG 1QRWA 2ANWA 4NA9H 2WINI 3LT3A 4VGCB 2VIPA 1AFQC 4H6SB 2TBSA 3HATH 1O3JA 1EAWA 1DWCH 1TOCB 2QIQA 3OY6U 5EQQA 4WMDA 5HMAA 3ATLA 5IYTA 3OTJE 1JRTA 2F3CE 4I31A 4X2YA 4OS1A 1BBRE 1ARCA 1KXBA 1V2LT 1S6HA 2ZG0H 4X2XA 4NGAH 1PFXC 2PLXA 2ZDLA 2TPIZ 2BD4A 1O2JA 5JB9S 3K6YA 3T28A 1WAYB 1ANDA 1CE5A 1KXFA 3A82A 1EP6A 1GMHF 1AUTC 1V2WT 1AVGH 5DGJA 2BDHA 2WV4A 1BJVA 1FDPA 4K1TA 2A32A 1SQAA 4ZH8A 1ZR0A 1K1IA 2ZPRA 3EDXB 1K1NA 1T8MA 1BTWA 1GHBG 1ZRBA 2QXJA 2AH4X 3ZVGA 2P93A 3P70B 5I46H 3GCHC 3F9HA 2V3HH 3V13A 1ORFA 1TOMH 3RXHA 1VZQH 3FAOA 2Y7ZA 3N7OA 1Y59T 1E37B 5A8XA 5GDSH 1KDQA 1C5OH 1DICA 1FN6A 2H9TH 4K3JA 5EQSA 3ZVCA 1O2TA 1O3LA 2HWLB 2PGBB 1ETTH 6GCHG 1A5HA 1YC0A 5FPSA 1VCQA 1C5XB 1AE8H 1A5IA 2ESTE 2WPHS 3FP8E 4ABEA 2OQ5A 3H09A 2C4FH 1DVAH 3UNSA 2ZKSA 3NPSA 2FMJA 5ETXA 5LGOA 3TITA 3RXAA 1RD3B 1Y3XA 3RXGA 1G37A 3FVFB 1O2SA 2P8OC 1LQDB 3WY8A 3MTYA 1LPGB 2OQUA 4X8VH 3F9EA 1DT2A 2XBXA 6LPRA 1E35B 1MAXA 1THSH 1RIWC 4JCNA 1O2YA 2PUQH 3RXUA 3C1KA 4CRGA 1GVZA 1GI5A 3A87A 4K2YA 2CXVA 1BBRK 5E2OA 2OINA 3PO1C 1GBBA 4CH2B 3AAVA 3U9AH 4UFEH 1T8LA 3DA9B 4O97A 3JZ1B 2IPHA 1YPGH 3BV9B 1C2IA 1AFQB 1K1JA 1L4ZA 3BTEE 3GY5A 3E0PB 1AMHA 2EI6A 1O5DH 3MNSA 3MO9A 3RU4D 1J16A 1BUIA 1GJ6A 3UR9A 1CO7E 1GI4A 1DUEA 4ZKNU 2R3UA 4X8TH 1YBWA 3RXFA 1O3PB 3KL6A 1W2KH 1C2LA 3E90B 1SG8B 4ABFA 2ZECA 1LQEA 4UFFH 4E06H 3ATIA 4O9VA 4ZKRU 1LCYA 4B74A 2FS8A 2BDCA 1FNIA 3DT0H 3DFLA 1PPGE 4AFQA 2QF3A 2O8UA 2Y5HA 3ODFA 4TY6A 3LONA 1OWKA 2ZGXH 3RM0H 2PHBA 2HVXA 4XSKU 2QXGA 2GGVB 4FVBA 5L2YH 1OXGA 5JYIA 3FZZA 4X2WA 4I8GA 4BXSA 2GDDA 3IITA 3GCHB 2VH0A 3U98H 1Z8IB 1L2EA 2FX6A 1FLEE 1JRSA 2D8WA 5EXLA 2SGFE 1QL8A 1P12E 2YNAA 4ISIH 4YTAA 2R0KA 1ZSJA 2ZCKP 1KXEA 2A45B 1C5PA 2KAIA 1TRMA 3A85A 4B73A 4WMEA 2YNBA 3UOUA 2G51A 2GMTC 4R8TB 2H9HA 1O2KA 1TBRH 4GAWA 4RKOB 1EKBB 1QGFA 4GCHG 4INHA 4BANB 1HAGE 2BYAX 3RLYH 4MG3A 3TNSA 5EG4A 2VVVA 2FX4A 1SGRE 4X1SU 2FLBH 2FOCA 2FXRA 2I6SA 3K65B 4ZHMU 3A7XA 2ZGJA 2F83A 2H5CA 1T4VH 2A31A 3BTGE 3BEIB 3RXCA 1BA8B 2FPZA 3LC3A 3M3SA 1M9UA 1WYKA 2GZ9A 4NWLA 1MD8A 2NU0E 1CT2E 4OS5A 1RIWB 1CHOF 4ZXYH 1N1LA 2K1QA 5C1XA 1K1MA 1BMAA 2J38A 3Q3XA 4FUEA 3RXDA 1EB1H 1KSNA 4ZUHA 4ZHLU 5A0CA 1SOTA 4XBCA 3ENSB 4BAHB 4DIIH 3FANA 1TX7A 7LPRA 1LVMA 1FAKH 3QWCH 3PO1B 1GL1A 1NFXA 2R2MB 5T3HA 2AGIX 4ZHAA 5TJXA 2A7HA 1W0ZU 1XUJA 5DO4H 1A3BH 1QA0A 4CHAC 2BD8A 3KHVA 1C2FA 1WTGH 1TGBA 1ELAA 1GI3A 3STJA 1GMCF 3E1XB 3ZVAA 2ZTXA 4ESTE 1RTLA 8LPRA 1QR3E 3A83A 2Z6BD 3ATKA 2W3KA 5GPIB 1C1MA 2EA3A 4B1TA 1ZHMA 1BRBE 3LGWA 1G3BA 1AZZA 1ANEA 2CF8H 4AYVB 1AY6H 1FUJA 1SLUB 3PWCA 1C5MD 1TNGA 4UFDH 1F0TA 5JBTA 1UO6A 1QBOA 1AFEH 1HAIH 2YOLA 2BY8X 3P8GA 1LHFH 1OP8A 1IQEA 1XUKA 3M3TA 2G4TA 1WV7H 2PWXA 4D76A 4DVAU 1O3BA 3G01A 2A1DB 3UWJH 4ISHH 5DP9A 4U2WA 4NSVA 1G30B 1GJBB 1ZJKA 2BDYA 3EGKH 1KLIH 5FBEA 1PQ8A 2G5NA 1AD8H 3SUGA 1EATA 1C5QA 2R3YA 3LGYA 1O3NA 3RC5A 2SGAA 4X6OA 2ZWLH 1Y8TA 4K8YA 2GDEH 3SQEE 1C1QA 2Z9IA 2VNTA 1EQ9A 2D2DA 1YYY1 4AG1A 4B2CA 1NROH 3RXTA 1D3TB 3RMMH 1TLDA 3U69H 3PV2A 2GTBA 4DG4A 1VITH 1NFYA 6GCHF 2GMTB 1FPHH 1O5FH 5FCRA 2B8OH 1GHZA 1O37A 4Y11E 3RUOA 4MNXA 1C5UA 3RXPA 1GJ4H 4MLFB 3MWIU 2VIQA 1NESE 1YP9A 4Y0ZE 1D3DB 2P3UB 3GISB 4Y8YA 1GDQA 1ACBE 2RA0A 1AI8H 2Q6DA 4AFUA 4AORA 5EU8A 1RJXB 1NRNH 2P3TB 2J94A 1K9OE 2BM2A 2WPIS 1UTNA 4X1PU 3ZV9A 3OY5U 1NM6A 5C20A 1FI8A 1CT4E 1V2MT 2BD5A 3F1SB 1SGTA 4I8JA 2A7CA 2HRVA 4TPYA 1O3CA 2A4QA 4Q7ZA 3P8NA 1L4DA 1ELTA 3Q76A 3SGAE 1D9IA 1KY9A 2W7SA 1XMNB 3T29A 1ESBA 1FY3A 1TAWA 2PR3A 1GHAF 1GI8B 6CHAC 2NU3E 1AHTH 1O2GH 1P2KA 4INKA 1HAPH 2CV3A 3ZYDA 1K1LA 2ZF0H 2F91A 2BLOA 4IS5A 1TQ7B 1MBQA 1WCZA 1OWEA 1KTSB 2JETC 4INLA 1GBDA 4ISOA 1EZQA 2BX3A 4Y7BA 3HGNA 4NSYA 3ELAH 4IN1A 1NRQH 1GJ7B 1O2IA 1QTFA 5EQRA 3QTVH 3SV8A 5AFZH 3LOXA 1KTTB 1TNJA 3GDUA 1MQ6A 1O3EA 3NKKA 4NZQA 3SNCA 1QB6A 1L1NA 2ILNA 3SQHE 3S9AA 2BTCE 3BTDE 1MTWA 5A0BA 1SB1H 2M5TA 1HJAC 4JMYA 1A3EH 4JZIA 1O2QA 2H9EH 2QF0A 1D6RA 1P2MA 2RCEA 2ZFSA 1GJCB 2PV9B 1HDTH 3BEFB 3T27A 1TBZH 4AFSA 1HNEE 1O2NA 2J2UA 1P2JA 1UCYK 3UUZA 1HYLA 1Y5AT 3PMBB 1VR1H 3ZZ4A 7KMEH 1F92A 2FOBA 2AIPA 1ZHPA 2VWMA 4ABDA 4ZMAH 1IHSH 2FOMB 1YPKH 4IMZA 1SLVB 4X6NA 1N8OC 1YLDA 1GI1A 5DP4A 2NU1E 1N6YA 3SUFA 4FUDA 4GCHF 2BZ6H 2Y80A 1YPJH 3DD2H 1IQIA 1TPAE 1BBRH 2EI7A 3SU4A 3MH5A 5C1YA 3QGNB 4ABAA 5GJ4B 2ZEBA 1UTKA 1O5CB 1DWBH 1IQKA 2VIOA 4DURA 3PLKA 1B0FA 2XRCA 3CP7A 1E38B 4I32A 2OXSA 1K2I1 3VB6A 3MI4A 1NTPA 1DM4B 2A4OA 4KGAA 4K8BA 1GI9B 4YOGA 2P59A 1CA0C 4OM9A 1DXWA 3BF6H 1DLKB 1GJ5H 3P8OA 1UK4A 4X8UH 4YT6H 4I7YH 5T6DA 1ZOMA 2W7UA 2ZIQH 1MKWK 2ANYA 3GY2A 2G5VA 4DCDA 1HAZB 2Y5GA 4B2BA 1EPTC 1IQNA 4TWWA 4X8SH 4Y71A 4DJZB 3ZZ8A 2XNIA 2OC7A 4DIHH 4FUHA 1WSSH 5DP8A 1AWHB 3M7TA 1TYNA 3E16B 2PUXB 2VGCC 1Z6JH 2JKHA 5GNDA 4FXGH 6CHAB 1L0ZA 2GCHF 2BD7A 1RXPA 1TX6A 4BAQB 1C1VH 4DOQA 3SNBA 1IQHA 1KYNA 3F68H 1BMNH 1O2ZA 5J4QA 4THNH 1BHXF 3AK5A 2JETB 3I29A 4AOQA 2I6QA 3SYJA 1TGCA 