4NWUH

Crystal structure of ape1551, an anti-human ngf fab with a nine amino acid insertion in cdr h1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
239
structure length
231
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASGGDTFSNYAISWVRQAPGQGFEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGPEYYDYVWGSYRYNYFDYWGQGTLVTVSSGSASAPTLFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APE1551 Ab Fab heavy chain
publication title Nucleotide insertions and deletions complement point mutations to massively expand the diversity created by somatic hypermutation of antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2013-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nwuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nwuH01
4G6AC 3R1GH 4HUUB 2FJHB 4MD0A 5IR1A 2ZG2A 1CLCA 2Q7YA 1XT5A 4BH7A 2NW3A 4ONHB 1Q9LB 2NX5A 3WUZA 1XGQB 1NJ9B 4O5LL 4RX4D 3EO9L 3SE4C 4TVPL 3DRQB 3QAZB 1J0HA 2V7NA 4XGZA 5IBLC 5DD3L 5L2KA 1U2HA 3QUKB 1DBAL 2BC4A 4WFED 5AWNL 4F15C 1G6RH 4LK4A 4ERSL 5FECB 4XWOC 4JG1H 2VLRE 2ZUSA 4D9RD 4GMTL 3U1SL 3UBXB 2YEZA 2YRPA 3IFLL 4DUWA 2Z35A 3INUH 2XOTA 5EZJB 1XF4A 3SCMB 2IQ9H 2XKSA 1HWGB 4OLUH 3PGFH 3WJLA 4RMQA 3RHWF 3MUGB 1FIGL 4P2OB 4XX1E 3SPVB 4IIQC 4X6EB 4I0PA 4UT6H 4G42B 4NNYB 3ZT5A 3O6ML 1I1AB 2Z91B 4JFEE 4LOUC 4OLXL 3PWVA 3B8SA 1S7VB 5A16A 5ECJE 3JV6A 1B6DA 1AJ7H 3LZFH 4NO3B 1NBVH 2VLLA 4TSAH 1UT9A 4I4WA 3GNMH 3QDHA 1AD0A 4MJ4A 4ZDHA 1LNUA 2R2HA 3ZTNL 5IVXF 4GLRI 3JZ7A 5C0GB 5DJ6B 1P2CB 3DRTB 1ZHNA 4WFFD 5GGUB 4RGNE 3O3DB 3DO7A 2GTZA 1TENA 1KFAL 4PP1D 3A67H 5HPOA 4PGBB 4M8QB 3S34L 4O00A 3D5OF 4GKOA 3CPLB 4HIXL 4R8WH 3MACH 4AQOA 4F8TA 2DKUA 4GXVL 1MHPL 1E4JA 1HOCA 2WQ8A 3QIUD 1H15B 3GSXB 3I3EA 4OGXH 5HYJB 3I3DA 3OJDB 2E9BA 4WW2A 2LV4A 2BHYA 5JW4R 2H2PD 1IQDA 4NBXB 5DQ9B 5HXMA 4OFYD 4Y5XA 4FMKA 1DTUA 1ZHKA 3VFTB 1HE7A 1NFKA 4CADB 5FCUH 1I3GH 4X5LA 4ZTOH 1H5BC 4OZGB 1JPTH 3WFBL 1G6VK 2DQEH 5F7KC 1GZPA 1QFWI 4R0LC 4YHKH 3VWKB 1JCKA 2IPKA 3FFDB 3L5WB 5E9DE 3U4BL 4ZYKA 1JWSA 4ZXBA 3PG2A 1OM3H 4GQPH 4LLQB 1QFUH 1BVZA 1XR8A 3M8OH 1ZVYA 1IGIL 1P4IL 5FUCE 4YX2H 1V7ML 2O61A 4HXAL 1FVDB 4Y1AB 3ZYOA 4OGAC 1A22B 1A5FH 3G5VA 4LSRH 4ZG1A 4H88L 4LNRB 4LU5H 3RWDA 1R5IA 3B3IB 1FORH 4CRPA 4KK8C 4CGTA 1G9MC 1H3UA 3IKCB 3JV4B 4Y4FB 3R06B 3B9KA 4XPTL 1WIPA 3MLUH 3WLWD 1Q0YH 4M1DL 1JV5B 1PG7W 2DLIA 5E2WH 3MCKB 5D1QB 4J23A 3WXWL 3QHZL 1I9IH 4DN4L 3FONB 1U8KA 1PBYA 2Y36H 4P23B 2IANB 4PV8A 2FYYA 4GRWB 5BQ7A 2R2EB 2QR0A 3KPRB 4LLYB 4H25B 4QY8B 4G9DB 3OAUL 1CVRA 2KQMA 2MMXA 4MX7B 5F1KC 5BO1H 2EKSB 3CC5B 4Q6IA 4KRPB 2JJUA 4ODHH 4OKVB 3L3GA 1WC7A 4LASL 1Q94B 2EDBA 5FGCE 4DVBB 2P42B 5DA4A 4F7PA 2AJYH 1FGNL 3QB7C 5CJBA 3QG6A 3IB4A 3CJJA 1T7ZA 4DVRH 4C58B 1U91A 1VERA 1ZE3C 3PDDA 5EC2A 4GS7C 4FXKB 1J1PL 4D94A 1C08A 5F9WC 4OCMC 3BW9B 4PR5A 2I60H 4UOJA 3KPNB 3CDYA 3EO0B 4HUVA 4KK6C 2C5DC 4QOKB 4Y19E 1E6OL 1V5JA 1EHNA 4YDLB 4WIQA 1QSEE 4S2SB 5DSCB 4Z0BL 4MNQD 4J7RA 5ITBL 3MFGB 2FBJH 4YHNB 3QXVA 3QUXB 3D2UD 3KHQA 4PJAF 4NQCE 4R97B 5AD0B 1R3HB 1OAXL 4HIEA 4V1DD 1C5BL 1VACB 1PKQE 3FQTA 3DXAB 1CFSB 4WUUE 3VG0H 3BDBA 3QCVH 5FK9A 2D31A 2HJFB 5GSRB 4OLWH 5SX4H 3BPLC 3RX7A 3D2UA 5HI3D 4RMTA 1VADB 3OB0K 3WKMH 4BZYA 3TT1H 2AEPH 1ZWIA 4QO1A 4M62L 1ZSDA 1EAPB 2W0LA 1Q9KA 2OI9C 4MDIB 4EBQH 2E3VA 1A6ZB 5A2IH 1VFBA 1MRCH 3DUSB 2Z8SA 3VXSE 1T22A 3QNZA 5M7QA 5DK2B 2R2BA 4ODSH 2CUIA 1GGUA 3Q6FB 4XCFL 3KLHC 1SEQH 1TMCB 4FQXA 2NXYC 5CJQL 3ARDC 2Y7QA 4F7TA 1BD2E 2PYFB 3TO2A 4D8PB 5CZKA 1PGRB 3SQOH 5DI8B 1U8IB 5EB9A 4ZAKD 2Z31B 4YXKL 4C83A 1C5CL 4I9WE 5DJ8B 1HDMA 4WEBL 1MCOL 4TNWF 5IB5B 1TJGH 1NCAL 4XC1H 4OD2B 5IFAL 2P5EB 3T3PE 1HSBA 4OCYL 5C0DA 4M6OH 2DLTA 3C60B 2FNBA 3CH1B 1URLA 3LHPL 1N0LA 4F3FB 3NIFE 2N7BA 5I16B 2H32A 3R1GL 4JAMA 3W39A 4K23L 3LIZL 5GGTA 2GIYA 1FZKA 4O2EA 2YMXH 4GW5A 1G9NL 5TH2A 1XF2A 1S9YA 1UH3A 2AK1L 4IHOB 5C86A 4L9LA 2VXUL 1DQLH 5DVNA 3RWJA 4OD1L 4G43B 4MA3B 3JWOL 1NANH 4K8RL 2ZZUT 5CBEB 3VXRD 1UWXH 2DQTH 4M02A 4NQDE 3V8OA 1WIUA 1G6RL 4G8EA 2E6JA 4LL9A 4P3DB 3GEWB 3T4AA 5DD1L 5HHME 5JZ7D 5GGRY 4P5TB 1LEIA 3I6KB 2V9RA 1XCQA 1E4WL 5HGDB 4PG2C 3VFWB 3BDYH 4KDVA 1J12A 5IV2A 5DT1H 3BKCH 3S36H 2ZCHH 3N1QC 4FFZH 4R7DB 5JOFB 2VQUA 2F8OA 4DK3A 3O81A 2AJXL 3QJHA 4NZTH 1KCUL 1EBAA 3U4EA 3TBYA 2EE3A 5T5FL 2F5AH 2AI0H 1KELH 1QLEH 2GCYB 1YY8B 4XI5C 1ZT1A 2GITB 2MPAH 5IEKB 1R3JA 1JHKL 4HX1B 4RGMC 4LGRB 3GMRA 1I7TB 3WEXB 1AJ7L 1MAMH 2OJEB 3O4LB 5IT2H 35C8L 4MXWH 2QQKH 3IXAA 1NCBL 4TSAL 5HDOA 2QLVB 5BOPA 2XN9A 3O3UN 3VE0B 5GS0D 5C0AD 4RWYL 5I1LA 3KNBA 3MNVB 1UXSB 5DGRA 1VESA 1A6PA 3QIWB 4ZXBC 1FYHB 3D18A 3BP5B 1WFUA 4NNPL 3T8XB 1E27B 4R4BB 4D0DB 3PWPD 3VFSA 1OQOA 3QDGD 2A73A 3A67L 4JJ5A 2HKHL 1AXTL 3EOAA 2F9BT 3DVNB 4R8WL 1G7HA 1DLFH 4DW2H 3B9KC 1S7RA 2I5YH 4PGZA 4G8FA 4L1DA 3VJ6A 4WUKL 3TVMB 4RIRA 5T1KD 2VMFA 4AEIH 4H0IA 3PWJB 3VXOA 3ZHLA 5D7JC 3A6BL 4WGVB 2VH5L 4YHOL 3L9RB 2DQEL 4HCRA 4YHKL 3STLA 5CEYA 4MA8H 4ORZC 5F93C 1GAFH 5F7EL 3FQWB 5F9DC 2VNCA 2EE2A 1NFDB 5MERA 4NN6C 5BVJB 4PJBE 2NNAA 4FTVE 3U7YH 1CDYA 4YWGH 2Z93B 1U8LA 1AP2A 1HQ4A 4K8RC 4YX2L 4MJ6A 4HKXA 5IQ9B 