4NWUH

Crystal structure of ape1551, an anti-human ngf fab with a nine amino acid insertion in cdr h1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
239
structure length
231
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASGGDTFSNYAISWVRQAPGQGFEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGPEYYDYVWGSYRYNYFDYWGQGTLVTVSSGSASAPTLFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide insertions and deletions complement point mutations to massively expand the diversity created by somatic hypermutation of antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords APE1551 Ab Fab heavy chain
total genus 40
structure length 231
sequence length 239
ec nomenclature
pdb deposition date 2013-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nwuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nwuH01
2XQBL 5K33A 3TYFB 3O2DL 4JDZB 1WBZA 3RDTC 1MCFA 4XPTH 1MVFA 1DVFC 4E41D 3W0WE 2ZOKB 5L7XH 1DQQA 1JGVH 3DX9B 3TCLA 1TVBA 3O4LB 2E8ZA 4PJHA 1FN4A 2OJEA 3GI9H 4NSKA 3RWIA 5KSUA 1GOHA 5CSGA 3CFEB 3H3KA 2NTFB 1FAKT 2EKSA 3MZTA 4QYOA 3ALWA 4WO4D 1Q94B 1KPVA 5E5UB 3UTTE 4D9LL 1KTRL 4YGVB 5C08B 1T6VN 3UDWC 1S9YB 3HAEH 1K8IB 1MFAH 4I13B 3O0RL 3QRGL 3V8OA 5HHOA 2HN7A 2IMMA 1R3LB 5HGBA 4HEME 2NY1D 3U46B 4OF7A 4X7FC 1GIGL 5J56B 4Z7OE 2DQHH 1W0VB 3WIFA 5K9QG 2D3VA 4LAQL 1DLHA 4Q0XH 5I73C 1MCNA 1UH3A 3CCHB 4M1DL 2UVFA 2BMKA 3VXRA 5JW3L 4XVTH 2HJKB 5JXED 3DETD 1NCCH 3RIAK 4D3CL 2VLKE 3ZYZA 1KC5H 2X70A 5FO7B 3UTSD 1YY9D 3B3IB 3UPRB 4NDMB 3D25A 2PO6D 1FZMB 1NLBH 1SYSB 2XTJC 5DC4B 1UM4L 1K4CB 4Y16C 4L4JA 5GSVA 5HD8C 1QBLL 5EO1B 1XR8A 1S7VA 1WICA 2P46B 1I7UB 1UXSA 1D5XB 4H0GA 1G1CA 4Y2DC 4HKXB 3MA7A 4GUPB 3IJYB 1X3DA 3C8KA 4MNHB 5KSBB 3LPWA 1KN2L 3FB7B 3LHPL 3CFIC 4OLZL 1J0IA 1LO3L 3LSOA 2GSIB 4JN2A 5EC2B 2B1HH 2X70B 5FO7A 5T1DL 3RWFA 5ALBL 4TTDC 1EFXA 1OWRM 4IRJA 4KY1H 1AGCB 3BZ4A 1NGYB 3FB6B 4I4WA 4LCYB 3ECBB 5L9DL 2XKNB 2PW2A 4JDZA 1XF4B 3CFKA 5ENWA 5GSVB 1CN4A 5JQHC 3O9WA 1OPGL 3GSVB 5JMOC 3B2VH 3ZTJH 3EYFA 1OTSD 2W0FA 5C92A 2XQYK 4GSDH 3FQRA 3RFZC 1CK0L 2E7BA 5DHYB 3UJJH 5CWSA 4C83B 2VO5A 4JFDE 4O4YL 1D5MA 2DI8A 3F6IA 3QDMA 1ND0A 4G8FB 5MI0C 2BSRB 3VFTA 1KJVA 5IF0B 3R4DA 1UZ8B 4PRHB 4TRPL 2ADFH 3N50A 4M7LL 4MJ5A 3VRLF 5JDSA 3L9RB 1EVTC 1FYTD 1P4IL 1U8KB 1FFPA 2BOCB 1D6VL 5GJSH 3EOTL 4FA8A 5E8NA 1MQKL 2IANB 3ZHKA 4WDIA 1BF2A 4CNIB 4JFYB 1FPTH 4F7MB 4PJ7A 2DJUA 1SBSH 1FYTE 5E1HB 5K93A 4PRAA 2FJFB 4QNPF 2FBJL 3TWCH 1KULA 3PHSA 3PGFH 4D9QE 5DUML 4YAQB 4X4ZA 4OD2B 3VI3F 4XCFH 1AO7E 3RWDA 2DLFL 5IB4A 1ORQB 3SDXF 2YD5A 1RUML 1CDGA 1T5XA 32C2B 4HS6A 4OZFA 4XI5D 3PHQA 4KH2A 1IGJB 4EBQL 2YD9A 4MDJB 5BQ7A 2Z0BA 4MMXC 4UV4L 3GJFA 4JO2H 4DZBA 3T2OA 1LQSR 35C8H 2KQNA 1I7UA 2WBWB 3HPLA 4P57A 2CRIA 1G7QB 2FHCA 1UB6B 4NNYA 4MQSB 4MQXC 4PJFF 2B0SH 3ZE0E 1LNUA 3MRJB 4NQED 2P5WE 4J23A 4NCDA 3E8UL 4HLJA 2JF1A 1GAFL 4V1DD 1JWMB 1PG7X 3ES6A 4QWWD 3V5DB 3WHE0 3G9VA 1A4KA 4XHJC 1EGJL 1FGVH 3WD5L 4MJ6A 2FR4A 4CADA 1WVZA 3FQUA 4OKDA 4UNUA 1XCTA 3FO1A 1P7QD 5DUMH 3AM8A 3A6BH 1YECH 2PW2B 4DZBB 1JHTB 1XGUA 4ZTOL 3UZVB 3WSQL 1DVFB 1YMHB 1AXIB 4ZD3L 5TPWH 3PL6A 1S7SB 4ZUSB 4HK3N 5D5MB 3UPAA 4I48A 5FYKD 4MX7A 5F7DB 1AO7A 5FKAA 4ODXB 1MEXH 1FSKC 5D70L 1P1ZA 1PY4A 5DJ2B 2BX5A 3Q6GL 4LFHD 2WINA 5C9JB 4N0UA 5HGDB 1HSAA 5LBSL 4HIJB 2PW1B 1LP9F 3LH2L 4DN4L 5DD0H 4JKWA 1UA6L 1UM6H 5T1LB 3AREA 25C8L 4FFWD 1M71A 4XCYA 1NL0H 2W60A 3VD3A 4FQJH 2VH5H 5DRWA 5F1NA 2FSEB 1E4XI 2HVKB 2YSSA 3VD5A 3WS6C 2UUDK 4Z0BH 3RNQA 3WLBA 4PJ5D 2BNQD 5CSBA 1CF8H 5B39B 1FVDA 3VE0B 1GHFH 2QHRH 2NMSA 4KGLA 5D9SB 1NCUA 5E2TH 5FYLE 3VGAB 1ZA3B 4M9OA 4HV8A 1YN6A 2VDPL 4YO0A 4Y4KA 5EIIB 1RQ5A 5HI4C 1LO3H 3KLDA 2W65A 4Y88A 15C8H 1T7VA 2O26U 4XXDB 4MQ7A 2NQCA 3X17A 3O9WD 3SDAB 4MAYA 2A6KB 5GGTA 2CK0H 2F53A 4IRSA 4J6RH 5JIKA 5IEHA 3KYOB 4DKEL 2GEEA 2Q8BL 1IC4L 3MGTB 4XTRC 5BZWB 3DURA 2GCYA 3WO4C 3FOMA 3T65B 4Y5VA 1RIHH 5D1ZD 1BEYH 3GIZH 3QULA 5C0FB 2A73B 1R5VA 1PAMA 2FB4L 2V6HA 4E41E 5LJYH 3N06B 4WY7H 1KCLA 1J87A 3DX8B 5INDB 3QDMD 5ICXB 3VA2C 1CXLA 4FZ8H 3OKOB 4KY1L 1A6AB 2NY4B 1PZ5A 5GS0H 1AFVH 3HC3L 4K7PH 3L6FB 5FA3A 1B90A 5CJOL 1G6RA 1YDPB 4FQXC 1MREH 2DLTA 3MJ9A 4UDTA 1T4KA 3EDJA 3LKOA 1NGQH 3VFTB 1WAAE 4Y2OA 1FDLH 4FXKB 3MOQA 2VISA 1FYHB 5GS2D 3GMPB 3TBYB 5B38B 4G8IB 1U3HA 3ULUF 3QEUA 3HZMB 2G2RA 1HYSC 2K7QA 4HIHA 1S3KH 2QSTA 1UVQB 5BZDA 2H9GB 1DBMH 3CZFB 3MRFA 4NT6B 4Z0XA 1FRGH 3RWCA 1TETH 4KVCL 5E6IA 1MY5A 4KDVA 2VITA 3MO1B 4HH9A 3MLTA 5J13B 2APFA 3I3EA 4LPCA 4GAYB 1LHZA 3PWVA 2FGWH 4BZ2H 3SGDH 4LPTA 1V05A 3ZDXF 3TBYA 2PTTA 3L3KA 2P8LB 2DRUA 3MV7E 4LKCA 5IJKC 4X4ME 5EZJB 4JFPB 5I8KH 1SJEA 3DV4B 5CLWA 2R23A 2YWZA 2F58L 3MBXL 4EUPA 4XPBL 4FQLH 4ZUTA 3VXRD 3ZHDA 2VDOL 2JK5B 4DFIA 1F3DH 5DMKB 3GGWB 1SEBA 2WBJB 5DJZB 5C07D 1AQDB 2KZ1B 1QLFB 4P9HH 1MFAL 2DN7A 4PJ8D 5DUBA 3VMOA 1A4JA 3HAEB 3QQ4A 1KOAA 4U1HA 5TF1H 4XXCA 2NCMA 5F1SA 1J8KA 2X4RA 4BUGA 1NCDL 4JCLA 1A1OB 4NJ9H 1CWVA 3T65A 4NZUH 1HK6A 5D7JD 1FO0H 3VW3H 1U8JB 2Y07L 5CBEA 1MHHA 4JM2A 2NY6B 1KB5H 4F8QA 3FL7A 4WUUA 1OD7A 1XGUB 5CJXC 5ESQA 1K4CA 3MXVH 4D0DA 2OK0H 1NFIB 4U1GB 