3M37A 1HV7A 4HTCH 3TGIE 1TPPA 3QDZB 1HAYB 1V2KT 4J2YB 1SGFA 1RFNA 1O2UA 1G3DA 3SJKA 3SU6A 1JWTA 1AN1E 2ZU2A 1LHCH 3T26A 1Q31A 2HPPH 1C1TA 2ZCHP 2Z3DA 5EPYA 3LJOA 1FQ3A 4I8HA 3ESTA 1HJAB 3LH3A 5L2ZH 1BMMH 2V3OH 1DX5M 1QQ4A 2BY5X 1A7SA 3PROA 1TPSA 1ID5H 4D9QA 1OS8A 1DLEA 1S82A 1NRRH 4FU9A 1YPLH 5AFYH 1GBAA 2A0QB 3V3MA 1GMCG 4AN7A 3I77A 2F4LA 3E3TA 1D6WA 1C2GA 1V3XA 4WY3A 3GCNA 1UHBB 5JBBS 2TGTA 1LTOA 1MZDA 2GZ7A 1PJPA 1AQ7A 4D9RA 3TK6A 4MVNA 1V2RT 1DS2E 1FY8E 4AB9A 3TGKE 3GYLB 2BOKA 2GV6A 1N8OB 2ZO3H 4MPUA 2PSYA 3DUXH 3OSYA 1CGHA 3VEQB 5A2MH 1XVOA 1EOLA 4B6EA 4BXWA 5K0HA 2VINA 1W10U 3A80A 1FN8A 1E36B 3S69A 1P01A 4MQAA 1W13U 1CVWH 4WXIA 1GI6A 3BIVH 5A09A 1T31A 1DWDH 2SGPE 4H6TA 2Z9GA 1BTPA 2THFB 3ZZ5A 3ZZCA 2BD2A 1G3CA 3S7KB 3GDVA 1TFXA 4H4FA 3SORA 1EZXC 1YCPK 1Q2WA 4B75A 1OSSA 3A7TA 1P3CA 1ANBA 1GVLA 2PGQB 4RN6A 1QRZA 4K1SA 1BTZA 3NUMA 3OU0A 3B23B 4E05H 4WH8A 2QA9E 3QN7A 2C8YB 2XC0A 3A8BA 4KELA 1EPTB 3LGVA 3MU4A 1LHEH 2O8TA 1XM1A 4NG9H 1JIMA 4JZFH 2OBOA 5ESBA 1CBWC 4O3UA 5HXFA 1QIXB 3MNBA 2CMYA 3V12A 5L30H 2XYAA 3Q3KA 1UVTH 2C93B 2WPMS 5T6FA 2B0FA 2VGCB 3U8TH 1BMLA 4CREA 3ZVDA 3RXOA 2P16A 2OCVB 1O2LA 4A92A 1A46H 2F9VA 5CE1A 1HB0B 3PV4A 1S83A 3SV2H 4H42U 5FAHA 2SGDE 4GUXA 1SPJA 4D7FA 1P2IA 1VGCC 3EQ0H 5AF9H 1MD7A 1Z1JA 2ODQA 2ZU5A 3UQOA 1EAIA 2DE9A 2Z9LA 1FONA 2B9LA 3VPKA 5DP3A 1ZGVA 1XKAC 2ZNKH 2UUYA 2AGGX 4AX9H 1C1RA 3PMHB 1C2EA 1QB1A 3F6UH 5DP5A 1A4WH 2VB0A 4XDEA 3PMJA 1ANCA 2QXIA 1O3AA 1SVPA 2PKAB 1O30A 5FHTA 2C3SA 1MH0A 3UY9A 1AE5A 2OD3B 2RG3A 1THRH 2XTTB 1GHAG 2FWWA 2ZTZA 4XBDA 1ZMNA 1DFPA 1A2CH 4ISLA 2R2WU 3NWUA 4E7NA 4OGYA 1QURH 1DXPA 1C4Y2 1IQJA 1GI2A 4AZ2B 2LPRA 1K1OA 1HCGA 1QCPA 1XUFA 1P02A 1SGYE 3KQCA 3ZZAA 3ATWA 3FZDA 1G9IE 2WYGA 1V2PT 3M7UA 2ZHEH 1MUEB 2RDLA 3TH4H 1T32A 1UJ1A 1AWFH 1CT0E 4GLYA 4YESB 4AGJA 5E8EH 1GL0E 1F7ZA 4AGKA 1RTKA 3MFJA 4ISNA 1P05A 2H6MA 2VVCA 2ZGCA 5G4BA 3GY7A 2HNTF 1HAVB 3SV7A 1NZQH 2QAAA 1O3GA 3EE0B 3A8DA 4FVDA 2BXTH 1EP5A 5DP7A 4DGJA 3OX7U 1H9HE 2Y81A 1Y3VA 3LDXH 1DE7H 5K7RA 2FS9A 1QA7A 1B7XB 2QY0B 1EXFA 1GI0A 1HIAB 2Z9JA 2C8WB 1ZTKA 2BLVA 2JH5D 2G4UA 2ZHFH 1QY6A 4F4OC 1P04A 2F9NA 2Z3CA 4WMFA 1MZAA 4CBNA 1A0HB 3BG4C 3PV5A 1UK3A 3TJNA 1FV9A 4QT8C 4U30A 3D49H 1O5EH 3SI4H 2XBWA 1RRKA 1UVOA 3U1JB 1A0JA 1CBWB 3MO3A 1A0LA 5JBAS 1TWXB 4JZEH 1SL3A 1ZPCA 4ABIA 1WQVH 1GBIA 1HFDA 1TNHA 2FZZA 1L1GA 1H8IH 3ZV8A 1O5GH 3M5LA 5GCHF 2A5AA 4MPVA 1CHGA 3LJJA 1O2MA 1GWAA 3TJVA 1BTYA 3FP6E 1F0SA 1THPB 3GY4A 1QFKH 1C1WH 1C4U2 1ELDE 1DPOA 1MKXK 1EPTA 4JK5A 3M3VA 1VGCB 2ZQ1A 2P8OB 3K6ZA 1AZ8A 1TONA 4AFZA 1HJ8A 1SQOA 1KXCA 1UCYH 1TA2A 4YO9A 2VIVA 1MCVA 1GHWH 3E91A 2AYWA 1Y3YA 3O8CA 1O2HA 2ZQ2A 1NN6A 8ESTE 1GHYH 2BD3A 4BOHA 1Y3UA 2PFEA 3GYMA 3B8JA 1TNKA 4KTUA 4Z6AH 4YZUA 1NFWA 1XXDA 2OBQA 9LPRA 2F9UA 3F9GA 3SU1A 2GCHG 3SJIA 3PMAB 1FY5A 4YLQH 1P09A 3RM2H 3M5MA 1T7CA 3P6ZB 3FP7E 2BDIA 2B5TB 2W3IA 2BY9X 3NK8A 1V2NT 3L33A 4NIYA 1DANH 2A4GA 3UIRA 1K22H 1GDNA 1C9PA 4JZDH 3BEUA 4UD9H 1J14A 1OP2A 2FI4E 1BTHH 1TB6H 2DE8A 1G2LA 1MKWH 1V2QT 3W95A 2W5EA 1ELFA 1HJ9A 2WPLS 4YOIA 3F9FA 1FY4A 1ETSH 3VB3A 3EAJA 5PTPA 4XOJA 3BTME 1EB2A 1B0EA 1BIOA 2C8ZB 2V0BA 1SHHB 1C4V2 1JIRA 2BOHB 4NCYA 1C2DA 1LVBA 2SGEE 1SGFG 3KCGH 1PPFE 1QBVH 1GPZA 3KN2A 3PLBA 1Z8RA 3H5CB 4WXVA 5BRRE 1CGJE 1AU8A 4JYVH 3QX5H 1C5WB 2VIWA 3SU0A 5ABWA 1V2JT 3S9CA 2UWLA 1HAVA 3BG4B 1O3HA 2GV7A 1GBKA 4TYDA 3W94A 4MTBA 1SGCA 2Y7XA 1YKTA 1HUTH 1ARBA 3GY8A 3ZZBA 1WOFA 9ESTA 1AB9C 4Y8ZA 4FUFA 3A8CA 3RXMA 4MNVA 1GBJA 1SLWB 1X7AC 1EASA 1IHTH 2SGQE 2QXHA 5ESTE 4A5TS 1UCYE 2Z3EA 2XW9A 1GHVH 4NWKA 1O3IA 2XCNA 1DSUA 3BTKE 2XC5A 2ZZUH 2TGPZ 1MU8B 4FUCA 1GBLA 3M36A 5EGMA 3C27B 2FI5E 3SUDA 4LXBH 1F2SE 1TNIA 5GXPA 1C1PA 3A7VA 5BPEA 2SFAA 1ABIH 3SN8A 3VB7A 3CS0A 5E0JA 3SJ8A 2ZFPH 1IQMA 1DWEH 2A2QH 2WYJA 5EW1H 4NZLA 1FXYA 1QB9A 5F8TA 2ZFTA 2FODA 4CHAB 4ABGA 3KGPA 1BZXE 1OWHA 3LIWA 4SGBE 1EJAA 2GP9B 3A8AA 4UONA 4BAMB 1RTFB 1Z8GA 1ZSKA 5A8YA 3MNXA 2Q6GA 1YCPH 5JBCS 1UVUH 1DOJA 2ZFFH 4D8NA 4CRAA 4A7IB 1QJ1B 4AG2A 1MQ5A 2XC4A 3MH4A 1SMFE 3MU1A 1Y5UT 3ZZ6A 5HGGA 1SR5C 1OX1A 3P95A 2BD9A 1P3EA 1F0UA 1UMAH 1DDJA 1BJUA 2ZFQH 2OC8A 1F0RA 1NFUA 1QQUA 3B9FH 4FUBA 4WJG2 2GT7A 1ELBA 1P9SA 3MMGA 1LMWB 1S85A 1GHXH 2O8MA 3MU5A 2ALPA 5EW2H 1V6DA 2JH6D 3STIA 2FYRA 3SI3H 2HALA 4A6LA 3URCA 5DKMA 3I78A 2P95A 4WWYA 1TMUH 3M5NA 1OYTH 3DHKH 5GWZA 1ZPBA 2PSXA 1Z1IA 5F8XA 1V2ST 3SBKA 4J1YA 4CR5A 1SFIA 1W0YH 2FOHA 1HLTH 2H2ZA 4CRBA 4ABHA 2B7DH 4BTUB 1HRTH 1TQ0B 1AB9B 3MU8A 1P06A 4HGCA 1AUJA 2ZFRH 3LGIA 2NU4E 1J17T 2WV9A 1O2PA 4TWYA 2A7JA 1TA6A 1GBEA 1HAXB 1SSXA 2Y6TA 3LC5A 2UUFB 4FUJA 2EI8A 1QJ6B 4KTSA 1O3OA 1GBHA 5FPYA 1UTJA 2C8XB 1IOEA 2GCTC 3RP2A 4AYYB 3PB1E 1OKXA 4I33A 4IN2A 5TCAA 1PPHE 1KDQB 1P2NA 2Y5FA 1OP0A 1TE0A 1TABE 2BXUH 1ETRH 5AHGH 4ASHA 1Z6EA 4MPWA 1C5NH 1ESTA 1Q3XA 2BDBA 4I8LA 1PYTD 5FXLA 4Y7AA 4F49A 1SBWA 1IQLA 1F5LA 3SZEA 3VXEH 2CHAC 2BQ6B 