4NX1A

Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1, target efi-510292, with bound alpha-d-taluronate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
323
structure length
308
Chain Sequence
HHHHHHMETVLRGASMFDEEHAFTKTLRKFEELVDEKYDGDVTFDLRLNGELGVESDYVTFLNQGVAIDYTILAPSNMAKFAPSIPLMDMPFLFRDLDHWNAVLSSDVLAPLEDELLEKADIKIVGYTGGGTRNLLSKQPVVTFDDLKGHKMRVMGAPIQAQIFQALTAAPSAIAYNEVYNAIQTGVIAGFENEAASIQNLKFYEVAPNLTLTRHSITVRPIVMSGKTFNSLPADLQAVVLEAGEEAGAYGRELESREDGVKLQEMVDAGQLTVSEFENRDKMLEMVKPVQDAYAAEIGASDLLEAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Transport protein
molecule keywords C4-dicarboxylate transport system substrate-binding protein
total genus 99
structure length 308
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nx1A00
4OVSA 2HZLA 4PCDA 2HZKA 5IGAA 2ZZXA 4P1EA 4PAIA 4PBHA 4OVRA 4OVTA 4PFRA 4OA4A 5I5PA 4MAGA 4MNCA 4N4UA 2XXKA 4OVPA 4PETA 4X04A 3B50A 4YZZA 4N6KA 4MNPA 2V4CA 4MIJA 2WYPA 2VPOA 4O7MA 4PAKA 5IZZA 4O8MA 4X8RA 4PGNA 4LN5A 4MEVA 4XFEA 4XF5A 4MCOA 4PGPA 4PDDA 4MHFA 4N6DA 4NHBA 4PFBA 2XWVA 2CEYA 5I7IA 4NF0A 4N17A 4YICA 3GYYA 4NX1A 4O94A 4NGUA 4DI4B 4MX6A 4PBQA 2XA5A 5IM2A 4N8GA 2PFZA 4PC9A 2CEXA 4OVQA 4DI3D 4N91A 2WYKA 4NN3A 3U65A 4P8BA 2XWIA 3FXBA 4PE3A 2VPNA 4NQ8A 4P47A 4XEQA 4P9KA 4N15A 2HPGA 5LTCA 4PAFA 4P56A 2PFYA 4PFIA 2XWKA 4MMPA 4NAPA 2WX9A 4N8YA 4P1LA 2ZZVA 2ZZWA 5CM6A 4UABA 4PDHA 4PF6A 4MNIA 4PF8A 4OANA 4P3LA 4NG7A 2XWOA
chains in the Genus database with same CATH superfamily
1POY1 1N04A 3WAFA 1D3KA 3D4GA 1LGBC 3ISPA 2XX8A 2O6AA 5I57A 3QK6A 2H98A 1QUJA 1FQFA 1ZKBA 4OVPA 4F18A 4GXAA 4PETA 3CG3A 1PBPA 1HSJA 4BDQA 4RK9A 1QJMA 2VPOA 3KC0A 1NV3A 3BIGA 4MH5A 3FGSA 5IZ1A 2RCBA 1JP4A 2E0SA 1DOTA 5FHNA 2FIXA 4GQOA 3IOUA 1FCKA 2X7PA 2B3FA 3ZKKA 1UTHB 4NF5B 2I3WA 3OEKA 2V3UA 3RUMA 1FQDA 1UTHA 4XKNA 4ZE9A 1B3LA 3O2AA 3RPLB 4JXIA 3N26A 1YZ0A 4LQ2A 1B1HA 3UGWA 3E13X 1USYH 3MJNA 1JETA 3T9XB 3H3GA 2XD2A 1P99A 4AB5A 2Y7IA 3LV0A 4GX4A 4WEDA 3SEVA 1B40A 2F6GA 4OVJA 1LBBA 1OLCA 3M3KA 3N6TA 3KN7A 4JSDA 2QMXA 1B7HA 1D9YA 1FTJA 2GRVA 3K4UA 3HHFA 4M4GA 4P47A 1Y4CA 2OZZA 3LUZA 1LAGE 4IO3A 4QFPA 5EYHA 1SW4A 1NNTA 2LAOA 1IZ1A 3MAMA 3FJGA 5DVFA 1FTOA 1Y1ZA 1EZ9A 2XWOA 3K00A 4QFKA 3NOHA 5IZ3B 3DP4A 5AA4B 1G0HA 4OVRA 5JTYA 3TCGA 4H8JA 3WAEA 4IO2A 4FIMA 2XXKA 2H9BA 1N0TA 3B50A 1MXUA 1MXVA 1WDNA 4OEUA 4HE1A 4H45A 3PU5A 3C31A 3CFXA 3CSGA 4ONYA 1NNKA 3DLNA 2I49A 3IFAA 4XF5A 1K9YA 1DSNA 3MVXA 3H6VA 1FPBA 3K1NA 4X1BA 5TU0A 3VLUA 3UORA 1XI6A 2OWTA 4PFBA 3OENA 2ZYNA 4ELOA 1IXIA 4KYSA 1FPLA 2NXOA 2RINA 3FD3A 3TQWA 3U92A 3DM0A 1FBGA 1Y20A 2ZXTA 1QKAA 3K6UA 4GWZA 4ISUA 3GLBA 3A29A 3RTFB 4EQ7A 4NTLA 5H8NA 4BDRA 3FBPA 3LSWA 3MPKA 2DQVA 1LB9A 2KLFA 3M3LA 4NN3A 1FQBA 1P1UA 4IGTA 1FPDA 2XWIA 3QIMA 2FA7A 3FXBA 4GWUA 3K1PA 1TT1A 5H8FB 5I84A 5EQAA 3O6GA 3F11A 2XXWA 2Z8EA 3OEMA 4POXA 1FTLA 4G4PA 4QFLA 5I59A 1H45A 5K2YA 3RY3A 3K6WA 4HS7A 4I1DA 4FBPA 4BDOA 2Y7RA 4PCDA 3C35A 3JYRA 4KFQA 4YKIA 2AL5A 5J16A 1KA1A 3HO7A 4XKRA 2UXAA 3L6HA 5I5PA 2YLNA 1FPGA 3O9PA 4MIJA 3C36A 4F29A 3K02A 3R7XA 3SKPA 3CG1A 5DVJA 4MEVA 1QGXA 1JQFA 3IOTA 4NF5A 4TQUQ 1T0KA 3UN6A 4NF0A 3R26A 1P1OA 3MP8A 1FBFA 4PBQA 5AA1A 1RYXA 1ZJLA 2O7IA 2DDKA 1KWHA 4R9GA 3PUXE 4JDFA 4N91A 3GBAA 5LOMA 4IB2A 4P0GA 1AOVA 3OO7A 1UTBA 2OCUA 1XHYA 3B6TA 3TUSA 1AWBA 3U8QA 3S4UA 3T96B 2P1SA 1LBVA 2DWHA 1MPDA 5ICQA 4AQ4A 3TTMA 2HPGA 3IO4A 3OO9A 4PFIA 3BKIB 1B46A 3EHSA 4ZEBA 3HCQA 3T1BA 2HXRA 2G29A 4EXKA 4GRKA 4BDMA 4PDHA 5EYFA 4MNIA 1NV5A 4GX3A 4OFOA 3U93A 4POWA 4RA1A 4IY6A 4PFRA 3E78A 2F97A 1XOCA 3RTWB 2XXIA 4GWSA 4R73A 5DVIA 4AS5A 2F5XA 2F3DA 2XXTA 1NNPA 1SI0A 2B4LA 3IB2A 1B52A 4DXCA 4XKQA 3W9VA 4U1OA 2HAVA 5H8HA 3A3UA 4LP2B 3EHTA 5I2NA 3FXUA 4I8CA 2ALUA 3CHGA 4BLAA 1GV8A 1IMFA 1IMCA 1MDQA 3O29A 2E1SA 5HPQA 3E4RA 1MY4A 3LSXA 3ECRA 4P8BA 1MY1A 2ONSA 5F1QA 3PPPA 4XXUA 1ELJA 4MF3A 4P56A 1NV2A 1B5JA 1VDWA 3M3FA 1MDP1 3U94A 3N5LA 2B3BA 1MPBA 1NH8A 1A8FA 1DTGA 2F34A 1PB9A 4PF8A 3IR1A 1PBQA 2HZLA 4PTKA 4GBWA 1LBWA 2F7AA 3TAJA 1B32A 1I6QA 2WBDA 3IOWA 4YB6A 2DVCA 1LAXA 2QS3A 5ICTA 2OBGA 1XC1A 2DWJA 3SEXA 3HFUA 4N6PA 