4PJ8B 2BNRD 3CZFA 4JFXB 5HHQB 1K3ZA 4RWHA 4Q7DA 1NC4D 4GRLD 5I1EL 1ZGLB 1FORL 4JHAH 1ZA3A 1N3NB 2VC2L 4P46B 3AY4C 2Z0BA 2MCG1 5F44A 2VE6B 2XQYG 4AEHL 4HS3A 3MQIA 1X5AA 1FV1B 3F7PC 4YC2B 3GSRB 4GAFB 4MJIE 3MLUL 3MRNA 3QUMA 5GISH 1Y6MR 1TQBC 4GOSA 4IBLT 3U46B 1YN6A 1I9IL 1EO8L 4ZS6D 2KQNA 2Y07L 3TFKC 1MJ7H 2HRPH 1HHJB 2Q3AA 5ELIA 4XCEA 3I02B 3TBVB 3VG9B 5FUOL 5J13B 4U1SA 5BO1L 5MEOB 4Z7NE 5GRJL 4E41A 5HPMA 3VXUA 1M7IA 4M1CC 4APQD 5TFSH 4KI5F 1I8MA 3UC0H 3SGEI 3NPSB 1LMKA 4WHYG 4ODHL 1OT1A 2VLKE 3C5SA 1MRFH 2PO6D 3IDNB 3T4YB 1PDKA 4X7CC 3WHXA 4ZFZA 1KLGA 3T1FA 3C08L 3MRIB 1U8MA 5F21B 1YC8A 4JFPA 4TVSa 3ZE2E 1KJMB 2NY2D 4APQA 4ZFFA 1Y6NR 5KVFH 3MGOA 5ESQB 5FXCH 1BJ1H 1WQVT 5TDPA 1BPVA 2B4CC 2EDOA 3A6CL 3KPOA 4X83A 3HNVH 3RUGB 3G5ZA 4J8RB 2QSQA 1KJ2B 3NCEB 4GT7A 3P9MB 2WLYA 3P4LA 1U8OA 4MDJA 2A9NL 3KS0J 5D5MF 4Y4HB 4NQVA 3MNZA 3EYUH 5DJZB 4CNIA 2FEDC 2IADB 4UV7H 5JIIA 1W72L 4Z7WF 1OPGH 4KKCC 4J1UA 3MNWB 1CL7H 2XY1A 5F72S 3GMPA 3L1OH 1CFTA 4OZHF 5GQBA 1CGSH 2W60A 4UOW1 5EO1B 2WWMD 3SO5A 3R0NA 1MCDA 3L3DA 5ICXA 1AY1L 1ZT4B 1MCPH 3SKMB 1BM3H 3VG0L 3QCVL 3RGVB 4MMZC 3RWIB 1DVFA 1OGAB 3NN8B 4I18A 4OZFH 4OLWL 1R3KA 2XACC 5E08L 3AS2A 2EYRB 2PTTA 4JFOB 5MEQB 1V7NL 4N0CC 3F12B 2X4NB 1YNLL 2IFFH 3MMEA 3WKML 5BJTA 1F58H 1BQLH 1I1FB 3QH3A 4Z95H 5B39A 1OVZA 2AEPL 4L4VD 2EZ0C 3T0EE 1ETZB 4LKXA 4PLJD 1RJLB 5IG7A 5F7NC 5LGKA 5B22A 4NN7C 1W0WB 1HHHA 3G04A 4U1HA 3RNKB 5CZXD 1MH5A 2ILLA 4MAYA 4M9OA 4YUEL 1S7SA 4R2GC 3AMLA 5MHSE 2DKSA 2VDPH 1NDGB 4OB5H 2HFEA 3P30H 1J8HA 4YFLF 4JO1H 1SEQL 1FGVH 1CFQB 2GTWB 1LEKB 3EW3B 4GH7B 4LMQE 4RFNC 3WNNA 3KYOA 2PKDA 1MUJA 2R2CA 4PTUB 5ADOH 4LQFH 1SY6H 4YBQC 4XC1L 2QADB 1IAKB 3BP4B 2Q76B 3OBAA 4C54A 3QDMA 3P0YH 2UUDH 3DROA 4WI7A 1R3LA 4LFHG 3QPQD 1XIWC 1XGYH 2R0WH 2DQDH 4KQ3L 2XNAB 4PRNA 3CZJA 4I0CC 4JREB 1A6AB 4L4JA 3NA9L 4K55A 3VGAB 2Y4SA 1DQLL 2NR6D 5D7LB 1RQ5A 2ESVA 1NDMA 2NYYD 4FG6D 1DQQA 2DQTL 3RBGA 1IGMH 5EBLB 5C09B 5E8EB 2D2OA 3MGAA 2DQHL 1GH7A 3NFNB 2DM2A 3B2UC 5D2LA 2CRZA 3DTXA 3IVKA 4QRRE 5ICYA 1E4KA 1J05B 4HWEH 4LLUB 1H3TA 5DT1L 2X7LA 3S36L 3T3MF 1A4JB 2CKBH 3QQNA 2X4QB 4RZCB 3AS0A 4OT1L 3HC0B 4Y0GA 2FJHA 4JHWH 3C6SB 1HYSD 4N8VB 3UTTD 2IFGA 4NZTL 2FO4B 3MXWH 1A7RH 4OUOA 5KANG 1G7IB 2F5AL 1KELL 3EYFB 3QBTB 3DRQA 3C5JB 2MPAL 2YPLB 3DIFA 3ZE0E 3QUKA 2DMCA 1D5XB 5EO9A 5FECA 2ENSA 5BS0E 1J11A 2PYEA 3DOSA 1Q9WB 1MAML 2PTVA 5A43C 1JHTB 2EC8A 1FO0B 4J3VA 3O11B 3UYPA 2F53B 2FECL 4WV1B 4NKMA 2NY3B 4NQSB 5E4IA 5EZJA 3SCMA 3ES6A 3CXHK 1Z0NA 5EBGA 3V6FB 2D7NA 1T20B 3SDAD 4LRNH 4I2XE 3HR5A 1VGEH 2EIZA 4IRSD 3MUGA 5IJKA 4U1KB 5KOMC 1NGXB 5HYSA 2X4TA 4G42A 1X4YA 2CDFB 4KTDL 4L8CB 3QG7H 1OCWL 3PXHA 2E8YA 3UTSD 1N0XH 2W65B 1NLBH 5ERWB 4IRJA 4AK1A 4N9GA 4QWWD 2WZPD 5EULV 1HH6A 5DMIH 4Y88A 4NO3A 4GUPA 5IFJB 5EOQL 2IH1A 4AEIL 4E42A 5EA0H 2IF7A 1K9TA 5BCAA 3QFJE 1I9JH 1YYML 2OTWA 4JRXE 5C0GA 2A6JA 4RNRB 3FN9A 1S7UB 1NH6A 1CD1A 4GAJH 3K0WA 2BSSA 5CP7B 2C4FT 4TPRH 1FG2B 5IFHH 4M8QA 5HHXH 1I8LC 1A0QH 3CPLA 5MENE 3O8XC 3MV01 3FFCD 5HI4D 1WZ1H 3QUYB 4DAGL 4NKQB 1DANU 1GGCH 3BRFA 4G6AD 4I48B 3MFFA 5HYJA 3QEHA 4KJYB 4KJWD 4EI6B 5ILTH 4N5EC 4P2QE 5DQ9A 1SJEB 2A6IA 5HHNB 5T3ZD 3VFTA 4CADA 2MTPA 4KQ4H 1MCWM 5JO5B 5K59E 5CKAA 4OZGA 4DQOH 1MCLA 2GJ6E 3E3QE 3KXFD 1FN4A 5CJXC 4S1DD 4Y8DC 5IBLD 3FFDA 4NUJB 5E8OB 3TZVB 5DRZB 2R69H 3GKZA 2DQCH 1YEFH 1LO3H 2B1HH 1JPSL 4HBCH 4JZOB 4RGOH 4LEXL 1B9ZA 4LLQA 5IW6B 1YEHL 1UA6H 2WINA 5J1SC 2NY4C 3UC0L 4Y1AA 1SMAA 3HMWL 4DUVA 2BNQE 4JO2H 4P4RB 4QHKI 5D96B 1PYWB 3MZTA 5IMOB 3O45A 1MRFL 2OK0H 3B3IA 1DVFC 4UDUB 5D93B 4I18C 4KJQC 4HAGA 5EU6B 5E99H 3JV4A 1OP5K 4NQEE 1QRNE 2YZ1A 2ATKB 4OM0H 3R06A 4Y4FA 3RWCB 4NC1C 2XT1B 2AW2A 2VDKH 3PWLB 1JV5A 5AYUH 3MCKA 2J8UA 5D1QA 3ZKMC 4JG0H 3FONA 3ARBD 4P23A 5E24E 1IT9H 2DL2A 3FT3A 3ZYJA 3K74B 4OF6A 5DC9B 2VLJD 2R2EA 5B39G 3H3BC 3KPRA 4MAYC 1EFXD 3BESR 2XICA 4M7LL 1KPVB 3CK0L 2C26A 2EKSA 1ZLSH 3EYUL 1T2QH 4DKAA 4K7PX 1DUZB 1CICA 3ARBA 3QJFB 4PJEE 2XG4A 3W0WE 3U6RB 5EOTB 4OKVA 1OPGL 5DWUH 2XI9A 2GJZB 5F9AC 2DQFA 4TUKL 3V6OA 1AGFB 2VLJA 3CDFA 1N4XH 4DVBA 1CGSL 4PLKD 1CG9A 1EFXA 1NMBH 4GW1B 3H3PH 2UZIL 1IAOB 3D0LB 2P8MA 2RR3A 3D3VE 1TCRA 2ZWLT 1H3WM 1S9VA 4TOYH 1RZIB 2WUBH 1JF1B 4CN4A 3IJHB 1BQLL 4Q6YA 4BKLB 1JYVA 5TE6H 1LEGB 4PTTA 4QOKA 2ED7A 2JJWA 2ZJSH 4Z7QE 4LCUB 3TJEL 3W2DH 1KENL 1UEMA 5DSCA 3HG1D 5HDQH 4WI9A 1EA9C 1T04B 4X98B 1UC6A 1DP0A 4YHNA 4YHPB 4NQUA 1HINH 4OF8A 2P47B 3V6BR 1YY9C 2F54E 4JO1L 3DXAA 1CFSA 2ADIA 4XPHL 2ITDA 3MSPA 4TVPD 5CIPA 3MBED 1HZHH 1WCQA 1E4KC 1MHEB 1YMMB 3PHQA 4Z7UB 5EFIB 4OGAD 3PDGA 4I0KA 4LQFL 1U6AL 2HMIC 3IF1A 1SY6L 2OR8A 4KK8D 3B9EA 3ECBB 1PVHA 1EEZA 3I85A 5C9KA 1A6ZA 1YPZF 4HH8A 3K4DA 5EN2A 1XGYL 2DQDL 3RIAF 2FR4B 3R8QA 1N5YL 3QAZC 1T4KB 5HVFB 3VXMB 3UBXI 2YSSA 5DK2A 4AH2B 2ZUWA 5IP4A 5F8QC 3Q6FA 5ANMA 5GGSA 3HRZB 5D9SA 2GSGA 1G7PA 1LO0H 3PL6D 5GS1A 3IGAA 4D8PA 5FUZL 3PV6B 2RBLA 3OKOA 1IGML 1H3GA 1U8IA 3VFPA 5I71B 2YR3A 3HAEA 3SCMC 5T1DL 5IB5A 5DRNA 4S1RL 3BH8B 1SMOA 3MV7B 3RVUC 2P5EA 1WK0A 4F7CB 1CFNB 2H1PL 1YMHA 4P2OC 4QF1B 3CH1A 3VFOB 4F3FA 3HUJA 2OZ4H 5I16A 