4NX1A

Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1, target efi-510292, with bound alpha-d-taluronate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
323
structure length
308
Chain Sequence
HHHHHHMETVLRGASMFDEEHAFTKTLRKFEELVDEKYDGDVTFDLRLNGELGVESDYVTFLNQGVAIDYTILAPSNMAKFAPSIPLMDMPFLFRDLDHWNAVLSSDVLAPLEDELLEKADIKIVGYTGGGTRNLLSKQPVVTFDDLKGHKMRVMGAPIQAQIFQALTAAPSAIAYNEVYNAIQTGVIAGFENEAASIQNLKFYEVAPNLTLTRHSITVRPIVMSGKTFNSLPADLQAVVLEAGEEAGAYGRELESREDGVKLQEMVDAGQLTVSEFENRDKMLEMVKPVQDAYAAEIGASDLLEAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Transport protein
molecule keywords C4-dicarboxylate transport system substrate-binding protein
total genus 99
structure length 308
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nx1A00
5IZZA 4P1EA 5CM6A 4NHBA 4OA4A 4MEVA 4PC9A 4N8GA 2XXKA 4PGPA 4MX6A 4NG7A 4PGNA 2XWVA 2PFYA 4MNPA 5I7IA 2WYKA 4OVQA 4MCOA 2XWOA 2ZZWA 4LN5A 2PFZA 2ZZVA 4OVSA 2HPGA 4PETA 4PFIA 4PF6A 4OVTA 4PDDA 2WYPA 2CEYA 3GYYA 2HZLA 4PF8A 4XEQA 4MNCA 4PFBA 4N6KA 2XWKA 3FXBA 4N4UA 4NAPA 5IM2A 4DI4B 4PBQA 4NX1A 4PFRA 4OANA 4N91A 4NQ8A 4PBHA 4PCDA 2WX9A 4N8YA 4P47A 2CEXA 4XFEA 4NGUA 4MIJA 2HZKA 4OVRA 4O8MA 4PAFA 4DI3D 4NF0A 5I5PA 4MMPA 2XA5A 4MAGA 4P1LA 4PAKA 5LTCA 4OVPA 4NN3A 4PDHA 4N6DA 2XWIA 4X04A 2VPNA 4PE3A 2ZZXA 4P3LA 4XF5A 2VPOA 4X8RA 4MHFA 3U65A 3B50A 4O7MA 5IGAA 4PAIA 4P9KA 4YICA 4P56A 4YZZA 2V4CA 4N15A 4MNIA 4N17A 4P8BA 4UABA 4O94A
chains in the Genus database with same CATH superfamily
1QGXA 1FPFA 1SDXA 3LUZA 4DXCA 1B40A 5I3SA 4PFTA 1ZBMA 4GF8A 2PFYA 1I6QA 4MNPA 5KDTA 3CFZA 4LN5A 2X26A 4OFOA 2ZZVA 2VOZA 2ZYMA 4RNSA 1P1NA 1BIYA 5L9MA 3T1BA 4P0GA 4EQBA 5TU0A 1LB8A 2VT5A 1R6ZA 3S9NC 4G8MA 4HCYA 4QF9A 2DDKA 4G77A 4H46A 3U1OA 2ZYOA 1QJMA 2FA7A 1Z7ME 5I56A 1H76A 1URSA 1FQEA 1SQYA 2REGA 2VD3A 2FHYA 4GIZA 2OWSA 4DI3D 1G0HA 3KZGA 3OXNA 1B6HA 3IO6A 3TMGA 3TCFA 2P0SA 2UYFA 5F24A 3W15C 5EQAA 2V3QA 1MPDA 1FRPA 1QUIA 3H7MA 4ZEKA 4G68C 4GOTA 3SERA 4O7IA 4OERA 4GL0A 1URGA 1RDXA 4ZECA 1FPDA 1M5EA 4BLAA 5AE4A 4PFWA 3O9PA 3QMFA 3QK6A 3O97A 1K9ZA 4FIMA 3SZPA 3U92A 2ESNA 1SW5A 4PGNA 3DP4A 1US4A 4OVQA 5FHNA 2XWOA 4NMYA 1USYE 3M3FA 5K2YA 4H67A 3TYHA 2H99A 4PFIA 1KA1A 3IOWA 3NOHA 1QUKA 1ZIUA 5FTIA 1MXVA 3HHFA 5I59B 4KXPA 4F2QA 2RINA 4IO6A 3KJ7A 2ZXTA 4NX1A 4IO5A 4G68A 3VLUA 3U94A 1FQDA 4XKQA 5ET8A 3Q25A 4ND9A 4KCCA 3LC8A 1LCFA 3K6UA 2DE2A 4U23A 3ODBA 5I2KA 2H25A 1Y1ZA 5I59A 4NF0A 1BKAA 1POY1 5JTYB 5B70A 1MY3A 4IO3A 4OZ9A 1DBZA 4EXLA 2DWJA 1OMPA 2AYSA 2XXUA 1Y3PA 1ZKBA 5F7VA 3TKDA 2Y84A 3MUQA 4XF5A 4QXDA 5BWJA 4QFOA 3T9XB 1S50A 1DMBA 1BP5A 4F3PA 3M3KA 2PX1A 3UGWA 3OSRA 1R1NA 3K00A 3QSLA 4TLLB 4R6HA 4X1DA 4BDQA 2VGQA 3B6QA 4NF8A 5IZZA 4OVJA 5CM6A 4OEUA 2PT1A 2HAVA 3PUVE 3W9VA 2XWVA 2XD2A 4GXAA 3BBRA 3PD9A 2HPGA 3MAMA 5ET6A 4PETA 5H8NB 2P2AA 5I2NB 3B6WA 3LSWA 4LVQA 2OBGA 4R6KA 3FXUA 4TOZA 2XXQA 2GHAA 2XHDA 1LEVA 1B7HA 2DE4A 4ZS9A 1EU8A 1DK4A 3KOTA 4GLIA 4PBQA 1II5A 4YKIA 3N5LA 3PUYE 3IB2A 4OENA 4GFRA 3C35A 3KBRA 