4EXLA 1XVXA 2Z23A 1XS5A 3BBRA 3W9WA 3HSTA 2A5SA 1VFDA 3OD7A 3ODBA 1IMBA 2V25A 4R74A 1YTVA 1JEUA 4F39A 2HFBA 4H6DA 1I6BA 2Y7WA 4N17A 4LATA 3QYTA 1I6AA 3ZS6A 2G93A 5H8HB 1L5TA 3G3GA 4WEPA 3C4MA 5AA3A 1Z7NE 4X9TA 1MXXA 1B05A 5H8FA 1RYOA 4O7IA 4GL0A 3V5AA 4OVQA 1B9JA 4PFTA 4GVOA 1CB6A 3FUZA 4PE3A 3TKDA 3TPAA 5F24A 3VVDA 4PP0A 4JBZA 1ZLQA 2XD3A 2F6PA 4JSOA 3H06B 3CIJA 2UVHA 4YU0A 2WX9A 4EDPA 1LSTA 5KCJA 1LB8A 4P1LA 5FTIA 5IKBA 2YJPA 1NV7A 3V89B 3MPLA 3I5OA 5EHMA 4RJZA 3C9HA 3MZBA 4F3PA 2R8TA 2P0SA 1MY2A 2UVGA 1SW1A 1J1NA 1LBXA 4Z7EA 1KA0A 4RPOA 3CVGA 1OQHA 1FQCA 2ZYOA 1BKAA 5A5XB 3D4CA 3TYHA 1MS7A 2UYEA 1Q9DA 2QL3A 4PAKA 4ECFA 1D9QA 4JB7A 2H25A 1M5FA 2I4BA 1MXWA 2DWAA 1B3EA 5DEXB 1NUYA 2BJIA 5IAIA 2DE4A 1R1NA 2HXWA 3E9XA 3CRBA 3I3VA 2Y5LA 4R6HA 4IO6A 1B7ZA 3VVFA 3RGYA 3KZGA 3JV9A 5AA2A 3FJMA 2DYXA 1MRPA 4R72A 3PD9A 4ZZEA 1IITA 3PUWE 4IY5A 5CI5A 3N6UA 5I58A 2ABHA 3DP8A 5EQ9A 5EYGA 4H5FA 2CZLA 5FBPA 5I56B 4MBPA 2CZHA 4I62A 4IO4A 2X7QA 4F3BA 4PAFA 4TLMB 3S9MC 4F3GA 1O64A 4MLQA 4G8MA 4ZEIA 4HE2A 3KG2A 4ZE8A 2Y84A 3QUFA 4GX6A 2QPQA 4XIGQ 1LCTA 4ZEKA 4JWYA 2GQ1A 1PC3A 3HN0A 1Y3PA 1SI1A 1O63A 2H99A 4OVTA 3Q25A 4WKMA 1B5HA 3RQTA 4U23A 2Y5KA 1NL5A 1NV6A 1Z7ME 3GXAA 5KDTA 4QXDA 1LLSA 3PPRA 2RF1A 1NFTA 4UACA 5B70A 5IZZA 4ZEDA 3O6IA 1B3HA 3V83A 1RDYA 4KD5A 2VHAA 4RK2A 4MCOA 3B8BA 4DIGA 1Q35A 5I7IA 3C33A 4LVQA 3AXFA 1UIVA 4NX1A 3TZAA 5ET8A 5A5LA 2KQZA 4OHNA 3Q28A 4ELRA 2ONKE 3IORA 4QRZA 1S7YA 1NMUA 4DI3D 3IB1A 1PEBA 5L9MA 1MH4A 1JEVA 4H8IA 3FJ7A 2GFEA 3S9EA 2VPNA 3S9NC 3CSBA 3HV1A 4PE5B 3S2VA 2QS2A 2XWKA 1ANFA 1FJ9A 1SW5A 3OOAA 4G8HA 2PT1A 1VE4A 1HSLA 1UQWA 2FHYA 5ITOA 3QXMA 5H8QA 2DVZA 3IOVA 1R6ZA 5J1DA 1AMFA 1FJ6A 5KDTB 2D5WA 3PMWA 2CZIA 2Q2AA 3EQ1A 4OENA 1N7WA 5I2KB 3RT8A 2XXYA 3UA8A 4AB6A 4YZZA 3TELA 1QW0A 4I3YA 1BP5A 3FATA 1MY3A 4O8MA 1TFDA 3VFJA 1IEJA 2ESNA 2ONRA 1QKBA 3A09A 4XFEA 1DTZA 1GTKA 4GL8A 4MHFA 2NWJA 1R9LA 4OETA 4YICA 3MC2A 3QUJA 4DI4B 4KXPA 3ILTB 1IMAA 4DLDA 2DWIA 4RNSA 2RC9A 3G3IA 5IM2A 1LFHA 1N3WA 3KEIA 2XHDA 4TOZA 3K2DA 1POTA 5H8NB 2A5TB 1XVYA 4IO7A 2Y7KA 3SEWA 4PFUA 1YPNA 4NF8B 3SZPA 1Q1KA 4H65A 3H6UA 1FSAA 3RPWA 4ESWA 4R9FA 3PUYE 5F7VA 2OJTA 4FECA 2DE3A 4QF9A 1FTMA 2ZZWA 5ET5A 1LBYA 2F36A 2REJA 3KOTA 4EUOA 1PDAA 5L9OA 4OFLA 3KGCA 5I3SA 5EQ8A 4R6KA 4KI0E 4P0IA 1MQJA 5DTBA 3T0JA 2PX1A 3RLFE 4GLIA 4PBHA 3EKIA 1FBEA 3LBSA 3FVGA 1B58A 4FEDA 4FAJA 4MAGA 5CBRA 1B4ZA 4U4SA 2F78A 4O3BA 4JVDA 3T66A 3SERA 1B0LA 1JVXA 3OSRA 3H4ZA 1K9ZA 2I48A 3QAXA 3KJ7A 4PGNA 3MSTA 1B6HA 3T9HB 5AA2B 2O84X 1URDA 4PDDA 1SQYA 5A5XA 1DCUA 3B7DA 1ATGA 2FBPA 4X48A 3GYYA 1PB8A 1FTKA 3CFZA 4C1UA 1FPFA 4YMAA 2F7BA 2GHBA 1GR2A 3QSLA 2L5VA 5AA2D 1QUIA 1H44A 2DXRA 2F8DA 3KBRA 3VE1B 4QSDA 5CC2A 3RYDA 1MM7A 1ZIUA 2XXPA 4G68C 4JVIA 1NI9A 1EH3A 1SD3A 1JW1A 3FVKA 4G8NA 2QVVA 2PFYA 2QRYA 1EZOA 3MW0A 2DSFA 3OO6A 4N8YA 1GGGA 1FBPA 3IL1B 3JZJA 3OMBA 1MH3A 1N3XA 2QVUA 2RKMA 4KHZE 1IXCA 4OVSA 1NNFA 1BLFA 3ZKLA 1B3GA 3ONMA 4DXBA 3RN8A 4OA4A 5I59B 5FHMA 1OMPA 3C32A 4ZECA 2BJJX 2DE2A 5T3JA 3SEUA 1D4NA 2FVZA 4QBAA 3Q27A 4O7MA 3TCHA 1CE2A 3C34A 3RPLA 4MFIA 1JNFA 3FV2A 1N76A 3U72A 1EYIA 4NWDA 4Q8RA 1OLAA 3RNNA 5I2KA 2P3NA 2Y7PA 3TTRA 2XWVA 4C1TA 2THIA 4RY1A 1B51A 3PPOA 2I0BA 3PGFA 1A8EA 4FATA 3LC8A 1KZ8A 2HEUA 5BUUA 4GWXA 4TLLB 4GXSB 3TTLA 3KFMA 4OYVA 2XA5A 1P1WA 1FPJA 2DP8A 3O6HA 3MWBA 1EU8A 4KYDA 4RPNA 2WYKA 4LZ5A 3FASA 2V3QA 4G68B 1FPEA 2XXVA 4DCYA 2D3IA 4I40A 3SETA 2UYFA 1YCJA 2XX9A 2FYIA 4NF6A 2RC7A 4EQ9A 3LR1A 3PD8A 2I0CA 3H6WA 3K6XA 2DS9A 2ZYMA 1FPKA 1IXGA 1URSA 4NF6B 5ESYA 3E79A 4K3FA 5KCJB 2QVRA 5AE4A 4BDNA 3MYUA 3D1RA 4N6KA 3T22A 2V4CA 3H03A 3ILUB 1WODA 3OELA 2R9JA 4RYAA 3BFUA 5TP9B 3PUZE 1LFIA 2ZMBA 5CRYA 1H76A 2Z8DA 1NUWA 2OX3A 4PGPA 4DCXA 1IUDA 2DXYA 2O7UA 1NV0A 4F19A 4F2OA 2ZNSA 2FIEA 2XX7A 3KN8A 4YKKA 2ZNUA 4UA8A 3QMFA 1B4HA 1B1XA 4PC9A 4F2QA 4OMBA 4KCDA 3KBZA 4ND9A 1US4A 5DW8A 4Q0CA 2P3VA 2PMSA 1SW2A 3H6TA 3IAZA 4U4XA 1M5DA 2VGQA 1OQGA 1MQGA 5ET6A 2NOOA 4QFOA 3FIRA 4X1DA 2D21A 4WXJA 4KCCA 3G3HA 1F9BA 3K6VA 3OXNA 1FW0A 2X26A 4LZ8A 5CMCA 1B2HA 1AH5A 2HZKA 3VDFA 3SEYA 3OSQA 1Y1MA 5JTYB 