3QZRA 1KLTA 1C1UH 3EYDA 4UEHH 3RXEA 1GDUA 2A5KA 1SGEE 3HKIB 3DFJA 1G2MA 1O36A 2J4IA 3VGCC 2OLGA 2XBYA 1BCUH 1JMOH 2TGDA 3SHCH 5GCHG 3ZZ3A 2O8LA 3GCOA 3A86A 1ELVA 3KNXA 4ABJA 8GCHF 1UVSH 1RS0A 1O0DH 1HXEH 4IMQA 1DSTA 2PTCE 1BRCE 1ZPZA 4OS2A 1SGNE 2BZAA 3MHWU 1OWJA 2BY7X 1OYQA 5EODA 2HLCA 5F8ZA 1TX8A 5L6NH 3URDA 1DITH 4IBLH 1ZLRA 1P8VC 1ZJDA 2F9BH 2FOAA 5CHAC 3SNEA 2WZQA 5I25A 2OK5A 4K5ZA 2SNVA 2VVUA 1UVPA 2GT8A 2CF9H 5FBIA 3D62A 1T4UH 3TNTA 5T1VA 2ASUB 2VU8E 2OTVA 4GPGA 1ELEE 1O33A 4CR9A 4HZHA 4A1VA 4CRFA 4IW4E 1MKXH 2V6NA 1A1RA 3SV6A 2VWOA 3EA7A 2PW8H 2RA3A 3UFAA 2GKVE 1P11E 3PYHA 3L3TA 2FM2A 3PTNA 1PPCE 1XKBC 1O3KA 1TBQH 4XBBA 4BNRA 4B71A 4B76A 5LPRA 1GMDF 3A84A 5A0AE 5E0GA 5C5OA 1O32A 4TY7A 4KP0A 1SQTA 4YT7H 2O9QA 3KQDA 2FTMA 3RMLH 2J34A 1UTQA 3QGJA 2J9NA 1P9UA 2GCTB 1P2QA 2ZGBH 2QV1A 3VXFH 2ZDVH 5HM2A 3E8LA 2KAIB 3H7OA 1BTXA 1G36A 1TRNA 5EXMA 2ZDAH 3SHAH 1CA0B 3MH6A 3RXIA 2FO9A 1O2VA 4NFFA 3SUEA 5C5NA 4K60A 3M7QA 2FP7B 2Z94A 1AVXA 3GCTF 3M35A 2ODYB 3RXLA 1LVOA 3V0XA 4BTTB 2CHAB 1AVWA 1GJ9B 1EX3A 2D26C 2UWOA 3RXQA 1EZUC 3S0NA 1C5LH 5EXNA 1XUHA 1XUGA 3SNDA 3VGCB 1H1BA 2XWBI 2H1UA 4KTCA 2GD4B 4MNWA 4CBOA 2XBVA 1O31A 3AAUA 3BTHE 3QTOH 4JZ1A 4MDSA 2BHGA 2W26A 3UWIA 2WV5A 1J9CH 4DT7B 1LPZB 3OTPA 1CSOE 3SOSA 3SGQE 3NZIA 4DY7B 2CGAA 1JBUH 1S81A 2ZCLP 1IQGA 3RU4T 1QHRB 2QGRA 5C1UA 5F03A 2G00A 4CRDA 1FAXA 2ZA5A 5CHAB 2ZU4A 3SO3A 4YOJA 3GDSA 1NC6A 1GBCA 1SC8U 1YPMH 2PKSC 1LPKB 4Y0YE 1VCPA 1C1OA 4Q7XA 3SGBE 3SZNA 1O38A 1O3DA 4X1QU 3RLWH 3RU4E 1QBNA 1XXFA 1NRPH 2NU2E 1V2TT 2P94A 3TPIZ 5H4IB 4BAOB 1TIOA 4RI0A 1O3FA 2XCFA 4ZKOU 1HAOH 1T8NA 3U1IB 3E6PH 1O3MA 2C90B 2AEIH 5DJ7A 3RMNH 2ZHDA 1KLJH 3EA8A 2ZDMA 1ABJH 3TIUA 5FX6A 1J8AA 1TMTH 4K1EA 3UREA 6ESTA 3IG6B 1GG6C 1EAXA 2BVRH 1BOQA 5C3NA 2ZU1A 4Z0KA 1UHBA 1AKSB 3ZVBA 1GJAB 3A81A 1W11U 3PM3A 5F6MA 2FEQH 4DW2U 2BY6X 1NY22 1OPHB 1YLCA 1UTOA 1ELCA 2TIOA 1ZMJA 2BLWA 2OP9A 3MH7A 4I8KA 3SJOA 4XFQA 4O3TA 1U6QA 2NWNA 1LO6A 4GHQA 5DG6A 4FU8A 3AASA 4NIVA 1BITA 1C5TA 1WBGB 3KQEA 3HK6B 1TPOA 2IN2A 1ELGA 4AB8A 1W8BH 2FTLE 1QRXA 4ABBA 2BMGB 3CENA 4WVPE 2AFQB 3E0NB 4HFPB 1VITF 2GZ8A 1WQSA 1GCTC 2AIQA 2ZGHA 3RXJA 3T62A 3RXKA 1UK2A 2BDAA 2HOBA 2JH0D 4PROA 2D1JA 3RC6A 3RXRA 2VIDA 1QL7A 5DPAA 2G52A 1C5YB 2H5DA 1D3PB 1KXAA 2UWPA 1SGPE 2AS9A 4M9FA 1O2WA 3HGPA 2Y82A 1MTNC 2QC2A 2ZPQA 3T25A 4LZ4B 2V35A 1LKBA 3V7TA 2Q6FA 1HXFH 1BB0B 4OS6A 2ZPSA 3QLPH 2AMPA 2O8WA 1W14U 2FYQA 4MNYA 3TH2H 5C67A 4X0WU 5FCKA 1S5SA 2J95A 2IOTA 2XXLA 3KF2A 5E0HA 2BX4A 1D4PB 3KQBA 1LHGH 1GI7B 2SNWA 1ZRKA 2HPQH 3UOPA 1MTVA 7ESTE 4R0IA 2BQWB 1EAUA 3O8BA 4JYUH 4Y10E 1XVMA 2F9PA 2R0LA 4BAKB 1IQFA 2ZP0H 2IJOB 1LKAA 1SOZA 2FESH 3RXVA 3PLPA 2PKSB 1H9IE 3RXBA 1C2JA 1OOKB 1SFQB 2ANKH 1ESAA 1WTHD 1V2UT 1A5GH 1C2HA 1Y3WA 3UPEA 4RKJB 1O34A 3ZZDA 1YM0A 4D7GA 2AMDA 4BTIB 5GIBA 2BB4A 4HI3A 1DY9A 1FIWA 4E7RG 7GCHF 8GCHG 3M5OA 3ZVEA 1O35A 3PTBA 3LGUA 3TK9A 1QL9A 1SHYA 3ZZ7A 1ZYOA 1F5RA 3BTWE 2PKAA 1W7XH 4ZROA 1QJ7B 2STBE 4OGXA 1MTSA 4ZXXH 1ZTLA 1YPEH 1WXRA 1Z8JB 3TH3H 2Z9KA 4UDWH 1O2OA 5LPFA 1PQ7A 3K2UA 4GHTA 3O8DA 1HBTH 1E34B 1KIGH 1EZSC 2VH6A 1BT7A 1GG6B 4Q80A 2XWAA 3LGTA 1QNJA 4NIWA 5FX5A 2TRMA 3LH1A 2G8TA 1C5SA 2UUJB 1ZHRA 1JOUB 3UNQA 3SV9A 1XX9A 2WUBA 1HPGA 3S7HB 4TPIZ 1C9TA 2CJIA 5J4SA 4WH6A 4Q2KA 4XE4A 2A4RA 5B6OA 4GVUA 1MAYA 4RSPA 1O5BB 2F9OA 1P10A 1YPHE 2AMQA 4X1RU 1FZZA 1EOJA 2BQ7B 2P3FH 1GHBF 1ZZZA 4Y76A 3GICB 1C5RA 1H9LB 3GY6A 4CRCA 1C2MA 2ZDKA 2G81E 5IDKA 1GCTB 4WF8A 5LPEA 1AKSA 2GVFA 1CA8B 2BLQA 5JDUB 4M7GA 1YPHC 3HK3B 1V2VT 2FI3E 3MU0A 3Q00A 5DP6A 1GMDG 1HIAA 1MMJN 3Q77A 1INCA 1KXDA 2WUCA 4FUGA 4NFEA 2ZHWH 1MTNB 3MYWA 1VJAU 3A89A 2J92A 3VB4A 5E2PA 3K9XB 1P57B 3A7WA 3SU2A 1C1NA 3U8OH 2FOEA 2FOFA 1GMHG 1MBMA 1YF4A 1B5GH 3P17H 1CU1A 1H8DH 5AVDA 3T2NA 1BHXB 5LH8A 2BDGA 3NXPA 1SGDE 2ODPA 2ZDNA 1GVKB 1EUFA 1SI5H 1YCPM 5C2ZA 2CN0H 2ZC9H 4JYTA 3GCTG 1NT1A 2ZTYA 4ZKSU 4U01A 4B6FA 3GY3A 2ULLA 3AW1A 1MTUA 1HGTH 3RMOH 1FIZA 2IJD1 1PPBH 3TGJE 5FPTA 1V2OT 1D3QB 3PWBA 2UUKB 1W7GH 3BN9A 3TU7H 3UTUH 1OWDA 2ALVA 2OC1A 3TJUA 1FMGA 3UQVA 1MU6B 2FOGA 5T6GA 1C1SA 1OWIA 3BTTE 2VBCA 1NRSH 1K28D 5B6LA 1ZTJA 3LU9B 1C5VA 4NIXA 3U8RH 1RGQA 5JPMH 4X6PA 3SU3A 2ANMH 4NA7A 2FIRH 4UE7H 4YM9A 1NU9A 4JK6A 1BRAA 3H7TA 3AVZA 1PPZA 2HNTE 3QUMP 1GCDA 3LKWA 3BG8A 1BTUA 1A61H 1GGDC 4OS4A 1UTPA 2R9PA 2DUCA 1LDTT 3RC4A 3UR6A 2LNCA 1Z7KA 3BTQE 1UTMA 1EJNA 2HNTC 1HAHH 2TGAA 4MPXA 2EEKA 1AGJA 1C5ZB 3SU5A 3Q3YA 3BSQA 2A2XH 1TGSZ 1VJ9U 3A7ZA 3D23A 4CH8B 3NCLA 3HKJB 1EJMA 1T8OA 2AGEX 4B2AA 5CMXH 3ZYEA 3QZQA 4VGCC 1TALA 1PQAA 1NS3A 4NA8A 3L6PA 4FUIA 2Q1JA 3R0FA 2VWNA 3LPRA 3SNAA 3ZZ9A 1WU1A 3MOCA 4Y6DA 3UNRA 3KIDU 1F5KU 3MO6A 3P8FA 1GJ8B 2GX4A 1CGIE 3ZVFA 1O39A 1BQYA 1VCWA 2FDAA 2VJ1A 1YGCH 4IGDA 4Y8XA 1O5AB 1AO5A 4Y79A 1TGTA 2QN5T 4OS7A 1NO9H 3HPTB 2VWLA 4Q7YA 3ITIA 5TCCA 1GBMA 1SLXB 2QYIA 1P0SH 1P2OA 4U32A 4LZ1H 3TK5A 1N6XA 1SGIB 1GBFA 1O2XA 2ZU3A 5HYOA 2Z7FE 5HM9A 1S0RA 1TGNA 3GOVB