1EYIA 1M5BA 2XXWA 2B3BA 2OZZA 1MRPA 1OLCA 5CBSA 3ILUB 3EHTA 4O8MA 4YB5A 4G4PA 1GV8A 2RC7A 1J1NA 5CMCA 3UIFA 2Q89A 2ZNSA 3ZKLA 2F7CA 1FJ9A 3TODA 4MJOA 5H8HA 1P99A 4HW8A 1IUDA 1IIWA 3OO9A 3FUZA 4ZE9A 1ANFA 1NV0A 1B32A 1MQDA 1MXZA 4FEBA 2Y5KA 1POTA 4JWYA 4R9FA 4EUOA 5H8QB 1P1WA 4HXVA 2F7AA 3N94A 2F5XA 1A99A 1MM6A 1NFTA 1EYJA 1FQFA 2Y7KA 4MEVA 4G68B 4JDFA 2UVHA 5M2VA 1UTBB 1MDQA 2GH9A 1A7LA 1B9JA 2WBDA 5CMKA 1M5FA 4DIGA 2CZKA 4KQPA 4NF6A 4ELRA 1BK4A 1ATGA 1SBPA 4RK9A 1R9LA 1JVYA 2Q2AA 1RDZA 4PDDA 1NUWA 2CEYA 3MP8A 2HZLA 4KD5A 4MNCA 2F97A 2Y7RA 2G29A 4ZEFA 4C0RA 5KZTA 2RC8A 3S4UA 1FTAA 1O64A 4N91A 4OESA 1FCKA 2ALUA 4BDLA 5CMBA 3LSFB 1CE2A 3MC2A 4Q0CA 3C32A 4XFEA 1B5HA 4EXKA 5EQ7A 1WDNA 2HZKA 3FV1A 1FTOA 3V5AA 4KCDA 2QPQA 3ISPA 3IAZA 4GWZA 4OTEA 3MYUA 2O51A 5EYFA 2GQ1A 3I5OA 2ZYKA 4AS5A 3EPEA 1SI0A 2XWIA 1B3FA 2JJKA 3H6VA 2RKMA 2D5WA 4KI0E 1NMUA 2HQ0A 4F1VA 1MH3A 3PD8A 4YKKA 4O7MA 3K1PA 5EHMA 3UP9A 4YZZA 3VFJA 4N15A 2ONSA 5BUUA 3O28A 4P8BA 1ZTYA 1H43A 3C33A 1FBCA 4YKPA 2Q88A 4HTGA 4H65A 4TQUQ 4YB6A 1NNFA 1AWBA 1JEUA 1FQCA 1H44A 3K02A 3CR9A 1IXHA 1KZ8A 2XXYA 5DEXB 3V89B 4LQ5A 2FBPA 3QYTA 2I58A 4BDNA 3O66A 1LBXA 4ZEIA 3SEWA 2OLBA 1TFDA 1YZ0A 3OO7A 4GWUA 4JVCA 5A5XA 2QS1A 3M8UA 5IM2A 1D9YA 3FJ7A 4ZDMA 2DXYA 4GL8A 4OFLA 5AA4A 3T9VA 1S9TA 1RYXA 4PTKA 4HS7A 5ITPA 1FTLA 4OFJA 2NOOA 1MXUA 3HCQA 3A29A 3CSBA 4R75A 4X9TA 2XA5A 2DQVA 3G3JA 1EH3A 2DWIA 2V25A 2GRVA 3RNNA 2ONKE 2P1SA 3PGFA 2I3VA 4I3EA 2Y7IA 1YYZA 1R9QA 1FTKA 5KCJB 1WVJA 3U8QA 2X7QA 4X8RA 4GX4A 3N6UA 5I2KB 2Q8MA 3FD3A 5ET5A 1N3XA 4F2OA 4F3SA 2HEUA 1XVYA 4OHNA 1QVSA 2XXTA 3IORA 1FBPA 4KYSA 3JZJA 1IITA 1DCUA 3H6UA 2I6EA 1B1XA 1LLSA 3D4GA 4TLMB 1VSOA 1B2HA 1AH5A 2QSXA 3SDFA 2LAOA 4F31B 1Q9DA 1FTMA 1P1UA 5FTHA 1FPGA 4QBAA 2PFZA 3L6HA 4JSOA 4PE5B 2REJA 3EN3A 3ONMA 4GXSB 4HE1A 2QRYA 3LV0A 2UVGA 3TTLA 3G3FA 4G61A 1FJ6A 4UACA 4EF1A 4H8JA 3RUMA 3HO7A 5DVFA 4N6KA 1FQBA 1OIBA 2A5TB 1I6BA 3A3CA 2FVZA 1ZU0A 5LDZA 3C4MA 3GBBA 4K3FA 2F7BA 3MVYA 1SI1A 4I8CA 1LBVA 4THIA 1D4NA 1FSAA 1PEBA 4Z7EA 4LZ5A 4GWSA 4BDOA 2V84A 3O6IA 3PUXE 2I0BA 5EQ9A 3T22A 1VFEA 2M8CA 1B3HA 4NF5A 1LAFE 4MH5A 3M3LA 2R8TA 3H6TA 3V83A 3SEUA 1IZ1A 3LR1A 3B8BA 1YCJA 3G3KA 4RYAA 4YB7A 4QHQA 2WBBA 1A55A 3HV1A 1PB7A 2ZNUA 4LZ7A 3B50A 3S9MC 4YU0A 4FE8A 2QVUA 5ET7A 1Y4TA 1LCTA 2ANJA 1ZLQA 3B7DA 4NHBA 5J16A 2RCAA 4X1BA 3C34A 3HN0A 4I62A 3HHGA 2Y5LA 1CB6A 4ISUA 4DXUA 4GWOA 3PMVA 1B1HA 4MCOA 3MZ9A 1K9YA 3FVNA 3K6VA 4F3GA 3S9LC 5TPAB 1FBFA 2Q74A 4DCYA 1FBGA 3U93A 3GXAA 3F11A 1NL5A 3TQLA 4RPOA 4OANA 4UA8A 4RPNA 1Y3NA 3KGCA 2G93A 5JEIA 3V8XB 4KFQA 1DPEA 3IB1A 3FZVA 5EHSA 2KLFA 4GWYA 2NXOA 3QUJA 1A8FA 2XXPA 3RQTA 3JV9A 1TFAA 5ESYA 1LBZA 5I58B 5I57B 1SVXB 2R6GE 4GQOA 1LBCA 3KN3A 2OCUA 3T0JA 5L9SA 2Z8EA 2VHAA 3MZBA 4H1XA 4R73A 3I6VA 2HAUA 3K1NA 1FTJA 3AXFA 1T0KA 4QSEA 4NF4A 1USYH 2V3TA 3K1MA 1FBDA 2NVUB 2O1LA 2O7UA 4UABA 4EQ7A 3MWBA 2L5VA 3SKPA 3HPIA 1XVXA 5DVJA 5I58A 3LBSA 1FQAA 5DTBA 5CMMA 4OVSA 1OVBA 5CRYA 2PBWA 3E9XA 3GYYA 2DOJA 