1RULH 2C1PB 4NKMB 5GGUB 5T3ZH 1D5XA 1Z6JT 4R8WH 4PJDE 4ZUSA 1A4JB 3IXTA 1C12B 1R3HA 1TZHA 4I77H 4AK1A 4S11A 1RZJC 3U4EA 3NIGE 4PJAF 5C0CD 1OGAE 1DN0A 1JGUH 1I7RB 4HG4K 3LKOB 4NC1E 1J1PH 3O3AA 2I24N 5I15L 1A9EA 4DJMA 3PGDA 1KTDB 2EDXA 1F4YL 5D7LD 4K2UH 5GSRB 2HVKA 4K23H 4J3VA 1OP5H 4QHNB 1NGXB 2Q20A 4P5MB 5CEZD 1LGVA 3DNKA 4HDIB 1RJZA 5IBUG 2AV1A 3KR3H 4D94A 3RWCB 3NA9L 4JM4L 1IFHH 1M7DA 3FT2A 4N8CH 5D7LE 3CXDL 5F70A 5I1EH 3MRMB 3CSPA 3WHXB 5EUOB 4N8CL 2B2XH 2ITCB 2EIZB 5DD6A 3OX8A 4OIIH 4QKXB 3GBNL 4PRHD 5IFHH 1FFPB 4DVBB 3UBXI 1MIMH 2MWCA 4U1MB 3MLYH 5GHWL 4WDIB 4IS6B 4QHMB 1KLFA 4KTDL 2OSLB 5JIHA 3ILPA 1T5WA 1NCAH 3TCLB 1CE1L 4O02H 5EH1A 3HAEA 3CX5J 2DLGA 2IEPA 3REVA 3EO1B 2EZ0D 3PWJB 5FB8A 1FNSL 3WYRA 2HTKC 4NBYB 3QDHA 1MJ7L 4HGMA 4RAHA 5GJTH 3MRQB 1IAOB 4M6ML 5EO9B 3ARZA 4PTTB 1B4JH 1ZANL 5EOTB 5FUZH 2Z31B 3LN5B 1KNOB 5DHVB 4GW4B 4NPYA 1PKQA 5BS0B 4LEXH 4XNUL 1CGSH 4TSBL 3O3BA 3LKSB 3WMSA 3I9GL 3ZE1E 4WV1A 5K9JH 3QNXA 3ZKMD 4CVXA 4KAQL 3UTSA 4TPRH 2J8UF 2VH5L 1U58A 4MLSA 1CLZL 4UIKL 2ADIB 4PJBF 4NQEA 4NNYB 2Q3ZA 1K6QL 1OTUC 3HPLB 4P57B 1YEDB 3EGSB 4D8PB 5HDQL 5JPMA 4JFZL 4P9ML 2FIKA 3RWHB 4Z7VA 5I2IB 2X2YA 4DN3L 3BUYB 5ID0A 1TCMA 4IOIB 5E8EB 1KNOA 3FO9A 4YHZL 1V7NL 2RGSA 4ZO9A 4FQXA 3S96A 2EZ0C 4G9FA 1XGQB 4MJ6B 2NR6D 5I8EB 3STBA 4YC2B 3VXSE 2I5YH 4NM4L 5HVHB 3T1FB 4NO2A 2FZ3A 4ZYKA 3WSQH 1YC7A 5IHUL 3AS2A 1VGKB 1FFNB 4YDJB 1G9EA 5E2WL 2VLJD 4MA1C 3M8OL 1MF2H 4ZS7H 2GI7A 4Q6IB 3NZ8A 2BRRH 2KDGA 3MXWL 4OLVH 4P5TA 5CJXA 1X5IA 1GAFH 3TVMA 5M95B 4MS8D 3REWA 4NCC2 5CCKH 3OKMB 1HSAB 3KPRA 2GJZA 4NO0B 4X6DB 4PJIA 5EU3B 4F33B 4YHKH 3VRJA 4MB4A 5EA0L 3OAUH 3BRGC 1FIGH 1CG9B 1YYLL 1BFOA 2Q76B 3K74B 4P2RD 5DD3L 2EXWD 3VD4A 3O4LA 1M71B 5AWNL 4JRYD 1IVLA 1HQ4A 2E9IA 3U0PB 5DR5H 4H1LB 4Y4HD 1XF4A 5SX4I 3O2WH 3H9ZA 2UZXB 4ONGL 2AGJH 4P9HC 3QIWC 2Y7QB 2Q3AA 3HE6C 1I85C 5E2TL 1WTGT 1YEJL 5MEQB 3RAJL 3G6JB 3RRQA 2BJML 3CSGA 3FQXB 1TZGL 2NY5H 2ID5A 1CF8L 1OOAA 1KFAH 5KANG 3EYVB 3N85L 4OZGB 3RDTD 5EIIA 4POUB 4Z0BL 3VGFA 5SX5H 4L8DA 1N59B 2P7TA 2A9MH 1TJGH 3D48R 4NNPL 4XXDA 5A16B 2A6JA 2FATL 4NN6B 1FL3A 1RUPH 2C9AA 5D7LB 5EU6B 1SBSL 2XV6B 1A0QL 4NM8L 4OLEA 4PV8A 1G9NC 4G8GA 1MCKA 3D3VA 3L3JB 4LBEB 4WY7L 3RX8A 5D5ME 2G5RA 4WHTA 4XCCH 3GNML 1A3RH 3P9MB 2YC1B 2OR7A 2QSVA 1HHKA 5JNYA 4Z7WA 4OUUA 4LGRB 2AXHA 2NY2B 1CXEA 2N56A 2Q8BH 4M1GL 4TUJB 2OP4L 5KZCB 1NMAH 2X4NA 3IDGB 5IB4B 5H94B 1IL1A 5AZEL 3JTTA 2V5RA 4RNRB 1UQSA 3ZDYE 1KIQB 3LD8B 4Q97A 4GSDL 4Y4FC 4LSDA 3ARGD 4JR9H 4LSSH 4AT6B 1B9ZA 1K4DB 5DVNA 4EDWL 1EJOH 1EGJH 3QUXB 4XCCL 4W6YB 2JCCE 2KPNA 1WF5A 4M62L 3GB7A 1YMMA 3VXMB 5D7JB 5FIEA 5D93C 1J1XL 3MV7D 1DUYB 3W39B 3RGVC 5ETUA 5GRUL 5ESVA 4I18B 2QJDA 4G43B 4TUJA 4XPFL 1EJOL 1PKQE 4B41A 4M03A 1MJUL 1T1ZB 2VUOA 4U1LB 5GS0C 1YYMH 4JO3L 4OLUL 2ARJA 4PP1C 1M7IB 4GG8B 2YEZA 4U7SA 3RL1A 3NCEB 3QHFL 2F54E 3KWWA 3DI2B 3P0VH 3QG6B 2AVGA 4QO1A 3LRGA 2NW3B 3K8MA 3GMNB 1XR9B 3EOAA 3SKNB 3V7MA 1KJVB 4PRIE 5IF0A 3CU7A 4Y2DB 5E4IA 1E28A 2XYCA 3PWNB 4OCWH 4X9IA 1G0DA 5HY9B 1NANI 4N9OB 4LLVB 1PLGL 5JZ7D 5AYUH 4CN1A 2BVOA 1WTLA 5IVZB 2IQ9H 4WUUE 3P9LB 1AQKH 4NZDA 2OXHA 4WI8A 5C6PB 3MV9B 4WV1C 2BRRL 1QFWM 1R5WB 4M93B 3IRZA 5IIEB 1NC4A 3L95A 4XH2A 4XMLH 5EU7E 3TNNA 3I75A 3BIAX 5J0BA 1YEIH 2ICWI 4FN0A 1Q72H 4WUUD 2VL5A 3ZL4L 3S35L 3TJEL 4XB8A 1B3JA 1F4XL 3BZFB 2V5MA 2D9CA 4JM2D 1PGRB 3U6RB 3SKOB 4XP5L 3QZWA 4O9HH 3WHE1 4LHUA 5JNYB 5TDNA 5I1CH 4XWGH 4YFLF 1KSRA 1FNFA 3DRQA 3R1GH 4Y89A 2DMBA 3VFUA 4YO0B 5GGTH 3BVNB 5T3XH 3X3FH 1A7PL 4BH8B 4WUKH 5CILL 1JGVL 1HHGA 1UYWL 1I3UA 4M00A 3C8HA 4OAWB 2JB6A 1NH6A 3GBMH 1GGUA 5ISZD 3HG1A 4ZS7L 4QRTB 4G9DB 2GITA 2XRAL 3IDYC 1XT5A 4EIZC 3HE7D 4XC3H 5HVGB 3BGMA 2M1KA 3ULVC 3F7PC 4I2XE 5IK3A 4XNYH 1PYWB 3GMLB 4X6DF 4JPWH 1S7QA 3MLPA 5SWZB 2JB5H 5FM5O 1D6VH 2VXTH 1RURH 5AG9A 1CE1H 1VADA 4JFFB 4LDEB 3DV6B 4BFIB 2BJMH 1I3VA 2WBJD 3VWKB 1G9NL 3OPZL 4PGEA 1PSKH 2X4QB 3L3OB 5H37H 5KG9B 5GRZA 3ARVA 1U3HD 4XP4L 3OKEB 4IRZL 3T0EC 5EO0B 2A2QT 3W9DA 4FQ2H 4XX1G 4RQQB 2PTVA 2VXQL 3SE4C 5T1LD 3IF1B 4JFHE 1NKOA 4FTVE 1WAAA 5E0QA 4RFEB 2PO6A 3FN9A 2DQTL 1CR9L 3S37H 3GI8H 2AQ3A 5IMKA 5AZ2L 2F15A 1F4HA 1HKLH 4Y5VC 1GJIA 3RWJB 3CMOH 1GIGH 5KSVB 3U4BL 4UU9B 5JHLH 4FQIH 4NO3B 3UJTL 4NO0D 2BHYA 2NY3B 3RIFF 3H7BA 3DXAB 4ODUA 5HHXL 3SE8L 1U93B 1BLNB 3HNVL 4KHXL 4PLOB 5FHAL 1NBYB 3EYOA 3E3QC 1UH4A 3PP4H 1T20B 5C6WH 1FNHA 1DQDH 1IEAA 2I60H 3MJ9H 4N1CA 2WUCH 5C3LD 3L3HA 1BVLA 2RCSH 3MA9H 1U36A 1DQLH 3F6LA 3QNXB 2YBRB 1OL0A 4X9FA 1JPGB 5C0GA 3GO1H 2Q8AL 5DJYB 4UU9A 4XBPB 4PB9L 5SV3A 4ODTL 3FOLA 3MRCA 4GXVL 2XTLA 4WTZA 1MCHA 3BW9A 1A2YB 3NACH 2EDRA 1FC1A 3LKPA 3GSUA 4LARH 1T1XB 5CJBA 1UWGH 4I3GA 2GITB 4P2OC 3VI4F 2GJ6D 4M3JA 3UTTA 1W0WB 4KAQH 3L7EA 1HXYA 4C55A 3QPXL 4LAQH 4P4RB 3S4SA 1JPGA 4MDIA 1NGPH 1LE9B 3U1SL 2RFXA 1NDGA 3CXHJ 4MXWH 1D6EB 4K9EH 2VXSL 2V5SA 1B6UA 3T77B 3QRGH 3O0RH 1SY6A 3QJFB 3JWOH 2OMNA 3KPRD 4KFZC 4GG6E 1CD1A 1OW0C 3SKMA 3I50H 2XWBA 4XMPL 4XPBH 3IFOA 1TNNA 4O58L 3D2UD 3OKEA 3L7EB 4BK5A 1JUFB 2WP3T 1JBJA 1S8DA 5JOEA 1P2CB 3FFCA 4M43H 1KTLA 3OXSA 2FJHA 4ZUUA 4X7TA 1CDHA 2QQKL 