4JHWL 5ESVB 3T0BA 4UILL 2V9TA 2F5BH 4WDIA 3QHFH 1I1AC 3LSOB 4X6FA 5HYSG 5IQ7L 3TN0A 3UYRH 4IHOA 3ZYZA 4HK3N 4G43A 4MA3A 4C56E 1KIQB 5CUSH 4HUXB 4ELME 4EDWL 1JN6B 2D03H 3VI4F 5ISZE 2ARJQ 3NCMA 4P3DA 4W6XB 4ALAL 5ETUB 2AEIT 4P5TA 1KT2B 3C09B 5HGDA 4NRZB 5JXAH 1NAMH 4K3DL 1QNZH 4LDLB 1JPFA 2JKXA 5C0CB 2KZ1B 3L5XL 3F7YB 5JW5B 1CFVL 1WGOA 3OKDA 4R7DA 5JOFA 4JFHD 4OZ4B 4CDHA 4S1QL 5DS8A 3BQUB 3JBG7 3SGJC 5HY9B 4TULL 1MI5B 1VGEL 1QR1A 3LQZB 2ZCKH 2JJSA 4QRPB 5GRWA 4XBEL 1VB9A 1KCVH 2ZKHH 2OMNA 2AK4E 3MRLB 1JMZA 1YY8A 1U58A 5IHLB 2D0GA 5BOZG 2X10A 1NLBL 3FN0H 5TDNA 1BBJA 4JM2D 1ZLVK 4HX1A 2DLHA 4U6XA 4E9LA 2R23B 1G7QB 1I7TA 2OJEA 5JIPA 5E56A 4QHMB 2WBJD 3VWKC 2NMSA 4NKIL 3NCJH 1P9MA 3VE0A 1YNKL 3F58L 3P9LB 1EGJH 1UB5A 2EDXA 2PTUA 3MNVA 1UXSA 4MLIA 4P2CG 1F4WH 3BP5A 5IM7A 3ARDD 3BZFB 1OLZA 3T8XA 3DJ9A 4R4BA 4H1LH 5HGBA 5HVHB 2WLZA 3H7LA 4PGEB 2WBJA 1DLHB 4XXDB 1CD0A 1RIUH 5LJYH 2VJXA 1MQKH 4TPRL 4ZUVA 2CLRB 3DVNA 3ETBF 3S3PA 5E70A 3ZE1E 3HI6H 1LP9A 2AJSH 2ZUYA 4Y4FC 2VR9A 1WWBX 1DN0B 1ED3B 1GGCL 3KYKH 4PPTA 3DO3A 4P57B 4PJ7E 5D1QC 1MLBA 3M1BA 3NZ8B 3TVMA 4P23C 5DMKB 4DCQB 4PUBL 5JHDB 4KQ4L 3IXTA 1KCRL 1NMAL 2YUWA 5KSVB 1I7ZA 3KWWB 4YK4B 3FZUD 3L9RA 5IIEB 3JTTB 1YEFL 4KRPC 4GAYA 5E2TH 4LLDB 3B6SB 5DLMH 5LBSH 5IVXB 3X13B 1LK2B 2Y1VA 4NN5B 3V6OC 3P77A 3X17A 1UA6L 3QIBA 4PJGA 5IQ9A 3LKQB 4PJ8A 5FYKE 1FYTE 4OZFB 4PB0H 3C87A 2CK0H 5HHQA 1WJ3A 4XNXH 5C3LD 1X7QB 2OK0L 1NGYA 2XZQH 4MS8D 1N3NA 2QJDA 1DN2A 1D5ZA 2HLFD 5ESAB 2ZUVA 4R26L 4OM0L 1RVFH 2XY2A 3GSRA 5FYKH 4Z7VE 4HZLB 2VDKL 4JDTH 1C7TA 3MOQA 1WAAA 4X4XB 2VL5B 2HJKA 1J5OH 4XI5D 3MRQA 4YDLC 1IT9L 5GJSH 3D85B 4ACPA 1FPTH 1HHJA 4L4TD 4PJDB 2BXZA 3LKSB 2Y23A 2WSKA 5BXFA 3JTSA 1NCDL 4ODUB 2R0LH 3QUXC 5C0ND 1DQML 1ZLSL 5MEOA 3NFSH 1S5HB 5HYEA 4R97C 1T2QL 4OCRL 3K8KA 5JORB 3VW3H 1RU9L 2DQUL 3RA7H 1L7TH 4KVNL 5FF6B 1SBSH 3GMLA 1AXIB 4YEFA 4LAQH 5GS2H 4BH8A 1N4XL 3FAXA 1ZA6B 4LCIH 1I1CA 1UZ6F 12E8L 1BVKB 5D1XD 8FABA 3MRIA 4RFEB 2FWOA 3H3PL 2HVJB 4KTEH 5HD8C 1J18A 5L8JB 1KJMA 2BVQA 4XVTL 4HLZH 1MCKA 3OKEA 3HNSL 3VFUA 3IDUA 3HE6D 3K4AA 3LDBB 5C7XL 1CXKA 4LCWB 3T0WA 1II4E 2CJUH 4XMLH 1AGCB 4Y16D 5LGJB 2WUBL 1T89A 5E7FA 1M05B 3RUGA 3PDOA 4J8RA 5D1XA 1YDPA 4Y5VA 4YBHA 4D0BB 5JMOC 4PJXB 5CBAB 1OTTC 5EU7E 4EOWL 2ZJSL 1JL8A 2ADFL 4JQXA 3CSPA 5FEBA 1EUTA 1KB5L 2BSTB 5HDQL 3F5WB 5EU4B 4WJ5B 4F8QA 1IEHA 5D7JD 5I1KL 3S5LB 4M8VA 5CEZD 5EO1A 5CHNB 2A6DA 2Z31C 3AM8C 5EBWA 3L3IB 4KUCF 4UMGA 6FABL 3RWIA 1EEYA 1F3DJ 3NN8A 1KXVC 4KUZH 4DZBA 2CKBB 1NAKL 1K4CB 3EDKA 2KBGA 4K8RD 1MJJB 4RFOL 5FFLA 5MEQA 4JFOA 4ZUWA 3C60C 3RWFB 1Q72H 3HAEG 3H9YA 1I1FA 1B0GB 2VDQL 4MVBC 3E6FA 5F88A 1OP5H 1HXYB 1BJ8A 1RUKL 2CDEA 2BVOB 1ETZA 4BFBD 2VXVH 3HE7B 3AC0A 3GI8H 1AIFB 2X9YA 4HG4J 5IF0B 5C07E 1V3KA 2D3VA 3RNKA 1G6RA 1AC6A 3VCLA 4NCC2 5HVGB 3ZKSD 2VLRD 1AD9B 1ZHBB 4B5EA 3MJ7B 2AXGB 1B6UA 1BZ7B 3MA7B 3OF6D 4J3XA 5GSVB 1NDGA 3IFNH 3TFKD 4PJCF 5LXGL 1GHFL 1LO0L 4P5TC 4QCIA 2R0KH 5CJ5A 5C0BE 1SYVA 1MIMH 1LK3H 5D1ZB 2X42A 2VLRA 4A2MA 4JRYB 5I8EB 2N1KA 5F7FA 1JPST 1R6VA 2MCPH 3OF6A 4PTUA 4ODXA 3WO3B 3V5DB 5K9OB 5DMYA 1IAKA 3BP4A 1C8PA 2JJSC 3S37H 5HSFA 1AI1H 4OQTH 5DQDL 2EE6A 4OV5B 2W1NA 1UWGH 4HSQA 3DNKA 5HGAB 1MOEA 1YQVH 3DBXA 4QXUH 3PWUB 1A6AA 1FBIL 1WFNA 3LV3B 1WFTA 3EJZC 3CFCL 4L8DA 5FYJE 5D7LA 1MVUB 5KJRL 1ZS8B 2PXYB 4JFEA 3ULUC 4JKPH 5CS7A 2D03L 1P9MC 5EBLA 5C09A 5E8EA 1Z2KA 4PJ9B 3CMGA 3O6FB 4RGND 3MV8E 4EIGB 3NFNA 3QIWC 4M7LT 5FYJH 3SDCD 5A40E 3MLZH 3FQUB 1QNZL 2OTUB 4M43L 3WUWB 5BRZB 3IAGC 4U1GB 1KJ2L 3FN3A 4OZIE 3SDYH 2BZDA 1A4JA 3DSFH 3HC0A 3EOYG 1CGXA 2O5XL 3RTQB 3QI9D 4AMKL 3VD4A 2X70A 1A6WH 5EUKB 1HH9B 4F33B 3B4NA 5HJ3B 2BDNH 3O2VH 4XMKH 3KR3H 2XKUA 3EYFA 5IW1B 5MENB 1BFVH 1A3LL 2W9DL 3C5JA 3TVMC 3FN0L 2VDLH 4CN6A 1F6AB 2D4DA 4DGYH 1JHLH 2XWJB 1N7ML 1D7FA 1DUYB 5E9DD 4M7KH 1Q9WA 3FKUS 1SHMA 3MLWL 4JE4B 1JHTA 1I7UB 5A2LH 4TQEL 4X8JA 1C12A 5C1MB 2HTLC 2XXCB 3BGFB 3V6FA 1Y0LB 3V5KB 3OR6B 4ZUSB 1U8PB 2ICCA 3I50H 4PJ8C 4XZUA 4GW4A 2Q8AH 3DX8B 2JLLA 2LABA 3X12A 1RIUL 4BZ1L 2NW2A 3WIFB 4YBQD 2CDFA 3KPTA 4QYOA 4L8CA 2APTA 4P46C 1D5IH 1HNFA 3TJHD 2W65A 2O5ZH 4EXPX 2AV1B 4YC2C 3TWCL 5E6IA 1XIWD 1UACH 2R56H 2LU3A 4X5XA 2M8XA 5DHVH 1A6TA 2L4OA 4W4OA 4TNWK 5IFJA 1SM3L 1BQHB 2H41A 3QRGL 4D9LH 3GJFK 3VG9C 3ULVC 1AO7B 1I9RL 1CGVA 2X4PA 5J13C 3TBWB 3K2UH 1EVTC 4Z6AT 3W11D 5FB8B 3BMVA 4X8XA 1S7UA 4O2FB 3NPSC 5E2TL 4P3CH 2D7TH 4LSTL 1PG7X 4P2RB 1FG2A 1NC2D 5KSBE 1MREH 4XH2A 4JCLA 3U0PA 1W8NA 4FZ8H 1EHLH 3MJ6A 4ZSOB 1K4DB 2XZQL 4M5ZL 5E03A 4TTGA 5C0FA 1RUPL 4I48A 4KJYA 3WLBB 4EI6A 3LKPB 1NKRA 1AGDB 4NZUH 3SJVD 1SJEA 4Y19D 5FYKL 1KC5L 5IB1B 1UXWB 4UU9A 1QSED 4XP1H 3UZVB 3SDDD 2HVKB 3U9PH 1RZFH 5IOPB 5L6YH 4JO4H 1BP3B 3Q3GB 4Y4HC 1ZLVH 4JQXC 3VH8B 5C0IB 5I75B 4OTXH 2WM0A 3K8MA 4YGVA 5DRZA 4NQCD 2R1WB 1S9XB 4JZOA 1GC1C 4ZD3H 5E6ZA 3CAFA 4D9RE 2VAAB 4WUUD 3LKOB 5F3BB 1ZT7B 3WDIA 4U6VL 3AREB 4FOMA 5ICZB 1L7TL 4I5BB 5I1CL 2NY1D 3KPLB 1PYWA 4LPXA 4Z9KB 5IMOA 1SBSL 2DTMH 3RGVC 1MCCA 4LAQL 3V4VL 4LCIL 3LH2H 1UWEH 4LARL 5D4QA 5EU6A 5ALCL 3KJ6H 4KTEL 1T5XB 3QULB 2ATKA 3MRKB 