3O28A 4BDLA 3KSJA 1QVSA 4RXLA 2O1MA 3IX1A 2MKZA 5TPAB 2O69A 2I3VA 3MZ9A 4O3CA 4EF1A 3IFCA 3T9UA 4FJPA 3H7MA 4N81A 4ELPA 4GWOA 1DPPA 3L6GA 4Z0IA 1IMEA 1LEVA 3HPIA 1A99A 4H1XA 4OERA 4E0XA 2VT5A 3EHUA 3TMGA 4F1UA 4HXVA 2CEYA 1FPIA 3GZGA 3TQLA 4HCWA 5ISUA 1II5A 4GF8A 2I6EA 1LBCA 1UTBB 4H5GA 3FXRA 4MX6A 4YMBA 4HW8A 5DT6A 3TEPA 3BFTA 2V84A 2Q8JA 1DBZA 2PYYA 3S9LC 1QUKA 1TFAA 3PV0E 4MJOA 4O3AA 4ELQA 2UVJA 3U65A 2YPNA 1FBCA 3VLWA 5I56A 3P7IA 1NH7A 2CZKA 3MVWA 2AL4A 2QS4A 2P2AA 5ET7A 2Q9TA 3MBPA 4Q30B 4MMPA 4OXVA 1SDXA 5DYHA 1N84A 3PMVA 3THIA 5KZTA 1AIVA 2PVUA 1M5CA 1MY0A 3UIFA 4P3LA 3RT6B 4NG7A 1IIWA 3IB0A 4P1EA 5AA4A 4F1VA 4YB5A 5TPAA 1NV4A 1S50A 3K0VA 1LFGA 2O68A 2XXRA 3MZ1A 2HQ0A 3PPQA 4NF4B 2Q74A 3B6QA 1OVBA 2OWSA 4JWOA 3IO6A 1TWYA 5M2VA 3GBBA 4LN5A 1H43A 4QHQA 3USDA 4ESXA 5B7DA 1MXZA 1INPA 3Q26A 1MQIA 4G2ZA 1Y3NA 2Q89A 4NHBA 4ZEFA 3VLVA 4P11A 3MP6A 3ZSFA 3R6UA 2W7YA 4FORA 5CMKA 3G3JA 3TFLA 1SVXB 1SYIA 3T93B 1VR5A 1RDZA 3TTKA 2XXUA 1ZU0A 3IJOB 2PFZA 2CEXA 4GD5A 2KR0A 1MG1A 1IQ7A 1NKXA 4LQ5A 4HE0A 4LONB 3MP1A 4HCYA 3LSFB 3TCFA 4NQ8A 3A3CA 5CMMA 4R6YA 3K1MA 4G61A 4XTCQ 4OZ9A 3U1OA 5ITPA 4NF8A 2Q2CA 4ZS9A 2B4MA 2GHAA 4NAPA 4YB7A 2RCAA 1WVJA 4GWYA 2ANJA 4DXUA 1ZBMA 3Q29A 4GBVA 4MLVA 1CNQA 4PF6A 3KSXA 1R9QA 5L8DA 1P1NA 4OANA 2M8CA 2QFLA 4EQBA 4DZ1A 1IXHA 5IGAA 2UVIA 4IR8A 2OLBA 3N94A 5IZ3A 1JW5A 1SPIA 4R2FA 2RC8A 4MNCA 1EYJA 3UP9A 2Z8FA 1OIBA 3PPNA 4R75A 1FBDA 3FVNA 3LSLA 1RDXA 3V8XB 2PT2A 2ZYKA 4LA9A 4PFWA 1YAEA 4N6DA 1LCFA 1FQAA 1MXYA 1URGA 2AYSA 3VVEA 1EZPA 1FBHA 3MVYA 2WEFA 4DDDA 2WBBA 3G7WA 1PB7A 5CBSA 2Q8MA 1SBPA 2O1LA 4OTEA 1VSOA 4N8GA 4YKPA 3G3KA 4YAHX 4ZDMA 1FQEA 3EPEA 4LZ7A 1EYKA 3IK6B 4FEBA 3SESA 1RKMA 4NWCA 1USYE 4N15A 5K2XA 5LTCA 3IJXB 2NVUB 2XXQA 3MVZA 1B5IA 4PFYA 2OK2A 1M5EA 1DK4A 1NUXA 1OVTA 3PTYA 2ZZVA 5CM6A 4H0WA 2JJKA 4U2RA 2QJEA 4F3SA 1LAHE 1O7TA 4F1YA 1MPCA 3I6VA 1P1QA 1XT8A 1BIYA 4AS4A 4FE8A 2QS1A 4JWXA 2OWZA 4PAIA 3VXBA 4I3EA 4G77A 2HHMA 2I58A 4N4UA 2PCRA 1B3FA 4H46A 4U1ZA 2Z22A 5HM4B 4OWDA 2F3BA 2WYPA 2I4CA 1FRPA 5EQ7A 1LBZA 1Y4TA 4QSEA 4R2BA 4X8RA 3PUVE 5I57B 1M5BA 3PMXA 5DEXA 3VXCA 1NV1A 4GIZA 4GOTA 3KOSA 4LUBA 4F31B 4OEVA 3TODA 5LDZA 2FNCA 4NMYA 4YKJA 4Q5TA 4KYEA 2PBWA 4O94A 1MQHA 2QMWA 4NGUA 2H5YA 4QFNA 5H8SA 3ROJA 3G3FA 2XXXA 4G68A 1A40A 2HCAA 3CR9A 2O51A 3CFLA 1A54A 3KN3A 4QSCA 4KQPA 3VV5A 2R71A 1ZMGA 4PQJA 4IO5A 3LUYA 1GVCA 1H3DA 3T9VA 5FTHA 1VFEA 4C0RA 2CMOA 1B7UA 1MM6A 4EF2A 3CI8A 2IEEA 1FTAA 3BIHA 2VD3A 2V93A 1IMDA 1LAFE 4GWWA 1I69A 5H8QB 3EN3A 4GFRA 1SYHA 2GH9A 1N7XA 1BK4A 1BTJA 3FVOA 3TTNA 5FHOA 2H4IA 1DMBA 3FZVA 1B0HA 5JK4A 1QULA 1HSEA 2ZZXA 3SDFA 4N13A 4F22A 1A55A 3E3KA 1NUZA 5JEIA 4OESA 4X04A 1US5A 4NF4A 1D9VA 1G0IA 4MNPA 1JVYA 4U21A 3UK4A 5I2NB 5L9SA 4N07A 2F7CA 4OFJA 2V3TA 4XKPA 2WKYA 1A7LA 3TDJA 2B65A 2NUVA 3K01A 3MQ9A 4ZZAA 1AL3A 3M8UA 1UIUA 2R6GE 3KC1A 4KR5A 3EF7A 4THIA 4NEDA 2A5TA 4HTGA 3HHGA 5I58B 3DELB 5TP9A 4I9DA 4L17A 3MUQA 3OO8A 4OQOA 5CMBA 5BWJA 4U22A 2Q88A 4M1VA 4DE8A 3DP6A 3O97A 4KPTA 1YYZA 1Y9UA 1JW4A 2VD2A 5EHSA 2ZNTA 5ELVA 2QSXA 1TXFA 2IA4A 1DPEA 4IGRA 3O66A 1S9TA 1MQDA 4H67A 5HBCA 4E0WA 2VOZA 1Y3QA 4NE4A 3FV1A 1ZTYA 2HAUA 4P9KA 4XEQA 3W15C 3KJTA 4JVCA 2F35A 2REGA 2VP1A 1YXIA 2DOJA 3B6WA 4UABA 2AIXA 2XXHA 3FXQA
chains in the Genus database with same CATH topology
2GQ1A 4OVSA 4FBPA 2HZLA 4PCDA 5JK4A 2HZKA 3NOHA 5IGAA 5IZ3B 4PTKA 4AS4A 3ISPA 4GBWA 1LBWA 3T0JA 4IR8A 2ZZXA 3E78A 2R8TA 4P1EA 5ESYA 3E79A 2OWZA 4PAIA 1G0HA 4PBHA 5EQ7A 5IZ3A 5J16A 3EKIA 4I3EA 4OVRA 4OVTA 4PFRA 1KA1A 1FBEA 1SPIA 1LBXA 2HHMA 2QVRA 4OA4A 2WBDA 4F1VA 5I5PA 4MAGA 1NV4A 4MNCA 1KA0A 1NUZA 1FPGA 2PCRA 2XXKA 2Y5KA 4N4UA 2MKZA 2DE2A 3MYUA 4H46A 4OVPA 4PETA 1NV6A 1EYJA 4X04A 3B50A 3D1RA 4YZZA 4GWSA 4JVDA 2FVZA 4N6KA 1G0IA 4MNPA 2V4CA 4I3YA 4MIJA 4QBAA 2F5XA 4QXDA 2F3BA 2WYPA 3HFUA 4F18A 4HE1A 2F3DA 3IFCA 1FRPA 1Q9DA 2Q74A 2VPOA 1LBZA 1NV3A 1K9ZA 3KC0A 1FBDA 4H45A 4O7MA 4PAKA 1RDXA 3BIGA 1D9QA 4N81A 4O8MA 5IZ1A 3RPLA 3W9WA 5IZZA 4X8RA 2B4LA 4PGNA 3MSTA 4LN5A 3IFAA 1IMEA 1LEVA 1K9YA 1JP4A 1NV1A 1NUWA 1QGXA 1RDYA 4XFEA 4XF5A 1EYIA 1NUYA 