4RFEA 2JJSA 4KK8D 6FABL 3U7YH 4XPTL 1A6TB 4XAKD 5HPMA 4JDVB 5CGTA 2VR4A 4CNIA 2DBLH 5DK0B 5EOCJ 1O5DT 5I1EL 2LU7A 1F2QA 3QIUB 4ODSH 5HYSG 3BP5A 5ICZB 4XNXL 4PB0L 1CVRA 2E9JA 3WFCH 3QUYB 1ZT1A 1EBPA 4M1CD 4AEHH 5JW5B 1KIPB 4YJZL 5C2BH 1HIMH 3GSNL 5ESAB 5F7NC 1QRNB 3PNWA 1LD9B 3FMGL 1ZLUH 4KV5F 1PKOA 4XP6H 3VGDA 1JUFA 43C9A 3OAZH 2Z8WC 4YE4L 4MAUH 2R2HA 2EE9A 5C6TL 4LKXB 3D39D 32C2A 4HS6B 4OZFB 3NN8A 2CO7B 4NFBA 3TEUA 4CVZA 4U1KB 3DO7B 2R9HD 4X7EC 2D9QB 4JQXC 3QIUA 4OIBA 2OSLA 2EO9A 2Z93B 2RJMA 4YK4B 3BEVB 4KJPC 5J1TC 3OB0K 2DYPA 4FTVB 2BNUB 4H25B 1AXTH 5CD3A 2JELH 5EBMB 1C7SA 3SE4A 2QLVB 4CMMA 3U30C 4U0QB 1K8DB 2HKHH 5EOTA 4FZEL 1S7TB 2FB4H 2AV7B 4XBEL 3GMMA 5ITFB 2M8XA 4PR5B 1Q9KB 3P4MA 4YBQD 2FHBA 4OLYH 3VW3L 4LQFL 3BMVA 3H42H 3VGGA 1IC4H 5JXAH 5TQ2L 5JLZA 4KI5C 1I1FB 4O00A 5IUSA 1S9KC 3AGVA 3B9KD 4NHCH 2EIBA 4DKAA 2VAAA 4MXQD 5J6GB 4QOKB 1EK3A 3VFGL 4L4VD 1Z0MA 3FMGH 4H0HB 5C0DA 2DQFB 1AR1C 1HIML 1HH9A 1AGDB 4GQ9H 4LSRH 4NQEE 4EEEA 4FQIL 2Q86B 5JHLL 3PF2A 1QYGH 4WFHD 4CBPA 3BN3B 4Y19B 5I8KL 3JV4A 4DGIH 2EYRA 5TE4L 3GI8L 5AUMA 3UTPE 4M4RA 3ULUC 3IAPA 3GMNA 4P3WA 4YWGH 5KSUB 3GSQB 3MV8B 2EECA 5MEOA 3QIBB 1BJMA 1YY8B 2JJUA 3G5VB 4NQCB 5E4EC 2VXUH 1T1YA 3WEXB 3HTLX 25C8H 1XF3B 4JB9L 3DVNA 3ZKQD 1H3PH 1X5LA 1TETL 4KVCH 1KEML 1VFUA 3ULUH 4PGJA 4PLJD 4XNQA 1FRGL 3WIHA 1QO3B 1RUAH 2RHEA 3CLFL 4C4KT 5J7CC 2VXTL 3JWNC 3K80A 5IB2A 5JW4R 4XBPA 4LLMB 2BNRA 5FO9B 3PXJA 3HMXA 3D69B 2QV2A 2H32A 2ESVD 3OJMB 3BDYH 1MFEL 2XPGA 4P3CH 3LEYL 2AKRB 4JY6A 2CGRH 3WKMH 2VL5B 3IAQA 4UAOC 3RNKB 3T0XA 4XNMB 4MVBC 4QT5B 4H1LG 3VA6A 2QEJA 5EZJA 1NL0L 4X5XB 4BJLA 4GRLB 3QXDA 4NKOB 5CEXA 3EJYC 1L6XA 5BW7C 1DFBH 4Q9QH 5GS1A 4JFDD 3DRTA 5I0DA 2IALA 1QSFE 1ORSA 1YMME 5FA4A 1RVFL 5TQ2H 2NY5C 2XWJA 1LDSA 3GK8H 3UTOA 4JKLA 1ULVA 3H3PL 1CD9B 3P77A 1DSFH 5IESL 2I27N 2NY6D 4AH2B 4QXUH 4YHIB 3MPCA 4UT9H 2Z8RA 5D7IF 4PLJC 1YMMD 3ZL4H 3EFDL 1T0MB 3TBSA 2BC4A 2BOBB 4X9GA 4M7KH 2QQQA 3MR9B 4HT1H 4QF1A 1KCVH 4IIQA 3EO9L 4X7CC 1SEQH 3UTTD 1KUMA 2VDPH 4JFEA 3RVXD 5H94A 1MIEH 2UVEA 3DPBA 1ZT7A 4Q2ZB 3IDNA 2APTA 3SE3A 3QIWD 3FT4B 4POZD 2XZCH 4S1DD 5D6CA 3TESA 5JW5A 4P2QE 1MOEA 3HPJA 2CRZA 4B0MM 4JPIA 3G5YA 5HHPA 5GPRA 2WAHA 4YE4H 4YXHL 4MCYA 4ZOCA 1DUYA 3GZKA 5KG9A 3OKLB 4RISH 4KJQC 3MCG1 3BZEB 4HWBA 1XGYL 3BHBA 3ARYA 4PJ5E 5FDWB 1RFDH 1KIRA 4CVZB 5L8LB 1QSZA 4PG2A 2EC8A 5HHQA 4U7KA 4OZIE 1I1AA 4HMCA 2BVQA 4Q2ZA 4OTXH 4WJ5A 2FX8L 4H8WH 4YXHH 3FT2B 1XGPA 1KEGL 1MFNA 1FHGA 1NSNH 4NOFA 4GMTL 1MFCH 1FFQA 2V5TA 2FBJH 4LP5A 2XOTA 1KPVB 4ZTOH 3LQZB 2PYEB 2OJZH 5DZNA 3WFDL 4AL8L 1GGCL 4NQXA 5F9DC 2DKMA 4MA8H 5BRZD 1X4YA 1WQVT 1A3LH 1MQKH 1MJJA 1PG7H 4M48L 3CNKA 3FRUB 3MYJA 2R2BA 5B4MD 1FFRA 2HAZA 3OKYA 4GG6A 4MA3B 4WI6A 3ZKND 4EQ3A 1MRFH 5JO5A 4ZDHB 4LPWA 1FE8H 4LLUB 4YGAB 3ZE2F 3CCHA 4O4YH 1OD9A 1WFUA 3SDAA 3C09C 1SMOA 3U48A 1CL7I 1U8IB 2ADJA 4NWTL 2VZOA 2YR3A 4N0YL 2FX9L 1RV6X 4JFFD 3BIKB 5FHBH 2CR3A 3VD7A 5DHVA 3MGTA 1QRNE 1BZ9A 4PJFA 5F1OB 4HH8A 3VCLA 4M93C 1WUNT 4NP4H 5BOZG 5KSBF 1GGBL 1KV3A 4HX1B 3VWJA 4OF5A 4LSPL 4LPUA 4X4MA 3EOBA 4PJ9B 3EDEA 4PB9H 3WKNA 3LKRB 1GZPA 4XWOD 3HUJB 3PWUB 1UWXH 4PJ9C 4RMQA 4P59L 1DBBL 3BP6A 2XG4A 2P5EB 3EJZC 2N7AA 4S1SH 4MVBD 2K9UA 4PJAB 1T1ZA 2YWYA 3SDXA 1CGUA 4OZHA 4LCIH 1BQHB 2PW1A 3IKCB 3PL6D 3ZSTA 2VE6A 1KJ2B 3PP4L 3T8XB 1XGQA 3QXWA 4NZRH 5E6IC 1EFQA 4L1DA 3B2UC 3JTSB 4K8RD 5HYQA 4EDXB 5DURB 1NGYA 3S7GA 4HBCH 1A14L 3OQ3B 1T0PB 1KLGB 3QFDB 1G7LB 5GGRB 2GT9A 2D7PA 3SO5A 4QCIA 5BVJB 4OGYH 4HCRA 1N0XL 3OAUL 5AZ2H 5H35A 1T1WB 3QUMA 5CCKL 1FZKA 5ERWA 4OD1L 4HH9B 3DSFH 1ZE3C 1A9BB 1E6JL 3KPSE 5EOQL 2XICA 1ZTXL 4NRXB 5EULV 1QRNA 4XPFH 4UMGA 5F7LB 4ZQKB 3CVHB 3B6SA 4PD4J 5E8OB 3BXNA 2R2HB 1H9VA 1CD8A 3IFLH 5KW9H 5GRUH 1FBIL 1RJLA 1VB9A 4Y4FB 3LD8C 3VFWB 5D7KE 3IF1A 5TDOB 3C09B 1N6UA 1VFAA 2VL4A 4PJHE 4W81A 3RY4A 4OF6A 3P77B 4HZLB 2NY7L 1T66C 3V5HA 4AG4L 1YNTA 4F7MA 2AK4E 1Q9WB 1AR1D 3WLWD 1BD2D 4JREC 3AXLB 4NWUL 1P9MC 3RVWD 4Y8DC 2BC4B 3UMTA 3QEHA 4MB3A 1JWUA 4EN3B 1CFVH 2CDEA 1G7JB 4N5UA 5A3ID 3GI9L 2APWA 1WSST 1A6VL 2BSSA 1PEWA 4L3EA 3VDBA 2D2OA 3EHBD 1S7TA 5I30H 5A16A 1DE4B 4PJFB 3HS0B 4LU5H 5BMFL 5IEKB 5IMLA 1JMZA 1SJVA 5K9OA 3H3BC 2PKDA 2UZIL 3CPLA 5HHOB 2KKQA 4CW1A 2LABA 4OJFL 5FYKE 2OQJB 2XQBH 1AHWB 1OGTA 1QZ1A 1P6FA 4QHUB 3LMJL 1NAMB 1YPZA 2VZ3A 5DQJB 2GFBA 3OHXA 1GL4B 5FV2A 3SE3C 3L3IB 4JKMA 4KQ3H 1F00I 1LO5B 2A9ML 3SN6N 4QXGH 2APXA 5EZOH 3WUWG 1B6DA 1RZIA 5AD0B 2CD0A 3IJSA 1BPVA 5D8JH 5C0RL 1TZGH 1BVKA 2NY5L 1KT2B 4LSTH 1KJ2L 2D31B 3W5MA 5IEKA 3QDJD 5IMLB 3BKMH 4ONFL 5IROC 1HILA 1HHHB 1MWAL 4PP1D 4ETQB 3GSXB 4XMLL 4JKKA 5J1SC 4FABL 4PUBH 1WT5A 5BRZA 2ICWB 3OR6B 3HNTH 1NBZB 1N26A 4PRNA 2W0KA 3TBTA 4HK0A 5ADOL 1XR8B 2B2XL 1R24B 3O6KL 1A1NB 2PTTB 3WEXA 4NQXB 1FYTA 1E4WL 1KENH 4ONHA 1WEJL 2A0LC 3QUMB 4MZ2A 1QBBA 1HQRA 1M7DB 5DMGD 4OCRH 4MA1B 1EZVY 4JM4H 1JZ2A 3B9AA 3E6HA 3GM8A 4NRXA 1H3XA 5HYJB 4OFIA 4XMKL 4DOHE 3GGWA 1X5FA 3QDGA 3BXNB 5JOFA 3IETB 4YHML 1WIOA 2IWGA 3LEXB 1HXMB 4JRYE 1FNGB 3BO8B 2DMKA 4G3YL 3VXOA 3BRFA 3ZDZF 3QDME 2A6IB 1A7RL 4RWYH 1TZIA 1XZ0B 3QCTL 5C09E 3VCLB 