3CVIH 1DBML 5SX5K 4EUPB 3PWLA 2XA8L 5E1AA 1P7QB 2XKNA 2YD4A 4DGVL 1N59B 3VU2A 4FQ2H 1OAYH 1FO0L 5INCA 4L8BB 3U7WH 4KV5E 4I1NB 1QFHA 1Y18B 3GSNL 4K3EH 2G75A 3D87B 2XQBH 1RUQH 2J4WH 5FO9B 2O5YL 3LEXA 2FHCA 2WWKT 1BD2D 4YQXL 5T1MA 1ND0A 3VXSA 2ICEB 3U6RA 3DI3B 5DJDB 3EO1A 3UJTH 1OTUD 2BVUA 4XMPL 2JCCB 5AZEH 3DARA 4XAKD 1FE8L 2RFXB 1IAOA 1UH2A 2FIKB 3L7FA 3GK8L 5CINL 1FDLH 3U48A 4QTHB 3WFCH 2Z8VC 1IGCL 5F7LB 2EC9T 1OY3B 1AQKH 4NBZB 2JJVA 3JWDH 4MCZA 5HI5D 2QADC 4Z76A 2JB6B 1DL7H 1RZIA 43CAB 1E6JL 4AIZB 1JZ2A 2NLJA 4XC3H 3O8XD 1JF1A 5AEAA 3KG5A 4P99A 4MQXC 2OQJB 3IJHA 2V5YA 1JP5A 2VWEC 1LEGA 2J1KA 1MFAL 1Z9LA 5ENWA 4EIZC 4JREC 4LCUA 1JGVH 2BJMH 3GI8L 1KIPB 5B8CB 2J88L 4PRPD 3VGAC 3LN4A 5JPMA 3NACH 4NQDD 1WTLA 1N26A 2QHRH 4X98A 3S88L 4CUCA 4HK0A 5HHMD 1QSVA 5D5MB 2VXTL 1V3MA 4GXUN 3TH4T 4YO0B 1GZQA 3OGCB 1WEJH 4CMHB 1NAMB 1DEDA 4AZ8A 5TGBB 3RVVD 4Y89A 2R0KL 1A7PH 1AQDA 3H9HA 4MHHG 4OZHB 5IMLB 3QISA 1F8TH 1MRDL 2NY4D 1KPUB 4Z7UA 4PJ5E 2R1YA 1KNOA 4YR6A 4GG6E 1OF2B 1KCSH 1HIML 1X44A 4JM4L 3OZ9H 2W0PA 5F1NA 3MLVH 3CFDA 3ECBA 3K2MC 5FGBC 3FCTB 3EYOB 4XPBL 1F42A 5HGGS 3SY0A 1MAKA 4OD3L 1UWGL 4P9HH 1B0RA 1A7BA 1NCCL 1YQVL 5EC1B 2FR4A 3F7VB 3VXMA 4A6YB 4Q2ZA 4MNGE 3BZEA 3BUYB 1LO4H 2D7PA 3HRZA 1INQB 2AV7B 5FIEA 4QRQB 4DZ8B 5EPMA 5EZIL 1S7XB 2DQIH 1QSFB 4JKPL 3V79C 5D2LF 4I77H 1KYOJ 1BBDL 1IZJA 5D2NB 3MRGB 4WV1C 3DWTA 2NY3C 2DLFH 1CQYA 2EICA 5FYJL 3QWQB 3BH8A 5HHOB 3TA3D 3I2CL 1HKLL 2ADJB 2DBLL 2ZUTA 4F7CA 4YXLH 2A83A 3JUYA 3QO0A 3CU1A 2QL1A 4X7DC 3VFOA 1SQ2N 3DSFL 1EBPA 3FJTA 2ICWA 5ESVA 4L3ED 4BSVB 2HFFB 4NQXA 3QNYB 3LSOA 3TA3A 3DV6B 4JR9H 2BDNL 2OSLB 4XMKL 5AUMA 3KR3L 1JGUL 3ARVA 1Z3GH 3QCUL 5LQBH 3BI9X 2UVEA 3CUPA 2J2ZA 4HC1H 5CILH 1FCGA 1JN6A 1ITBB 1YEKL 4YDJB 3VWJA 4H0HB 4DGYL 2KL6A 1JHLL 5FAAA 4GKNA 4M7KL 1KT2A 2PR4H 4NRZA 4KK9C 4FTVD 3AAZB 1FNEA 1NFIA 1YY9D 4G6JL 4WTZA 3HLAB 4V1DE 5I76B 1T0MA 1LHZA 3F7YA 3E2HB 4HFUH 2ZUQB 2OJZL 2XRAL 3EOTL 3BQUA 4NNXB 4BQ6A 3DX6B 5HY9A 4CVXB 1JZ8A 2AJZA 4M3JA 1W2KT 3I50L 5DURB 3LQZA 4PJBA 2HN7A 1S7QA 1QLRA 4EI5A 5BZDA 5D6CA 5JW5A 1IGFH 2Q8AL 3LRGA 3OGOE 3FQRB 4J2XA 5C0RL 4MZ3A 3QUYC 4X6BB 3V4UH 3FQNB 1D5IL 5KSAB 1AXSB 2RQ8A 1J0IA 4XPGL 1NGZA 3Q0HA 4OCLC 4HT1L 43C9B 1BMGA 3B5HA 2CH8A 1UACL 4GBXA 4O58L 1G7QA 3TLRA 2HTKD 4MJIA 4QHMA 2DYPD 3SE9H 3QWRA 3TZVC 2FX7L 2X89D 5SX4I 2G5BA 2VXQL 5HHVL 4GSDL 2Y6SD 4HGWB 1P7KA 2IAMB 3BZFA 3K2UL 1TZIB 4N9OB 2VLKD 4WNQB 3FB7B 2C3GA 4UV4L 3ARFB 3I6GA 5DJAB 5D96C 3PNWB 1DLHA 3D1MC 4NFCA 5GGVY 4LDEB 4PJAE 2EEAA 2X89A 4UB0L 5E2JA 2COQA 5D93C 1TNMA 3RVUD 3BHBA 3MV9B 1WV7T 3O9WB 2YRZA 1JZ5A 3K3QA 3CFJB 1EHLL 2VLKA 3GBNH 4P2OD 1DN0A 5F1OB 3GSUB 1ED3A 4OLVL 3S35H 4MB4A 3K46A 2DBJA 4CMMB 4O9HH 5C0EB 3NZ8A 4NZUL 1U2CA 4OZGF 3B5GA 3ROOB 1I1AD 2Z92B 5LGHL 3DX9A 4YIQA 2ERJB 4YHYB 4G8GB 2NXZD 3NTCL 4OIIL 2CXKA 3B5TA 1VGKB 3KWWA 3VGEA 1IAIM 3TIEB 3VXRE 5JW4N 2QKIB 2ITCB 4ZD3L 2B1AH 1X5LA 3X13A 1ORSA 1ZHLA 2W9EH 4NOBA 4PJIB 5DDHB 3FL7A 2ORBH 3PF2A 5FCSH 4OZFA 5SWZE 3ZLQC 4JDZA 1XMWA 4PJHB 2DTML 3ISWA 1LO5B 3NABL 5DJYB 3LH2L 3KJ6L 5EUOE 2ED8A 2J8UF 3CVIL 4HJJL 1NANI 3T0ED 4N0UE 4ORGA 5BV7H 4U6TA 5J12B 2V2XB 2F74B 1X6LA 4KKLC 4GRWF 1OAYL 1IFHH 3U7WL 4JB9L 1KOAA 2YHGA 4KVCH 3KLAA 4M93B 4PJDA 4XBGA 5KS9E 3MROA 2XQBL 3NMEA 1RUQL 2EDTA 2GI7A 3OG6B 3IDMB 1YJDL 1BFSA 3G9AB 5A3IC 1S5HA 3VWKD 5F7DB 5JORA 3BD4A 4JHBA 3GJFH 3EGSA 3SDXE 4XRCA 2XTJB 3C6LD 5DK0B 1ZA6A 1SY6A 1BVKA 4RFEA 4NJ9H 1U8HB 2O26U 4P5MA 3PWPE 4WRLA 4QHLB 4HDIB 4ONGH 2N4IA 1DZBA 5GS0H 3JWDL 4KMTL 4PREB 4NOFA 3O0RH 1DL7L 4Y5YB 3DYMA 3QXTA 1M05A 3RL1A 1P4LB 4FFVC 2BY1A 5DO2C 5F6IB 5IVZA 2KH2B 5E8NA 3E6HA 1RFDL 5JDJA 1JGVL 2BJML 1LD9B 4AL8H 1J86A 5GGSY 1RZJC 2IAND 2BSTA 5ADPH 3KYMA 1F90L 3F5WA 3D39E 2CMRH 1CN4A 1ZOXA 4WJ5A 1X6NA 1P1ZB 2K1MA 4KAQH 4EN3B 4DUXA 5I1HH 3BKMH 1L0XA 4JFDB 1A1MA 1BOGB 1ACYH 3BEVB 1HEZB 4D9QE 5EO0B 1AGBB 5CHNA 4ESKA 2L7UA 4QRRD 3L3IA 5I71C 4K3HA 4U1NB 4KRPD 5K9QI 1A7PL 1NUNB 4RISH 2CKBA 4XPAH 1FFPA 2VXSH 4C55A 4DKEL 2BNRE 3X11A 2ZNXA 2NY5H 3IAPA 3ZKXB 1MCHA 2R9HD 3LQAL 2FZ3A 1MFCH 1YEJH 5C08B 1HXYA 4PBVC 2BVOA 5SX5H 3TBSB 1WWAX 5IF0A 1SYSB 2V7HB 5K9QG 4WI6A 5I15H 5DF0A 2V5RA 3NH7H 4U7SA 5BS0D 3TT3H 2LQRA 2B8OT 5EOCH 5EG6C 1LO2L 1X9QA 4FRWA 5CP3H 4CKVX 1AE6H 4WGWB 5GSVA 2EYSA 3P9WB 4FFWC 5ID1B 4FABL 1CDCA 3BRDA 1KIRA 4GG8B 4JZJA 3C09C 4WFGD 2AERT 1X5YA 4DGIH 3BZDA 4I77L 1IE5A 5IHUL 4JRYA 1OAKH 4TSBH 1D6VL 3MO1B 3MBXL 1AR1C 1J0ZA 1ONQB 4UT7H 2DDQH 5E94B 3BQUC 3Q5YA 1YJDC 3HUJF 2FSEB 3DV4B 5C9JB 1K8DA 5KSUB 4YXLL 2I07B 1VFOA 4WTZG 1QFWM 4X80L 4OV5A 4I2XA 4PRHB 4ZNEA 2EH7H 5D72L 4QTIH 3EIFA 5H37H 4ODVH 1QR4A 2VZ1A 1E4XL 4IM8A 1IILE 3LV3A 3RZCB 1QP1A 2P5WB 2HWZL 3QEUB 1IKFL 1N6QH 1MVUA 1Z3GL 5LQBL 3RY4A 1N6UA 2PXYA 4JKLA 3QFJD 4HC1L 3ZDYF 1P84K 3ILPA 5IROA 1ZVSB 3QEQE 4OM1H 3WL9B 4IOFC 4PJ9A 5DFVD 3FHAA 1GRWA 3FMGH 3O2DH 4M6MH 1IBGL 1X4XA 3HC4L 2OTUA 3MA9L 4LCCB 3AVEA 5HVHC 3IDGA 4JRXA 3CLEH 3WD5H 4HFUL 3S98A 4KI5E 2A1WL 1IM9B 4LBEA 4LPWA 3WBDA 3RTQA 5SWSB 2JB5H 1IGFL 5IR1B 5EUKA 1HH9A 4F33A 4NUGL 5HJ3A 2Q7YB 3BE1H 5IW1A 5MENA 1H8NA 