1FPBA 1IMBA 2OX3A 4MCOA 4PGPA 3W9VA 4PDDA 3KC1A 2FIXA 1INPA 2BJIA 4MHFA 2DE4A 3B8BA 4N6DA 2P3NA 1XI6A 2VT5A 4NHBA 5LDZA 4PFBA 1DCUA 1NV0A 2XWVA 4HXVA 2CEYA 1FPIA 4F19A 4F1UA 4NF0A 5I7IA 2FBPA 4HCWA 4N17A 4YICA 1FBHA 1FPLA 2Y5LA 3GYYA 4NX1A 4O94A 4NGUA 5ET8A 1KZ8A 2FIEA 1FPFA 4DI4B 5A5LA 4KXPA 4MX6A 3RPLB 1FBGA 2WEFA 3ROJA 1FBFA 2KQZA 2L5VA 2WBBA 4GWXA 4MEVA 4PBQA 1YZ0A 3CHGA 3QMFA 1IMAA 2Q8MA 4AS5A 1IMFA 1IMCA 4GWZA 1RDZA 4X9TA 2XA5A 4M1VA 3A29A 5IM2A 1FPJA 4N8GA 2DDKA 2PFZA 4PC9A 4O7IA 2CEXA 4OVQA 3LV0A 3FBPA 4GX4A 1YYZA 3KBZA 4DI3D 1DBZA 5DW8A 4N91A 2KR0A 4MJOA 2WYKA 2P3VA 4NN3A 3U65A 1FPDA 5EQ9A 4HE0A 4P8BA 1EYKA 1FTAA 5EYGA 2XWIA 3BIHA 2CZIA 4HCYA 1FBCA 3RYDA 2V3QA 3FXBA 4GWUA 2CZKA 4PE3A 1AWBA 4JVIA 2VPNA 1NI9A 4NQ8A 5F24A 5FBPA 1LBVA 4P47A 1IMDA 4G61A 4P9KA 4XEQA 5ET6A 2CZHA 1FPEA 4N15A 5ET7A 2HPGA 4GWWA 4PAFA 3SZPA 5LTCA 3LUZA 4I40A 5EQAA 4P56A 2QVVA 1NV2A 2PFYA 4PFIA 2Q9TA 1FSAA 2XWKA 1FJ9A 1VDWA 1DK4A 2B4MA 5EYHA 1NUXA 4JVCA 4MMPA 2DE3A 3PTYA 2WX9A 4NAPA 4GWYA 3T1BA 4HE2A 4N8YA 2HXRA 2FHYA 4GX6A 1FBPA 1YXIA 2QPQA 4P1LA 2ZZVA 4GBVA 2ZZWA 5ET5A 5CM6A 2DVZA 1LBYA 4PDHA 4UABA 1BK4A 1CNQA 4PF6A 2QVUA 4MNIA 4PF8A 2JJKA 1FJ6A 1NV5A 5J1DA 4OANA 4GX3A 2QFLA 5T3JA 4P3LA 5I3SA 5EQ8A 1FPKA 4NG7A 1NV7A 2XWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  2HZL A;  4PCD A;  2HZK A;  5IGA A;  2ZZX A;  4P1E A;  4PAI A;  4PBH A;  4OVR A;  4OVT A;  4PFR A;  4OA4 A;  5I5P A;  4MAG A;  4MNC A;  4N4U A;  2XXK A;  4OVP A;  4PET A;  4X04 A;  3B50 A;  4YZZ A;  4N6K A;  4MNP A;  2V4C A;  4MIJ A;  2WYP A;  2VPO A;  4O7M A;  4PAK A;  5IZZ A;  4O8M A;  4X8R A;  4PGN A;  4LN5 A;  4MEV A;  4XFE A;  4XF5 A;  4MCO A;  4PGP A;  4PDD A;  4MHF A;  4N6D A;  4NHB A;  4PFB A;  2XWV A;  2CEY A;  5I7I A;  4NF0 A;  4N17 A;  4YIC A;  3GYY A;  4NX1 A;  4O94 A;  4NGU A;  4DI4 B;  4MX6 A;  4PBQ A;  2XA5 A;  5IM2 A;  4N8G A;  2PFZ A;  4PC9 A;  2CEX A;  4OVQ A;  4DI3 D;  4N91 A;  2WYK A;  4NN3 A;  3U65 A;  4P8B A;  2XWI A;  3FXB A;  4PE3 A;  2VPN A;  4NQ8 A;  4P47 A;  4XEQ A;  4P9K A;  4N15 A;  2HPG A;  5LTC A;  4PAF A;  4P56 A;  2PFY A;  4PFI A;  2XWK A;  4MMP A;  4NAP A;  2WX9 A;  4N8Y A;  4P1L A;  2ZZV A;  2ZZW A;  5CM6 A;  4UAB A;  4PDH A;  4PF6 A;  4MNI A;  4PF8 A;  4OAN A;  4P3L A;  4NG7 A;  2XWO A; 
#chains in the Genus database with same CATH topology
 1POY 1;  1N04 A;  3WAF A;  1D3K A;  3D4G A;  1LGB C;  3ISP A;  2XX8 A;  2O6A A;  5I57 A;  3QK6 A;  2H98 A;  1QUJ A;  1FQF A;  1ZKB A;  4OVP A;  4F18 A;  4GXA A;  4PET A;  3CG3 A;  1PBP A;  1HSJ A;  4BDQ A;  4RK9 A;  1QJM A;  2VPO A;  3KC0 A;  1NV3 A;  3BIG A;  4MH5 A;  3FGS A;  5IZ1 A;  2RCB A;  1JP4 A;  2E0S A;  1DOT A;  5FHN A;  2FIX A;  4GQO A;  3IOU A;  1FCK A;  2X7P A;  2B3F A;  3ZKK A;  1UTH B;  4NF5 B;  2I3W A;  3OEK A;  2V3U A;  3RUM A;  1FQD A;  1UTH A;  4XKN A;  4ZE9 A;  1B3L A;  3O2A A;  3RPL B;  4JXI A;  3N26 A;  1YZ0 A;  4LQ2 A;  1B1H A;  3UGW A;  3E13 X;  1USY H;  3MJN A;  1JET A;  3T9X B;  3H3G A;  2XD2 A;  1P99 A;  4AB5 A;  2Y7I A;  3LV0 A;  4GX4 A;  4WED A;  3SEV A;  1B40 A;  2F6G A;  4OVJ A;  1LBB A;  1OLC A;  3M3K A;  3N6T A;  3KN7 A;  4JSD A;  2QMX A;  1B7H A;  1D9Y A;  1FTJ A;  2GRV A;  3K4U A;  3HHF A;  4M4G A;  4P47 A;  1Y4C A;  2OZZ A;  3LUZ A;  1LAG E;  4IO3 A;  4QFP A;  5EYH A;  1SW4 A;  1NNT A;  2LAO A;  1IZ1 A;  3MAM A;  3FJG A;  5DVF A;  1FTO A;  1Y1Z A;  1EZ9 A;  2XWO A;  3K00 A;  4QFK A;  3NOH A;  5IZ3 B;  3DP4 A;  5AA4 B;  1G0H A;  4OVR A;  5JTY A;  3TCG A;  4H8J A;  3WAE A;  4IO2 A;  4FIM A;  2XXK A;  2H9B A;  1N0T A;  3B50 A;  1MXU A;  1MXV A;  1WDN A;  4OEU A;  4HE1 A;  4H45 A;  3PU5 A;  3C31 A;  3CFX A;  3CSG A;  4ONY A;  1NNK A;  3DLN A;  2I49 A;  3IFA A;  4XF5 A;  1K9Y A;  1DSN A;  3MVX A;  3H6V A;  1FPB A;  3K1N A;  4X1B A;  5TU0 A;  3VLU A;  3UOR A;  1XI6 A;  2OWT A;  4PFB A;  3OEN A;  2ZYN A;  4ELO A;  1IXI A;  4KYS A;  1FPL A;  2NXO A;  2RIN A;  3FD3 A;  3TQW A;  3U92 A;  3DM0 A;  1FBG A;  1Y20 A;  2ZXT A;  1QKA A;  3K6U A;  4GWZ A;  4ISU A;  3GLB A;  3A29 A;  3RTF B;  4EQ7 A;  4NTL A;  