chains in the Genus database with same CATH superfamily
4X2VA 1S0QA 1TNLA 2OC0A 3TVJB 3TJOA 1Z71A 4O03A 2FLRH 1SGQE 2OUAA 3BTFE 1XUIA 2BVSH 1S6FA 1TRYA 3OE7D 3O8RA 1VITG 1O2RA 2G55A 3ATMA 4LOYH 1ZSLA 1G3EA 1P03A 3A7YA 2WHXA 1PYTC 3VFEA 3S9BA 3RDZA 1BDAA 1CQQA 2EC9H 5A8ZA 1AIXH 1LHDH 1DUAA 3MNCA 2AERH 1MCTA 4IC5A 3SJ9A 3M61U 1K21H 1K1PA 3EA9A 2PTNA 4GSOA 3IWMA 3QK1A 3VB5A 1NBMD 3CS7A 3KEEA 4YLUA 5EOKA 1PPEE 5DK1A 5JB8S 5SGAE 1DY8A 1W12U 2WPJS 1S84A 2L6OA 1LVYA 1NPMA 4K69A 1FY1A 1BRUP 1PQ5A 3ODDA 1UTLM 1TMBH 3FFGA 1IAUA 3D65E 3P92A 2BVXH 1JXPA 2STAE 1Y5BT 3RXSA 4SGAE 1NU7B 1GJDB 1J15A 1WUNH 1W3CA 4FU7A 3OYPA 1H4WA 2WPKS 3T5FH 1ZGIA 8KME2 2A5IA 1G32B 1C2KA 4LK4A 1GGDB 2HGTH 1E0FD 4A1XA 2ZHQH 1L1JA 4A1TA 3R3GB 1GBTA 3JZ2B 5EPNA 3AW0A 4ZAEA 3SW2B 1FPCH 4X1NU 2QCYA 1CHOG 1FJSA 3A88A 4UFGH 1ZMLA 3TLOA 3QO6A 4KKDA 4IC6A 4X6MA 2ZI2H 3BIUH 2WPDD 7GCHG 1QRWA 2ANWA 3KQ5A 4NA9H 2WINI 3LT3A 4VGCB 2VIPA 1AFQC 4H6SB 2TBSA 2KX4A 3HATH 1O3JA 1EAWA 5HIYA 1DWCH 1TOCB 2QIQA 3OY6U 5EQQA 4WMDA 5HMAA 3ATLA 5IYTA 3OTJE 1JRTA 2F3CE 4I31A 4X2YA 4OS1A 1BBRE 1ARCA 1KXBA 1V2LT 1S6HA 2ZG0H 4X2XA 4NGAH 1PFXC 2PLXA 5EJZA 2ZDLA 1E1QD 2TPIZ 2BD4A 1O2JA 5JB9S 3K6YA 3T28A 1WAYB 4YXWD 1ANDA 1CE5A 1KXFA 3A82A 1EP6A 1GMHF 1AUTC 1V2WT 1AVGH 5DGJA 2BDHA 1OHHD 1BJVA 1FDPA 2WV4A 4K1TA 2A32A 1SQAA 4ZH8A 1ZR0A 1K1IA 2ZPRA 3EDXB 1K1NA 1T8MA 1BTWA 1GHBG 1ZRBA 2QXJA 2AH4X 3ZVGA 2P93A 3P70B 5I46H 3GCHC 3F9HA 2V3HH 3V13A 1ORFA 1TOMH 3RXHA 1VZQH 3FAOA 2Y7ZA 3N7OA 1Y59T 1E37B 5A8XA 5GDSH 1KDQA 1C5OH 1DICA 1FN6A 2H9TH 4K3JA 5EQSA 3ZVCA 1O2TA 1O3LA 2HWLB 2PGBB 1ETTH 6GCHG 1A5HA 1YC0A 5FPSA 1VCQA 1C5XB 1AE8H 1A5IA 2W6JD 2ESTE 2WPHS 3FP8E 4ABEA 2OQ5A 3H09A 2C4FH 1DVAH 3UNSA 2ZKSA 3NPSA 2FMJA 5ETXA 3GS9A 5LGOA 3TITA 3RXAA 1RD3B 1Y3XA 3RXGA 1G37A 3FVFB 1O2SA 2P8OC 4ACBA 1LQDB 3WY8A 3MTYA 1LPGB 2OQUA 4X8VH 3F9EA 1DT2A 2XBXA 6LPRA 1KMHB 1E35B 1MAXA 1THSH 1RIWC 4JCNA 1O2YA 2PUQH 3RXUA 3C1KA 4CRGA 1GVZA 1GI5A 3A87A 4K2YA 2CXVA 1BBRK 5E2OA 2OINA 2JJ1D 3PO1C 1GBBA 4CH2B 3AAVA 3U9AH 4UFEH 1T8LA 3DA9B 4O97A 3JZ1B 2IPHA 1YPGH 3BV9B 1C2IA 1AFQB 1K1JA 1L4ZA 3BTEE 3GY5A 3E0PB 1AMHA 2EI6A 2XNDD 1O5DH 3MNSA 3MO9A 3UB0A 3RU4D 1J16A 1BUIA 1GJ6A 3UR9A 1CO7E 1GI4A 1DUEA 4ZKNU 2R3UA 1H8HD 4X8TH 1YBWA 2K0QA 3RXFA 1O3PB 3KL6A 2LELA 1W2KH 1C2LA 3E90B 1SG8B 4ABFA 2ZECA 1LQEA 1YY3A 4UFFH 4E06H 3ATIA 2L74A 4O9VA 4ZKRU 1LCYA 4B74A 2FS8A 2BDCA 1FNIA 3DT0H 3DFLA 1PPGE 4AFQA 2QF3A 2O8UA 2Y5HA 3ODFA 4TY6A 3LONA 1OWKA 2ZGXH 3RM0H 2PHBA 2HVXA 4XSKU 2QXGA 2GGVB 4FVBA 5L2YH 1OXGA 4RT0A 5JYIA 3FZZA 4X2WA 4I8GA 4BXSA 2GDDA 3IITA 3GCHB 2VH0A 3U98H 1Z8IB 1L2EA 2FX6A 1FLEE 1JRSA 2D8WA 5EXLA 2SGFE 1QL8A 1P12E 2YNAA 4ISIH 4YTAA 2R0KA 1ZSJA 2ZCKP 1KXEA 2A45B 1C5PA 2KAIA 1TRMA 3A85A 4B73A 4WMEA 2YNBA 3UOUA 2G51A 2GMTC 4R8TB 2H9HA 1O2KA 1TBRH 4GAWA 4RKOB 1EKBB 1QGFA 4GCHG 4INHA 4BANB 1HAGE 2BYAX 3RLYH 4MG3A 3TNSA 5EG4A 2JIZD 2VVVA 2FX4A 1SGRE 4X1SU 2FLBH 2FOCA 2FXRA 2I6SA 3K65B 4ZHMU 3A7XA 2ZGJA 2F83A 2H5CA 1T4VH 2A31A 3BTGE 3BEIB 3RXCA 1BA8B 2FPZA 3LC3A 3M3SA 3CNRA 1M9UA 1WYKA 2GZ9A 4NWLA 1MD8A 2NU0E 1CT2E 4OS5A 1RIWB 1CHOF 4ZXYH 1N1LA 2K1QA 5C1XA 1K1MA 1BMAA 2J38A 3Q3XA 4FUEA 3RXDA 1EB1H 1KSNA 4ZUHA 4ZHLU 5A0CA 1SOTA 4XBCA 3ENSB 4BAHB 4DIIH 3FANA 1TX7A 7LPRA 1LVMA 1FAKH 3QWCH 3PO1B 1GL1A 1NFXA 2R2MB 5T3HA 2AGIX 5HIZA 4ZHAA 5TJXA 2A7HA 1W0ZU 1XUJA 5DO4H 1A3BH 1QA0A 4CHAC 2BD8A 3KHVA 1C2FA 1WTGH 1TGBA 1ELAA 1GI3A 3STJA 1GMCF 3E1XB 3ZVAA 2ZTXA 4ESTE 1RTLA 8LPRA 1QR3E 3A83A 2Z6BD 3ATKA 2W3KA 5GPIB 1C1MA 2EA3A 4B1TA 1ZHMA 1BRBE 3LGWA 1G3BA 1AZZA 1ANEA 2CF8H 4AYVB 1K0HA 1AY6H 1FUJA 1SLUB 5EJ1A 3PWCA 1C5MD 1TNGA 4UFDH 1F0TA 5JBTA 1UO6A 1QBOA 1AFEH 3WWBA 1HAIH 2YOLA 2BY8X 3P8GA 1LHFH 1OP8A 1IQEA 1XUKA 3M3TA 2G4TA 1WV7H 2PWXA 4D76A 4DVAU 1O3BA 3G01A 2A1DB 3UWJH 4ISHH 5DP9A 4U2WA 4NSVA 1G30B 1GJBB 1ZJKA 2BDYA 4F55A 5KGOA 3EGKH 1KLIH 5FBEA 4ACAA 1PQ8A 2G5NA 1AD8H 3SUGA 1EATA 1C5QA 2R3YA 3LGYA 1O3NA 3RC5A 2SGAA 4X6OA 2ZWLH 1Y8TA 4K8YA 2GDEH 3SQEE 1C1QA 2Z9IA 3EE7A 2VNTA 1EQ9A 2D2DA 2LP6A 1YYY1 4AG1A 4B2CA 1NROH 3RXTA 1D3TB 3RMMH 1TLDA 3U69H 3PV2A 2GTBA 4DG4A 1VITH 1WDIA 1NFYA 6GCHF 2GMTB 1FPHH 1O5FH 5FCRA 2B8OH 2RDEA 1GHZA 1O37A 4Y11E 3RUOA 4MNXA 1C5UA 2IPQX 3RXPA 1GJ4H 4MLFB 3MWIU 2VIQA 1NESE 1YP9A 4Y0ZE 1D3DB 2P3UB 3GISB 4Y8YA 1GDQA 1ACBE 2RA0A 1AI8H 2Q6DA 4AFUA 4AORA 5EU8A 1RJXB 1NRNH 2P3TB 5C0UA 2J94A 1K9OE 2BM2A 2WPIS 1UTNA 4X1PU 3ZV9A 3OY5U 1NM6A 5C20A 1FI8A 1CT4E 1V2MT 2BD5A 3F1SB 1SGTA 4I8JA 2A7CA 2HRVA 4TPYA 1O3CA 2A4QA 4Q7ZA 3P8NA 1L4DA 1ELTA 3Q76A 3SGAE 1D9IA 1KY9A 2W7SA 1XMNB 3T29A 1ESBA 1FY3A 1TAWA 5IK2D 2PR3A 1GHAF 1GI8B 6CHAC 2NU3E 1AHTH 1O2GH 1P2KA 4INKA 1HAPH 2CV3A 3ZYDA 1K1LA 2ZF0H 2J98B 2F91A 2BLOA 4IS5A 1TQ7B 1MBQA 1WCZA 1OWEA 1KTSB 2JETC 4INLA 3MQKC 1GBDA 4ISOA 1EZQA 2BX3A 4Y7BA 3HGNA 4NSYA 3ELAH 4IN1A 1NRQH 