4B53A 7CGTA 4L4VE 2GJ6D 2IPUK 1CL7I 1F6AA 3ULUF 4LRIA 1FAIH 2XWJA 2BC4B 2G5RA 3LKRA 5SV3A 4EQ3A 4J4PD 3TYGH 4P2QA 4YK4C 1C16B 3K1DA 1OSZA 3TV3H 4X4YB 3OAZK 3SGDI 4F58H 2YEZB 1ZTXH 2DJUA 4H8WH 1CDUA 3Q48A 4XNYH 4PS4L 4JY6A 2H9GB 2Z35B 3CH8A 3TH2T 4KJPC 3AROA 4NN5C 1XF4B 3V5KA 1LDPL 4OF3A 3PUCA 4J4PA 1JTOA 1U8PA 1GGBH 4X6DB 1F2XK 3WXVH 4Z7WE 1CLYH 3KPSD 3DX8A 2DS4A 1LP9F 3SGKA 2BMKB 3VXNA 4NQED 1IKNC 1F6FB 4F37F 5DTFA 3GMMB 3SOBH 5CSZB 2BNQA 3MUJA 3QQ4A 1CLZH 2IG2H 4I0PB 4OZFG 1QPPA 1KACB 3KPQA 5I1JL 4H20L 1UM5H 4HUNB 3DSNA 5C0JB 2YD5A 4WEMB 5IB4B 1QRNA 3PWVB 4HMCA 3OXSA 1U3YA 4O02H 5GHWH 1WISA 3EYQC 5DRWA 1MHHB 2VLLB 2P46B 4GQ9H 1T7VA 4I4WB 4JEGB 1AO7A 5EORH 1S9WA 2HT3D 3ZKNC 1AD0B 1LNUB 1I1RA 2R2HB 5FB8A 3GHBH 4QHNB 3LEVH 4YHLH 2YD7A 4F7EA 3QQ9C 3DVIA 4PJGF 4R4NC 5GGRA 1PX3A 2B1AL 3QIWD 1L6ZA 3D3VD 4LMQI 4P2RA 4WCYH 3DO7B 3WFDL 2GTZB 4PJEA 1JBJA 1FZMA 3IJSA 1E0OB 3W0WA 3GUTB 2XWBA 3N85H 1RUAH 3LDBC 1MELA 3WLBA 3VGHA 1BHGA 4WFHE 3UTTE 3KPMB 1AGDA 1GIGH 1F4AA 4E5XB 1WAAF 1GGIH 4WW2B 3MRDA 5IB1A 3DMMA 4J6RL 3LN9A 1IQDB 2X4UB 1WT5A 4Y5XB 3WCYA 4NO0A 3Q3GA 5C0IA 5GS3A 1RZ8A 4HWBH 3QNXB 3QIUB 2R1WA 1S9XA 3R8BB 2YUXA 3K80A 2F54D 4ZYKB 2VAAA 4X9GA 5HDBF 3LKOA 1ZT7A 3EYSH 1TVHA 3AREA 5ICZA 1XR8B 5KAQG 1L0QA 2R4RH 5I17B 2O61B 3JV5A 3MUHL 4TTDD 3G5VB 4C59B 3WIHH 2VDRH 4JVPA 1I8IA 3RWDB 1R5IB 3GBMH 3GHEL 3MRKA 3RI5F 2HYMA 3I84A 3WSQL 3RUGF 2E6PA 3CVHH 4JPVH 1FVCA 1JI2A 1N59A 4JFQA 2NCMA 4P46D 4K94H 4WEUD 2GAZB 1OAQH 1INEH 3VRLF 4AT6A 3HE7C 3IYLW 2N56A 4JDVA 1Y18A 4PV8B 5BQ7B 1FZJA 4MNHA 2QR0B 1CBVL 1IMHC 3H9SE 4OCWH 1VENA 3UJIL 1JF5A 4RMVA 1NKOA 4Q6IB 1K8IA 4LSPH 3ULVD 1B4JH 5D1ZC 1IAIH 4XAWL 3GIZL 5I1GH 1MFDH 1FJ1B 4HQQH 3NAAH 3VMPA 5HHPA 4RISL 3ARGD 3SE8H 1JI1A 5GJTH 2OZ4A 1YEGL 4F57L 3QRFM 3QG6B 43CAA 4L29A 1U91B 5EC2B 1NL0L 2OQJA 4M03A 4ELKB 5DRXB 5FA4B 1YEJL 1C08B 1OAUH 1OARL 2YUZA 4LSSH 4PR5B 2YOCA 4YFEA 2ICWJ 1MY5A 3DX7B 5CLTA 5I2IA 4UINH 5ISZD 2PXYC 1FNSH 4KHXL 4Y4HD 3WS6A 3KXFE 2DI7A 3OGCA 1NAMA 4C56A 4PJ9C 3O6FC 4XVSH 5D70L 1CXLA 5T3ZH 2VKWA 3UJJH 3FQTB 4DGIL 4JFFE 5ISZA 1J88A 4B0MM 5IMLA 4MNQB 5FK9B 3H3KA 4TSBL 2J8HA 1JPGA 4KK5C 4U1GC 3RY6A 5DK3A 2IH3B 3L6FA 4UT7L 3D2UB 4BZ2L 1OF2A 1AKJD 2X41A 1OGAD 2BCKA 2AK4D 4JO3L 4S1SL 3IFPB 1NSNH 3EYOA 5GGVH 3RTQC 1ZWIB 3BEWA 1UJ3B 2X2YA 3Q1SL 1ZSDB 1LE9A 3C8KA 1EJ6A 3MOAL 1VFBB 4ODVL 2HJLA 4WY7H 1CD8A 4LLMB 3QNZB 3BUYA 4YZFE 5K9KB 2AV7A 2R2BB 2H26A 1YEEH 1EGJA 4DKFL 3MCLL 1QSFA 1IC5L 4FQXB 1JWMA 3CFEA 4OM1L 2Y7QB 3TO2B 1WTGT 1B4RA 5GRVK 1MPAH 3BGFC 4H1LA 3EHBC 2WANA 5CD5C 1EUUA 4YDKH 5HHOA 1HDMB 2ADJA 3G5XA 4UAOB 2EXWD 5D71L 4YDVB 2I25N 1HSBB 2IMNA 3VD5A 3RNQB 1RMFL 4Z8FL 3P11H 4BSVA 3QDJE 1IGTA 4ZAKB 2H32B 1KJ3H 3H42H 1BJ1J 3VFVA 3DV6A 3AGVA 3QP3A 1YA5A 1FZKB 3BE1L 4O2EB 2OSLA 4OLZH 4GW5B 5TH2B 2AABL 2YBRA 3FT4B 4J3UA 2VR4A 4L9LB 3RWJB 3B8YA 3FB5A 1JZ7A 3H0TB 2FCBA 1T2XA 2Q7NA 4FNLL 4MXQC 1FAIL 5EWIL 1XF5B 1XR9A 5JOEA 4G8EB 3T4AB 5J9PB 2CK2A 4WI2A 4HH9A 5FM5O 3MRHB 1XCQB 4F58L 1ZTXL 1IL1A 2FHFA 5FYKD 1FYTD 3LB6C 3S37X 4NNXA 4X6CE 1DR9A 3DX6A 4TVPE 4CVXA 1MCFA 1T66C 4AEFA 2F19L 3BIAX 5JW3H 3QJHB 4U6HA 3DI2B 1B2WL 3U4EB 4OLYL 1VHPA 1FYTA 5BV7B 3TBYB 2EDNA 1AXSA 2IG2L 4DKDC 1J87A 3MCG1 4O5LH 2X6MA 4TVPH 4KWUA 4PLNC 2DF3A 43C9A 1UM5L 4LSVL 5C6PB 1DBAH 5AWNH 5KW9L 4ERSH 1YZZA 1SBBA 2IMMA 4Z7VA 5GHWL 2YPLD 4NYLB 5I75C 3OMZA 3HC3H 4GMTH 4PRBB 2VUOA 2V5MA 4PYGA 3OKKB 3GRWL 3GJFB 2AGJL 3PQYE 4HGWA 1TZIA 3FB7A 1GPOH 1SJHB 3GHBL 3BIKA 1PLGL 2GEEA 3HPJA 2F53D 2ZOLA 3AREC 5DJAA 3W9DB 1UENA 1MCEA 2WQRA 4NO2B 4KZDL 2LU4A 2X4SB 3VFSB 2AEQL 1FIGH 3LPWA 4DN3L 2A73B 3MV9A 4HPOL 4WWKA 5C0AB 3HS0A 3O9WA 3O4OB 3V52L 4A6YL 3CFJA 1BIIA 3ZT7A 3GSOB 5CGMA 4JPIA 1NBYB 3N85L 3QUZD 4YNYA 4DOHE 4PRIE 1G7HB 3GSUA 3RDTD 4WO4D 1X5ZA 4FQQA 4OLXH 3QDGB 4G8FB 4YHMH 3WE6B 4YFDB 3ROOA 2Z92A 3TO4A 3L7EB 3VJ6B 2Q8BL 1T80A 4RIRB 5D7IB 3QUZA 1VGKA 3GFUA 3RDTA 4WO4A 1FZOB 3C2AL 3MJGX 1YPZE 3ZTNH 3VFMA 2QKIA 4RBPK 4L3AA 2XZZA 4CU8A 5D7KE 5CEYB 2DOCA 3GO1H 2DLGA 2BNUA 4PJIA 4LQ1A 2ARJB 3OAZH 4KK9D 5DDHA 1NMCB 4IMKA 4NZRL 5IK3A 1F13A 1KUMA 1UZ8A 3S34H 4MJ6B 4XP9L 1MEXH 4WWID 3MLYL 5F1IB 2PF6A 3OR7A 2UY6A 4OF5A 1M4KA 1KEML 1F4XL 1ZA3B 5C70A 1CZ8H 1CR9L 5LG1A 2F74A 5C07D 3MRNB 3QUMB 4K94L 5L7XL 5F97E 3KDMB 2FX9H 3WFBH 1CF8H 5B8CC 4GRLB 2NX5E 2YPKB 3U4BH 1FC2D 4XCEB 5C0BD 3L3KA 5F7DA 1ZLWK 4TRPH 4CMHC 3TZVD 5L2KE 4S0TD 3FB8A 1S8DB 1M7IB 3VXUB 1P4IH 1MWAH 1V7MH 1I8MB 4HXAH 4G80A 1OWWA 1U3HD 1B4JL 2EDLA 2VOTA 1CK0L 4H88H 1IAIL 3C5SB 3D9AL 1U8HA 4EXKA 3BJ91 3UDWA 5ACZB 3WHXB 1MFDL 4ZFZB 1KLGB 3NAAL 2OL3L 2VITA 4HQQL 5GGQL 2E7LA 1U8MB 3G6DL 4JFPB 4OQTA 4PREA 3QFDA 4XPTH 4IDLA 4APQB 3EJJX 1U3HA 4Y5YA 3T3PF 4XCYB 4N8CL 4DFHA 1P4LA 5M94B 3WXWH 2E7MA 3QHZH 4DN4H 4Z0XA 1NBZA 3NIFF 4KPHH 3G5ZB 1OAUL 5FYJD 3VXTB 2DMBA 4KY1L 2DI9A 1LD9A 1MJUL 5KBNC 2NY2B 3OAUH 4NQVB 3MNZB 1ORQB 1NCNA 3MV8D 4N90E 4K7FA 4HGKC 3FO1A 2AEWA 4HWZA 3TNMA 1T7WA 1BOGA 3BEVA 4J1UB 5D2NC 5EO0A 1AGBA 2QSTA 4LASH 3GMPB 1CFTB 1UG9A 5ICXB 4Z7UF 1FGNH 4Y4KD 4XHJD 3UXFA 3ZDXF 1PSKL 4H1LG 3MZGB 4PD4K 1NCWH 