5H8N A;  4BDR A;  3FBP A;  3LSW A;  3MPK A;  2DQV A;  1LB9 A;  2KLF A;  3M3L A;  4NN3 A;  1FQB A;  1P1U A;  4IGT A;  1FPD A;  2XWI A;  3QIM A;  2FA7 A;  3FXB A;  4GWU A;  3K1P A;  1TT1 A;  5H8F B;  5I84 A;  5EQA A;  3O6G A;  3F11 A;  2XXW A;  2Z8E A;  3OEM A;  4POX A;  1FTL A;  4G4P A;  4QFL A;  5I59 A;  1H45 A;  5K2Y A;  3RY3 A;  3K6W A;  4HS7 A;  4I1D A;  4FBP A;  4BDO A;  2Y7R A;  4PCD A;  3C35 A;  3JYR A;  4KFQ A;  4YKI A;  2AL5 A;  5J16 A;  1KA1 A;  3HO7 A;  4XKR A;  2UXA A;  3L6H A;  5I5P A;  2YLN A;  1FPG A;  3O9P A;  4MIJ A;  3C36 A;  4F29 A;  3K02 A;  3R7X A;  3SKP A;  3CG1 A;  5DVJ A;  4MEV A;  1QGX A;  1JQF A;  3IOT A;  4NF5 A;  4TQU Q;  1T0K A;  3UN6 A;  4NF0 A;  3R26 A;  1P1O A;  3MP8 A;  1FBF A;  4PBQ A;  5AA1 A;  1RYX A;  1ZJL A;  2O7I A;  2DDK A;  1KWH A;  4R9G A;  3PUX E;  4JDF A;  4N91 A;  3GBA A;  5LOM A;  4IB2 A;  4P0G A;  1AOV A;  3OO7 A;  1UTB A;  2OCU A;  1XHY A;  3B6T A;  3TUS A;  1AWB A;  3U8Q A;  3S4U A;  3T96 B;  2P1S A;  1LBV A;  2DWH A;  1MPD A;  5ICQ A;  4AQ4 A;  3TTM A;  2HPG A;  3IO4 A;  3OO9 A;  4PFI A;  3BKI B;  1B46 A;  3EHS A;  4ZEB A;  3HCQ A;  3T1B A;  2HXR A;  2G29 A;  4EXK A;  4GRK A;  4BDM A;  4PDH A;  5EYF A;  4MNI A;  1NV5 A;  4GX3 A;  4OFO A;  3U93 A;  4POW A;  4RA1 A;  4IY6 A;  4PFR A;  3E78 A;  2F97 A;  1XOC A;  3RTW B;  2XXI A;  4GWS A;  4R73 A;  5DVI A;  4AS5 A;  2F5X A;  2F3D A;  2XXT A;  1NNP A;  1SI0 A;  2B4L A;  3IB2 A;  1B52 A;  4DXC A;  4XKQ A;  3W9V A;  4U1O A;  2HAV A;  5H8H A;  3A3U A;  4LP2 B;  3EHT A;  5I2N A;  3FXU A;  4I8C A;  2ALU A;  3CHG A;  4BLA A;  1GV8 A;  1IMF A;  1IMC A;  1MDQ A;  3O29 A;  2E1S A;  5HPQ A;  3E4R A;  1MY4 A;  3LSX A;  3ECR A;  4P8B A;  1MY1 A;  2ONS A;  5F1Q A;  3PPP A;  4XXU A;  1ELJ A;  4MF3 A;  4P56 A;  1NV2 A;  1B5J A;  1VDW A;  3M3F A;  1MDP 1;  3U94 A;  3N5L A;  2B3B A;  1MPB A;  1NH8 A;  1A8F A;  1DTG A;  2F34 A;  1PB9 A;  4PF8 A;  3IR1 A;  1PBQ A;  2HZL A;  4PTK A;  4GBW A;  1LBW A;  2F7A A;  3TAJ A;  1B32 A;  1I6Q A;  2WBD A;  3IOW A;  4YB6 A;  2DVC A;  1LAX A;  2QS3 A;  5ICT A;  2OBG A;  1XC1 A;  2DWJ A;  3SEX A;  3HFU A;  4N6P A;  4EXL A;  1XVX A;  2Z23 A;  1XS5 A;  3BBR A;  3W9W A;  3HST A;  2A5S A;  1VFD A;  3OD7 A;  3ODB A;  1IMB A;  2V25 A;  4R74 A;  1YTV A;  1JEU A;  4F39 A;  2HFB A;  4H6D A;  1I6B A;  2Y7W A;  4N17 A;  4LAT A;  3QYT A;  1I6A A;  3ZS6 A;  2G93 A;  5H8H B;  1L5T A;  3G3G A;  4WEP A;  3C4M A;  5AA3 A;  1Z7N E;  4X9T A;  1MXX A;  1B05 A;  5H8F A;  1RYO A;  4O7I A;  4GL0 A;  3V5A A;  4OVQ A;  1B9J A;  4PFT A;  4GVO A;  1CB6 A;  3FUZ A;  4PE3 A;  3TKD A;  3TPA A;  5F24 A;  3VVD A;  4PP0 A;  4JBZ A;  1ZLQ A;  2XD3 A;  2F6P A;  4JSO A;  3H06 B;  3CIJ A;  2UVH A;  4YU0 A;  2WX9 A;  4EDP A;  1LST A;  5KCJ A;  1LB8 A;  4P1L A;  5FTI A;  5IKB A;  2YJP A;  1NV7 A;  3V89 B;  3MPL A;  3I5O A;  5EHM A;  4RJZ A;  3C9H A;  3MZB A;  4F3P A;  2R8T A;  2P0S A;  1MY2 A;  2UVG A;  1SW1 A;  1J1N A;  1LBX A;  4Z7E A;  1KA0 A;  4RPO A;  3CVG A;  1OQH A;  1FQC A;  2ZYO A;  1BKA A;  5A5X B;  3D4C A;  3TYH A;  1MS7 A;  2UYE A;  1Q9D A;  2QL3 A;  4PAK A;  4ECF A;  1D9Q A;  4JB7 A;  2H25 A;  1M5F A;  2I4B A;  1MXW A;  2DWA A;  1B3E A;  5DEX B;  1NUY A;  2BJI A;  5IAI A;  2DE4 A;  1R1N A;  2HXW A;  3E9X A;  3CRB A;  3I3V A;  2Y5L A;  4R6H A;  4IO6 A;  1B7Z A;  3VVF A;  3RGY A;  3KZG A;  3JV9 A;  5AA2 A;  3FJM A;  2DYX A;  1MRP A;  4R72 A;  3PD9 A;  4ZZE A;  1IIT A;  3PUW E;  4IY5 A;  5CI5 A;  3N6U A;  5I58 A;  2ABH A;  3DP8 A;  5EQ9 A;  5EYG A;  4H5F A;  2CZL A;  5FBP A;  5I56 B;  4MBP A;  2CZH A;  4I62 A;  4IO4 A;  2X7Q A;  4F3B A;  4PAF A;  4TLM B;  3S9M C;  4F3G A;  1O64 A;  4MLQ A;  4G8M A;  4ZEI A;  4HE2 A;  3KG2 A;  4ZE8 A;  2Y84 A;  3QUF A;  4GX6 A;  2QPQ A;  4XIG Q;  1LCT A;  4ZEK A;  4JWY A;  2GQ1 A;  1PC3 A;  3HN0 A;  1Y3P A;  1SI1 A;  1O63 A;  2H99 A;  4OVT A;  3Q25 A;  4WKM A;  1B5H A;  3RQT A;  4U23 A;  2Y5K A;  1NL5 A;  1NV6 A;  1Z7M E;  3GXA A;  5KDT A;  4QXD A;  1LLS A;  3PPR A;  2RF1 A;  1NFT A;  4UAC A;  5B70 A;  5IZZ A;  4ZED A;  3O6I A;  1B3H