1GJ7B 1O2IA 1QTFA 5EQRA 3QTVH 3SV8A 5AFZH 3LOXA 1KTTB 1TNJA 3GDUA 1FX0B 1MQ6A 1O3EA 3NKKA 4NZQA 3SNCA 1QB6A 1L1NA 2ILNA 3SQHE 3S9AA 2BTCE 3BTDE 1MTWA 5A0BA 1SB1H 2M5TA 1HJAC 4JMYA 1A3EH 4JZIA 1O2QA 2H9EH 2QF0A 1D6RA 1P2MA 2RCEA 2ZFSA 1GJCB 2PV9B 1HDTH 3BEFB 3T27A 1TBZH 4AFSA 1HNEE 1O2NA 2J2UA 1P2JA 1UCYK 3UUZA 1HYLA 1Y5AT 3PMBB 1VR1H 3ZZ4A 7KMEH 1F92A 2FOBA 5C94A 2AIPA 1ZHPA 2VWMA 4ABDA 4ZMAH 1IHSH 2FOMB 1YPKH 2GJGA 4IMZA 1SLVB 4X6NA 1N8OC 1YLDA 1GI1A 5DP4A 2NU1E 1N6YA 3SUFA 4FUDA 4GCHF 2BZ6H 2Y80A 1YPJH 3DD2H 1IQIA 1TPAE 3DSGA 1BBRH 2EI7A 3SU4A 2AHME 3MH5A 5C1YA 3QGNB 4ABAA 5GJ4B 2ZEBA 1UTKA 1O5CB 1DWBH 1IQKA 2VIOA 4DURA 3PLKA 1B0FA 2XRCA 3CP7A 1E38B 4I32A 2OXSA 1K2I1 3VB6A 3MI4A 1NTPA 1DM4B 2A4OA 4DT4A 4KGAA 4K8BA 1GI9B 4YOGA 2P59A 1CA0C 4OM9A 1DXWA 3BF6H 1DLKB 1GJ5H 3P8OA 1UK4A 4X8UH 4YT6H 4I7YH 3PRDA 5T6DA 1ZOMA 2W7UA 3ZIAD 2ZIQH 1MKWK 2ANYA 3GY2A 2G5VA 4DCDA 1HAZB 2Y5GA 4B2BA 1EPTC 1IQNA 2HVYB 4TWWA 4X8SH 4Y71A 4DJZB 3ZZ8A 2XNIA 2OC7A 4DIHH 4FUHA 1WSSH 5DP8A 1NBME 1QZ8A 1AWHB 3M7TA 1TYNA 3E16B 2PUXB 2VGCC 1Z6JH 2JKHA 5GNDA 4FXGH 6CHAB 1L0ZA 2GCHF 2BD7A 1RXPA 1TX6A 4BAQB 1C1VH 4DOQA 3SNBA 1IQHA 1KYNA 3F68H 1BMNH 1O2ZA 5J4QA 5KEDA 4THNH 1BHXF 3AK5A 2JETB 3I29A 4AOQA 2I6QA 3SYJA 3NRLA 1TGCA 3M37A 1HV7A 4HTCH 3TGIE 1TPPA 3QDZB 1HAYB 1V2KT 4J2YB 1SGFA 1RFNA 1O2UA 1G3DA 3F2GA 3SJKA 3SU6A 1JWTA 1AN1E 2ZU2A 1LHCH 3T26A 5CDFE 1Q31A 2HPPH 1C1TA 2ZCHP 2Z3DA 5EPYA 3LJOA 1FQ3A 4I8HA 3ESTA 1MABB 1HJAB 3LH3A 5L2ZH 1BMMH 2V3OH 1DX5M 1QQ4A 2BY5X 1A7SA 3PROA 1TPSA 1ID5H 4D9QA 1COWD 1OS8A 1DLEA 1S82A 4Q63A 2YMSC 1NRRH 4FU9A 1YPLH 5AFYH 1GBAA 2A0QB 3V3MA 1GMCG 4AN7A 2F4LA 3I77A 3E3TA 1D6WA 1C2GA 1V3XA 4WY3A 3GCNA 1UHBB 5JBBS 2TGTA 1LTOA 1MZDA 2GZ7A 4ZCNA 1PJPA 1AQ7A 4D9RA 3TK6A 4MVNA 1V2RT 1DS2E 1FY8E 4AB9A 3TGKE 3GYLB 2BOKA 2GV6A 1N8OB 1H8ED 2ZO3H 4MPUA 2PSYA 3DUXH 3OSYA 1CGHA 3VEQB 5A2MH 1XVOA 1EOLA 4B6EA 4BXWA 5K0HA 2VINA 1W10U 3A80A 1FN8A 1E36B 3S69A 1P01A 4MQAA 1W13U 1CVWH 4WXIA 1GI6A 3BIVH 5A09A 1T31A 1DWDH 2SGPE 4H6TA 2Z9GA 1BTPA 2THFB 3ZZ5A 3ZZCA 2BD2A 1G3CA 3S7KB 3GDVA 1TFXA 4H4FA 3SORA 1EZXC 1YCPK 1Q2WA 4B75A 5DN6D 1OSSA 3A7TA 1P3CA 1ANBA 1GVLA 2PGQB 4RN6A 2M2AA 1QRZA 4K1SA 1BTZA 3NUMA 3OU0A 3B23B 5CHBA 4E05H 4WH8A 4TSFD 2QA9E 3QN7A 2C8YB 2XC0A 3A8BA 4KELA 1EPTB 3LGVA 3MU4A 1LHEH 2O8TA 1XM1A 4NG9H 1JIMA 4JZFH 2OBOA 5ESBA 1CBWC 4O3UA 5HXFA 1QIXB 3MNBA 2CMYA 3V12A 5L30H 2EQNA 2XYAA 3Q3KA 1UVTH 2C93B 2WPMS 5T6FA 2B0FA 2VGCB 1E1RD 3U8TH 1BMLA 4CREA 3ZVDA 3RXOA 2P16A 2OCVB 1O2LA 4A92A 1A46H 2F9VA 5CE1A 1HB0B 3PV4A 1S83A 3SV2H 4P02A 4H42U 5FAHA 2SGDE 4GUXA 1SPJA 4D7FA 1P2IA 1VGCC 3EQ0H 5AF9H 1MD7A 1Z1JA 2ODQA 2ZU5A 3UQOA 1EAIA 2DE9A 2Z9LA 1FONA 2B9LA 3VPKA 5EIYA 5DP3A 2J5UA 1ZGVA 1XKAC 2ZNKH 4AC9A 3DSOA 1YLNA 2UUYA 2AGGX 4AX9H 1C1RA 3PMHB 1C2EA 1QB1A 3F6UH 5DP5A 1A4WH 2VB0A 4XDEA 3PMJA 1ANCA 2QXIA 3KYGA 1O3AA 1SVPA 2PKAB 1O30A 5FHTA 2C3SA 1MH0A 3UY9A 1AE5A 2OD3B 2RG3A 1SKYE 4XD7D 1THRH 2XTTB 1GHAG 2FWWA 2ZTZA 4XBDA 1ZMNA 1DFPA 1A2CH 4ISLA 2R2WU 4FOUC 2YMSB 3NWUA 4E7NA 4OGYA 1QURH 1DXPA 1C4Y2 1IQJA 1GI2A 4AZ2B 2LPRA 1K1OA 1HCGA 1QCPA 1XUFA 1P02A 1SGYE 3KQCA 3ZZAA 3ATWA 3FZDA 1G9IE 2WYGA 1V2PT 3DCLA 3M7UA 2ZHEH 3OEHD 1MUEB 1UW7A 2RDLA 3PRBA 3TH4H 1T32A 1UJ1A 1AWFH 1CT0E 4GLYA 4YESB 4AGJA 5E8EH 1GL0E 1F7ZA 4AGKA 1RTKA 3MFJA 4ISNA 1P05A 2H6MA 2VVCA 2ZGCA 5G4BA 3GY7A 2HNTF 1HAVB 3SV7A 1NZQH 2QAAA 1O3GA 3EE0B 3A8DA 4FVDA 2BXTH 1EP5A 5DP7A 4DGJA 3OX7U 1H9HE 2Y81A 1Y3VA 3LDXH 1DE7H 5K7RA 2FS9A 1QA7A 2KR7A 1B7XB 5EJLA 2QY0B 1EXFA 1GI0A 1HIAB 2Z9JA 4RT1A 2C8WB 1ZTKA 2BLVA 2JH5D 2G4UA 2ZHFH 1QY6A 4F4OC 1P04A 2F9NA 2Z3CA 4WMFA 1MZAA 4CBNA 1A0HB 3BG4C 3PV5A 1UK3A 3TJNA 1FV9A 4QT8C 4U30A 3D49H 1O5EH 3SI4H 2XBWA 1RRKA 1UVOA 3U1JB 1A0JA 1CBWB 3MO3A 1A0LA 5JBAS 1TWXB 4JZEH 1SL3A 1ZPCA 4ABIA 1WQVH 1GBIA 1HFDA 1TNHA 2FZZA 1L1GA 1H8IH 3ZV8A 1O5GH 3M5LA 5GCHF 2A5AA 4MPVA 1CHGA 3LJJA 1O2MA 1GWAA 3N7DA 3TJVA 1BTYA 3FP6E 2RFKC 1F0SA 1THPB 3GY4A 1QFKH 1C1WH 1C4U2 1ELDE 1DPOA 1MKXK 1EPTA 4JK5A 3M3VA 1VGCB 2ZQ1A 2P8OB 3K6ZA 1AZ8A 1TONA 4AFZA 1HJ8A 1SQOA 1KXCA 1UCYH 5F53A 1TA2A 4YO9A 2VIVA 1MCVA 1GHWH 3E91A 2JDID 2AYWA 4HG6A 1Y3YA 3O8CA 5DSFA 1O2HA 2ZQ2A 1NN6A 8ESTE 1GHYH 2BD3A 4BOHA 2WSSD 1Y3UA 2PFEA 3GYMA 3B8JA 1TNKA 4KTUA 4Z6AH 4YZUA 1NFWA 1XXDA 2OBQA 9LPRA 2F9UA 3F9GA 3SU1A 2GCHG 3SJIA 3PMAB 1FY5A 4YLQH 1P09A 3RM2H 3M5MA 1T7CA 3P6ZB 3FP7E 2BDIA 2B5TB 2W3IA 2BY9X 3KYFA 3NK8A 1V2NT 3L33A 4NIYA 1DANH 2A4GA 3UIRA 1K22H 1GDNA 1C9PA 4JZDH 3BEUA 4UD9H 1J14A 1OP2A 2QE7D 2FI4E 1BTHH 1TB6H 2DE8A 1G2LA 1MKWH 1V2QT 3W95A 2W5EA 1ELFA 1HJ9A 2WPLS 4YOIA 3F9FA 1FY4A 1ETSH 3VB3A 3EAJA 5PTPA 4XOJA 3BTME 1EB2A 1B0EA 1BIOA 4TT3D 2C8ZB 2V0BA 1SHHB 1C4V2 1JIRA 2BOHB 4NCYA 1C2DA 1LVBA 2SGEE 1SGFG 3KCGH 1PPFE 1QBVH 1GPZA 3KN2A 3PLBA 1Z8RA 3H5CB 4WXVA 5BRRE 1CGJE 1AU8A 4JYVH 3QX5H 3W1EA 1C5WB 2VIWA 3SU0A 5ABWA 1V2JT 3S9CA 2UWLA 1HAVA 