1ES0A 2I26N 3MMEB 4HK3J 4BSWA 5B39B 1IC7L 1JYNA 2QQQA 4Y4KA 2HT4C 1E6OH 2BRRL 4LKXB 5J8OA 3QCTL 4HFWA 4Z0BH 2BVEA 3F7RA 1HHHB 3G04B 4WI4A 4LAJH 4RAVB 4WY7L 4NM8L 5ID1A 1OB1B 1L9MA 5IB2A 1P5VA 4GG8A 1OAXH 5HGHB 2HFEB 4RCAA 4WI3A 4LP4A 1T21A 5A3ID 1S5IH 1C7SA 1LVEA 3MO1A 2YD3A 3KYOB 1MUJB 3E2HC 4Y2DD 1MFBH 2ZUQC 1DQJB 4PV9B 4YDKL 5E94A 3VGDA 1NGWB 4F7MA 4P4KD 2FSEA 5KSUA 1CU4L 2I07A 5FO7A 3ROLB 3DGGA 3FOLB 2RCSH 4LLWA 4N5UA 1OAZH 3HB3C 1UB6A 1FNAA 4X99A 4RQQA 5E0QA 5KSAC 5DHYB 4Y2DA 3BGMB 5DHVA 3GKWL 1KJ3L 4FFYL 4PRNB 2VZSA 1J0KA 4P4KA 4PJFB 3RZCA 3QEUA 3WMSA 2NZ9C 2CQVA 3VXQA 1WBYA 4XCFH 4B41A 1WSST 1NDMB 1ZVSA 1AC0A 4Q9BA 5F8RC 3E8UH 2C1OA 2OM5A 1DQQB 3GB7A 2NY6D 2APBA 1ZXQA 1Q9OB 4YXKH 2IAMC 2I27N 4NKDA 3ARFC 3OHXB 2QTEA 4LCCA 5D2LB 1MCOH 4LSUH 5CEZE 3DTXB 5GZOC 5IFAH 2X05A 2ZCLL 1UYWH 4M4RA 5ICYB 3IETA 4EJ1C 3PIQA 1D6EA 3BMWA 3MV7D 3RPKA 1IM9A 3V0VB 3O9WC 5SWSA 4FA8A 4I3RL 5JW3L 4K23H 4X7TB 3EDEA 5CEZH 3LIZH 3V6ZA 1BLNB 4NO5B 5KSBA 1G9NH 1UZ6E 4HLZG 1BF8A 2AK1H 5DMGD 2HA1A 2VXUH 3BPNB 4OD1H 5DFWH 5I0ZA 2YA2A 1QFWL 5CD3A 3JWOH 4ZOEA 2ERJC 4K8RH 2P8PA 3DHJA 4YHYC 4HUKB 3DIFB 3O6KL 3O3EB 1U3JA 4M9PA 5EO9B 1OT2A 5E5MA 3FT2B 5I8CA 5DD1H 1C16A 1I3UA 1TVDA 2E7HA 4GAGL 4X4YA 2PYEB 4BQBA 3HC3L 2FH6A 4UZGA 1E4WH 1JFQL 4RX4A 1PEWA 1G9ML 1JGEB 1OD7A 1EDQA 5IBUG 2H9GA 4NKMB 1XGPB 4IOIA 4U7KA 3ES6B 3UTZA 1GPOL 4Z7NF 1BREA 4OIAA 4ETQA 4X6DA 2MOVA 3HR5B 5C0CD 2AJXH 2BMKA 2EIZB 4ZOBA 4H5SA 3GMMA 4TUOB 1KCUH 25C8L 5HYSB 5CSZA 5M95B 3VI3F 3CVHB 2X4TB 3EDFA 1MI5D 2GFBB 3HMXA 4OCXH 5T5FH 4QRPD 3IU3B 4W81A 3V7AE 5C0JA 2Z4QA 4IRJB 5IB4A 5J12C 3SDAB 4WTXA 2W0FB 4N9GB 1A6VH 2EIEA 1JWUB 4N8PA 1JHKH 1U3ZA 4IRSB 4PG9A 5JQHC 1HH6B 4YHML 5EU3B 4JHZA 2XIDA 4GUPB 35C8H 4M93C 4EKXA 1MHHA 2IH1B 4Z5RB 5L9DL 1NCBH 3T0DA 1FC1A 3UTSB 3BRGC 3MUY1 4E42B 4RWYH 4QHNA 2OTWB 3OQ3B 4NNPH 1A14L 2A6JB 1FP5A 2F58L 1FL3B 2XTJC 3GO1L 1CD1B 5IBTL 1VEMA 1T0NA 3VFGH 2HKHH 1AXTH 4PJCE 2BSSB 2K7QA 3UDWC 3GUTA 1O7SA 1ADQH 4N0RA 1MEXL 3VMOA 2PW2B 3I75B 3ARPA 3IJYA 1NGQH 4Y5YC 1CGTA 2XZCH 3KPMA 3T77A 4E5XA 3MFFB 5J1AA 3FTGB 3QEHB 5JXED 1CZ8L 4KRNA 4WUKH 2A6IB 2X4UA 1JUFB 3T0XA 5F6IC 4PJDF 2UWEE 2VLME 4Y8AA 5DJXB 3FFCB 4OSUL 2MSPA 1YEIL 3A6BH 2FX9L 2EEBA 1CF8L 2VH5H 3QNXA 4YHOH 3QIUA 1FN4B 3G5YB 5LWYL 2EYTB 5JXEA 2RIKA 5F7EH 4HHAB 4EN3C 2EH8L 4UI2A 4OFYA 4TRPL 2PUQT 3MRJB 3GSQA 1FVEB 5IMKB 3B9DA 1MWAL 4B7LA 5I17A 2WINB 3O6LL 4PJ5D 4KJPD 3RVWC 3S3JA 3MRCA 3O45B 2H2SC 2VDMH 5I1EH 3O3BA 2H8PA 1TTUA 4Z78B 3S35X 3V95A 2VC2H 5GRUL 3GI9L 3ULSB 3ZKXC 4YPGA 4AEHH 5B38B 3WFEH 4NBYB 2D4FA 3OKYA 4PJXF 2Y06H 4RAHA 2GAZA 5CMAA 4GG6A 2WWKO 2J8UB 2I9TB 3RWEA 1EO8H 4OUUB 3NCYP 4J12A 5BZWB 2Y07H 4KPHL 2DL9A 3FT3B 3RJQB 5KAQF 1R5WB 2EXYC 3MRBA 3HI5L 2QSCL 4R3SB 1IQWL 5FUOH 5ACMA 3EYQD 5GRJH 3LEYL 5MP6L 4U05A 3PHOB 1CICB 3ARBB 3G9VA 1GXEA 4R6UA 4JRWA 3L3OA 4RBPH 2B7DT 2DQFB 4LHUD 2VLJB 3ME0A 4PY7A 1CG9B 1EFXB 2XN9E 1FJ1A 4R4ND 2Q3ZA 3C08H 5TE4L 3U2SA 3LMJL 2P8MB 3G6AA 1A9BA 1TCRB 1X4ZA 1S9VB 3BKJL 1I85A 5I66B 2W0KA 1JGLH 3A6CH 4IDJL 4ELKA 4LHUA 5DRXA 5FA4A 1NCWL 4LCWD 2CRIA 5GXBB 3DX7A 2OP4L 4U3HA 4PTTB 3GIVA 3SJVE 2A9NH 4K9EL 3RZCC 4HC1A 2KUTA 3MOBH 5E2UL 2R4SL 5L88H 5IGXL 1W72H 3ZE0F 1V3LA 3GMQA 4BQ9A 4UDTA 2JTDA 3S8WA 4PP2A 3FO9A 1AY1H 1KULA 1ZLWH 4G9FE 2ADIB 4LCCC 3OV6A 1S5IL 3FHQA 3HG1B 3OPZL 4MNQA 2ITDB 3SEPA 4KU1A 5CIPB 4R96B 2IH3A 4X4ZA 5E08H 4HJGA 1IEBA 1MFBL 1WLHA 3PHQB 1FG9C 1V7NH 3CXHJ 3OL2A 1YNLH 4O2CB 2R1XB 4V1DA 5DMJB 3IF1B 5INDB 3N9GH 3IFPA 5T33H 2RCSL 1OAZL 4MA1B 1DJSA 2F8XC 1UJ3A 1ZEAL 5KVMC 1EEZB 3MBEB 5ACLA 2K9UA 2AAVA 3VGBA 2BX5A 2OR7A 1FH5L 3QR2A 5EN2B 2GK2A 2HAZA 1RZKC 4YUEH 3HE7D 1CWVA 4LLMA 4NQTA 3U9UB 2YSSB 5CEXA 5K9KA 4L8SB 3NCFB 3T1WA 4JY5L 5ANMB 5GGSB 5D9SB 2GSGB 1G7PB 3LPGA 5GS1B 3IFOB 3IGAB 2EDEA 3E8UL 2YD6A 2XXMB 1EEQA 3OKOB 3C8HA 3T0VA 3ZSSA 1T3FB 3HZKA 2EDWA 3VFPB 3HZMA 2DIJA 3HAEB 5D7SH 4LSUL 5DRNB 5IEHA 4IOSD 4XAKE 4YDVA 1UYWL 3WJLC 3PL6B 1ZLUK 3RNQA 1YMHB 3OKLA 1RSFA 3HUJB 4ZAKA 3X14B 1RIVL 4I0PC 4PGDA 5D6DA 4KQ3H 5JOPE 5CEZL 1JF6A 5J4MA 4GKSB 4WDIB 1KTDA 4AY0A 5SWQA 3NA9H 4X6FB 1OGTA 1VFAB 3TN0B 3FT4A 1D9KD 1K6QH 2DM7A 3H0TA 2VB5A 1N8ZB 4NCDA 4PRPE 4NCC1 1XF5A 1A9EA 5K59F 5ITFA 5J6GB 3IRPX 2GY5A 4NT6A 4WENB 1TZHB 5J9PA 2DQHH 3X3GL 4G5ZL 1IRAY 3MRHA 2MWCA 5KVGH 3FQXA 4K9EC 5SWZD 3ARXA 3VXRA 2P24A 1JPFB 4LVOB 5EDXA 3RX5A 5GRVL 2XPGA 3OKDB 5GRYA 1OTSC 4OT1H 4P49A 5DS8B 5BRZD 1QR1B 3C5ZD 1N2RA 1FL5A 4OCXL 1IC4L 4WW2C 1U58B 5T1LD 3AXLA 5TDNB 2IEPA 3PABB 3S4SA 4NC1E 1BBJB 3EDDA 5KOVC 1A6VL 4Y5XC 5EUOA 3C5ZA 4U6XB 4AM0B 4N0UA 4JN2A 4NYLA 1K5NB 4PRBA 3QIUC 3OKKA 2M2DA 3S97C 3GJFA 3HN3A 5T1LA 4U0RB 3EYVA 4U3XA 2AP2A 4HBQA 4HKZA 2H2PC 1UB5B 4JM2B 1HWHB 1SJHA 1AFVH 5KS9A 5IM7B 3W9DA 2B4CL 4PJEF 4NO2A 4RDQF 2X4SA 2YD8A 1YNTB 5HGBB 2ARWA 1J8HE 2RB8A 2WBJB 4PRAB 3VFGL 4LEOA 3SDXA 5C0AA 4UQ2A 4ZUVB 3L95B 1L9NA 3ARWA 4KTDH 3GSOA 1EJOL 1OCWH 1ADQL 1NBYA 1LP9B 1W8OA 4R4FL 2Q86B 1DE4B 1NGQL 4P9HC 1CXIA 3PWPA 1I4FA 4OGZA 5KTEL 5FKPB 4L3EE 3QDGA 2XZCL 2CIKA 1IJ9A 1WBZA 3CIQA 4HEPG 3WE6A 3SKOA 1MLBB 3S9DB 4OF7A 