A;  3V83 A;  1RDY A;  4KD5 A;  2VHA A;  4RK2 A;  4MCO A;  3B8B A;  4DIG A;  1Q35 A;  5I7I A;  3C33 A;  4LVQ A;  3AXF A;  1UIV A;  4NX1 A;  3TZA A;  5ET8 A;  5A5L A;  2KQZ A;  4OHN A;  3Q28 A;  4ELR A;  2ONK E;  3IOR A;  4QRZ A;  1S7Y A;  1NMU A;  4DI3 D;  3IB1 A;  1PEB A;  5L9M A;  1MH4 A;  1JEV A;  4H8I A;  3FJ7 A;  2GFE A;  3S9E A;  2VPN A;  3S9N C;  3CSB A;  3HV1 A;  4PE5 B;  3S2V A;  2QS2 A;  2XWK A;  1ANF A;  1FJ9 A;  1SW5 A;  3OOA A;  4G8H A;  2PT1 A;  1VE4 A;  1HSL A;  1UQW A;  2FHY A;  5ITO A;  3QXM A;  5H8Q A;  2DVZ A;  3IOV A;  1R6Z A;  5J1D A;  1AMF A;  1FJ6 A;  5KDT B;  2D5W A;  3PMW A;  2CZI A;  2Q2A A;  3EQ1 A;  4OEN A;  1N7W A;  5I2K B;  3RT8 A;  2XXY A;  3UA8 A;  4AB6 A;  4YZZ A;  3TEL A;  1QW0 A;  4I3Y A;  1BP5 A;  3FAT A;  1MY3 A;  4O8M A;  1TFD A;  3VFJ A;  1IEJ A;  2ESN A;  2ONR A;  1QKB A;  3A09 A;  4XFE A;  1DTZ A;  1GTK A;  4GL8 A;  4MHF A;  2NWJ A;  1R9L A;  4OET A;  4YIC A;  3MC2 A;  3QUJ A;  4DI4 B;  4KXP A;  3ILT B;  1IMA A;  4DLD A;  2DWI A;  4RNS A;  2RC9 A;  3G3I A;  5IM2 A;  1LFH A;  1N3W A;  3KEI A;  2XHD A;  4TOZ A;  3K2D A;  1POT A;  5H8N B;  2A5T B;  1XVY A;  4IO7 A;  2Y7K A;  3SEW A;  4PFU A;  1YPN A;  4NF8 B;  3SZP A;  1Q1K A;  4H65 A;  3H6U A;  1FSA A;  3RPW A;  4ESW A;  4R9F A;  3PUY E;  5F7V A;  2OJT A;  4FEC A;  2DE3 A;  4QF9 A;  1FTM A;  2ZZW A;  5ET5 A;  1LBY A;  2F36 A;  2REJ A;  3KOT A;  4EUO A;  1PDA A;  5L9O A;  4OFL A;  3KGC A;  5I3S A;  5EQ8 A;  4R6K A;  4KI0 E;  4P0I A;  1MQJ A;  5DTB A;  3T0J A;  2PX1 A;  3RLF E;  4GLI A;  4PBH A;  3EKI A;  1FBE A;  3LBS A;  3FVG A;  1B58 A;  4FED A;  4FAJ A;  4MAG A;  5CBR A;  1B4Z A;  4U4S A;  2F78 A;  4O3B A;  4JVD A;  3T66 A;  3SER A;  1B0L A;  1JVX A;  3OSR A;  3H4Z A;  1K9Z A;  2I48 A;  3QAX A;  3KJ7 A;  4PGN A;  3MST A;  1B6H A;  3T9H B;  5AA2 B;  2O84 X;  1URD A;  4PDD A;  1SQY A;  5A5X A;  1DCU A;  3B7D A;  1ATG A;  2FBP A;  4X48 A;  3GYY A;  1PB8 A;  1FTK A;  3CFZ A;  4C1U A;  1FPF A;  4YMA A;  2F7B A;  2GHB A;  1GR2 A;  3QSL A;  2L5V A;  5AA2 D;  1QUI A;  1H44 A;  2DXR A;  2F8D A;  3KBR A;  3VE1 B;  4QSD A;  5CC2 A;  3RYD A;  1MM7 A;  1ZIU A;  2XXP A;  4G68 C;  4JVI A;  1NI9 A;  1EH3 A;  1SD3 A;  1JW1 A;  3FVK A;  4G8N A;  2QVV A;  2PFY A;  2QRY A;  1EZO A;  3MW0 A;  2DSF A;  3OO6 A;  4N8Y A;  1GGG A;  1FBP A;  3IL1 B;  3JZJ A;  3OMB A;  1MH3 A;  1N3X A;  2QVU A;  2RKM A;  4KHZ E;  1IXC A;  4OVS A;  1NNF A;  1BLF A;  3ZKL A;  1B3G A;  3ONM A;  4DXB A;  3RN8 A;  4OA4 A;  5I59 B;  5FHM A;  1OMP A;  3C32 A;  4ZEC A;  2BJJ X;  2DE2 A;  5T3J A;  3SEU A;  1D4N A;  2FVZ A;  4QBA A;  3Q27 A;  4O7M A;  3TCH A;  1CE2 A;  3C34 A;  3RPL A;  4MFI A;  1JNF A;  3FV2 A;  1N76 A;  3U72 A;  1EYI A;  4NWD A;  4Q8R A;  1OLA A;  3RNN A;  5I2K A;  2P3N A;  2Y7P A;  3TTR A;  2XWV A;  4C1T A;  2THI A;  4RY1 A;  1B51 A;  3PPO A;  2I0B A;  3PGF A;  1A8E A;  4FAT A;  3LC8 A;  1KZ8 A;  2HEU A;  5BUU A;  4GWX A;  4TLL B;  4GXS B;  3TTL A;  3KFM A;  4OYV A;  2XA5 A;  1P1W A;  1FPJ A;  2DP8 A;  3O6H A;  3MWB A;  1EU8 A;  4KYD A;  4RPN A;  2WYK A;  4LZ5 A;  3FAS A;  2V3Q A;  4G68 B;  1FPE A;  2XXV A;  4DCY A;  2D3I A;  4I40 A;  3SET A;  2UYF A;  1YCJ A;  2XX9 A;  2FYI A;  4NF6 A;  2RC7 A;  4EQ9 A;  3LR1 A;  3PD8 A;  2I0C A;  3H6W A;  3K6X A;  2DS9 A;  2ZYM A;  1FPK A;  1IXG A;  1URS A;  4NF6 B;  5ESY A;  3E79 A;  4K3F A;  5KCJ B;  2QVR A;  5AE4 A;  4BDN A;  3MYU A;  3D1R A;  4N6K A;  3T22 A;  2V4C A;  3H03 A;  3ILU B;  1WOD A;  3OEL A;  2R9J A;  4RYA A;  3BFU A;  5TP9 B;  3PUZ E;  1LFI A;  2ZMB A;  5CRY A;  1H76 A;  2Z8D A;  1NUW A;  2OX3 A;  4PGP A;  4DCX A;  1IUD A;  2DXY A;  2O7U A;  1NV0 A;  4F19 A;  4F2O A;  2ZNS A;  2FIE A;  2XX7 A;  3KN8 A;  4YKK A;  2ZNU A;  4UA8 A;  3QMF A;  1B4H A;  1B1X A;  4PC9 A;  4F2Q A;  4OMB A;  4KCD A;  3KBZ A;  4ND9 A;  1US4 A;  5DW8 A;  4Q0C A;  2P3V A;  2PMS A;  1SW2 A;  3H6T A;  3IAZ A;  4U4X A;  1M5D A;  2VGQ A;  1OQG A;  1MQG A;  5ET6 A;  2NOO A;  4QFO A;  3FIR A;  4X1D A;  2D21 A;  4WXJ A;  4KCC A;  3G3H A;  1F9B A;  3K6V A;  3OXN A;  1FW0 