4JWXA 5FHMA 5CBRA 4YMAA 4GBVA 1TT1A 5CI5A 4QRZA 1LSTA 1SW2A 2XX7A 1N7XA 3PPQA 1EYKA 1F9BA 2B4MA 1MY4A 4P47A 2AL4A 3K4UA 3Q29A 2QS4A 3CI8A 1IEJA 2DWHA 1GTKA 4XIGQ 5DW8A 1QULA 5DYHA 4JVIA 4DXBA 4FECA 1IMEA 1JP4A 1UTHA 3BIGA 3PU5A 3QXMA 3VDFA 5DT6A 4MLQA 1HSJA 1P1OA 5H8HB 3OMBA 5CC2A 3IX1A 4RY1A 3EHUA 2QS2A 5AA2D 5IGAA 4RA1A 1LFGA 1JETA 1B46A 5KCJA 4EF2A 4KPTA 3SESA 3H3GA 3FXQA 5AA2B 2PT2A 4GD5A 3P7IA 4HE0A 1TXFA 2E0SA 4IO7A 3QIMA 3TEPA 2B3FA 5AA3A 5B7DA 5EQ8A 2O69A 2V93A 4LUBA 5I7IA 2E1SA 3VLWA 4XTCQ 1FBHA 2H4IA 3FIRA 3GZGA 3OEMA 1PBQA 4OVTA 1B0LA 3IB0A 2OJTA 3RGYA 4F18A 3U72A 3RTWB 1NV3A 3DP8A 2BJJX 2CZHA 4FAJA 3FXBA 1ZMGA 3EF7A 1YTVA 4ELPA 2Q8JA 2PVUA 3RLFE 1GGGA 5I56B 4G8HA 4Q8RA 1KA0A 4NQ8A 3TTKA 1NI9A 2DYXA 4LP2B 4XKRA 2O6AA 3HFUA 4OVRA 5DEXA 4PAFA 2P3NA 2A5SA 1NV1A 2RC9A 5ELVA 2ABHA 1LAXA 1IMAA 1SW4A 2THIA 3E13X 4N6DA 1N04A 1IMFA 1PDAA 3OD7A 1JW4A 3TELA 1D3KA 4PE3A 3KSJA 2DVCA 5TPAA 1GVCA 4H6DA 1L5TA 2IA4A 2R71A 1M5CA 2H9BA 2X7PA 2Q2CA 1FPIA 4ZE8A 1LBWA 3DLNA 4KYDA 3RY3A 4KHZE 1YPNA 1XT8A 1N84A 2QVVA 1JVXA 4F3BA 3OENA 4QFLA 1EZOA 4ZEDA 2XD3A 4PC9A 3RPWA 2XXKA 1MDP1 4H45A 3D1RA 5I84A 4MX6A 3ZS6A 4N6PA 2Y7PA 4O3AA 3MVZA 3SETA 2OK2A 4HE2A 4PFUA 1IMDA 3MVWA 3TPAA 3TTMA 3FGSA 3H6WA 2GFEA 3RT6B 3S2VA 1NNTA 2I48A 3C36A 2O84X 3FJGA 4PFBA 2B4LA 3ZSFA 3BFTA 4F1UA 3K6WA 3KSXA 4F1YA 2ONRA 4IR8A 3TDJA 5FBPA 1SD3A 3T96B 1INPA 3TCHA 3TAJA 3KN7A 4R2FA 1MPCA 1JQFA 3MQ9A 2RCBA 3EHSA 1LBBA 2RF1A 2O68A 3GLBA 4MAGA 4IO4A 1G0IA 1MQHA 3IFCA 3CSGA 3DELB 3FVKA 3E3KA 3CIJA 4M4GA 1US5A 2AL5A 3MW0A 4G2ZA 3MVXA 1AMFA 1PC3A 4JBZA 4P3LA 5H8QA 1B3EA 2HFBA 3U65A 4WKMA 3USDA 3ZKKA 3H06B 4QSDA 1PB9A 3CFLA 4XKNA 3L6GA 3VVDA 3K2DA 4WEPA 4IB2A 4O94A 4P1EA 3KC1A 1UTHB 3E4RA 1SPIA 4PGPA 3UA8A 3G7WA 3OELA 2VD2A 1IMBA 1FPJA 2ZZWA 2Z22A 5ICQA 4PF6A 5H8NA 1IXCA 2HHMA 2WKYA 2DXRA 1SW1A 4XEQA 1FBEA 1NV7A 3ECRA 2XX9A 3IO4A 2CMOA 4FBPA 1JW1A 4BDRA 2MKZA 4LA9A 4JSDA 4IO2A 1FPLA 2FNCA 1N76A 1Y20A 3TQWA 4PCDA 4N8YA 2Z23A 5H8FB 4F19A 3W9WA 1NH8A 1SYIA 3VXBA 3MPKA 1ELJA 2OWZA 4MF3A 4LATA 5ISUA 4DCXA 2DE3A 3K0VA 4C1TA 4OVPA 3A09A 1Y4CA 1FPBA 1B0HA 4AB5A 2FIEA 4X04A 1XHYA 4DZ1A 5IAIA 2ZZXA 5TP9A 2F3DA 2UVIA 1ZJLA 2QMXA 1LAHE 1MG1A 2HXWA 2XXRA 1BTJA 1Z7NE 1MQIA 2YJPA 1B7UA 2XXVA 1JEVA 4PP0A 3ROJA 4FORA 3KC0A 3JYRA 3FVOA 3LUYA 5HM4B 2QL3A 1VR5A 2XX8A 3D4CA 5HPQA 3O6HA 1B05A 1NH7A 4I3YA 3UN6A 3N26A 3TUSA 3KG2A 3G3HA 2DS9A 2KR0A 5LOMA 3T9UA 2I0CA 4N4UA 3RPLA 1B52A 5JK4A 1KWHA 1SYHA 4HCWA 1NV5A 5IZ3B 4I40A 2Y7WA 3MJNA 1D9QA 4JVDA 2PMSA 2VP1A 2WX9A 4NTLA 2A5TA 1JNFA 3HSTA 3PTYA 4NF4B 4NGUA 2I49A 1NUXA 4R9GA 2PCRA 4MIJA 1DOTA 4GBWA 5ITOA 5J1DA 4OYVA 1UIVA 3KEIA 4EQ9A 1MH4A 4XXUA 1QKAA 1P1QA 3BIHA 2FYIA 2H98A 3T93B 1B58A 4Q30B 4IGRA 5FHOA 1A40A 3CRBA 4AS4A 4PDHA 5L8DA 4POWA 2NWJA 3LSXA 3WAEA 4LONB 2ZNTA 1NNKA 2VPOA 4RJZA 2Q9TA 1B51A 4X48A 2DP8A 3O29A 2UXAA 4Q5TA 3Q28A 2V4CA 1TWYA 1VDWA 1A54A 3N6TA 4GX6A 4MNIA 4N17A 2XXIA 3PPOA 3VE1B 1B4ZA 1MQGA 4WXJA 2F36A 1I69A 1IMCA 5EYGA 4NG7A 