3L7EA 3M1BB 5AAWA 5EOQH 1JJUA 3LD8B 4Y7MA 5DJ2A 3D39D 1JK8A 4NC2B 5D7IA 2VQTA 1J1OH 3S96A 4XTRC 3IXTB 3MX0A 1FZOA 1I7ZB 4M6NL 1YYMH 4LPTA 4XP4L 2D0FA 1H3XA 4MXQD 1BWWA 4JCMA 3U82B 4D9QD 1PW3A 4Q6IC 2J5LB 4CAGA 3TPUA 15C8H 1F4YH 2AJ3B 2Y9RT 4GAYB 2RJMA 2ARJA 4LPYA 5I1DA 5T1KA 3D39A 2DLEA 2ADGA 5AG8A 3P77B 5GGTL 1U41A 3QIBB 4PJGB 4XNZB 2A0LD 2VQ1A 3RP1A 4LP5A 1JIBA 2PCPA 3OKMB 3V5HB 3PGDA 5F1IA 4DAGH 2VDML 4K07A 1NGYB 4JFYB 1T66D 1I85C 4MYWB 1D5ZB 4CBPA 1OW0A 3HZVB 4HMDA 1H8SA 3DURA 3ZDZE 4XXCA 3WFEL 5T3XE 1ULVA 2BNRA 2Y06L 2X09A 4JJHA 3KDMA 3QDAA 1NC4A 4GRLA 4PGCA 2HJKB 5CP3A 4LHUG 4X9BA 3MRQB 3A0OA 2YPKA 1JPSH 5BXFB 3JTSB 4LEXH 2SEBB 3U83A 1S8DA 2KKQA 2JCCF 1YEHH 4JZNB 2PW1A 3HMWH 3MXVH 3TF7C 3GM0A 3DPBA 3ILQC 3RWHB 3GMLB 4L4TB 1KV3A 2CXGA 2JELL 4BH8B 3WFZA 5ACZA 1EAJA 8FABB 2FWOB 5ID0A 2GUOA 3WN5A 2BVQB 3OKEB 3RL2A 3VFUB 1N64L 5B3NA 4XCYA 1JGLL 1Q1JL 1DSFL 1UJ3C 2PO6A 3RPIA 2FATL 3N06B 3PDOB 1EIBA 1ZANH 3V0WL 5D1XB 1FNHA 3VXTA 4HF5H 5DFTA 1YDPB 4Y5VB 2NY0D 3UEZA 1ZGLM 1KIUA 4M7LH 3CK0H 3MOBL 4YGAB 3UMTA 3OWEA 3QEQD 3HE6B 1JYXA 1BECA 1ORQA 5L88L 2HT2D 3HNTH 4Y16B 3O2DA 4NKOB 2LFGA 3RRQA 5TQ0L 4FQXC 4PRDA 3HCVB 1YYLH 4R7NA 4TUKH 1NPUA 3OG4B 5J6HB 2P4AB 2A6DB 1CLOL 2UZIH 5EBWB 4FQPA 3QEQA 5IKCB 4ODWA 1RZ7H 1W0VB 4UAOC 1EEYB 4KI5D 4DZBB 3BIBX 4BA8A 3IDYB 1HHGB 5F7HA 4ZUWB 4N68A 3PGCB 4ZAKC 3N9GL 5DVLA 5T33L 3UPRA 1T83A 4HCRL 3E6FB 5F88B 4CU6A 1VSCA 2HKFL 3H6JA 2CDEB 4HIHB 3TJEH 4EEEA 4ZO7A 1KENH 4XWGL 4L9LC 5HYJE 2Y5TB 1X5GA 3VCLB 1G6RB 3JSSA 4RAVA 4Q0XL 1OB1A 1HHIB 5HGHA 4L4VA 5FYLL 4OZGE 4QCIB 3ORJA 1T1YA 4XPHH 1SYVB 3LCYA 4A2LA 1WVZA 2H3NA 1BF2A 2LTQB 2VLRB 4JGJA 1N5AA 1WCBA 1DQJA 2AXHA 4PV9A 4WW1B 4ODXB 5D7SL 1NGWA 1U6AH 3ROLA 2E6QA 3FOLA 4Z18A 1AHWB 4Y1AE 1HNGA 4MWFA 3SKUD 2X1OA 5KN5B 3NIDF 5BV7C 1KN2L 5E8DL 4HJ0D 1XGUA 5DHYA 4Z7WA 5FDYA 4POZD 2NPLX 3BGMA 4U6YA 1N5YH 3DBXB 1H3VA 4PJFA 4M1GH 4X4ME 4KMQA 2IALB 4HXBL 1K6QL 4L8DB 1TDQA 5IHZB 1CTOA 3QSKB 4JFEB 2IANE 2YK1L 5FUZH 4ZFOA 1A7OH 1UCTA 3S4SG 4GRWE 1SVCP 3QO1A 1Q9OA 3KPRE 2DQJL 4X7SH 3S3SA 2MQ0A 4HEME 2NQCA 3OHXA 3QA3A 5T1DH 2YD1A 2B0SH 4S1RH 5KANI 5KVGL 1EMTH 3CLFH 3TCLB 2W9LA 2H1PH 4WU7A 3G6JE 3WDJA 5GS0C 3V6OE 4E0RA 4XNUH 3V0VA 3O4OC 4W6WB 4RGNB 2FBOJ 1BGXH 4UILH 2AXFA 4X7TA 4Z7OE 4WFHD 5I8OH 5JNYA 3KAAA 3SDCB 3L5JA 1BLNA 4NO5A 5J89A 1Q0XH 1FFNA 2X70B 3OB0H 2AJUH 5IQ7H 2IBZY 2VUYA 3C9NA 1IAMA 4ZO8A 4X7FC 4HWBA 3IS0X 4DTGH 3O3EA 4EDWH 3R0MA 3UTTA 1R0AL 3QI9B 3FT2A 4TNVF 4QOKE 4OGYL 4ALAH 4M4PA 4LIQE 5JUEL 4K3DH 5I30L 1JGEA 1H9VA 4X8JB 1C12B 1XGPA 5BMFL 1C1EL 4WFGE 1NMCC 3L5XH 1AFVL 4G7YL 1CFVH 1F6LL 3WIHA 4S1QH 1MJ8H 5E9DB 4OI9A 3BT2L 4KROB 4TULH 3DETC 2OLDA 3H7BB 4XZUB 3WO4B 4GW4B 3DXAE 4TUOA 4XBEH 5DEZA 3X12B 3CVHA 1J9CT 4HKJA 1T6WA 2GFBA 5EZLB 2YC1A 4UNTA 2NW2B 2D7MA 4QYOB 1ZLUH 3IU3A 4U1IA 3MYJA 3SDAA 2HH0L 2W0FA 1JWUA 4IRSA 1BAFL 2UVFA 4UTBH 1RHHA 4HV8B 5E6IB 5EU3A 1FHGA 4X5XB 2D7QA 1NCTA 1A6TB 2APWA 4GRLC 32C2A 1J8KA 3DGCR 4HULB 4Z5RA 3H9SD 4NKIH 2FLRT 1J1OL 3UTSA 4GRMB 1YNKH 3F58H 2ZSVB 5JLZB 2X4PB 4PJIF 3CX5K 3T08A 1HILB 4Q58C 1YN7B 1NUFA 15C8L 4ZS6C 1F4YL 5I1AA 1FL3A 2FJFA 3HTLX 2YKLL 4PJHF 2VISB 2JK5B 3ARFD 2KDGA 3V0AC 1VFUA 5L8KB 4CN1A 1F2QA 4XH2B 2PW2A 3I75A 3U0PB 1CT8A 2A77L 3RVXC 1A1NA 4APQC 3BKYH 5FGCB 1LE5A 2P5EE 5C0FB 4LGSB 2XWTA 5CWSB 3FTGA 2X1WL 1GVIA 3MRFA 4CW1B 3KLDA 3IU4L 4LLVB 1QTYT 1NC2B 4NDMA 1JUFA 1RK0B 1YECH 2V5TA 3CFIC 3EAKA 4PUBH 4UU9B 5DJXA 1M6OA 3FFCA 4CDGC 1KCRH 3MLXL 1TVBA 1NMAH 2NY2C 4KKAC 5DJCB 2VN7A 1T03L 3G5YA 4G8GD 3U4AA 2EYTA 5CGYC 4YGVB 3RFZC 4HHAA 4XWOD 3SQBA 4Y19B 5T3XL 4NWUL 2A9ML 1HXMB 4HWNA 3MRJA 1QSEB 4JFFD 1F5WA 1FVEA 1IC1A 1RIHH 2AVGA 5IMKA 3SDDB 1PD6A 3MXVL 4QHUB 3KXFA 3THML 1MHCB 1TLKA 4RAUA 4NQCB 4Z78A 2W07A 1JNJA 1O7VA 4R9HA 1G7LA 1PKQB 2MJWA 3ULSA 3KPSE 4JFFA 4QXWA 4WUUB 4R26H 2ZSWA 5B38A 5A2KH 5E1AB 2CIIB 2NY1B 2XKNB 2I9TA 1MCIA 4OUUA 1WZLA 5INCB 4UQ3B 5BZWA 4YAQB 1ZANL 2GQHA 4HF5L 2IBBA 3OB8A 1N6VA 1BFOA 2J6EH 1R5WA 4LOUD 4XP5L 4M48L 4R3SA 2G75B 1NCDH 1DQMH 2VN4A 3LEXB 3HNTL 4OCRH 3PHOA 1RU9H 1EHAA 2DQUH 5T1MB 4H8WC 4QNPE 1ND0B 4KVNH 4PLJC 3VXSB 3L3HB 3O4LE 1YYLL 1MAJA 3ULUE 3EO1B 4Z77B 1XEDA 3W9EA 12E8H 5E00A 2MKLC 1FRGL 3L7FB 4K2UL 1BD2B 1RZ7L 4XVTH 2FD6H 3HNSH 3QDJD 5I66A 4JKKA 4MCZB 4Z76B 5C7XH 1OQXA 2NLJB 1A3QA 2C3VA 1KLFA 3STZA 4EOWH 5ENWB 3OJVC 2ADFH 1KB5H 1PAMA 3D0VA 4LF3A 3H9ZA 3LN4B 5JPMB 3TIDB 2B5IB 1RJYA 3ZO0A 4HKBA 1PQZA 2E7BA 5I1KH 4HK0B 3NGBB 3QPQC 4HIIB 1ODAA 1GZQB 4WHCA 3SKNA 4EN3D 3BP6A 4JFDD 6FABH 3HG1A 4NQDB 1AQDB 3H9HB 1KTLA 1NAKH 3MJ9A 4R96A 5HHMB 4FG6C 1NFDE 4RFOH 5GZNC 2DN7A 4XCCH 3D25A 2R1YB 1KNOB 4O2CA 2C3HA 2R1XA 3RVWD 1INDL 4YR6B 3ZL4H 2OYPA 1CE6B 5INDA 2VDQH 5F1NB 3VMNA 2CRYA 1CXEA 3CFDB 4G8IB 4X6CA 1RUKH 1BEYH 4BFIA 3AU1A 3MBEA 3SY0B 2AJVL 1B0RB 4G6KH 3BPNC 3BZ4A 3QQ3A 3IS1X 4M1GL 3U9UA 1HYSC 4L8SA 3TC9A 4Q2ZB 1OWRM 3BZEB 4AG4L 5LXGH 1WAAE 3LN5B 4S0SD 3PQYD 4IJ3B 1GHFH 5H8DA 3IFOA 5CGTA 5EPMB 4ZFGL 1A7OL 3FRUA 1A4KA 1T3FA 1CVSC 1QVOB 4X7SL 3ULVE 2WNGA 3F7QA 2B0SL 1UWXK 1DEEA 2V2WB 4P0DA 4UOW0 1EMTL 3CLFL 1G7JA 