A;  2X26 A;  4LZ8 A;  5CMC A;  1B2H A;  1AH5 A;  2HZK A;  3VDF A;  3SEY A;  3OSQ A;  1Y1M A;  5JTY B;  3O28 A;  4BDL A;  3KSJ A;  1QVS A;  4RXL A;  2O1M A;  3IX1 A;  2MKZ A;  5TPA B;  2O69 A;  2I3V A;  3MZ9 A;  4O3C A;  4EF1 A;  3IFC A;  3T9U A;  4FJP A;  3H7M A;  4N81 A;  4ELP A;  4GWO A;  1DPP A;  3L6G A;  4Z0I A;  1IME A;  1LEV A;  3HPI A;  1A99 A;  4H1X A;  4OER A;  4E0X A;  2VT5 A;  3EHU A;  3TMG A;  4F1U A;  4HXV A;  2CEY A;  1FPI A;  3GZG A;  3TQL A;  4HCW A;  5ISU A;  1II5 A;  4GF8 A;  2I6E A;  1LBC A;  1UTB B;  4H5G A;  3FXR A;  4MX6 A;  4YMB A;  4HW8 A;  5DT6 A;  3TEP A;  3BFT A;  2V84 A;  2Q8J A;  1DBZ A;  2PYY A;  3S9L C;  1QUK A;  1TFA A;  3PV0 E;  4MJO A;  4O3A A;  4ELQ A;  2UVJ A;  3U65 A;  2YPN A;  1FBC A;  3VLW A;  5I56 A;  3P7I A;  1NH7 A;  2CZK A;  3MVW A;  2AL4 A;  2QS4 A;  2P2A A;  5ET7 A;  2Q9T A;  3MBP A;  4Q30 B;  4MMP A;  4OXV A;  1SDX A;  5DYH A;  1N84 A;  3PMV A;  3THI A;  5KZT A;  1AIV A;  2PVU A;  1M5C A;  1MY0 A;  3UIF A;  4P3L A;  3RT6 B;  4NG7 A;  1IIW A;  3IB0 A;  4P1E A;  5AA4 A;  4F1V A;  4YB5 A;  5TPA A;  1NV4 A;  1S50 A;  3K0V A;  1LFG A;  2O68 A;  2XXR A;  3MZ1 A;  2HQ0 A;  3PPQ A;  4NF4 B;  2Q74 A;  3B6Q A;  1OVB A;  2OWS A;  4JWO A;  3IO6 A;  1TWY A;  5M2V A;  3GBB A;  4LN5 A;  1H43 A;  4QHQ A;  3USD A;  4ESX A;  5B7D A;  1MXZ A;  1INP A;  3Q26 A;  1MQI A;  4G2Z A;  1Y3N A;  2Q89 A;  4NHB A;  4ZEF A;  3VLV A;  4P11 A;  3MP6 A;  3ZSF A;  3R6U A;  2W7Y A;  4FOR A;  5CMK A;  3G3J A;  3TFL A;  1SVX B;  1SYI A;  3T93 B;  1VR5 A;  1RDZ A;  3TTK A;  2XXU A;  1ZU0 A;  3IJO B;  2PFZ A;  2CEX A;  4GD5 A;  2KR0 A;  1MG1 A;  1IQ7 A;  1NKX A;  4LQ5 A;  4HE0 A;  4LON B;  3MP1 A;  4HCY A;  3LSF B;  3TCF A;  4NQ8 A;  3A3C A;  5CMM A;  4R6Y A;  3K1M A;  4G61 A;  4XTC Q;  4OZ9 A;  3U1O A;  5ITP A;  4NF8 A;  2Q2C A;  4ZS9 A;  2B4M A;  2GHA A;  4NAP A;  4YB7 A;  2RCA A;  1WVJ A;  4GWY A;  2ANJ A;  4DXU A;  1ZBM A;  3Q29 A;  4GBV A;  4MLV A;  1CNQ A;  4PF6 A;  3KSX A;  1R9Q A;  5L8D A;  1P1N A;  4OAN A;  2M8C A;  2QFL A;  4EQB A;  4DZ1 A;  1IXH A;  5IGA A;  2UVI A;  4IR8 A;  2OLB A;  3N94 A;  5IZ3 A;  1JW5 A;  1SPI A;  4R2F A;  2RC8 A;  4MNC A;  1EYJ A;  3UP9 A;  2Z8F A;  1OIB A;  3PPN A;  4R75 A;  1FBD A;  3FVN A;  3LSL A;  1RDX A;  3V8X B;  2PT2 A;  2ZYK A;  4LA9 A;  4PFW A;  1YAE A;  4N6D A;  1LCF A;  1FQA A;  1MXY A;  1URG A;  2AYS A;  3VVE A;  1EZP A;  1FBH A;  3MVY A;  2WEF A;  4DDD A;  2WBB A;  3G7W A;  1PB7 A;  5CBS A;  2Q8M A;  1SBP A;  2O1L A;  4OTE A;  1VSO A;  4N8G A;  4YKP A;  3G3K A;  4YAH X;  4ZDM A;  1FQE A;  3EPE A;  4LZ7 A;  1EYK A;  3IK6 B;  4FEB A;  3SES A;  1RKM A;  4NWC A;  1USY E;  4N15 A;  5K2X A;  5LTC A;  3IJX B;  2NVU B;  2XXQ A;  3MVZ A;  1B5I A;  4PFY A;  2OK2 A;  1M5E A;  1DK4 A;  1NUX A;  1OVT A;  3PTY A;  2ZZV A;  5CM6 A;  4H0W A;  2JJK A;  4U2R A;  2QJE A;  4F3S A;  1LAH E;  1O7T A;  4F1Y A;  1MPC A;  3I6V A;  1P1Q A;  1XT8 A;  1BIY A;  4AS4 A;  4FE8 A;  2QS1 A;  4JWX A;  2OWZ A;  4PAI A;  3VXB A;  4I3E A;  4G77 A;  2HHM A;  2I58 A;  4N4U A;  2PCR A;  1B3F A;  4H46 A;  4U1Z A;  2Z22 A;  5HM4 B;  4OWD A;  2F3B A;  2WYP A;  2I4C A;  1FRP A;  5EQ7 A;  1LBZ A;  1Y4T A;  4QSE A;  4R2B A;  4X8R A;  3PUV E;  5I57 B;  1M5B A;  3PMX A;  5DEX A;  3VXC A;  1NV1 A;  4GIZ A;  4GOT A;  3KOS A;  4LUB A;  4F31 B;  4OEV A;  3TOD A;  5LDZ A;  2FNC A;  4NMY A;  4YKJ A;  4Q5T A;  4KYE A;  2PBW A;  4O94 A;  1MQH A;  2QMW A;  4NGU A;  2H5Y A;  4QFN A;  5H8S A;  3ROJ A;  3G3F A;  2XXX A;  4G68 A;  1A40 A;  2HCA A;  3CR9 A;  2O51 A;  3CFL A;  1A54 A;  3KN3 A;  4QSC A;  4KQP A;  3VV5 A;  2R71 A;  1ZMG A;  4PQJ A;  4IO5 A;  3LUY A;  1GVC A;  1H3D A;  3T9V A;  5FTH A;  1VFE A;  4C0R A;  2CMO A;  1B7U A;  1MM6 A;  4EF2 A;  3CI8 A;  2IEE A;  1FTA A;  3BIH A;  2VD3 A;  2V93 A;  1IMD A;  1LAF E;  4GWW A;  1I69 A;  5H8Q B;  3EN3 A;  4GFR A;  1SYH A;  2GH9 A;  1N7X A;  1BK4 A;  1BTJ A;  3FVO A;  3TTN A;  5FHO A;  2H4I A;  1DMB A;  3FZV A;  1B0H A;  5JK4 A;  1QUL A;  1HSE A;  2ZZX A;  3SDF A;  4N13 A;  4F22 A;  1A55 A;  3E3K A;  