3BG4B 1O3HA 2GV7A 1GBKA 4TYDA 3W94A 4MTBA 1SGCA 3U28C 2Y7XA 1YKTA 1HUTH 1ARBA 3GY8A 3ZZBA 1WOFA 9ESTA 1AB9C 4Y8ZA 4FUFA 3A8CA 3RXMA 4MNVA 1GBJA 1SLWB 1X7AC 1EASA 1IHTH 2SGQE 2QXHA 5ESTE 4A5TS 1UCYE 2Z3EA 2XW9A 1GHVH 4NWKA 1O3IA 2XCNA 1DSUA 3BTKE 2XC5A 2ZZUH 2TGPZ 1MU8B 4FUCA 1GBLA 3M36A 5EGMA 3C27B 2FI5E 3SUDA 4LXBH 1F2SE 1TNIA 5GXPA 1C1PA 3A7VA 5BPEA 2SFAA 1ABIH 3SN8A 3VB7A 3CS0A 5E0JA 3SJ8A 2ZFPH 1IQMA 1DWEH 2A2QH 2WYJA 5EW1H 4NZLA 1FXYA 1QB9A 5F8TA 2ZFTA 4XRNA 2FODA 4CHAB 4ABGA 4Q4LA 1S6LA 3KGPA 1BZXE 1OWHA 2KFWA 3F0OA 3LIWA 4SGBE 1EJAA 2GP9B 3A8AA 4UONA 4BAMB 1RTFB 1Z8GA 1ZSKA 5A8YA 3MNXA 2Q6GA 4Z1MD 1YCPH 5JBCS 1UVUH 1DOJA 2ZFFH 4D8NA 4P00A 3FN8A 4CRAA 4A7IB 1QJ1B 4AG2A 1MQ5A 2XC4A 3MH4A 1SMFE 3MU1A 1Y5UT 3ZZ6A 5HGGA 1SR5C 1OX1A 3P95A 2BD9A 1P3EA 1F0UA 1UMAH 1DDJA 1BJUA 2ZFQH 2OC8A 1F0RA 1NFUA 1QQUA 3B9FH 4FUBA 4WJG2 2GT7A 1ELBA 1P9SA 3MMGA 1LMWB 1S85A 1GHXH 2O8MA 3MU5A 2ALPA 5EW2H 1V6DA 2JH6D 3STIA 2FYRA 3SI3H 2HALA 2CK3D 4A6LA 3URCA 5DKMA 3I78A 2P95A 4WWYA 1TMUH 3M5NA 1OYTH 3DHKH 5GWZA 1ZPBA 2PSXA 1Z1IA 5F8XA 1V2ST 3SBKA 3F0PA 4J1YA 4CR5A 1SFIA 1W0YH 2FOHA 1HLTH 2H2ZA 4CRBA 4ABHA 2B7DH 4BTUB 1HRTH 1TQ0B 1AB9B 3MU8A 1P06A 4HGCA 1AUJA 2ZFRH 3LGIA 2NU4E 1J17T 2WV9A 1O2PA 4TWYA 2A7JA 1TA6A 1GBEA 1HAXB 1SSXA 2Y6TA 3LC5A 2UUFB 4FUJA 2EI8A 1QJ6B 4KTSA 1O3OA 1GBHA 5FPYA 1UTJA 2C8XB 1IOEA 2GCTC 3RP2A 4AYYB 3PB1E 1OKXA 4I33A 4IN2A 5TCAA 1PPHE 1KDQB 1P2NA 2Y5FA 1OP0A 2K8IA 1TE0A 1TABE 2BXUH 1ETRH 5AHGH 4ASHA 1Z6EA 4MPWA 1C5NH 1ESTA 2XOKD 1Q3XA 2BDBA 3F2HA 4I8LA 1PYTD 5FXLA 4Y7AA 4F49A 1SBWA 1IQLA 1F5LA 3SZEA 3VXEH 2CHAC 2BQ6B 3QZRA 1KLTA 1C1UH 1YWUA 3EYDA 4UEHH 3RXEA 1GDUA 2A5KA 3N99A 1SGEE 3HKIB 3DFJA 1G2MA 1O36A 2J4IA 3VGCC 2OLGA 2XBYA 1BCUH 3N7EA 1JMOH 2KCYA 2TGDA 3SHCH 5GCHG 3ZZ3A 2O8LA 3GCOA 3A86A 1ELVA 3KNXA 4ABJA 8GCHF 1E79D 1UVSH 1RS0A 1O0DH 1HXEH 4IMQA 1DSTA 2PTCE 1BRCE 1ZPZA 4OS2A 1SGNE 3DSPA 2BZAA 3MHWU 1OWJA 2BY7X 1OYQA 5EODA 2HLCA 5F8ZA 1TX8A 5L6NH 3URDA 1DITH 4IBLH 1ZLRA 1P8VC 1ZJDA 1W0JD 2J98A 2F9BH 2FOAA 5CHAC 5FL7D 3SNEA 2WZQA 5I25A 2OK5A 4K5ZA 3FKSD 3OFND 2SNVA 2VVUA 1UVPA 2GT8A 2CF9H 5FBIA 3D62A 1T4UH 3TNTA 5T1VA 2ASUB 2VU8E 2OTVA 4GPGA 1ELEE 1O33A 2YMSD 4CR9A 4HZHA 4A1VA 4CRFA 4IW4E 1MKXH 2V6NA 1A1RA 3SV6A 2VWOA 3EA7A 2PW8H 2RA3A 3UFAA 2GKVE 1P11E 3PYHA 3L3TA 2FM2A 3PTNA 1PPCE 1XKBC 2KCAA 1O3KA 1TBQH 4XBBA 4BNRA 4B71A 4B76A 5LPRA 1GMDF 3WWFA 3A84A 5A0AE 5E0GA 5C5OA 1O32A 4TY7A 4KP0A 1SQTA 4YT7H 2V3MA 2O9QA 3KQDA 2FTMA 3RMLH 2J34A 1UTQA 3QGJA 2J9NA 1P9UA 2GCTB 1P2QA 2ZGBH 2QV1A 3VXFH 2ZDVH 5HM2A 3E8LA 2KAIB 3H7OA 1BTXA 1G36A 1TRNA 5EXMA 2ZDAH 3SHAH 1CA0B 3MH6A 3RXIA 2FO9A 1O2VA 3FO8D 4NFFA 3SUEA 5C5NA 4K60A 3M7QA 2FP7B 2Z94A 1AVXA 3GCTF 3M35A 2ODYB 3RXLA 1LVOA 3V0XA 4BTTB 2CHAB 1AVWA 1GJ9B 4ASUD 1EX3A 2D26C 2UWOA 3RXQA 1EZUC 3S0NA 1C5LH 5EXNA 1XUHA 1XUGA 3SNDA 3VGCB 1H1BA 2XWBI 2H1UA 4KTCA 2GD4B 4MNWA 4CBOA 2XBVA 1O31A 3AAUA 3BTHE 3QTOH 4JZ1A 4MDSA 2BHGA 2W26A 3UWIA 2WV5A 1J9CH 4DT7B 1LPZB 3UAIC 3OTPA 1CSOE 3SOSA 3SGQE 3NZIA 4DY7B 2CGAA 1JBUH 1S81A 2ZCLP 1IQGA 3RU4T 1QHRB 2QGRA 5C1UA 5F03A 2G00A 4CRDA 1FAXA 2ZA5A 5CHAB 2ZU4A 3SO3A 4YOJA 3GDSA 1NC6A 1GBCA 1SC8U 1BMFD 1YPMH 2PKSC 1LPKB 4Y0YE 1VCPA 1C1OA 2KCOA 4Q7XA 2HLDD 3SGBE 3SZNA 1O38A 1O3DA 4X1QU 3RLWH 3RU4E 1QBNA 1XXFA 1NRPH 2J97A 2NU2E 1V2TT 1W0KD 2P94A 3TPIZ 5H4IB 4BAOB 1TIOA 4RI0A 1O3FA 2XCFA 4ZKOU 1HAOH 1T8NA 3U1IB 3E6PH 1O3MA 2C90B 2AEIH 5DJ7A 3RMNH 1SQRA 2ZHDA 1KLJH 3EA8A 2ZDMA 1ABJH 3TIUA 2KZ4A 2PP6A 5FX6A 1J8AA 1TMTH 4K1EA 3UREA 3WW7A 2KM0A 6ESTA 3IG6B 1GG6C 1EAXA 2BVRH 1BOQA 5C3NA 2ZU1A 4Z0KA 1UHBA 1AKSB 3ZVBA 1GJAB 3A81A 1W11U 3PM3A 5F6MA 2FEQH 4DW2U 2BY6X 1NY22 1OPHB 1YLCA 1UTOA 1ELCA 2TIOA 1ZMJA 2BLWA 2OP9A 3MH7A 4I8KA 3SJOA 4XFQA 4O3TA 1U6QA 2NWNA 1LO6A 4GHQA 5DG6A 4FU8A 3AASA 4NIVA 1BITA 1C5TA 1WBGB 3KQEA 3HK6B 1TPOA 2IN2A 1ELGA 4AB8A 1W8BH 2FTLE 1QRXA 4ABBA 2BMGB 3CENA 4WVPE 2AFQB 3E0NB 4HFPB 1VITF 2GZ8A 1WQSA 1GCTC 2AIQA 2ZGHA 2F43B 3RXJA 3T62A 3RXKA 1UK2A 2BDAA 2HOBA 2JH0D 4PROA 2D1JA 3RC6A 3RXRA 2VIDA 1QL7A 5DPAA 2G52A 1C5YB 2H5DA 1D3PB 1KXAA 2UWPA 1SGPE 2AS9A 4M9FA 1O2WA 3HGPA 2Y82A 1MTNC 2QC2A 2ZPQA 3T25A 4LZ4B 2V35A 1LKBA 3V7TA 2Q6FA 1HXFH 4I86A 1BB0B 4OS6A 2ZPSA 3QLPH 2AMPA 2O8WA 1W14U 2FYQA 4MNYA 3TH2H 5C67A 4X0WU 5FCKA 1S5SA 2J95A 2IOTA 2XXLA 1VKYA 3KF2A 5E0HA 2BX4A 1D4PB 3KQBA 1LHGH 1GI7B 5C17A 2SNWA 1ZRKA 2HPQH 3UOPA 3VG8A 1MTVA 7ESTE 4R0IA 2BQWB 1EAUA 3O8BA 4JYUH 4Y10E 1XVMA 2F9PA 2R0LA 4BAKB 1IQFA 2ZP0H 2IJOB 3F3BA 1LKAA 1SOZA 2FESH 3RXVA 3PLPA 2PKSB 1H9IE 3RXBA 1EFRD 1C2JA 1OOKB 1SFQB 2ANKH 1ESAA 1WTHD 1V2UT 1A5GH 1C2HA 1Y3WA 3UPEA 4RKJB 1O34A 3F2FA 3ZZDA 1YM0A 4D7GA 2AMDA 4BTIB 5GIBA 2BB4A 4HI3A 1DY9A 1FIWA 4E7RG 7GCHF 8GCHG 3M5OA 3ZVEA 1O35A 3PTBA 3LGUA 3OAAD 3TK9A 1QL9A 1SHYA 3ZZ7A 1ZYOA 1F5RA 3BTWE 2PKAA 1W7XH 4ZROA 1QJ7B 2STBE 4OGXA 1MTSA 4ZXXH 1ZTLA 1YPEH 1WXRA 1Z8JB 