3RN8A 5A5LA 3OOAA 5ICTA 4GWXA 2IEEA 4ESXA 2F6GA 5I2NA 1Y1MA 4ZZAA 4GX3A 2OX3A 3VXCA 3PUWE 1DPPA 4ELQA 4NE4A 2ZYNA 3MP6A 1LFHA 2HCAA 1DTZA 3FBPA 2BJIA 4MFIA 4YKJA 4P11A 2CZLA 3I3VA 3DM0A 2WEFA 3C9HA 4OWDA 1NUYA 4DE8A 1NKXA 3MPLA 4PBHA 4Z0IA 1MXWA 3IOTA 2I3WA 3VVFA 5IKBA 4YMBA 4R6YA 3TFLA 4FJPA 1S7YA 3G3GA 4U22A 3KOSA 2YPNA 3E79A 4MMPA 5AA2A 1OLAA 5EYHA 1YAEA 4OETA 4IGTA 4WEDA 3WAFA 3VV5A 1OQHA 4U1ZA 3MBPA 1MQJA 4I1DA 3FXRA 2VPNA 3LSLA 4H0WA 5DVIA 3SEVA 2UYEA 3IJOB 1XC1A 4PFYA 3IR1A 2CZIA 1VFDA 2QS3A 4H5GA 2F78A 1O7TA 4P56A 1B3LA 3R7XA 2QVRA 4F29A 4ECFA 3CHGA 1AL3A 2H5YA 4MLVA 5AA1A 1VE4A 5H8SA 4N13A 3R26A 4N8GA 1Q35A 3IOUA 5F1QA 4N07A 4R74A 3UK4A 2O7IA 4DLDA 2W7YA 3VVEA 1IXIA 3EQ1A 1RYOA 2KQZA 5IZ3A 1YXIA 1AOVA 3O2AA 2I4CA 4F39A 3TZAA 2WYPA 3KFMA 1EZ9A 1NV4A 5IZ1A 3PPRA 4H5FA 3E78A 4AQ4A 3PPPA 3RPLB 4RK2A 4DI4B 2F3BA 4KYEA 4G8NA 1WODA 1DTGA 1NV2A 3DP6A 4F22A 3A3UA 3KBZA 2DVZA 2DWAA 3KJTA 2CEXA 3PPNA 4XKPA 3G3IA 3TCGA 3Q27A 1QW0A 1UIUA 4YAHX 3PMWA 4P0IA 4FEDA 3MZ1A 5L9OA 1Y3QA 2FIXA 2UVJA 4OXVA 4O3BA 4PAKA 5LTCA 1MS7A 3H4ZA 2R9JA 2HXRA 1M5DA 2F34A 3RT8A 4L17A 3OO8A 1H3DA 4AB6A 2ZMBA 1RDYA 1HSLA 4MHFA 1EZPA 3RTFB 4PAIA 3SEXA 1GR2A 4YICA 5TP9B 3PV0E 5AA4B 1MPBA 5H8FA 4RXLA 4ZEBA 4ESWA 4KR5A 1H45A 4OQOA 3R6UA 2QJEA 3S9EA 4LZ8A 2F35A 1NV6A 4GWWA 4U2RA 2D3IA 4U4XA 2Z8DA 2WYKA 3IK6B 1JW5A 5KDTB 2AIXA 1MXYA 4NWCA 1D9VA 3B6TA 4GVOA 1FPKA 4PF8A 3Q26A 4LQ2A 1B3GA 1FPEA 3FJMA 4ONYA 2NUVA 2OWTA 3PUZE 4IY5A 3T66A 2XWKA 4JXIA 2D21A 3MP1A 4NAPA 1NUZA 4QSCA 4PFRA 2QMWA 4NEDA 3EKIA 4FATA 4JWOA 2F8DA 4O3CA 4ELOA 3MSTA 3CFXA 2GHBA 4OMBA 2DSFA 2O1MA 3QAXA 3OEKA 1NNPA 4QFNA 4DDDA 3TTRA 4H8IA 4NN3A 3FV2A 4MBPA 1URDA 3RYDA 4M1VA 4POXA 1N3WA 4NF5B 3FATA 4E0WA 3CG1A 1PB8A 1XS5A 3FASA 4U21A 3THIA 4NF8B 3K6XA 3IL1B 1LB9A 1N0TA 2B65A 3ILTB 1MY0A 3IJXB 3TTNA 2XXXA 1MM7A 2P3VA 5T3JA 4N81A 4OA4A 1UQWA 2QFLA 2Z8FA 4OEVA 2F6PA 3IOVA 2XXHA 1LGBC 3QUFA 1IQ7A 4E0XA 4JB7A 1B7ZA 3SEYA 1QKBA 2V3UA 2YLNA 1O63A 4NF6B 4ZZEA 4BDMA 3GBAA 4U1OA 3O6GA 1N7WA 1LBYA 3BKIB 1XI6A 3KN8A 3CG3A 3VLVA 1A8EA 1B5JA 1AIVA 1B5IA 4GRKA 1OQGA 4R72A 1DSNA 4C1UA 4EDPA 5I5PA 1PBPA 5JTYA 4NWDA 1XOCA 5HBCA 3OSQA 4P1LA 1LFIA 1RKMA 1BLFA 4R2BA 1Q1KA 3CVGA 4QFKA 5I57A 1LAGE 1CNQA 3H03A 1OVTA 1IXGA 5A5XB 3K01A 2I4BA 2PYYA 4PQJA 4I9DA 3FVGA 1MY1A 3C31A 4IY6A 3IFAA 1MXXA 1I6AA 1B4HA 1HSEA 3PMXA 5K2XA 1MY2A 3T9HB 1FW0A 4P9KA 3OO6A 1UTBA 1Y9UA 3BFUA 3UORA 4U4SA 4QFPA 1QUJA
chains in the Genus database with same CATH topology
1QGXA 1FBCA 1FPFA 2L5VA 1FBPA 3QMFA 3ROJA 3KC0A 4HE0A 3LUZA 2P3VA 4P1EA 5T3JA 1K9ZA 5CM6A 1EYJA 4N81A 3KC1A 4NHBA 4OA4A 5J16A 1DCUA 4MEVA 3SZPA 2QFLA 4PC9A 1IMCA 4N8GA 2XXKA 5I3SA 5EYGA 1AWBA 4H45A 1SPIA 4PGPA 3D1RA 4MX6A 4NG7A 1NV6A 2WBDA 4GWWA 4PGNA 2XWVA 2PFYA 5EQ8A 3W9VA 4MNPA 2Y5LA 5A5LA 5I7IA 1IMBA 1FPJA 2WYKA 4OVQA 4GWXA 1FBHA 4MCOA 1Q9DA 2XWOA 2CZKA 2ZZWA 1FPGA 4LN5A 4HE2A 1BK4A 1KZ8A 2PFZA 2ZZVA 4OVSA 4QBAA 2HPGA 2KQZA 1K9YA 5IZ3A 4GX3A 5ET6A 4PETA 1YXIA 2OX3A 