2CKBL 2RB8A 3NAAH 2X9WA 4OIAA 4B7IA 1MJUH 3QCUL 4F3FA 1SY6L 2DIJA 5D1QD 5HGBB 5A2FA 1CTOA 1DBJH 2KZWA 5HGAB 5D9SA 4TVSa 5E4EB 4IMLA 4MNGE 1LWRA 1UCBH 3RHWF 3ZLQC 4YFEA 5FEBA 2VLMD 4XAWH 1OTUD 3ZKXB 4N5EC 2VLRD 5IHZB 3Q5YA 4F7TA 1OAQL 2G60H 3G6DL 4HPOL 4WI3A 4EXKA 3PP3H 5GRVK 2XKUA 4JR9L 4LSSL 3KJ4B 3L7FA 4H88L 3U7WL 2O61A 5C0JA 1OWWA 4CN4A 2WLZA 2FO4B 1MRFL 5DTFA 3JTSA 3N9GH 5EBLA 5I2IA 3EBAA 4TVPE 2FYYA 2JIXD 3P0YH 4TSAH 1QPXA 2ILLA 5C0BB 1A6AA 4ODWA 4Y16A 3QUXD 1UH2A 2E9BA 5SWQA 4OZIA 1SJXA 3PV6B 4S2SA 4ZXBD 3C5JB 3ZYIA 3MLYL 3ZZ1A 3U82B 5EPMB 1CIDA 1FH5H 3VXRE 4PJFE 1F13A 1K2DA 3CVHH 3DVFA 4F37F 4X4YB 4ALAH 3TV3L 4HW6A 2FGWL 1CT8B 5DJ8B 1J05A 4YUEL 5JR1L 3NFSH 4JHAH 3RP1A 1WEJH 1QG3A 3GEWB 1K5NB 5KBNC 1MCWM 3O8XC 5C0EB 4HUMB 3QB7C 5INCA 4U6VL 4I0PB 3ILQC 3BKYL 1EH9A 2EDBA 5E9DB 4NT6A 5TGBB 3H9HB 4OCSL 4E5XB 5BZDB 3D0VA 4LRNH 2FCBA 3AXLA 3ET9F 1ETZB 3QJHA 3KLAA 2YUXA 2F54D 4X6CF 3DX7A 4M6OH 2Z92A 2JCCA 5HHME 1LD9A 1ZT4B 1CGWA 1UZ8A 4PRHA 3V0VB 4JHAL 5IHLB 4PJAE 1YJDH 2I9TA 1OAUH 2R0KH 1T1YB 4U6YB 4QTHA 4CW1B 3IDUA 1SJEB 3DV4A 3FQXA 3MXWH 4OLVL 3TVMC 1ZS8B 1WLHA 4PJEA 2B5IB 3VD9A 4HT1L 2R2BB 4U33A 4MHHI 1C1EH 1DQQB 3DX9A 4OFYD 3SKJL 2NY6C 1DCLA 4FZ8L 2WBJA 4ELMA 1KGCE 5IHUH 4NSKB 1T04B 3RWIB 3SO3C 5AD0A 2FIKB 3FN3A 3SHSA 5IJVA 2HH0H 1JTTA 1KPRA 4WI4A 1D7FA 3C6LD 4DOHB 1ZK9A 1K9TA 3O41B 4PJ5B 3X3FL 4PR5A 1IGTB 2YPLA 4QRPE 3VG9C 3EUUA 1EFXD 2QSCL 1TMCB 3FAWA 1QTYT 1AGCA 1QLRB 4R4BA 1KF9B 2EYTB 4XGZB 5IKCB 1D5ZB 2VDKL 4OM1H 5I1CL 5CJ5A 3ULVE 1U2CA 5DT1H 1Q1JH 1U8LA 3EFFA 3ARTA 3IXTB 1BIIB 1XF5B 4XP5H 3V4PL 1W72L 4P46D 3TJEH 2CGRL 3WKML 2AK4B 4XP1H 1LNUB 3TC9A 5I8OL 3F12B 4UQ2B 5HHNB 4LLAA 3VXMA 4P2OB 3EW3B 4MMZC 1T2QL 5EZIH 4POYA 3QA3B 4P5TD 2NY0B 4QY8B 2ORBL 4JN1L 4WW1B 4LCWD 1B4JL 1MCRA 1UWXK 1JGDA 5A2JH 5DQ9B 5D7KD 5EOQH 3QCTH 3I2CH 2D03L 3MNZB 4XBGB 4HC1H 1TXKA 3FO1B 4LDLB 4HFUL 4CVWA 3N1QC 2PO6B 3ULVH 3QIBA 5IMKB 1U8QB 3TYGH 3EJZD 4JY5H 1NC4D 4OGAC 1A14H 1HHJB 5CSZB 1DBML 2AK4A 3C6SB 3CFDB 4U6XB 5ERWB 3DVNB 4GJTB 4LVEA 4FFVC 2PXYC 5J89A 1GH7A 1NDMB 5L6YH 2EDWA 3HG1E 4OCRL 4RDQG 4F9PA 4P5KA 2VDNL 1MRDL 2P5ED 1P2CA 3MACL 3MNZA 3VMPA 1CICA 2NXZD 3VXUE 4I9WE 4LHUD 4QTHB 1G7IB 2Z8SA 4KJWC 1J8HB 5ENWB 3PHQB 1RIUL 1PBYA 2BCKA 3CLEL 3HB3D 1BBJB 2V2XA 4U7MA 4CMHB 2NZ9C 3Q3GA 3VXTA 2F9BT 4L3ED 3HC3H 2P5EE 4G7VL 4ODHH 5I1GH 3QUYA 1D5IH 4WU7A 4XNMA 4P3DA 1U2HA 1EEQA 4RSVA 1GZQA 4XRCA 3R8BB 4X80H 1BQHG 4X5XA 1RHHA 2MOVA 1ZEAL 3W11D 5MHSE 1PX4A 1QQDB 4N0YH 1U8KA 2X1XR 4G80A 4YLQT 5FUCE 2YMXL 1I1YA 3GDBA 1IGTA 1G7IA 5FM8A 4ZO8A 1DLFL 3L1OL 5SWSD 3DRQB 4L3AA 4G42A 4X7SH 1NBVL 2FX7L 4R8WL 3OHXB 3HR6A 3NZHL 1QFWH 1ZGLM 3F5WB 4H88H 1OQOA 2VKXA 2ZSWA 1IM9A 1FG2A 2ZUUA 3IKKA 4Y5VB 4LK4A 1GCFA 2ADIA 3RVTC 1LDPL 4U4BA 4OFDA 1LO5A 3HKFA 1CCZA 3GMOA 1DQTA 2BNRE 5D7SL 1JZ8A 1UKTA 4IOIA 2ICCA 4M5YL 5F9WB 1CXHA 4PTUB 2NY1C 4I0PA 1BWMA 2FATH 2IBBA 1A1OA 4GG8A 4KK9C 3CFJA 3H6JA 2H6PB 3VI4E 5IFAH 5I1DB 3B9KB 5IWLA 5TF1L 4NQTA 4DW2L 3BZ4B 3OJDA 4K3DL 1R3IL 3T1FA 5D2NA 4OZ4B 3GSWA 4NYLA 2H2PC 1NEZB 3U9PH 3B83A 1Q9OB 1U6AL 2R0ZL 4KK6D 2IPTL 5FYJH 5F88B 1V8HA 2CRYA 1UA6H 3C87A 1MI5B 2VAAB 1RY7B 3BZEA 2AGJL 1U3JA 1HNFA 3TPKA 1ONQB 5LBSH 5CZXC 4S0TD 4AM0A 2FJGB 3SDXB 3P73B 1MEXL 3SBWA 1S5IH 1YNKH 4Y4KD 1OAKH 1NEUA 3U0TB 2VN4A 5DD1L 1FIGL 1HEZA 3MLRL 3HN3A 4XPAL 3SGJC 2J8UE 1EXUA 5B8CA 1QVOA 1AGEB 3BKJH 3O6KH 1P7QB 3NCJL 2B1AH 1SEQL 4OKVB 4YXLH 4JLRA 4GW5B 2BY0A 1YEEL 3TA3C 2OBGA 2WINB 4OCLC 5C9JA 5CD3B 1RIVL 2J6EL 3MUY1 4KWUA 5T5FH 1EA9C 3WDIA 4PBVC 4Y5XA 1U8NB 3PDGA 5EO1A 3QPXH 1YC8A 2EIZA 1H5BA 2P7TB 1ZLUK 4PJCF 3OL2A 2AJUL 4HWNA 3UTZB 4QTIH 5I76B 1ACZA 4WWKD 4F9PC 3HG1B 3AC0A 3E3QE 2DLHA 4WEBH 3L5XH 4HIEA 4PJCA 1LEKA 3BGAA 1IEBB 3P9MA 1HHKB 3D3VD 4G8GD 4XVTL 3RIFK 3D85A 3TO2A 2VC2H 1F97A 1RUMH 5EU6D 4I18C 3MOBL 4IHOB 4LU5L 3ECBA 1Y18B 3RGVB 1DDHA 1CICC 1RIHL 1C7TA 1T1XA 2BFVH 1MFBH 2Y6SC 4P3CL 4DKEH 2Z31A 4KI5F 1U95A 3EYFB 2J8UA 4LLQB 1K4DA 3CZFA 4Z0XB 3QSKB 3ZKMC 4F2MB 5TJWK 3P30L 3IFNL 4DEPB 4RX4D 2Q7YB 3BISA 2DWEA 3QDMB 3GSOA 4G5ZH 3ZYJA 5MEOB 5F9OH 2GFBB 5EPMA 2HFFB 1TDQA 1WAAF 1P53A 3QJFA 2HTKD 3IU4L 5BJTB 2HT2C 3NVQA 1VPOH 4AIOA 2GHWB 1LO2L 5ID0B 5T1KD 4JRXB 3MSPA 5TGBA 4HLZH 3TJHC 4G6ML 3U2SA 2Z91A 4G9FB 4UTBL 4JHWH 3P4LA 2YUVA 4JJ5A 4TOYL 1ITCA 3B2VL 4HWEL 4LIQE 4NN6C 1SYVA 1QVOB 2AI0L 2ICWJ 4JPIB 3BN9C 2Q1EA 4JFEE 3D39E 4ONOA 3VDAA 1OQXA 1QA9B 4NQCD 4G8EA 3CVHA 5J6HA 2E6PA 5ALBH 4Y5YB 3ME0A 3PWNA 5F3HB 4U1IB 1RURL 2P8PB 5FM4A 4KMTH 4K3DH 4X6BA 1JF5A 3TH4T 4Z7WE 2NY2C 2ATPA 3C2AH 3W82A 1I1AC 2JJTC 1RPQA 2BERA 3HE7C 3KLSA 2Z91B 4NQCE 1UB5B 5JMRA 4TUKL 1TCRB 3C5ZD 1RIVH 2J6EH 4I3SL 5C0AE 2OMBA 4KZEH 3G6AB 4OUOA 1AXSB 2FH8A 4KJPD 3LQAC 5I9QB 2EDQA 2XWJB 3LKNA 4MJIB 5C7XL 2AAVA 4GAYA 2BMKB 3VXRB 2AXGB 4P59H 1UM4H 5IR1B 1XF1A 2NW2B 4I77L 1UYWH 5EU7C 5L88H 3NCJH 3WXVH 1MHPH 2X44D 4O2EB 2GJJA 1RULL 3VRLE 2ATPB 4K3EL 4GRWH 4ELKB 3WNKA 3K4ZA 2YKLH 4MD5B 4ZUTB 2YUWA 3QIWB 3D9AL 4IMKC 2Z31D 4HPYH 4HUVB 1CTNA 1BD2A 2HRPL 4JAMA 4LEOB 4YHOH 3EYSL 3IDNB 1LEGB 4YC2C 1F4XH 5J12C 2IADA 3S88H 3BE1L 5I66B 