1NUZ A;  5JEI A;  4OES A;  4X04 A;  1US5 A;  4NF4 A;  1D9V A;  1G0I A;  4MNP A;  1JVY A;  4U21 A;  3UK4 A;  5I2N B;  5L9S A;  4N07 A;  2F7C A;  4OFJ A;  2V3T A;  4XKP A;  2WKY A;  1A7L A;  3TDJ A;  2B65 A;  2NUV A;  3K01 A;  3MQ9 A;  4ZZA A;  1AL3 A;  3M8U A;  1UIU A;  2R6G E;  3KC1 A;  4KR5 A;  3EF7 A;  4THI A;  4NED A;  2A5T A;  4HTG A;  3HHG A;  5I58 B;  3DEL B;  5TP9 A;  4I9D A;  4L17 A;  3MUQ A;  3OO8 A;  4OQO A;  5CMB A;  5BWJ A;  4U22 A;  2Q88 A;  4M1V A;  4DE8 A;  3DP6 A;  3O97 A;  4KPT A;  1YYZ A;  1Y9U A;  1JW4 A;  2VD2 A;  5EHS A;  2ZNT A;  5ELV A;  2QSX A;  1TXF A;  2IA4 A;  1DPE A;  4IGR A;  3O66 A;  1S9T A;  1MQD A;  4H67 A;  5HBC A;  4E0W A;  2VOZ A;  1Y3Q A;  4NE4 A;  3FV1 A;  1ZTY A;  2HAU A;  4P9K A;  4XEQ A;  3W15 C;  3KJT A;  4JVC A;  2F35 A;  2REG A;  2VP1 A;  1YXI A;  2DOJ A;  3B6W A;  4UAB A;  2AIX A;  2XXH A;  3FXQ A; 
#chains in the Genus database with same CATH homology
 2GQ1 A;  4OVS A;  4FBP A;  2HZL A;  4PCD A;  5JK4 A;  2HZK A;  3NOH A;  5IGA A;  5IZ3 B;  4PTK A;  4AS4 A;  3ISP A;  4GBW A;  1LBW A;  3T0J A;  4IR8 A;  2ZZX A;  3E78 A;  2R8T A;  4P1E A;  5ESY A;  3E79 A;  2OWZ A;  4PAI A;  1G0H A;  4PBH A;  5EQ7 A;  5IZ3 A;  5J16 A;  3EKI A;  4I3E A;  4OVR A;  4OVT A;  4PFR A;  1KA1 A;  1FBE A;  1SPI A;  1LBX A;  2HHM A;  2QVR A;  4OA4 A;  2WBD A;  4F1V A;  5I5P A;  4MAG A;  1NV4 A;  4MNC A;  1KA0 A;  1NUZ A;  1FPG A;  2PCR A;  2XXK A;  2Y5K A;  4N4U A;  2MKZ A;  2DE2 A;  3MYU A;  4H46 A;  4OVP A;  4PET A;  1NV6 A;  1EYJ A;  4X04 A;  3B50 A;  3D1R A;  4YZZ A;  4GWS A;  4JVD A;  2FVZ A;  4N6K A;  1G0I A;  4MNP A;  2V4C A;  4I3Y A;  4MIJ A;  4QBA A;  2F5X A;  4QXD A;  2F3B A;  2WYP A;  3HFU A;  4F18 A;  4HE1 A;  2F3D A;  3IFC A;  1FRP A;  1Q9D A;  2Q74 A;  2VPO A;  1LBZ A;  1NV3 A;  1K9Z A;  3KC0 A;  1FBD A;  4H45 A;  4O7M A;  4PAK A;  1RDX A;  3BIG A;  1D9Q A;  4N81 A;  4O8M A;  5IZ1 A;  3RPL A;  3W9W A;  5IZZ A;  4X8R A;  2B4L A;  4PGN A;  3MST A;  4LN5 A;  3IFA A;  1IME A;  1LEV A;  1K9Y A;  1JP4 A;  1NV1 A;  1NUW A;  1QGX A;  1RDY A;  4XFE A;  4XF5 A;  1EYI A;  1NUY A;  1FPB A;  1IMB A;  2OX3 A;  4MCO A;  4PGP A;  3W9V A;  4PDD A;  3KC1 A;  2FIX A;  1INP A;  2BJI A;  4MHF A;  2DE4 A;  3B8B A;  4N6D A;  2P3N A;  1XI6 A;  2VT5 A;  4NHB A;  5LDZ A;  4PFB A;  1DCU A;  1NV0 A;  2XWV A;  4HXV A;  2CEY A;  1FPI A;  4F19 A;  4F1U A;  4NF0 A;  5I7I A;  2FBP A;  4HCW A;  4N17 A;  4YIC A;  1FBH A;  1FPL A;  2Y5L A;  3GYY A;  4NX1 A;  4O94 A;  4NGU A;  5ET8 A;  1KZ8 A;  2FIE A;  1FPF A;  4DI4 B;  5A5L A;  4KXP A;  4MX6 A;  3RPL B;  1FBG A;  2WEF A;  3ROJ A;  1FBF A;  2KQZ A;  2L5V A;  2WBB A;  4GWX A;  4MEV A;  4PBQ A;  1YZ0 A;  3CHG A;  3QMF A;  1IMA A;  2Q8M A;  4AS5 A;  1IMF A;  1IMC A;  4GWZ A;  1RDZ A;  4X9T A;  2XA5 A;  4M1V A;  3A29 A;  5IM2 A;  1FPJ A;  4N8G A;  2DDK A;  2PFZ A;  4PC9 A;  4O7I A;  2CEX A;  4OVQ A;  3LV0 A;  3FBP A;  4GX4 A;  1YYZ A;  3KBZ A;  4DI3 D;  1DBZ A;  5DW8 A;  4N91 A;  2KR0 A;  4MJO A;  2WYK A;  2P3V A;  4NN3 A;  3U65 A;  1FPD A;  5EQ9 A;  4HE0 A;  4P8B A;  1EYK A;  1FTA A;  5EYG A;  2XWI A;  3BIH A;  2CZI A;  4HCY A;  1FBC A;  3RYD A;  2V3Q A;  3FXB A;  4GWU A;  2CZK A;  4PE3 A;  1AWB A;  4JVI A;  2VPN A;  1NI9 A;  4NQ8 A;  5F24 A;  5FBP A;  1LBV A;  4P47 A;  1IMD A;  4G61 A;  4P9K A;  4XEQ A;  5ET6 A;  2CZH A;  1FPE A;  4N15 A;  5ET7 A;  2HPG A;  4GWW A;  4PAF A;  3SZP A;  5LTC A;  3LUZ A;  4I40 A;  5EQA A;  4P56 A;  2QVV A;  1NV2 A;  2PFY A;  4PFI A;  2Q9T A;  1FSA A;  2XWK A;  1FJ9 A;  1VDW A;  1DK4 A;  2B4M A;  5EYH A;  1NUX A;  4JVC A;  4MMP A;  2DE3 A;  3PTY A;  2WX9 A;  4NAP A;  4GWY A;  3T1B A;  4HE2 A;  4N8Y A;  2HXR A;  2FHY A;  4GX6 A;  1FBP A;  1YXI A;  2QPQ A;  4P1L A;  2ZZV A;  4GBV A;  2ZZW A;  5ET5 A;  5CM6 A;  2DVZ A;  1LBY A;  4PDH A;  4UAB A;  1BK4 A;  1CNQ A;  4PF6 A;  2QVU A;  4MNI A;  4PF8 A;  2JJK A;  1FJ6 A;  1NV5 A;  5J1D A;  4OAN A;  4GX3 A;  2QFL A;  5T3J A;  4P3L A;  5I3S A;  5EQ8 A;  1FPK A;  4NG7 A;  1NV7 A;  2XWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...