4ZODA 1JZ3A 3PL6A 3P0VH 2A83B 5IJKC 3QO0B 1P5UA 5LAXA 4PRID 5DQDH 5KSBF 3X14A 4XNUL 4QXTA 3FO2A 3ULVH 1JVKA 2ICWB 1BGXL 5CLWA 2A74A 5I8OL 4ETYA 4GKSA 2X4OB 1E28A 1Q0XL 5L2JA 4NQXB 4IRJC 4PRHD 3SDAC 4UTAL 1FBIH 2AJUL 3KJ4B 3TA3B 1VFAA 3H2WA 2EO9A 5I0DA 3CFCH 4IRSC 5AUMB 4ZUTA 2BXYA 4JGUA 4LSQH 1S7TB 4OQ1A 1N8ZA 4KK6D 2XTLA 5KJRH 2QQNL 5E5UB 2P5WD 3A6OA 3CUPB 5LCVL 4DTGL 5JPNB 5BVPH 2BSED 5J6GA 3VWJB 5D7KD 1QYGL 3VRLE 1TZHA 1KPRA 4FQIL 1QBMH 4GKNB 1P4BH 4QWWC 1BX2B 5IMMA 4M43H 1MCWW 1WITA 1X5HA 5FHAL 1FNEB 1NFIB 4X6DF 5I19H 1RK1A 1KJ2H 1T0MB 4M6AA 1MJ8L 4OF0A 2R0ZH 2AJZB 4OFPA 3LKNA 5HYIA 4PJBB 2HN7B 1S7QB 1QLRB 2O5XH 3O2WL 4FTVB 4LIQL 5D6CB 3WNOA 4AMKH 4EI5B 3MTRA 5BZDB 3QXAA 3G08A 1G0YR 1OGAE 4M7JH 2E5EA 1GC1H 1NUGA 1U93A 1A3LH 2W9DH 1XZ0B 3L3JA 1NGZB 5H94B 3PABA 1RV6X 1FSKB 4BUGA 2EKJA 2NX5D 2R29L 1VFMA 5IVOA 4UTBL 4AM0A 1N7MH 2OTPA 2VDOL 4GBXB 1K5NA 1MNUL 2R8SL 4KZEL 3MLWH 3P4MA 2J7LA 4MJIB 5A2JH 5EOCJ 1LQSR 4KJWC 5L2KD 2MKWA 4TQEH 4ZTPL 3BGAA 1MWAA 2CR3A 2IQAA 2G5BB 4JM2A 3KLHD 2C4FU 2NXYD 1P7KB 3I6GB 3I9GL 1KLUA 1YNTA 4HUWA 4JQIL 3ALPA 4OFDA 5FHBH 3KYAA 2DYPB 4S1DC 4PRAA 4KXZH 4W68A 4BZ1H 3L95A 4QRUA 2X9WA 3V4PH 1MIEH 3BHBB 3Q6GL 3LRHA 3ARDA 3P0GB 2VLKB 2Q86A 1DE4A 4WW2F 3BKYL 5FKPA 3TWCH 1FFOA 2J12B 3JV0A 4I0PD 1U8QB 4W6YB 2MQCA 3DVGB 2DQGL 4X0KB 1JYWA 1SM3H 4JKWA 1YECL 4KRLB 4D3CL 3DX9B 4HS6A 5B38G 4YIQB 2VWEE 3QRGH 1A1OA 4N90D 1I9RH 3QXWA 4JQVA 4X9IA 4AENB 4FQLL 1BZQK 2AJ3A 1CICC 2W38A 3ARBC 5D7LE 4UNVA 2JJTA 3VDCA 5I18H 1RZGB 3MRRA 4O4YH 4LSTH 1ORSB 1ZHLB 2NXZB 1RIHL 5C09E 3SE3A 1JTTA 1X5KA 1KBGH 3OKMA 3UTPE 3V5HA 3QEGL 4JDZB 4NJAL 4JFYA 4M5ZH 2F15A 1OTSD 1RUPH 2HG5A 3DECA 3HZVA 4GG6F 1HHKA 4PG2A 4PLKC 1TPXB 2IPTL 3ZSTA 1KC5H 4ORGB 4FQCL 5J0BA 1Y6KR 2FB4H 1C5DB 4GMSL 4K7PL 4CVUA 1I75A 5E2VL 2CPCA 1SVZA 3IDJA 2J6EL 3FOMB 3KLAB 3RHWK 5K93A 4XBGB 1CGYA 3T0EB 3MROB 2SEBA 3W5MA 2YPLE 5F9OL 4JPKL 1I9EA 5DR5H 3RWGA 2ZOKA 3FO0H 1JRHL 4JZNA 4U6VH 3EGSB 5I1CH 3BPOB 3RWHA 1FNLA 5T5NG 4XRCB 4L4TA 4ZXBD 3V4VH 3JVGA 2F53E 1XCTA 2VZOA 3SKJL 3I6LE 4XPFH 4YXHL 4LARH 4P5MB 5ALCH 1I8KB 3U36A 1DBMH 5J11B 2FD6L 2XA8H 5FKAB 3NZHL 4DGVH 4MA1C 3ULUL 1FO0H 3C6LB 4OI8A 3RL1B 4YLQT 1OSPL 3MBEC 1TETL 3ZHDA 3B9KD 1HSAA 1XGRA 3GSNH 5TPWL 5IVZB 5E8NB 3E6HB 4L3CA 2UY7A 2DMKA 2O5YH 1A21A 3RGHA 3HE6A 4L8SC 3KYMB 1L4IA 3MGTA 4Y16A 1WZMA 4YQXH 4XTRD 4NKOA 3AMKA 2HFGL 4G6ML 3UYOD 3HCVA 5GS1C 1A1MB 4XMPH 4RA0C 5J6HA 1FE8H 4P5KB 5IKCA 3GK8H 5CINH 5IWLA 5C2BL 1W0VA 1IGCH 1R24A 3BSZL 5DD0L 2JIXD 2BVPA 4U1MA 5D7JA 3PL6C 1HHGA 1FFPB 2PN5A 2IWGA 4XCCL 1E6JH 1EPFA 3X11B 3LS5H 3IDXL 4ZS7H 3PGCA 3ZL4L 4OV6F 3KGRA 2FZ3B 4MAUH 4QRRB 3AB0B 1KB9K 4WHTB 1MFAH 3G6JB 4CVZA 5GPRA 3PP4L 4HIHA 1BEYL 2I9LA 1T5WB 2JIXA 3TN0C 5CJOL 2J88H 4G6KL 3S88H 2Y5TA 2QBWA 1GYAA 5DJ0B 2UUDK 2VXTH 4FQJL 1HHIA 5DEGB 1BZ9A 1QBLH 3AY4A 1A47A 2EYSB 4I13B 3BVNA 3BWUC 1KIRB 4HMEA 2IPUG 1RJCA 4JZJB 4G6FD 2QQLL 4NFDA 4M1CD 5BS0B 1MRDH 1Z0MA 1SJXA 1JRHI 4WW1A 4LVOC 1JGDB 3ILQD 2Q20A 4JM4H 1HIMH 2BOCB 1AHWA 2M1KA 5GRXG 5HYQA 1K8DB 4KUCD 3P0VL 4HPYL 4JN1L 1CD9B 4XPBH 1DDHA 5EH1A 5KN5A 4ODTL 2O93L 3BAEH 4OD3H 4QXGL 4I2XB 3ULVL 1NCCH 5EU6E 3FAWA 2ZNWA 1HK6A 4V2CB 2IALA 2EDKA 3O41B 5FDWA 2MHAA 3V9FA 4LSQL 5IHZA 5TQ2L 2APFA 1BOYA 3I3BA 4XCNA 1J1XL 4JPWH 5EZIH 5BVPL 5E7BA 3ILPB 1BBDH 5F89B 4J3OC 4U0RC 1S3KH 2ATPB 2C1PA 2FEDD 3KPPA 1QBML 4JM2C 1P4BL 4I3SH 4MZ2A 4FQXD 3B43A 4KKCD 4LSDA 4AQ1B 2XA3A 4ONFL 5F7YC 4KC3B 3I2CH 1LDSA 1HKLH 2DBLH 3TCLA 5I19L 3GZKA 4NRXB 3QFJB 3UROR 1ADQA 2WBJC 3IDGB 4JRXB 1YC7A 1CDIA 2R0ZL 3MODL 3OXRA 4LBEB 5I8KL 3SDCA 4PJCA 4N0CD 2YPVL 4M7JL 2DIAA 1GC1L 4CJ1A 5EUOF 2EDHA 1JGUH 2VLMD 3QCUH 4JY4A 1DBJL 2EZ0D 3LD8C 5EIVA 1YEKH 4JFZL 1MCJA 3QI9A 3LRSB 1I7RA 3F6IA 3BJLA 2VKXA 3LKRB 4X7EC 4P2QB 1FNFA 3R4DA 1CFBA 1OSZB 3STBA 1BFTA 2UWEA 4R2GD 2J5LC 5KS9F 4JQVC 4TSCH 2CLZB 2IJ0C 4G6JH 5H35A 2GJ6B 2JJTC 4JY6B 3E0GA 5C8JA 3CSYA 2OJZH 2XRAH 3EOTH 5E9DA 3X3FH 5B3JF 3QIBC 3SDXF 2QV2A 5FA3A 4XNZC 2HP4A 3SE3C 1OP9A 3FZUC 2YZ8A 3H7BA 5FHBL 1WIOA 3ZZ1A 2Y5EA 5C0RH 3VXNB 2EDRA 4LFHD 5EZLA 1FNGA 5DTFB 4ISVB 1K3IA 4JG1L 4LVHB 3V4PL 2BNQB 1MIEL 1YMME 1U8JA 2YRLA 3QQ4B 4Z7UE 2HLAA 4XPGH 3NCCB 3KPQB 4XNQB 3U0WH 4HT1H 3BUTA 4FN0A 3INUL 4HV8A 3ZDXE 4U1JB 5D7IF 3KPSB 4O58H 2IQ9L 4NQEB 1QRNB 3J7HA 3EFFA 4QRSB 4M7ZB 4MS8C 5MEPA 4XNMA 1PKOA 3OXSB 4WTWA 4OLUL 3PGFL 2M26A 2FX7H 4GRMA 2HLFC 2ZUXA 2ZSVA 5JLZA 5DRWB 3PJSB 1JTPA 1PG7H 2VXQH 3HKFA 5HHVH 4GSDH 3VXME 1S9WB 1XIWA 4UT6L 3S36X 3VDBA 1HILA 4UV4H 1V3JA 1YN7A 3BWAB 1EVUA 2XN9D 4F7EB 4GKZB 5GGRB 2VISA 2JK5A 5I18L 4O4YL 3B2UD 4U1LB 1F3JB 1K85A 4UB0H 3JVGC 4MXVE 4PJEB 1FZMB 2X4RA 3IJSB 3W0WB 3MLTB 5C0NC 1KBGL 1RZJH 1TFHA 3LZFL 1RURH 2XWBB 4FP8H 1NBVL 1B0WA 3MV7E 4OIBA 3GNML 4UIKH 4OLVH 5H2BB 5CWSA 2P7TB 4WI8A 4CW1A 3D3VB 1T89C 3QPXH 4LLVA 1NC2A 1ZKAA 3Q2CA 5D1XC 5J56B 1RK0A 4Y5VC 5LGHH 3MRDB 2FX8H 5BW7A 3DMMB 1KB5B 2ICES 3NTCH 4OIIH 3RY5A 2FB4L 5DJCA 1CDBA 4NO0B 5FM4A 1W72A 3QXDA 4LCYB 1RZ8B 3HE6C 3OJMB 4Y16C 3MACL 1S78C 3SJVA 4Y19A 3Q5TA 3VFRA 1HXMA 3EJYC 4G9FD 1QSEA 1QUNA 1KTRL 3SDDA