4FTVD 4G9DA 3ZTNH 1PQZB 4JANB 2XZQL 2IBGA 4YPGA 5IT2L 3MNWB 4HS3A 3HAEG 1MCPH 3DO3A 3HZYB 3CFBA 4UNTA 4HIXH 1FP5A 4JDTH 1XGRA 1PYWA 3WFBH 5KVDH 2FEDD 4MA8L 4GRLC 5ISZA 3MBXH 4J3SA 3F8UB 1T2JA 2IQ9L 4MD5A 3D2UA 1I9RL 5GZND 1MFEH 1S9XB 3MACH 1RZ8A 1U92A 3RDTB 3OXRB 3MRLA 1R24A 2VLKD 5F97E 4LLDA 3FZUC 5F6HJ 4HJ0C 5DRNA 4P2RB 2P5EA 5D7SH 4QRRB 3X3GL 2ZWLT 1LMKA 4X0KB 2W9EL 3C60D 1JVKA 2NYYD 4IOFD 1YN6B 4P2QD 2CDGB 3DUUB 1X7QA 1BQLL 3MNWA 5IB5B 3VXSA 4P5KB 3TYGL 1KJMB 3DSNA 3QHTC 3UTQB 2CXGA 1VGEL 5CUSL 2J6EA 5L2KE 4R4FL 4P2QB 4RFOL 3QBTB 4L9DA 3OAYH 1L7IH 2HT4C 5EC1B 3RZWA 3K8LA 5E2JA 1CFTB 2OTUB 5FGRA 4HF5L 2IAMB 1BHGA 1G0XA 1VDGA 4PJCB 4KK5D 3ULUD 2P45B 5IW1B 4ZPVA 5E99H 2PYFB 3QIBC 5D96B 3EOAB 3SKNA 3RWDB 4OQTA 1MREL 3S4SG 2VQUA 3OGCA 4OLZH 4LARL 1QR1A 5FK9A 1Q9KA 1LEIB 1F4WL 4PS4L 4R26H 1NBVH 2FX7H 5HTSA 2BSED 1AGBA 3BAEL 5IVOA 1T0NB 2R8SL 1CGYA 5IW6A 2F5AL 5FXCH 3V6FA 4OI8A 1QHPA 4WHYG 3SGEH 3HI6L 1MWAA 2DQCL 1JGLL 1ZEAH 4Z7WB 3GNMH 5F6IB 1VEPA 2AQ2A 4UOW0 1GPOH 3GMOB 5IVXB 3MNVA 4HHAA 1JV5A 2G2RB 2CRMA 5FCUH 1N5YL 4JFQB 3AS0A 4U1JA 1RK0A 4FRWA 4H20L 4I1NB 2EDHA 4M7JL 15C8L 3M1BB 2K1MA 3V5DA 1A5FH 3O6FA 3FONB 4PGDB 3WFEH 1INQA 2VR5A 3S9DB 1NFDA 5F44A 1OTSC 5BS0D 1MFDL 4P4KB 5I1AA 3D2UB 2B7DT 1BFTA 4LIQH 1WWAX 4OFVA 1YJDL 4YK4C 1S7VB 3QCVL 3RAJH 3IDIB 4LSUH 4LHUG 4X6CE 4C54A 1DUZA 3R06A 2R4SH 4HUNB 4R7NB 4PG2C 2DQUH 4WW2A 4TULL 2ICEA 4UQ3B 4LCCC 1TCRA 2GAZB 1INEH 2D0FA 1UEMA 3T09A 5CKGA 1EEZA 4YZFE 4PJGB 3P4NB 2WWMD 3MRDB 4FFWC 5EA0H 4OM0L 1OCWH 2VXUL 5EFIA 4U1MA 1FFNA 2P5WD 4YDJA 5T3ZE 4U3HA 5DRWB 3X3GH 4HK0B 4DTGL 1R3JB 5CP3A 3W11C 2X4SB 3I6LD 4MAYD 1BBDL 5GIRB 3QEQD 2VLLA 3PHOB 43CAA 1T2QH 5E6ID 5EZIL 3NIDE 3HE7A 2CDFA 5HYIA 3PABA 4PJIB 5K9QI 2YXMA 4XC3L 4Q9RH 2YD7A 4ENEC 4DWHA 3WXWH 5HI5D 3TP4A 3V4PH 3I6GB 2W65B 4NM4H 4DQOL 3SGEI 4HUVA 5L8KB 4QRRE 2VDLH 5J3HD 3P0YL 4TSAL 4RRPG 2AXFA 4NO5B 4O2FB 1I3RA 3KPSB 3U79A 4QRQA 4Y1AD 4GO6B 2Z9TA 3MROA 1E4XL 4Z5RA 2ZG2A 3WJLC 1I7RA 3Q2CA 3U1SH 1WBYB 2BDNL 3BESR 4HWBH 3O11B 1G7MA 2V9TA 1YPZB 4YHOL 3KYAA 3SY0A 2WBJC 4HIEB 5JPNA 2ZZUT 4W6WB 3SDYH 2BOBA 1RZJH 3N1MC 3EGSA 4D8PA 5JPMB 5F7EL 4HUUA 1OP5K 5CJQH 3MNVB 4OD2A 2HH0L 1YEKH 1BOGB 1NBYA 3EYOB 2VWEC 2VSCA 4QHNA 2SEBA 1JHLH 1T20A 2AEPH 3SKUD 3BH8B 1U95B 2JELL 4MSWB 1I1CA 4FQXB 1FNLA 1BVLB 2R0WL 1JFQL 4WI2A 3OF6D 3GSXA 3QUZD 4Z6AT 1SY6H 5BV7L 3ROOB 3DJ9A 5I1KH 4A6YA 2Q7YA 2UZYB 3C8KB 4MDJA 1VFBB 3TV3H 3ARSA 2E6JA 1FNSH 1I1FA 3LS5H 3W0WB 2VLJA 4R7DB 1HE7A 1FG2B 2F5BL 2QADD 3MA9L 5D71H 5DFWH 3LEVL 5F6IC 1IM3B 5DD6B 4NUJB 5E24E 4NQVB 3QG7H 2JLLA 4KQ4L 1HQRB 3QEUB 2CKBA 4GKZA 2I07B 2XKNA 3Q5OA 5A1AA 1YA5A 4KU1A 3GRWA 3WDJA 1G0YR 1HH9B 1KTKE 5I71B 4GW1B 3HI6H 1M6OA 1A4KB 5D6DC 2E8YA 3U2SB 3IYLW 3U9UB 1F3JA 1EAPA 4X98B 4RGMB 2C5DC 3LIZL 1VFBA 3RKDC 4C83A 4XP9H 1S5HB 2MPAL 5EN2A 1F45A 1JF6A 3MRQA 3W39A 1JNLH 4HWEH 2NY3C 4ORZC 2PCPB 4I2XA 3D9AH 4J7RA 3L3KB 5DMJB 2VXQH 2AK1L 3MUZ1 3PDDA 4GLRH 1KJ3H 1FO0B 4TUOA 5HYFA 1DBAH 3FQNB 3OWEA 5J1AB 4H0IA 1I8KB 1XIWD 3MCLL 1MWAH 2QQLH 3JWDH 1BD2E 2IAMC 2A38A 3H9HA 1E27A 4WGVB 1UCBL 4YR6A 1UB5A 3R0NA 4KKAD 3VGHA 5LXGH 3T0EB 3KPMB 1IAIM 3CVIH 1FL3B 2E7CA 2V5YA 4F7TB 3OAYK 3LB6D 2QR0A 3SDAC 5DJDB 4OGXL 2NTFA 5GRWA 2GSGA 3RWGB 4JQVC 5CIPB 2LU3A 4FMFA 4NGHH 3VWKC 1HOCB 4JDVA 1DEDA 4G3YH 1VGEH 5CUSH 1A02N 2VUYA 4M1GH 2F53D 4IRSD 1P4LA 4PV9A 4KV5E 3NCFB 5BO1L 5I0ZA 3AU1B 3VGAC 3QAZC 4IMKA 2VIRA 4KTEL 4LCUB 5L2KB 4L5FL 3ZT7A 4OZHE 4Y0GA 3GFUA 3SDAD 4JAMB 3HS0A 4WTWA 4I8DA 2IQAA 4D9RE 2V7NB 4KKBD 3RBSA 4JHBA 5ACZA 4OF0A 4LVHC 2A6KA 3QCUH 3CMGA 4ERSH 2ZCHL 2X4QA 4U6TA 1OF2B 1AC6A 3TLRA 4Q0XL 4WFGD 2ZP0T 4FABH 4ZXBC 5F9JA 1S7UA 5HGHA 2IBZY 4R4BB 1ITBB 3FN0H 4J8RA 1MRCH 3Q1SL 1AD0B 1IGYB 1IC7H 2WWMC 4ONGH 5ANME 5M7QA 2IPKB 1FZJB 2FH6A 2L7JA 4L9LC 2WMPA 5EOCL 3VXSD 1S7SA 3A67H 4HPYL 1HSBB 1QR4A 3TZVC 2ATKA 1S5HA 1HCVA 4YHNB 4IOSD 1IGML 1LK2A 1JPFA 3NCYP 4HUWB 4WHCA 4NQDA 2X6MA 5E8OA 1KG0B 1I8MB 3RY5A 3MX0A 1QBMH 3GMPA 5I9QC 3FFCB 4TUOB 2QQNL 3UTQA 4G6FB 3S5LB 4FOMA 3BHBB 3VFRA 4FQ2L 1AKJD 5TDOA 3MRIA 3F65A 3ULVF 1J0KA 2FSEA 3MROB 4Z5RB 2J2ZA 4EJ1C 1I1AB 5HPMB 1NFKA 4PRIA 1GGIH 4S1RH 3FN0L 4OLXH 5B38G 3GBLA 3HMXL 3PG2A 2YHGA 1BZ7B 2B4CL 4JLRB 4JFOB 1MAKA 1R5WA 1AO7D 4S1SL 3I6KB 4Y5YC 2I9LA 3HI1A 4ZUWB 4BZ1L 2Y25A 3MLTB 2EDJA 3PWVB 1V7NH 3WL9A 1CBVL 2BY1A 5GS1C 2AJYL 4PJ5A 3O3BB 1NAKH 1ZVSA 4LCWA 1A1MA 3NCBB 1OM3L 2E7MA 3GHEH 1FL5B 4WW2C 3X11A 3UROR 3IRPX 4XVSH 4OZFG 3V6OC 1FBIH 5D6DA 2EE2A 2HJLB 4UIKH 4F57L 2CIKA 3UTSB 2DF3A 3ESVF 2UZIH 4KZDH 5CGMA 3TH2T 1OARL 5IHZA 1UWEH 1SHMA 4R7DA 1AQDA 3V52H 5LAXA 1WIPA 5ESVB 3DXAA 4UBDD 3FB5A 3O9WC 1YEDA 1JV5B 1DLFH 3L1OH 1CFVL 1KB5A 3QUML 4FXGB 4J3TA 1BZ9B 1CXKA 5J9PB 2DM4A 1ZOXA 1A6UL 1JK8A 4DEPC 2V17H 4HWZA 3EJJX 1XCQB 3RZCD 2XQYG 4HX1A 3S35X 2Z8VC 1J11A 4UT6H 1N0LA 2Z35A 1MLBB 1P6AB 1PVHA 5CD5C 1S7XA 3V6OA 4IEFB 3BIBX 1JWSA 4K3JH 3Q48A 1ZLSL 4FG6C 4QRPB 1Z5LB 2V7HA 5D5MF 3FB5B 1YQVH 1MH5A 3MQIA 1IAKB 5DMYA 2LTQC 4LFHG 1DBBH 4WW2B 1G9ML 1PQZA 4YDVB 1K2DB 3V9FA 3DVGA 4CDHA 2ARJQ 1A7QL 5L6YL 3QNZA 1BFSA 3PGDB 