3TH3H 2Z9KA 4UDWH 1O2OA 5LPFA 1PQ7A 3K2UA 3FOAA 4GHTA 3O8DA 1HBTH 1E34B 1KIGH 1EZSC 2VH6A 1BT7A 1GG6B 4FETA 4Q80A 2XWAA 3LGTA 1QNJA 4NIWA 5FX5A 2TRMA 3LH1A 2G8TA 1C5SA 2UUJB 1ZHRA 1JOUB 3UNQA 3OEED 3SV9A 1XX9A 2WUBA 1HPGA 3S7HB 4TPIZ 1C9TA 2CJIA 5J4SA 4WH6A 4Q2KA 4XE4A 2A4RA 5B6OA 4GVUA 1MAYA 4RSPA 1O5BB 2F9OA 1P10A 1YPHE 2AMQA 4X1RU 1FZZA 1EOJA 2BQ7B 2P3FH 1GHBF 1ZZZA 4Y76A 3GICB 1C5RA 1H9LB 3GY6A 4CRCA 1C2MA 2ZDKA 2G81E 5IDKA 1GCTB 4WF8A 5LPEA 1AKSA 2GVFA 1CA8B 2BLQA 5JDUB 4M7GA 1YPHC 3HK3B 1V2VT 2FI3E 2KCPA 3MU0A 3Q00A 5DP6A 1GMDG 1HIAA 2V7QD 1MMJN 3Q77A 1INCA 1KXDA 2WUCA 4FUGA 4NFEA 2ZHWH 1MTNB 3MYWA 5HKKD 1VJAU 3A89A 2J92A 3VB4A 5E2PA 3K9XB 1P57B 3A7WA 3SU2A 1C1NA 3U8OH 2FOEA 2FOFA 1GMHG 1MBMA 1YF4A 1B5GH 3P17H 1CU1A 1H8DH 5AVDA 3T2NA 1BHXB 5LH8A 2BDGA 3NXPA 1SGDE 2ODPA 2ZDNA 1GVKB 1EUFA 1SI5H 1YCPM 5C2ZA 2CN0H 2ZC9H 4JYTA 3GCTG 1NT1A 2ZTYA 4ZKSU 4U01A 4B6FA 3GY3A 2ULLA 3AW1A 4F48B 1MTUA 1HGTH 3RMOH 1FIZA 2IJD1 1PPBH 3TGJE 5FPTA 1V2OT 1D3QB 3PWBA 2UUKB 1W7GH 3BN9A 3TU7H 3UTUH 1OWDA 2ALVA 2OC1A 3TJUA 1FMGA 3UQVA 1MU6B 2FOGA 5T6GA 1C1SA 1OWIA 2VBCA 3BTTE 1NRSH 1K28D 5B6LA 1ZTJA 3LU9B 1C5VA 4NIXA 3U8RH 1RGQA 5JPMH 4X6PA 3SU3A 2ANMH 4NA7A 2FIRH 4UE7H 4YM9A 1NU9A 4JK6A 1BRAA 3H7TA 3AVZA 1PPZA 2HNTE 3QUMP 1GCDA 3LKWA 3BG8A 1BTUA 1A61H 1GGDC 4OS4A 1UTPA 2R9PA 2DUCA 1LDTT 3RC4A 3UR6A 2QF5A 2LNCA 1Z7KA 3BTQE 1UTMA 1EJNA 2HNTC 1HAHH 2TGAA 4MPXA 2EEKA 1AGJA 1C5ZB 2QF4A 3Q3YA 3SU5A 3BSQA 2A2XH 1TGSZ 1VJ9U 3A7ZA 3D23A 4CH8B 3NCLA 3HKJB 1EJMA 1T8OA 2AGEX 4B2AA 5CMXH 3ZYEA 3QZQA 4VGCC 1TALA 1PQAA 1NS3A 4NA8A 3L6PA 4FUIA 2Q1JA 3R0FA 2VWNA 3LPRA 3SNAA 3ZZ9A 1WU1A 2JJ2D 3MOCA 4Y6DA 2W6ID 3UNRA 3KIDU 1F5KU 3MO6A 3P8FA 1GJ8B 2GX4A 1CGIE 3ZVFA 1O39A 1BQYA 1VCWA 2EY4C 2FDAA 2VJ1A 1YGCH 4IGDA 4Y8XA 1O5AB 1AO5A 4Y79A 1TGTA 5C0TA 2QN5T 4OS7A 1NO9H 3HPTB 5KECA 2VWLA 4Q7YA 3ITIA 5TCCA 1GBMA 1SLXB 2QYIA 1P0SH 1P2OA 4U32A 4LZ1H 3TK5A 1N6XA 1SGIB 1GBFA 1O2XA 2ZU3A 5HYOA 2Z7FE 5HM9A 1S0RA 1TGNA 3GOVB
chains in the Genus database with same CATH topology
4X2VA 1S0QA 1TNLA 2OC0A 3TVJB 3TJOA 1Z71A 4O03A 2FLRH 1SGQE 2OUAA 3BTFE 1XUIA 2BVSH 1S6FA 1TRYA 3OE7D 3O8RA 1VITG 1O2RA 2G55A 3ATMA 4LOYH 1ZSLA 1G3EA 1P03A 3A7YA 2WHXA 1PYTC 3VFEA 3S9BA 3RDZA 1BDAA 1CQQA 2EC9H 5A8ZA 1AIXH 1LHDH 1DUAA 3MNCA 2AERH 1MCTA 4IC5A 3SJ9A 3M61U 1K21H 1K1PA 3EA9A 2PTNA 4GSOA 3IWMA 3QK1A 3VB5A 1NBMD 3CS7A 3KEEA 4YLUA 5EOKA 1PPEE 5DK1A 5JB8S 5SGAE 1DY8A 1W12U 2WPJS 1S84A 2L6OA 1LVYA 1NPMA 4K69A 1FY1A 1BRUP 1PQ5A 3ODDA 1UTLM 1TMBH 3FFGA 1IAUA 3D65E 3P92A 2BVXH 1JXPA 2STAE 1Y5BT 3RXSA 4SGAE 1NU7B 1GJDB 1J15A 1WUNH 1W3CA 4FU7A 3OYPA 1H4WA 2WPKS 3T5FH 1ZGIA 8KME2 2A5IA 1G32B 1C2KA 4LK4A 1GGDB 2HGTH 1E0FD 4A1XA 2ZHQH 1L1JA 4A1TA 3R3GB 1GBTA 3JZ2B 5EPNA 3AW0A 4ZAEA 3SW2B 1FPCH 4X1NU 2QCYA 1CHOG 1FJSA 3A88A 4UFGH 1ZMLA 3TLOA 3QO6A 4KKDA 4IC6A 4X6MA 2ZI2H 3BIUH 7GCHG 2WPDD 1QRWA 2ANWA 4NA9H 2WINI 3LT3A 4VGCB 2VIPA 1AFQC 4H6SB 2TBSA 3HATH 1O3JA 1EAWA 1DWCH 1TOCB 2QIQA 3OY6U 5EQQA 4WMDA 5HMAA 3ATLA 5IYTA 3OTJE 1JRTA 2F3CE 4I31A 4X2YA 4OS1A 1BBRE 1ARCA 1KXBA 1V2LT 1S6HA 2ZG0H 4X2XA 4NGAH 1PFXC 2PLXA 2ZDLA 1E1QD 2TPIZ 2BD4A 1O2JA 5JB9S 3K6YA 3T28A 1WAYB 4YXWD 1ANDA 1CE5A 1KXFA 3A82A 1EP6A 1GMHF 1AUTC 1V2WT 1AVGH 5DGJA 2BDHA 2WV4A 1BJVA 1FDPA 4K1TA 1OHHD 2A32A 1SQAA 4ZH8A 1ZR0A 1K1IA 2ZPRA 3EDXB 1K1NA 1T8MA 1BTWA 1GHBG 1ZRBA 2QXJA 2AH4X 3ZVGA 2P93A 3P70B 5I46H 3GCHC 3F9HA 2V3HH 3V13A 1ORFA 1TOMH 3RXHA 1VZQH 3FAOA 2Y7ZA 3N7OA 1Y59T 1E37B 5A8XA 5GDSH 1KDQA 1C5OH 1DICA 1FN6A 2H9TH 4K3JA 5EQSA 3ZVCA 1O2TA 1O3LA 2HWLB 2PGBB 1ETTH 6GCHG 1A5HA 1YC0A 5FPSA 1VCQA 1C5XB 1AE8H 1A5IA 2W6JD 2ESTE 2WPHS 3FP8E 4ABEA 2OQ5A 3H09A 2C4FH 1DVAH 3UNSA 2ZKSA 3NPSA 2FMJA 5ETXA 5LGOA 3GS9A 3TITA 3RXAA 1RD3B 1Y3XA 3RXGA 1G37A 3FVFB 1O2SA 2P8OC 1LQDB 3WY8A 3MTYA 1LPGB 2OQUA 4X8VH 3F9EA 1DT2A 2XBXA 6LPRA 1KMHB 1E35B 1MAXA 1THSH 1RIWC 4JCNA 1O2YA 2PUQH 3RXUA 3C1KA 4CRGA 1GVZA 1GI5A 3A87A 4K2YA 2CXVA 1BBRK 5E2OA 2OINA 2JJ1D 3PO1C 1GBBA 4CH2B 3AAVA 3U9AH 4UFEH 1T8LA 3DA9B 4O97A 3JZ1B 2IPHA 1YPGH 3BV9B 1C2IA 1AFQB 1K1JA 1L4ZA 3BTEE 3GY5A 3E0PB 1AMHA 2EI6A 2XNDD 1O5DH 3MNSA 3MO9A 3UB0A 3RU4D 1J16A 1BUIA 1GJ6A 3UR9A 1CO7E 1GI4A 1DUEA 4ZKNU 2R3UA 1H8HD 4X8TH 1YBWA 2K0QA 3RXFA 1O3PB 3KL6A 2LELA 1W2KH 1C2LA 3E90B 1SG8B 4ABFA 2ZECA 1LQEA 4UFFH 4E06H 3ATIA 4O9VA 4ZKRU 1LCYA 4B74A 2FS8A 2BDCA 1FNIA 3DT0H 3DFLA 1PPGE 4AFQA 2QF3A 2O8UA 2Y5HA 3ODFA 4TY6A 3LONA 1OWKA 2ZGXH 3RM0H 2PHBA 2HVXA 4XSKU 2QXGA 2GGVB 4FVBA 5L2YH 1OXGA 5JYIA 3FZZA 4X2WA 4I8GA 4BXSA 2GDDA 3IITA 3GCHB 2VH0A 3U98H 1Z8IB 1L2EA 2FX6A 1FLEE 1JRSA 2D8WA 5EXLA 2SGFE 1QL8A 1P12E 2YNAA 4ISIH 4YTAA 2R0KA 1ZSJA 2ZCKP 1KXEA 2A45B 1C5PA 2KAIA 1TRMA 3A85A 4B73A 4WMEA 2YNBA 3UOUA 2G51A 2GMTC 4R8TB 2H9HA 1O2KA 1TBRH 4GAWA 4RKOB 1EKBB 1QGFA 4GCHG 4INHA 4BANB 1HAGE 2BYAX 3RLYH 4MG3A 3TNSA 5EG4A 2JIZD 2VVVA 2FX4A 1SGRE 4X1SU 2FLBH 