1IMDA 2FBPA 4PFIA 4I3YA 1RDZA 4PF6A 2HHMA 1KA1A 3NOHA 4HE1A 1FPKA 3LV0A 1NUWA 4OVTA 4PDDA 2WYPA 2CEYA 3GYYA 1FJ6A 2HZLA 4G61A 4PF8A 3T1BA 1FBFA 1LBXA 2Q74A 1NV4A 2VT5A 4XEQA 5IZ1A 1FBEA 1FPEA 1NV7A 4F18A 1FBGA 4MNCA 3E78A 1NV3A 4GWUA 1YZ0A 4FBPA 2CZHA 4KXPA 1LBYA 2B4LA 4GBVA 4HCYA 4PFBA 2MKZA 4N6KA 1LEVA 2KR0A 2XWKA 2BJIA 2DDKA 3FBPA 3FXBA 4H46A 4N4UA 4JVCA 3RPLB 3RPLA 2DE4A 4NAPA 1NUZA 2WEFA 1XI6A 4F1UA 5JK4A 1DK4A 5IM2A 2F3BA 2FVZA 4DI4B 4HCWA 4PBQA 4NX1A 5LDZA 1NV5A 1FPLA 4IR8A 4PFRA 4I40A 5IZ3B 4OANA 1NUYA 1FTAA 1NV2A 1EYKA 1D9QA 4JVDA 3KBZA 4N91A 5ET8A 5FBPA 1KA0A 1EYIA 4NQ8A 4PBHA 2DVZA 1NI9A 4PCDA 2B4MA 1LBVA 2WX9A 3EKIA 4N8YA 2CEXA 4P47A 1INPA 2FHYA 4GWYA 4PTKA 4XFEA 3PTYA 4F19A 3HFUA 4NGUA 3W9WA 2DE2A 1FSAA 1NUXA 5EQ7A 2PCRA 2HZKA 4MIJA 4OVRA 4O8MA 4GWSA 5ESYA 4GBWA 3A29A 1LBZA 4PAFA 2P3NA 3MSTA 4DI3D 5J1DA 2OWZA 5DW8A 4NF0A 3E79A 5I5PA 4JVIA 4MMPA 5IZZA 1NV1A 2QPQA 1G0HA 3ISPA 1IMEA 1JP4A 3BIHA 4X9TA 2XA5A 2FIXA 3BIGA 4GWZA 5EYHA 2DE3A 4MAGA 5EQ9A 1DBZA 3MYUA 2GQ1A 1G0IA 1IMAA 3IFCA 4P1LA 4PAKA 5LTCA 5F24A 4OVPA 4AS4A 4NN3A 4PDHA 4AS5A 1FJ9A 4MJOA 1FPBA 1CNQA 4N6DA 3T0JA 1IMFA 5EQAA 2FIEA 2R8TA 2V3QA 2XWIA 4X04A 3RYDA 2HXRA 2JJKA 4M1VA 1FRPA 2VPNA 4PE3A 4I3EA 2ZZXA 3B8BA 1YYZA 4P3LA 4XF5A 2F3DA 2VPOA 2WBBA 4F1VA 4X8RA 3IFAA 4QXDA 1RDYA 4GX4A 4MHFA 2Q9TA 1NV0A 2Q8MA 3U65A 5ET5A 3B50A 4O7MA 4O7IA 5IGAA 2CZIA 2Y5KA 4PAIA 1FPIA 1LBWA 1FBDA 4P9KA 4YICA 2QVUA 1RDXA 4P56A 4YZZA 4HXVA 2V4CA 1VDWA 2QVRA 4N15A 5ET7A 1FPDA 4GX6A 2QVVA 2F5XA 4MNIA 4N17A 4P8BA 3CHGA 4O94A 4UABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZZ A;  4P1E A;  5CM6 A;  4NHB A;  4OA4 A;  4MEV A;  4PC9 A;  4N8G A;  2XXK A;  4PGP A;  4MX6 A;  4NG7 A;  4PGN A;  2XWV A;  2PFY A;  4MNP A;  5I7I A;  2WYK A;  4OVQ A;  4MCO A;  2XWO A;  2ZZW A;  4LN5 A;  2PFZ A;  2ZZV A;  4OVS A;  2HPG A;  4PET A;  4PFI A;  4PF6 A;  4OVT A;  4PDD A;  2WYP A;  2CEY A;  3GYY A;  2HZL A;  4PF8 A;  4XEQ A;  4MNC A;  4PFB A;  4N6K A;  2XWK A;  3FXB A;  4N4U A;  4NAP A;  5IM2 A;  4DI4 B;  4PBQ A;  4NX1 A;  4PFR A;  4OAN A;  4N91 A;  4NQ8 A;  4PBH A;  4PCD A;  2WX9 A;  4N8Y A;  4P47 A;  2CEX A;  4XFE A;  4NGU A;  4MIJ A;  2HZK A;  4OVR A;  4O8M A;  4PAF A;  4DI3 D;  4NF0 A;  5I5P A;  4MMP A;  2XA5 A;  4MAG A;  4P1L A;  4PAK A;  5LTC A;  4OVP A;  4NN3 A;  4PDH A;  4N6D A;  2XWI A;  4X04 A;  2VPN A;  4PE3 A;  2ZZX A;  4P3L A;  4XF5 A;  2VPO A;  4X8R A;  4MHF A;  3U65 A;  3B50 A;  4O7M A;  5IGA A;  4PAI A;  4P9K A;  4YIC A;  4P56 A;  4YZZ A;  2V4C A;  4N15 A;  4MNI A;  4N17 A;  4P8B A;  4UAB A;  4O94 A; 
#chains in the Genus database with same CATH topology