2DIBA 2ZG3A 5HDBF 1EJ6A 1WBZB 3ARPA 4OCYL 4KTEH 1YY8A 2OCFD 1IRAY 5E9DA 3K8KA 4ZSOE 3HE6B 1XZ0A 3QI9C 2VZ1A 5MEQA 5DD3H 1MPAL 2RQ8A 2BRQA 5GIRA 3LEVH 3V4UL 4YHKL 3HPJB 1E0OB 3TA3D 1ZWIB 4N0UB 3WLWC 5ANMB 2R23B 3S36H 2OR9H 2YPLD 5I19H 4EN3D 1ZGLP 2FEEL 2ORBH 2F8XC 1LK3H 3WUZA 3BT2L 2EIDA 5F96L 4L9LA 5DI8A 3FZUD 2DM3A 4PRDB 1QUNA 3L7FB 2O61B 3B9VA 1OLZA 4QRQB 3WJJA 2FECI 3MCKA 3HC0B 1Q9WA 5CJQL 4PJEF 1FC2D 1CDIA 3VGBA 5LAXB 3RA7L 2W07A 3BW9B 2AK1H 2JJTA 5KJRL 1N3NB 2P47B 3UBXB 3QEGL 2K3TA 2QKIB 1AD0A 1IGYA 2BDNH 1EO8H 3OR7A 5ADPH 4EOWL 4PJGE 2PUQT 5FK9B 1BD2B 4KK6C 2CH8A 5T33H 2VKWA 1TQCB 3OBAA 2VDLL 1QLEH 2EYRB 3VWKA 3C5JA 4L3CA 3T0EE 1NGWA 4OZ4A 2ERJC 1VKXB 1WWCA 1F6FB 4APQA 4ZPTA 4FQLL 1MCLA 3SQBA 5HJ3B 3NH7L 4KQ4H 1MELA 3HZYA 4HK3J 4I18A 4TSBH 3S34L 2BNUA 1U8OB 2ZPKH 3QAZB 1A3QA 3IAGC 1KEGH 3B5GA 1HN1A 3TN0C 1S9XA 1FORH 2MQCA 4BZ2L 1MCCA 4WI9A 4HZAA 2AJXL 5LGHH 4YFDB 1BZ7A 5FYKH 5GGVL 4M7JH 4PRBB 5C09D 3QNZB 1LO0H 5BRZB 4NUGH 4EI5D 1KEMH 3ULUL 1UZ6E 4KRPB 4HJGB 3OR6A 4MB5A 1BAFH 2ZKHL 4LL9A 4QYOB 4PJEE 4ODVL 3ZDXE 1UACL 1I9JH 2VLME 1WC7A 2YMXH 1S9YA 3GBNH 5DJAA 1IARB 5DJ0A 5IFHL 3QO1B 4X6FB 4Y1AB 4S0SD 2MQ0A 3ULVD 3O45A 4NBXB 2EH7H 1WFOA 1V3JA 2DD8H 4K7FA 4MXVF 5D2LF 4KXZI 4QRSB 3VFNA 2HLAA 4OV5B 2F5AH 4PLNC 1CFTA 2OTUA 3O4LD 4JQIH 4IS6A 4M6NH 4QHMA 3ZDYF 2CIKB 5EU3A 4F33A 1MIEL 4GQ9L 5DF0A 3PQYA 4OQ1A 3F58L 1EEZB 3F7RA 1NC4B 3QPQC 4R6UA 5IBTL 2V2TA 3KYNB 2NXYB 3U0PA 2E6QA 4M7KL 4TVPD 3CGTA 4U2YA 5DO2C 5FGCB 1IKNA 4DAGL 4W4OA 1RIUH 3SDDA 4K23L 4KVNH 4LLWA 1A7BA 4PTTA 3BPLC 1P84J 3L5HA 3EFDH 5I71C 3BDYL 5H35B 1MCEA 5FGBC 3VFOB 1J0YA 4OV5A 2D7TH 3RUGB 2PR4H 4H25A 3QDGD 4MHHG 5TDNB 3OKNA 3K1KC 1JGUL 3N9GL 4HUXA 3I3DA 1OGAB 1L7IL 4ZSOB 3RVTD 5INDA 4X8XA 4XCNB 2ADGA 2AV7A 4XZUB 2MKWA 2O5XH 3D69A 3HFML 1UM5L 4MD0B 1BM3H 1NCCL 2R1WA 2BVPA 5C0JB 4LMQE 3D3VB 4G8GB 4I9WD 1OAQH 2G60L 5GS0D 3R0MA 4HQQH 4QWWC 1JGDB 2IGFH 1DEEA 4XAWL 3BH9A 3VXQB 3WNOA 1U8OA 2QBWA 4Y8AA 3OXSB 3SJVB 2DQJH 4BKLB 3S34H 5ID1B 4HSQA 1YEGL 5FDWA 3FT3A 5JR1H 5ESQB 3VG0L 2IALB 2EEBA 4M6MH 3MJGX 1A7OL 5FOJA 4PGBA 3J7HA 5EUOE 2GY5A 4J3WA 1HSBA 1MCPL 5HI3C 1DUZB 3F62A 2VB5A 4KC3B 1HDMA 5C2BL 1KB9J 3QUXA 3PWPB 3UO1L 4LPYA 4MD4B 4A6YB 1AKJA 2F58H 2YD6A 2WK2A 1X6NA 1JPFB 3RX5A 2R15A 3IKCA 3F7YB 4OI9A 1T0MA 4YHMH 5ITBH 1MIML 2HRPH 4OV6F 1IM3A 4DGYL 3SO3B 4LGSB 2L0DA 5JTWA 4H8WC 3VFRB 4K71C 3M45A 4LKCB 4LNVA 1R6VA 3S5LA 3MLXH 4U1KA 1IMHC 5I1HH 1BVZA 2R1YB 3ABZA 3O2DH 3QFDA 5GGRA 2YD3A 3BZDA 4M02A 5DA0B 3D0VB 1M6OB 4QHLB 1IFHL 1TVBB 2HMID 3U7WH 3WFBL 3P9WB 1C1EL 3O2VH 3KR3L 3TVMD 4MQTB 4WVRA 5DQDL 1DQMH 3DTXA 3VFGH 2X1WL 1IEHA 1K8DA 1G7PA 4AQOA 4BQ9A 1HH6A 3BIKA 4DZ8A 2IAMD 4NHCL 5F21B 2EH8H 3RUGA 5D7LA 3GKWL 2YBRA 4YBLC 5I15H 3HE6D 1CBVH 4PJEB 5IP4A 5I6XC 2Y06H 3D39B 3C60A 4NZJA 5B3NA 3IDXH 3O8XB 4XPHL 1EHXA 1NBQA 3DRTB 6CGTA 1FL6A 2VABA 1MHCB 3CUPA 4MD0A 1OAZL 4OUUB 1C12A 4P23D 4JG0L 3QEQA 1QP1A 5D2NE 5JOPD 1BQLH 4K3HA 1KPRB 3RI5K 3KXFA 3O3UN 4AIZB 2ZUXA 2PYEA 5CZVL 4L1HA 4JHWL 3MLXL 4ALAL 4PIRF 2J4WH 3O4OB 3N1PC 1OY3B 1F42A 3ARFC 3PQYE 5HGAA 4NJ9L 1NEZA 4YHLH 5DMIH 2Z35B 1SQ2N 3P40A 1F90L 3ARUA 2P42B 4P2CG 3WO4B 3O81A 3QFJB 4UILL 1MH5B 5KVDL 2B20A 2CXKA 3MLSH 5BXFB 3VXUD 3PQYD 1JRHL 1ACYH 3VH8A 4NJAH 1UXWA 4RFNC 5DA4A 3RVUD 3BKML 3IFOB 3T3ME 4MCYB 3BD5A 5CBAB 1EVUA 4L3EE 5KSAC 3S88L 1OVZA 3UP1A 5C8JA 4ZFFB 1EAPB 1F02I 5J8OA 1ES0A 4H26A 1KIRB 4U49A 3HI5L 1ERNA 5ICYA 1E6JH 1T03L 5C1MB 3MV8D 4ERSL 1UWEL 5F89A 2X4UB 1HHJA 5CSZA 3JV5A 3RNKA 5EORL 4KI5D 2N7BA 3SE9L 2VQ1B 1CFSB 1V3MA 4GAGL 5CWSB 3CC5A 2BY3A 1XGPB 1RUKH 4EN3A 5SX5K 3ZMRA 2A9NH 4K7PX 4OZGF 3KS0H 4YHNA 1Z9OA 5EO9A 2JB5L 3LHPH 4ENED 4RWHA 1FQ9C 5HVFB 1QR1B 2P8PA 3KPMA 1NMCC 5MP6L 3NFNA 4R96A 5IIEA 3LKSA 2WUBH 2MCG1 4MXWL 4PRDA 3C6LB 5E03A 3DO7A 2WUCL 2WIIB 3OZ9L 2IFFL 3OMZA 1MCQA 4RBPH 3HC0A 4GG6F 2Z93A 3BD4A 1RZFL 1H3WM 4YHIA 3V8CA 5F1IB 3D87B 2ZUQC 5CJOH 2OTPA 2XNAB 1MWAB 3QULB 5C0FA 1NLBL 2C7UA 2NR6C 4Z7QF 3H9SD 4UT7H 2R0LL 4X9HA 3MRHA 1B2WH 1GRWA 1ZAGA 3GJFK 4HHAB 4MNQE 5CS7A 1P69B 3MGAA 1HKLL 1P5UA 2C3GA 3WE6B 4BYHA 1I1YB 2WWKO 1YJDC 4G80B 3WNNA 4QTIL 1IGIH 2C3HA 2W59A 2XWTA 3OKKB 1U9KA 3UJIH 5B39G 1RZKH 2XFXB 4LSQL 3AFLA 2IG2H 3CDCA 3HNTL 4EI6B 1FIEA 2IH1B 3NTCL 1WBYA 1JNLL 4JKPH 1LO4H 2C3XA 2VR9A 4F37K 5HHOD 3PWLB 4OLWH 1A1NA 4FFYH 5B38A 4P23B 4O51B 4JE4B 2IPTH 1KJ2H 1QFOA 4NN5B 5EIVA 1EUUA 3OGOE 3V0WH 5D1XB 3MRNB 7CGTA 1FZOB 3U9PL 3T1WA 1JRHH 2WV3A 3LRSB 1S78D 3S97C 4XCFL 4UV7L 2A0LD 4IBLT 5C0CB 2FIRT 2AJVH 2XZAH 5CBAA 5MEPA 2ZCLH 1CDYA 1C8PA 4YXKL 5HYJD 2PF6A 2FR4B 4EI6A 4PRBA 1U8HB 3GRWH 3UEZA 5I1LA 4JQVA 3NH7H 3GSWB 4NYLB 5KTEH 3GSQA 4NC1C 1OT1A 1RK1B 2GW5A 4WU5A 2DTSA 4RMVA 3KPLB 5ETUB 1LK2B 4XNZC 3JXAA 1SJHA 4QRUA 4KKNA 4AEFA 4RGND 1T89C 4EN3C 3MV9E 2V7HB 1AO7B 2R69H 5FKAB 2VQTA 4JREB 5D1XA 3G6JA 3OF6A 4K7FB 5KSAD 1TVHA 3MZGB 1AP2B 3DYMA 4PLKC 4AQ1B 5CFHA 4FQCH 2ITDA 1EFXB 2XY2A 3VU2A 1BFVL 3QQ4B 3VMNA 2F74B 3AMLA 4NQUA 5MI0B 2R2EB 1NFDE 1LVEA 2AXGA 1HYSD 1VFAB 1T3FA 5T5FL 2XZCL 3KYMA 4HC1A 2DAVA 4W68A 2H8PA 2IH3A 2G9HB 1CFBA 3VFVB 4HXAH 