2FOCA 2FXRA 2I6SA 3K65B 4ZHMU 3A7XA 2ZGJA 2F83A 2H5CA 1T4VH 2A31A 3BTGE 3BEIB 3RXCA 1BA8B 2FPZA 3LC3A 3M3SA 1M9UA 1WYKA 2GZ9A 4NWLA 1MD8A 2NU0E 1CT2E 4OS5A 1RIWB 1CHOF 4ZXYH 1N1LA 2K1QA 5C1XA 1K1MA 1BMAA 2J38A 3Q3XA 4FUEA 3RXDA 1EB1H 1KSNA 4ZUHA 4ZHLU 5A0CA 1SOTA 4XBCA 3ENSB 4BAHB 4DIIH 3FANA 1TX7A 7LPRA 1LVMA 1FAKH 3QWCH 3PO1B 1GL1A 1NFXA 2R2MB 5T3HA 2AGIX 4ZHAA 5TJXA 2A7HA 1W0ZU 1XUJA 5DO4H 1A3BH 1QA0A 4CHAC 2BD8A 3KHVA 1C2FA 1WTGH 1TGBA 1ELAA 1GI3A 3STJA 1GMCF 3E1XB 3ZVAA 2ZTXA 4ESTE 1RTLA 8LPRA 1QR3E 3A83A 2Z6BD 3ATKA 2W3KA 5GPIB 1C1MA 2EA3A 4B1TA 1ZHMA 1BRBE 3LGWA 1G3BA 1AZZA 1ANEA 2CF8H 4AYVB 1AY6H 1FUJA 1SLUB 3PWCA 1C5MD 1TNGA 4UFDH 1F0TA 5JBTA 1UO6A 1QBOA 1AFEH 3WWBA 1HAIH 2YOLA 2BY8X 3P8GA 1LHFH 1OP8A 1IQEA 1XUKA 3M3TA 2G4TA 1WV7H 2PWXA 4D76A 4DVAU 1O3BA 3G01A 2A1DB 3UWJH 4ISHH 5DP9A 4U2WA 4NSVA 1G30B 1GJBB 1ZJKA 2BDYA 4F55A 3EGKH 1KLIH 5FBEA 1PQ8A 2G5NA 1AD8H 3SUGA 1EATA 1C5QA 2R3YA 3LGYA 1O3NA 3RC5A 2SGAA 4X6OA 2ZWLH 1Y8TA 4K8YA 2GDEH 3SQEE 1C1QA 2Z9IA 2VNTA 1EQ9A 2D2DA 1YYY1 4AG1A 4B2CA 1NROH 3RXTA 1D3TB 3RMMH 1TLDA 3U69H 3PV2A 2GTBA 4DG4A 1VITH 1NFYA 6GCHF 2GMTB 1FPHH 1O5FH 5FCRA 2B8OH 1GHZA 1O37A 4Y11E 3RUOA 4MNXA 1C5UA 3RXPA 1GJ4H 4MLFB 3MWIU 2VIQA 1NESE 1YP9A 4Y0ZE 1D3DB 2P3UB 3GISB 4Y8YA 1GDQA 1ACBE 2RA0A 1AI8H 2Q6DA 4AFUA 4AORA 5EU8A 1RJXB 1NRNH 2P3TB 5C0UA 2J94A 1K9OE 2BM2A 2WPIS 1UTNA 4X1PU 3ZV9A 3OY5U 1NM6A 5C20A 1FI8A 1CT4E 1V2MT 2BD5A 3F1SB 1SGTA 4I8JA 2A7CA 2HRVA 4TPYA 1O3CA 2A4QA 4Q7ZA 3P8NA 1L4DA 1ELTA 3Q76A 3SGAE 1D9IA 1KY9A 2W7SA 1XMNB 3T29A 1ESBA 1FY3A 1TAWA 5IK2D 2PR3A 1GHAF 1GI8B 6CHAC 2NU3E 1AHTH 1O2GH 1P2KA 4INKA 1HAPH 2CV3A 3ZYDA 1K1LA 2ZF0H 2F91A 2BLOA 4IS5A 1TQ7B 1MBQA 1WCZA 1OWEA 1KTSB 2JETC 4INLA 1GBDA 4ISOA 1EZQA 2BX3A 4Y7BA 3HGNA 4NSYA 3ELAH 4IN1A 1NRQH 1GJ7B 1O2IA 1QTFA 5EQRA 3QTVH 3SV8A 5AFZH 3LOXA 1KTTB 1TNJA 3GDUA 1FX0B 1MQ6A 1O3EA 3NKKA 4NZQA 3SNCA 1QB6A 1L1NA 2ILNA 3SQHE 3S9AA 2BTCE 3BTDE 1MTWA 5A0BA 1SB1H 2M5TA 1HJAC 4JMYA 1A3EH 4JZIA 1O2QA 2H9EH 2QF0A 1D6RA 1P2MA 2RCEA 2ZFSA 1GJCB 2PV9B 1HDTH 3BEFB 3T27A 1TBZH 4AFSA 1HNEE 1O2NA 2J2UA 1P2JA 1UCYK 3UUZA 1HYLA 1Y5AT 3PMBB 1VR1H 3ZZ4A 7KMEH 1F92A 2FOBA 2AIPA 1ZHPA 2VWMA 4ABDA 4ZMAH 1IHSH 2FOMB 1YPKH 4IMZA 1SLVB 4X6NA 1N8OC 1YLDA 1GI1A 5DP4A 2NU1E 1N6YA 3SUFA 4FUDA 4GCHF 2BZ6H 2Y80A 1YPJH 3DD2H 1IQIA 1TPAE 1BBRH 2EI7A 3SU4A 2AHME 3MH5A 5C1YA 3QGNB 4ABAA 5GJ4B 2ZEBA 1UTKA 1O5CB 1DWBH 1IQKA 2VIOA 4DURA 3PLKA 1B0FA 2XRCA 3CP7A 1E38B 4I32A 2OXSA 1K2I1 3VB6A 3MI4A 1NTPA 1DM4B 2A4OA 4DT4A 4KGAA 4K8BA 1GI9B 4YOGA 2P59A 1CA0C 4OM9A 1DXWA 3BF6H 1DLKB 1GJ5H 3P8OA 1UK4A 4X8UH 4YT6H 4I7YH 3PRDA 5T6DA 1ZOMA 2W7UA 3ZIAD 2ZIQH 1MKWK 2ANYA 3GY2A 2G5VA 4DCDA 1HAZB 2Y5GA 4B2BA 1EPTC 1IQNA 4TWWA 4X8SH 4Y71A 4DJZB 3ZZ8A 2XNIA 2OC7A 4DIHH 4FUHA 1WSSH 5DP8A 1NBME 1AWHB 3M7TA 1TYNA 3E16B 2PUXB 2VGCC 1Z6JH 2JKHA 5GNDA 4FXGH 6CHAB 1L0ZA 2GCHF 2BD7A 1RXPA 1TX6A 4BAQB 1C1VH 4DOQA 3SNBA 1IQHA 1KYNA 3F68H 1BMNH 1O2ZA 5J4QA 4THNH 1BHXF 3AK5A 2JETB 3I29A 4AOQA 2I6QA 3SYJA 3NRLA 1TGCA 3M37A 1HV7A 4HTCH 3TGIE 1TPPA 3QDZB 1HAYB 1V2KT 4J2YB 1SGFA 1RFNA 1O2UA 1G3DA 3SJKA 3SU6A 3F2GA 1JWTA 1AN1E 2ZU2A 1LHCH 3T26A 5CDFE 1Q31A 2HPPH 1C1TA 2ZCHP 2Z3DA 5EPYA 3LJOA 1FQ3A 4I8HA 3ESTA 1MABB 1HJAB 3LH3A 5L2ZH 1BMMH 2V3OH 1DX5M 1QQ4A 2BY5X 1A7SA 3PROA 1TPSA 1ID5H 4D9QA 1OS8A 1COWD 1DLEA 1S82A 4Q63A 2YMSC 1NRRH 4FU9A 1YPLH 5AFYH 1GBAA 2A0QB 3V3MA 1GMCG 4AN7A 3I77A 2F4LA 3E3TA 1D6WA 1C2GA 1V3XA 4WY3A 3GCNA 1UHBB 5JBBS 2TGTA 1LTOA 1MZDA 2GZ7A 4ZCNA 1PJPA 1AQ7A 4D9RA 3TK6A 4MVNA 1V2RT 1DS2E 1FY8E 4AB9A 3TGKE 3GYLB 2BOKA 2GV6A 1N8OB 1H8ED 2ZO3H 4MPUA 2PSYA 3DUXH 3OSYA 1CGHA 3VEQB 5A2MH 1XVOA 1EOLA 4B6EA 4BXWA 5K0HA 2VINA 1W10U 3A80A 1FN8A 1E36B 3S69A 1P01A 4MQAA 1W13U 1CVWH 4WXIA 1GI6A 3BIVH 5A09A 1T31A 1DWDH 2SGPE 4H6TA 2Z9GA 1BTPA 2THFB 3ZZ5A 3ZZCA 2BD2A 1G3CA 3S7KB 3GDVA 1TFXA 4H4FA 3SORA 1EZXC 1YCPK 1Q2WA 4B75A 5DN6D 1OSSA 3A7TA 1P3CA 1ANBA 1GVLA 2PGQB 4RN6A 2M2AA 1QRZA 4K1SA 1BTZA 3NUMA 3OU0A 3B23B 4E05H 5CHBA 4WH8A 4TSFD 2QA9E 3QN7A 2C8YB 2XC0A 3A8BA 4KELA 1EPTB 3LGVA 3MU4A 1LHEH 2O8TA 1XM1A 4NG9H 1JIMA 4JZFH 2OBOA 5ESBA 1CBWC 4O3UA 5HXFA 1QIXB 3MNBA 2CMYA 3V12A 5L30H 2XYAA 3Q3KA 1UVTH 2C93B 2WPMS 5T6FA 2B0FA 2VGCB 1E1RD 3U8TH 1BMLA 4CREA 3ZVDA 3RXOA 2P16A 2OCVB 1O2LA 4A92A 1A46H 2F9VA 5CE1A 1HB0B 3PV4A 1S83A 3SV2H 4H42U 5FAHA 2SGDE 4GUXA 1SPJA 4D7FA 1P2IA 1VGCC 3EQ0H 5AF9H 1MD7A 1Z1JA 2ODQA 2ZU5A 3UQOA 1EAIA 2DE9A 2Z9LA 1FONA 2B9LA 3VPKA 5DP3A 2J5UA 1ZGVA 1XKAC 2ZNKH 3DSOA 2UUYA 2AGGX 4AX9H 1C1RA 3PMHB 1C2EA 1QB1A 3F6UH 5DP5A 1A4WH 2VB0A 4XDEA 3PMJA 1ANCA 2QXIA 1O3AA 1SVPA 2PKAB 1O30A 5FHTA 2C3SA 1MH0A 3UY9A 1AE5A 2OD3B 2RG3A 1SKYE 4XD7D 1THRH 2XTTB 1GHAG 2FWWA 2ZTZA 4XBDA 1ZMNA 1DFPA 1A2CH 4ISLA 2R2WU 2YMSB 3NWUA 4E7NA 4OGYA 1QURH 1DXPA 1C4Y2 1IQJA 1GI2A 4AZ2B 2LPRA 1K1OA 1HCGA 1QCPA 1XUFA 1P02A 1SGYE 3KQCA 3ZZAA 3ATWA