 1QGX A;  1FPF A;  1SDX A;  3LUZ A;  4DXC A;  1B40 A;  5I3S A;  4PFT A;  1ZBM A;  4GF8 A;  2PFY A;  1I6Q A;  4MNP A;  5KDT A;  3CFZ A;  4LN5 A;  2X26 A;  4OFO A;  2ZZV A;  2VOZ A;  2ZYM A;  4RNS A;  1P1N A;  1BIY A;  5L9M A;  3T1B A;  4P0G A;  4EQB A;  5TU0 A;  1LB8 A;  2VT5 A;  1R6Z A;  3S9N C;  4G8M A;  4HCY A;  4QF9 A;  2DDK A;  4G77 A;  4H46 A;  3U1O A;  2ZYO A;  1QJM A;  2FA7 A;  1Z7M E;  5I56 A;  1H76 A;  1URS A;  1FQE A;  1SQY A;  2REG A;  2VD3 A;  2FHY A;  4GIZ A;  2OWS A;  4DI3 D;  1G0H A;  3KZG A;  3OXN A;  1B6H A;  3IO6 A;  3TMG A;  3TCF A;  2P0S A;  2UYF A;  5F24 A;  3W15 C;  5EQA A;  2V3Q A;  1MPD A;  1FRP A;  1QUI A;  3H7M A;  4ZEK A;  4G68 C;  4GOT A;  3SER A;  4O7I A;  4OER A;  4GL0 A;  1URG A;  1RDX A;  4ZEC A;  1FPD A;  1M5E A;  4BLA A;  5AE4 A;  4PFW A;  3O9P A;  3QMF A;  3QK6 A;  3O97 A;  1K9Z A;  4FIM A;  3SZP A;  3U92 A;  2ESN A;  1SW5 A;  4PGN A;  3DP4 A;  1US4 A;  4OVQ A;  5FHN A;  2XWO A;  4NMY A;  1USY E;  3M3F A;  5K2Y A;  4H67 A;  3TYH A;  2H99 A;  4PFI A;  1KA1 A;  3IOW A;  3NOH A;  1QUK A;  1ZIU A;  5FTI A;  1MXV A;  3HHF A;  5I59 B;  4KXP A;  4F2Q A;  2RIN A;  4IO6 A;  3KJ7 A;  2ZXT A;  4NX1 A;  4IO5 A;  4G68 A;  3VLU A;  3U94 A;  1FQD A;  4XKQ A;  5ET8 A;  3Q25 A;  4ND9 A;  4KCC A;  3LC8 A;  1LCF A;  3K6U A;  2DE2 A;  4U23 A;  3ODB A;  5I2K A;  2H25 A;  1Y1Z A;  5I59 A;  4NF0 A;  1BKA A;  1POY 1;  5JTY B;  5B70 A;  1MY3 A;  4IO3 A;  4OZ9 A;  1DBZ A;  4EXL A;  2DWJ A;  1OMP A;  2AYS A;  2XXU A;  1Y3P A;  1ZKB A;  5F7V A;  3TKD A;  2Y84 A;  3MUQ A;  4XF5 A;  4QXD A;  5BWJ A;  4QFO A;  3T9X B;  1S50 A;  1DMB A;  1BP5 A;  4F3P A;  3M3K A;  2PX1 A;  3UGW A;  3OSR A;  1R1N A;  3K00 A;  3QSL A;  4TLL B;  4R6H A;  4X1D A;  4BDQ A;  2VGQ A;  3B6Q A;  4NF8 A;  5IZZ A;  4OVJ A;  5CM6 A;  4OEU A;  2PT1 A;  2HAV A;  3PUV E;  3W9V A;  2XWV A;  2XD2 A;  4GXA A;  3BBR A;  3PD9 A;  2HPG A;  3MAM A;  5ET6 A;  4PET A;  5H8N B;  2P2A A;  5I2N B;  3B6W A;  3LSW A;  4LVQ A;  2OBG A;  4R6K A;  3FXU A;  4TOZ A;  2XXQ A;  2GHA A;  2XHD A;  1LEV A;  1B7H A;  2DE4 A;  4ZS9 A;  1EU8 A;  1DK4 A;  3KOT A;  4GLI A;  4PBQ A;  1II5 A;  4YKI A;  3N5L A;  3PUY E;  3IB2 A;  4OEN A;  4GFR A;  3C35 A;  3KBR A;  1EYI A;  1M5B A;  2XXW A;  2B3B A;  2OZZ A;  1MRP A;  1OLC A;  5CBS A;  3ILU B;  3EHT A;  4O8M A;  4YB5 A;  4G4P A;  1GV8 A;  2RC7 A;  1J1N A;  5CMC A;  3UIF A;  2Q89 A;  2ZNS A;  3ZKL A;  2F7C A;  1FJ9 A;  3TOD A;  4MJO A;  5H8H A;  1P99 A;  4HW8 A;  1IUD A;  1IIW A;  3OO9 A;  3FUZ A;  4ZE9 A;  1ANF A;  1NV0 A;  1B32 A;  1MQD A;  1MXZ A;  4FEB A;  2Y5K A;  1POT A;  4JWY A;  4R9F A;  4EUO A;  5H8Q B;  1P1W A;  4HXV A;  2F7A A;  3N94 A;  2F5X A;  1A99 A;  1MM6 A;  1NFT A;  1EYJ A;  1FQF A;  2Y7K A;  4MEV A;  4G68 B;  4JDF A;  2UVH A;  5M2V A;  1UTB B;  1MDQ A;  2GH9 A;  1A7L A;  1B9J A;  2WBD A;  5CMK A;  1M5F A;  4DIG A;  2CZK A;  4KQP A;  4NF6 A;  4ELR A;  1BK4 A;  1ATG A;  1SBP A;  4RK9 A;  1R9L A;  1JVY A;  2Q2A A;  1RDZ A;  4PDD A;  1NUW A;  2CEY A;  3MP8 A;  2HZL A;  4KD5 A;  4MNC A;  2F97 A;  2Y7R A;  2G29 A;  4ZEF A;  4C0R A;  5KZT A;  2RC8 A;  3S4U A;  1FTA A;  1O64 A;  4N91 A;  4OES A;  1FCK A;  2ALU A;  4BDL A;  5CMB A;  3LSF B;  1CE2 A;  3MC2 A;  4Q0C A;  3C32 A;  4XFE A;  1B5H A;  4EXK A;  5EQ7 A;  1WDN A;  2HZK A;  3FV1 