3BQUA 4LLYB 4ZTPL 4TSCL 3C60C 1UENA 3HHRB 3QXAA 3PWJA 3OAZK 5C07B 3O3EA 4PP2B 4E0RB 1PG7L 4HXAL 3T2PA 1E27B 4WUKL 2C1PA 3KPRE 5CILH 1BF8A 1F11B 1A7PH 4XCNA 3IDJB 3BKJL 5BRZE 3CFCL 4RNRA 1UFUA 2P8MA 2VDNH 5D72H 1VEOA 3LIZH 7FABH 1X9QA 2XN9D 1DSFL 2ZUSA 1QBLH 1OP3K 3TPUA 2IFGA 1JRHI 2Y1VA 2OM5A 4KPHL 3BJ91 3MCKB 2H3NA 4JO2L 5JW4M 2NLJB 1JN6A 3VFVA 2CLRA 1M05B 2ED8A 3DLQR 3EHBC 1PD6A 3TIDA 4X4YA 3OG6B 1MCJA 2FWOA 3Q0HA 4D3CH 4P4KD 1X5HA 1QLRA 4MDIB 2XTJB 5D71L 4JFDB 1YPZE 3BKCL 2OTWB 2V2WA 1KELH 2X4UA 3WIIL 4PREB 3DGGA 4FMKA 4WHYH 3FONA 4PGDA 1HILB 1RZ7L 4OFPA 5FGCE 3V4VH 1VFOA 3DIFA 1YDPA 1U8HA 2ICES 2DQJL 3MOAL 1Y0LB 4J3UA 5DMGC 1CE6B 2IGFL 3HR5A 3ZT6A 3W0WD 4ZOEA 3RUGE 5FKPA 5I75C 3MUHL 1D5BA 5DQ9A 2NXYD 3KNBA 4Z77B 2EIEA 1UB6A 4MYWB 2NNAB 1YN7B 4J4PC 2OXGA 4KDTA 3B9DA 2Y36L 5F9JB 5I17B 4P2QA 4EDWH 3TA3B 1FVCA 4O5LH 3NZHH 3WS6A 1G84A 5KVFL 4JRWA 1H3PL 1A6TA 4UUJB 1ED3B 1RJYB 5JOFB 2BVQB 3PUCA 5IOPA 2BHZA 5KZCD 4U0RB 1KIPA 1RZKL 3L95B 4I0PD 2FLBT 1N6QH 3C2SA 3MV8A 1YEHH 2BP3A 5FF6B 4NFCA 3B2UD 4K8RC 1A3RL 2GKIA 2BZDA 4JCMA 4W70A 4YWGL 3WXWL 4F57H 3C5ZC 1GC1H 4DZ8B 5JDSB 4Z77A 2X41A 1RZGA 2DQGH 4Z95L 5DJ8A 4BH7B 3MGOB 1PZUB 1B2WL 2MHAB 4GMSL 1P4LB 2X10A 4PV9B 2W9DH 2YRPA 4JFXB 4HIIA 5IM7A 4QRSA 4M62H 2IH1A 4XTRD 3FRUA 4IMLB 1T83C 2VIRB 5L2KA 4CUCA 3X14B 3UPCA 2P5WB 2C26A 3DMMB 5IB2B 4LVNC 3BDBA 2NXZC 1NCWH 4PJBA 2BSTB 4HMEA 4OB5L 1MQ8A 1AXSA 2X40A 3H7LA 3RJDA 5FOBB 3KYNA 2W38A 1Q0XL 1NC2D 3BUYA 4WFHE 4N1EA 2YS4A 2NPLX 3IXAA 4YX2L 2V9RA 1KCUL 1IEAB 2P48B 5T3XD 1UJ3C 2GUOB 3ULSB 5FYLH 3FQWA 4HG4J 1AD9A 1RUAL 2MTPA 3NGBB 2FO4A 5CBEB 1MJ8L 1MI5D 5F9WC 4U3CA 4K94H 1TJIL 1QBML 4HUUB 2GQHA 2IC2A 3AS3A 3FO0L 3G5XA 2MCPL 5TE7L 3BQUC 4Y4KB 2OLDA 4YXKH 4C59B 3NFPB 1MVUA 4ACPA 5HJ3A 4HFUH 1H5BB 3DGGB 5JQ6H 3O6FD 3NIGF 3R06B 1OLLA 5E8DH 5C07E 2F8VA 3FQRB 3EZJB 2E7LA 4RGOH 3T0VA 4JRXD 4MLIA 4OZHB 1RU9L 3E6HB 1Q9LA 2VLJB 5FCUL 3INUL 1FFOB 2K7PA 1JPSH 1SYSA 3EOYG 2VDRL 5CLTA 1K3IA 3O2WL 1ACYL 1ROWA 5IKCA 1L9NA 4X7DC 3X13A 3BO8A 3K4DA 3QWRD 4UILH 4Z7UB 4PJBE 4L4VE 5AWNH 4OCXL 5FGBA 1F6LL 1QRND 3BE1H 2AQ1A 4Q6YA 4NQCA 5ADPL 3ARGB 3H9SE 4NKDA 2YRZA 3QP3A 4CMHC 4MX7B 4PS4H 4R26L 5F7DA 1JPST 3VFNB 1KXVC 3ARBD 4HKZA 4N68A 4AM0B 3AROA 3DX7B 4F15C 3BUTA 1KCRL 4G6FD 5EUOA 3PQYB 2Z4QB 4Q7DA 2YRLA 3RZCA 2CR6A 1G6VK 2HN7B 2O5ZH 5FO8A 1DP0A 1ODAA 1CGSL 2YK1H 3GMRB 3I50L 1ZS8A 3THML 3TCXA 3VH8G 4Y4KC 5MP6H 1ZANH 1F58L 4LLWB 4OT1H 3HE6A 3L3DB 4FFZH 2CKBH 5I19L 5SX4H 5ICZA 1M05A 1MJ7H 4UI2A 3FFCE 1ADQA 4ZPVB 5F1IA 2X42A 3FKUS 1ZLWK 5IB3A 3S36L 4CKVX 1SYVB 2HT3D 4TQEL 1NGPL 1D9KB 2A74A 2YK1L 5D1ZC 3UZQA 4L3EB 4S1QH 5HDQH 1FGNL 1U8MB 3QQ3A 5IMMB 1HINL 3SKOA 3RZCB 3TNMA 1CLYL 3EIFA 3FJTA 4QHKJ 2H6PA 1L6ZA 1HWGB 1NLDH 1S9WA 2NXZB 2R1XB 1NAMA 1MCBA 5E2UL 3I9GH 5I18H 4LHJB 4WFGE 4AEIL 4ODSL 5TE4H 5DMKA 2AABH 3FRPA 3GMQA 4P3DB 4AEIH 4YUEH 3QDJA 4Z78B 4BSVA 1WV7T 4TOYH 2QL1A 1DL7L 2IQAB 4LDOB 4Y4HC 1N3NA 3RU8H 2DQIH 2J7LA 1JZ6A 5GGRY 3VG9B 3TBWB 5T3ZD 1YQVL 1DQLL 1RK0B 2DQEH 1F5WA 2X4OB 4WEMB 5C0BD 2X4RB 1N7ML 2XZQH 3LSOB 1ED3A 1L7TL 4JPVL 2FBOJ 4OZFH 1QSED 1FFOA 3OG4B 3QEQE 3A6CL 3N1FC 1L7TH 4JPVH 4IRJB 4U2ZA 4P4KA 5I1AB 2DL9A 4X9BA 4KHXH 2V17L 4ZYKB 1IQDA 3LAFA 1OAYH 1NUNB 1EMTH 3BGFC 1IAIL 3QFJA 4K9EL 4KQ3L 4F7PB 5KS9B 2HFGH 1P4BL 1LEGA 1UADC 2UY6A 5DHYA 4TTDD 3TVMB 3VH8B 3ARDC 2JIXB 3GM0A 4CVUA 4NN7B 3QRFM 2ICEB 2A1WL 5ACMA 2XTJE 3O6LL 4Y19A 4IRZH 2EICA 4WFFD 2HWZH 1OP3H 4HCRH 5JA9A 1T3FB 1H15B 5LVEA 2R2EA 1KLGA 1DVFA 4ODTH 1MAMH 3KJ6H 2X4PA 3QDJE 3VXME 1DBJL 3KYOA 5CKAA 3HZVB 4MWFB 2DICA 5BVPH 1TZIB 2H2PD 3C9NB 4PJDB 3Q5TA 4PY7B 3HUJF 1UKQA 2CLZA 2A73A 2VLRA 4WO4A 2VDRH 4Z8FH 3I84A 3KPNA 3VXSB 5IB5A 3NPSB 2FL5A 1OTTD 1PY9A 3LDBB 5DXWA 3BVNA 1LP9A 1Z3GH 2X7LB 4YH6A 1KYOJ 4MS8C 4L4VA 4BSWB 4DAGH 4XCYB 3WN5C 4F2MA 3QZWG 3QWRA 4W4OC 1Z9MA 4NNXB 5FUOL 1QD0A 4O2FA 3L6FA 5FA3B 1BQUA 4GT7A 2QQKH 9CGTA 1X4ZA 1GC1C 3PE9A 3O11A 2DIAA 4APQB 3GSNA 5DJ6B 3CMOL 3WUWB 2CK0L 1WBXB 3VXPA 4NZTH 4EI5A 3D1MC 5E8PA 3KPOA 1ZHLA 2BXYA 3JVGC 4KKCC 1QOKA 2IANE 4OCNC 3KPNB 3M07A 4HKJB 1TTFA 1UQSB 4UB0L 2WZPD 4XP4H 1LE5B 4QRPD 2VDQL 1J10A 1FVEA 5T1KB 4M7ZB 3VFSB 1SM3H 3U4EB 4KK8C 1LE9A 2R0ZH 3BFOA 5GGVH 3S3JA 1I8IA 1Y0LA 3WN5A 1NDMA 3RVUC 4LIQL 2GCYB 3G6JE 1FCGA 1YMHA 4V2BA 2I26N 1NGQL 3T77A 5JHDA 3CH1B 3TIEB 1IGCL 4OZGE 2C4XA 1OSZA 2J1KA 1OTTC 2VDMH 3LY6A 2P24B 4IIQB 2A83A 3TA3A 1RZ8B 5DD0L 4M5YH 4JFYA 3BEWA 1DANU 4KRPD 3E6FB 4LP4A 4P46B 2GTWA 1BIHA 3QO0B 1HCFX 1INQB 2J8OA 1YEHL 4QRRA 1F3JB 4AENA 2W60B 4X6CA 1JGEB 2XY1A 2MJWA 1XR9A 1A7NL 1ZT4A 3V7AE 1URLA 1DVFD 2HFFA 3L3GB 4FP8L 3RNQB 3WLBB 4MZ3A 4EOWH 3RWEA 5GRJL 5ELIA 4J6RL 3CFCH 5D1QB 5JHDB 5D1XC 1C5BL 2OZ4A 3QI9D 4OB5H 2C1OA 5KVFH 5HYSA 1FL5A 3X11B 3KPQA 4P23C 2Y6SD 5EG6C 3LKQA 1ZXQA 5GZOC 1J8HD 2VLRB 2O93L 1JIBA 1QFUL 4O9HL 3FHQA 1J1OH 3MRRA 1CG9A 4Z18A 3P9LA 4QHLA 4NKMA 5GGUA 1GGCH 1FLTX 1CS6A 3UC0H 4ELMB 4MQ7B 1GC1L 4BELD 4JFFE 1FAIL 1RJCA 2OI9B 3J8F7 3TBWA 3BSZH 2J5LB 4M61A 3OGCB 1JWMA 2OX5A 3FQWB 1MCSA 5IQ7H 1PKQB 2G9HA 3AUVA 2YPLB 4NRYA 4X6BB 1C5BH 3FQUB 3FRPG 