A;  1FTO A;  3V5A A;  4KCD A;  2QPQ A;  3ISP A;  3IAZ A;  4GWZ A;  4OTE A;  3MYU A;  2O51 A;  5EYF A;  2GQ1 A;  3I5O A;  2ZYK A;  4AS5 A;  3EPE A;  1SI0 A;  2XWI A;  1B3F A;  2JJK A;  3H6V A;  2RKM A;  2D5W A;  4KI0 E;  1NMU A;  2HQ0 A;  4F1V A;  1MH3 A;  3PD8 A;  4YKK A;  4O7M A;  3K1P A;  5EHM A;  3UP9 A;  4YZZ A;  3VFJ A;  4N15 A;  2ONS A;  5BUU A;  3O28 A;  4P8B A;  1ZTY A;  1H43 A;  3C33 A;  1FBC A;  4YKP A;  2Q88 A;  4HTG A;  4H65 A;  4TQU Q;  4YB6 A;  1NNF A;  1AWB A;  1JEU A;  1FQC A;  1H44 A;  3K02 A;  3CR9 A;  1IXH A;  1KZ8 A;  2XXY A;  5DEX B;  3V89 B;  4LQ5 A;  2FBP A;  3QYT A;  2I58 A;  4BDN A;  3O66 A;  1LBX A;  4ZEI A;  3SEW A;  2OLB A;  1TFD A;  1YZ0 A;  3OO7 A;  4GWU A;  4JVC A;  5A5X A;  2QS1 A;  3M8U A;  5IM2 A;  1D9Y A;  3FJ7 A;  4ZDM A;  2DXY A;  4GL8 A;  4OFL A;  5AA4 A;  3T9V A;  1S9T A;  1RYX A;  4PTK A;  4HS7 A;  5ITP A;  1FTL A;  4OFJ A;  2NOO A;  1MXU A;  3HCQ A;  3A29 A;  3CSB A;  4R75 A;  4X9T A;  2XA5 A;  2DQV A;  3G3J A;  1EH3 A;  2DWI A;  2V25 A;  2GRV A;  3RNN A;  2ONK E;  2P1S A;  3PGF A;  2I3V A;  4I3E A;  2Y7I A;  1YYZ A;  1R9Q A;  1FTK A;  5KCJ B;  1WVJ A;  3U8Q A;  2X7Q A;  4X8R A;  4GX4 A;  3N6U A;  5I2K B;  2Q8M A;  3FD3 A;  5ET5 A;  1N3X A;  4F2O A;  4F3S A;  2HEU A;  1XVY A;  4OHN A;  1QVS A;  2XXT A;  3IOR A;  1FBP A;  4KYS A;  3JZJ A;  1IIT A;  1DCU A;  3H6U A;  2I6E A;  1B1X A;  1LLS A;  3D4G A;  4TLM B;  1VSO A;  1B2H A;  1AH5 A;  2QSX A;  3SDF A;  2LAO A;  4F31 B;  1Q9D A;  1FTM A;  1P1U A;  5FTH A;  1FPG A;  4QBA A;  2PFZ A;  3L6H A;  4JSO A;  4PE5 B;  2REJ A;  3EN3 A;  3ONM A;  4GXS B;  4HE1 A;  2QRY A;  3LV0 A;  2UVG A;  3TTL A;  3G3F A;  4G61 A;  1FJ6 A;  4UAC A;  4EF1 A;  4H8J A;  3RUM A;  3HO7 A;  5DVF A;  4N6K A;  1FQB A;  1OIB A;  2A5T B;  1I6B A;  3A3C A;  2FVZ A;  1ZU0 A;  5LDZ A;  3C4M A;  3GBB A;  4K3F A;  2F7B A;  3MVY A;  1SI1 A;  4I8C A;  1LBV A;  4THI A;  1D4N A;  1FSA A;  1PEB A;  4Z7E A;  4LZ5 A;  4GWS A;  4BDO A;  2V84 A;  3O6I A;  3PUX E;  2I0B A;  5EQ9 A;  3T22 A;  1VFE A;  2M8C A;  1B3H A;  4NF5 A;  1LAF E;  4MH5 A;  3M3L A;  2R8T A;  3H6T A;  3V83 A;  3SEU A;  1IZ1 A;  3LR1 A;  3B8B A;  1YCJ A;  3G3K A;  4RYA A;  4YB7 A;  4QHQ A;  2WBB A;  1A55 A;  3HV1 A;  1PB7 A;  2ZNU A;  4LZ7 A;  3B50 A;  3S9M C;  4YU0 A;  4FE8 A;  2QVU A;  5ET7 A;  1Y4T A;  1LCT A;  2ANJ A;  1ZLQ A;  3B7D A;  4NHB A;  5J16 A;  2RCA A;  4X1B A;  3C34 A;  3HN0 A;  4I62 A;  3HHG A;  2Y5L A;  1CB6 A;  4ISU A;  4DXU A;  4GWO A;  3PMV A;  1B1H A;  4MCO A;  3MZ9 A;  1K9Y A;  3FVN A;  3K6V A;  4F3G A;  3S9L C;  5TPA B;  1FBF A;  2Q74 A;  4DCY A;  1FBG A;  3U93 A;  3GXA A;  3F11 A;  1NL5 A;  3TQL A;  4RPO A;  4OAN A;  4UA8 A;  4RPN A;  1Y3N A;  3KGC A;  2G93 A;  5JEI A;  3V8X B;  4KFQ A;  1DPE A;  3IB1 A;  3FZV A;  5EHS A;  2KLF A;  4GWY A;  2NXO A;  3QUJ A;  1A8F A;  2XXP A;  3RQT A;  3JV9 A;  1TFA A;  5ESY A;  1LBZ A;  5I58 B;  5I57 B;  1SVX B;  2R6G E;  4GQO A;  1LBC A;  3KN3 A;  2OCU