3B3IA 1V5JA 1BAFL 1H3VA 3UAJD 3O3EB 4PP2A 4E0RA 1A7NH 4HKJA 1IQDB 4O5LL 2FRGP 2F54B 3G08A 4Y4HA 1U92B 1T89A 3IT8D 1NKRA 3AAZA 4YDLC 3RKDD 3A6OA 4OD3H 3DBXA 3C6LC 4KPHH 4LLQA 2EC9U 5E00A 3LKNB 1QSEB 4MJIA 2AXFB 4NO5A 5MENE 1WWBX 3IDYB 5ACZB 5IFJA 1XMWA 3MOAH 5JORA 4UBDC 1I9RH 4N8VA 5FUCC 3CH1A 4H8WL 3TT1L 3WIIH 4LASL 4X7TB 4WCYH 1TIUA 4WUUB 1S7QB 3EOBB 4PJ9A 3V0WL 1DBKL 3MBEC 2D7QA 2ICWA 1ZLSH 4N9GB 3FFCD 2X4TA 1B88A 3BH8A 5C0BA 3TBTB 4M7LH 1IL1B 2CLVA 4LHQB 3GSVA 4YQXL 4UT6L 3RPKA 1CU4H 1RI8A 3JV4B 4G6JH 1KACB 1INDL 2GTWB 3EYQC 4NKDB 2HFEB 4R3SB 4B5EA 1W72H 1F3DJ 4E41B 4CU6A 3Q6GH 4NC0B 1ND0B 4G8FA 3AM8C 1X6LA 2IG2L 5FHBL 2VLKB 2GK2A 4YPGB 2VDKH 4OM1L 4R90H 3L3GA 8FABA 3RA7H 4HS3B 4CGTA 3D5OF 3OV6A 4M5ZH 3QUMH 5LCVL 1Q38A 3WO3B 2EDDA 4BSWA 5FO8B 4QXTA 3MRKA 2HLAB 2BOCA 4JGJA 3D39A 4QNPE 1NEZG 4D0CA 4UDUA 4DFHA 2MNUA 3RL1B 2CSPA 4RIRA 1RJYA 5E94A 1A3LL 2YA2A 3TO2B 4ZDHA 1FZKB 3O4OC 4XVSL 2OJZL 3GRWL 1N4XL 2DI9A 2JCCB 1TJGL 3CDFA 2ITCA 4I2XB 4OFYA 3ARWA 4L8CA 1ZSDB 3GMMB 2AJ3A 3LDBC 3SBWC 4BH7A 1JYNA 4M1CC 3QWOB 3NIFE 4FQCL 3HA0A 4OTXL 2HJLA 1NGWB 3AY4A 3TPUB 4XVJL 3SGDI 3UYPA 5GRYA 2YZ1A 1NFIA 2EO1A 4OLWL 3UBXG 1GYAA 3QIWA 4V1DA 1E4KC 2HWZL 1XGYH 5ABDE 2ZJSL 5DWUL 2ZUTA 2VLRE 1CK0H 4K07A 4RAVA 4P5TB 1JI1A 3K0WA 3PGFL 4E42B 5KTEL 5F7UA 1ZGLA 4JN1H 5D7JC 4L8CB 1YYLH 4PTUA 4C56A 4LCCA 4UQ3A 3DXAD 3BOVA 1KJ2A 1I4FA 2DQHL 5FUZL 3CPLB 3UC0L 4P46A 1SM3L 3V95A 4ETYA 4NN7C 5CIPH 2Q6WA 3D25B 1T0NA 3AREC 4FNLL 5D2NB 2VITB 3ROOA 5GS2H 1CFQA 1A22B 5E08L 3VXMD 2DDQL 4WNQB 4FFVD 2DI7A 3TF7C 4N9GA 1Q9OA 3WNMA 3PL6B 4PJHF 1R3KB 4PJ8A 2YPLE 3DXAE 1BOYA 1IC7L 4QRPA 5D2LA 4ZNCD 4K8RH 3ARDA 1TQBB 2C1OB 2JJSC 2PTUA 1P1ZB 4U3XA 4YHYB 2BHUA 1NMAL 1NQBA 3HZKA 4ODXA 5GRJH 1A9BA 1KT2A 5L7XL 1OF2A 4UZGA 4ZODA 2ZCHH 2X1OA 3RL2A 4X6EA 5GRVL 5JHDD 2OL3B 1OPGH 3T3PE 3MRKB 2V2TB 1YNLH 4ZAKB 3ORJA 1S7RB 2GJ6B 2B39A 1KYOK 3BPOC 4U6HB 2XPGB 3ELAT 2Z92B 4L8SA 3NA9H 3V6OE 4MNGB 4C57C 3S8WA 5GISL 3BP5B 2MKLC 1BGXL 5BCAA 4NNPH 2CIIB 3MGOA 3QEHB 1RZFH 1I9IH 3ZO0A 3HI5H 3REVB 5FB8B 2APBA 3T0ED 4Q9CA 2DM7A 2FL5B 2F54A 2BY2A 1NUFA 4MJ5B 4RGNC 3DMMD 1CGXA 1U8NA 5JOPE 4OLYL 1GGIL 4S1RL 1RMFH 3BYYA 1I7ZB 4OGXH 4ZOAA 4XP6L 3D85D 4HCRL 3O6FC 2QR0B 1J8HA 3BJLA 1A7RH 3VWJD 3I75B 4XBEH 4YXLL 4RFOH 3KYMB 2A9NL 5DR5L 3VJ6B 4QHUA 2HKHL 4GG6B 2XG5A 3BKYH 2HMIC 5SWZE 2VOTA 4YDIL 4LLUA 4N8VB 2G5BB 2OL3L 1CIUA 3MLRH 4Q6IC 1T83A 4JZJC 2I9LB 3HI1B 1N64L 4M8QB 3AU1A 4XPGL 2ADJB 4M1DH 1U3HC 4WRLA 4NHUA 1QEWA 2QKIA 4ELMF 3P3YA 1B0RB 1FH5L 4OF3A 3DUSA 4M43L 5C0NC 5ICXA 3M1BA 5DGRA 1J0HA 4XP9L 1Z3GL 4L3CB 1MRCL 3Q1SH 2NX5D 1YQ2A 4KK5C 4X0KA 4LBEA 3G6JF 4WNQA 5F7YC 2H3NB 1AJ7L 5DK3A 4X8JA 1NCNA 4BM7A 2FEEI 4RDQF 2QSQA 4YHZH 2JJWA 4N0RA 3WFCL 1HI6B 4I4WB 3FB6A 4LCYA 4OZHF 3FQNA 4Y2DD 1AGDA 5T3XE 3PGCB 4ODWB 2IPKA 3ILPB 1HHIA 4AT6A 3DV6A 2ITDB 2HKFH 2E7HA 1N64H 1YMMB 2Z31C 1TTUA 3TO4C 5DURD 3RWEB 1G7LA 5J6HB 3QWQB 4ZUVB 1OAZH 4XNUH 5K9KB 3K46A 2VQ1A 3GJFH 3MFFB 1FCCA 3BQUB 4NCC1 2J8HA 5I1HL 3JWOL 1KB5L 4KMQA 4Q74A 1KCUH 3T0AA 4JM2C 4PLKD 5E8NB 1EAJA 4Q9BA 5C07A 4N1HB 3PGCA 4JFPA 1J88A 2N4IA 3KXFE 4HLZG 4G9FD 1TLKA 1IBGH 1SEBB 1FDLL 4JZOA 2A6JB 2ZSVB 3X12A 3KLAB 4AEEA 3NBNA 5JUEL 2E7LC 1GZQB 2DQEL 5IBTH 3W9EA 4XMKH 4U1JB 4LF3B 2I9TB 5FGSA 1OHQA 1QQDA 5E6YA 2Y72A 4QT5A 3FO2A 1AY1L 4PB0H 5A43C 5TFSL 1NFDB 4ZOBA 2ENYA 4C58B 4R4NC 3GMLA 5I18L 3QT2A 2DKUA 4NHUB 1ZTXH 4EUPH 1CXFA 4X4XB 1PJ9A 3MLUH 3HC4L 1UZ6F 2ZUWA 1ORSB 2ZJSH 4OSUH 4RCAA 4OZIB 4BSVB 4PJXA 5F7HA 3CZJA 4ODVH 2FHFA 3LN4A 1JL8A 3ROLA 3QUKA 3AVEA 3FQTB 3HLAB 5D7IE 1WZ1L 2IADB 4BFGA 3KPRB 3MMEB 4N90E 3VGEA 5J9PA 5SWSE 5FHAH 4ZS6D 1RUQL 5K59E 4P49A 4PBWD 4BUHA 2Y36H 1JK8B 4RGOL 1DEEB 5C8JB 4XHJD 5EO0A 1HXYB 5B22A 5F9OL 4EI5B 1I85A 5TH2A 1CT8A 1FORL 5CP3H 2EEAA 2CMRH 3EYUH 5IB1B 3SQOL 3E2HB 3UBXA 2I07A 4JVUA 2N1KA 4JQXA 4U1GC 3P30H 4U1LA 1B0GB 1YEGH 3BN9D 2D31A 4MNGA 1JNNL 3RDTA 3QYCA 4YBHA 4XCEB 1I7TA 3OSKA 2CIIA 1ZT7B 1I9IL 4NFDA 5I8CA 4N0CD 1KELL 1AGFA 1ONQA 4R0LC 5JLZB 4G6KL 3PWPA 1KCRH 4K7PL 1UWGL 1BGXH 5A2KH 4WHDA 4JGUA 1UM6L 1FO0L 2LTQB 2HLFC 5T3XL 3BPNC 1T7WA 5HY9A 5DFTA 1R5IB 2YD8A 1E4XH 4M5ZL 4F8TA 1W72B 2EXYC 3U46A 2FECL 1JYWA 4A2LA 4HGWA 4PGZA 1OSPH 3GJEA 4WWKC 2Y5TA 4OKVA 4EZMA 3O6ML 4D0CB 5JPNB 3MYZA 1FVDB 4RBPK 5DEGA 3JV6B 1ZT1B 1I3GL 1JZ3A 3K3QA 1T22A 4JFHD 4GAJH 4L29B 5L0QC 2I60L 2PYFA 1X5ZA 1DQDL 5ALCL 1KPUB 2X4NB 1QPPA 3GSUB 3U83A 2AJXH 4PYHA 2UUDH 1N6QL 1U42A 2A77L 4X6DE 4AJ0A 3U0WL 3U4BH 4ZFOL 1OAUL 4HMDA 5IW6B 1T2XA 2EDTA 4PRIB 3ARBA 2XACC 1CR9H 3S37L 4GKSA 4CU7A 3C5SB 2WWKT 2GJ6E 5BZWA 4NQEB 1YNKL 3PDOA 1INEL 1U3ZA 5IHBA 3LPFA 3G6AA 3QR2A 2FX8H 5E5RB 3MLWL 2DQUL 1T66D 3KXFB 4AIZA 1QNZL 2ZKHH 4HFWB 3MV8E 3G9AB 2XKSA 1YEIL 5FYJL 3T0BA 3QCVH 3VFOA 3NA4A 2DTML 3JWOC 4Z7NE 1CQYA 4W4NA 2NY4C 5IB1A 5D70H 2AJSL 3TT1H 2MMXA 4UDTB 2R56L 2O5YH 2PYED 4TNWK 5GQBA 4J8RB 5E2VL 1EHNA 5EU6E 3F5WA 5F7WC 4NKQB 3QUZB 1FAIH 4KUZH 5J11C 1G7QA 4XZUA 4H20H 4GMSH 1VFMA 1VEMA 1A2YA 3BP6B 5J6GA 1U0QA 2YPKB 5EU4B 1EIBA 4F7EA 5DEZA 3SDCB 2PYEE 4JO1L 1AP2A 3IB4A 1FGVL 3ARQA 3L3OA 4K94C