A;  3T0J A;  5L9S A;  2Z8E A;  2VHA A;  3MZB A;  4H1X A;  4R73 A;  3I6V A;  2HAU A;  3K1N A;  1FTJ A;  3AXF A;  1T0K A;  4QSE A;  4NF4 A;  1USY H;  2V3T A;  3K1M A;  1FBD A;  2NVU B;  2O1L A;  2O7U A;  4UAB A;  4EQ7 A;  3MWB A;  2L5V A;  3SKP A;  3HPI A;  1XVX A;  5DVJ A;  5I58 A;  3LBS A;  1FQA A;  5DTB A;  5CMM A;  4OVS A;  1OVB A;  5CRY A;  2PBW A;  3E9X A;  3GYY A;  2DOJ A;  4JWX A;  5FHM A;  5CBR A;  4YMA A;  4GBV A;  1TT1 A;  5CI5 A;  4QRZ A;  1LST A;  1SW2 A;  2XX7 A;  1N7X A;  3PPQ A;  1EYK A;  1F9B A;  2B4M A;  1MY4 A;  4P47 A;  2AL4 A;  3K4U A;  3Q29 A;  2QS4 A;  3CI8 A;  1IEJ A;  2DWH A;  1GTK A;  4XIG Q;  5DW8 A;  1QUL A;  5DYH A;  4JVI A;  4DXB A;  4FEC A;  1IME A;  1JP4 A;  1UTH A;  3BIG A;  3PU5 A;  3QXM A;  3VDF A;  5DT6 A;  4MLQ A;  1HSJ A;  1P1O A;  5H8H B;  3OMB A;  5CC2 A;  3IX1 A;  4RY1 A;  3EHU A;  2QS2 A;  5AA2 D;  5IGA A;  4RA1 A;  1LFG A;  1JET A;  1B46 A;  5KCJ A;  4EF2 A;  4KPT A;  3SES A;  3H3G A;  3FXQ A;  5AA2 B;  2PT2 A;  4GD5 A;  3P7I A;  4HE0 A;  1TXF A;  2E0S A;  4IO7 A;  3QIM A;  3TEP A;  2B3F A;  5AA3 A;  5B7D A;  5EQ8 A;  2O69 A;  2V93 A;  4LUB A;  5I7I A;  2E1S A;  3VLW A;  4XTC Q;  1FBH A;  2H4I A;  3FIR A;  3GZG A;  3OEM A;  1PBQ A;  4OVT A;  1B0L A;  3IB0 A;  2OJT A;  3RGY A;  4F18 A;  3U72 A;  3RTW B;  1NV3 A;  3DP8 A;  2BJJ X;  2CZH A;  4FAJ A;  3FXB A;  1ZMG A;  3EF7 A;  1YTV A;  4ELP A;  2Q8J A;  2PVU A;  3RLF E;  1GGG A;  5I56 B;  4G8H A;  4Q8R A;  1KA0 A;  4NQ8 A;  3TTK A;  1NI9 A;  2DYX A;  4LP2 B;  4XKR A;  2O6A A;  3HFU A;  4OVR A;  5DEX A;  4PAF A;  2P3N A;  2A5S A;  1NV1 A;  2RC9 A;  5ELV A;  2ABH A;  1LAX A;  1IMA A;  1SW4 A;  2THI A;  3E13 X;  4N6D A;  1N04 A;  1IMF A;  1PDA A;  3OD7 A;  1JW4 A;  3TEL A;  1D3K A;  4PE3 A;  3KSJ A;  2DVC A;  5TPA A;  1GVC A;  4H6D A;  1L5T A;  2IA4 A;  2R71 A;  1M5C A;  2H9B A;  2X7P A;  2Q2C A;  1FPI A;  4ZE8 A;  1LBW A;  3DLN A;  4KYD A;  3RY3 A;  4KHZ E;  1YPN A;  1XT8 A;  1N84 A;  2QVV A;  1JVX A;  4F3B A;  3OEN A;  4QFL A;  1EZO A;  4ZED A;  2XD3 A;  4PC9 A;  3RPW A;  2XXK A;  1MDP 1;  4H45 A;  3D1R A;  5I84 A;  4MX6 A;  3ZS6 A;  4N6P A;  2Y7P A;  4O3A A;  3MVZ A;  3SET A;  2OK2 A;  4HE2 A;  4PFU A;  1IMD A;  3MVW A;  3TPA A;  3TTM A;  3FGS A;  3H6W A;  2GFE A;  3RT6 B;  3S2V A;  1NNT A;  2I48 A;  3C36 A;  2O84 X;  3FJG A;  4PFB A;  2B4L A;  3ZSF A;  3BFT A;  4F1U A;  3K6W A;  3KSX A;  4F1Y A;  2ONR A;  4IR8 A;  3TDJ A;  5FBP A;  1SD3 A;  3T96 B;  1INP A;  3TCH A;  3TAJ A;  3KN7 A;  4R2F A;  1MPC A;  1JQF A;  3MQ9 A;  2RCB A;  3EHS A;  1LBB A;  2RF1 A;  2O68 A;  3GLB A;  4MAG A;  4IO4 A;  1G0I A;  1MQH A;  3IFC A;  3CSG A;  3DEL B;  3FVK A;  3E3K A;  3CIJ A;  4M4G A;  1US5 A;  2AL5 A;  3MW0 A;  4G2Z A;  3MVX A;  1AMF A;  1PC3 A;  4JBZ A;  4P3L A;  5H8Q A;  1B3E A;  2HFB A;  3U65 A;  4WKM A;  3USD A;  3ZKK A;  3H06 B;  4QSD A;  1PB9 A;  3CFL A;  4XKN A;  3L6G A;  3VVD A;  3K2D A;  4WEP A;  4IB2 A;  4O94 A;  4P1E A;  3KC1 A;  1UTH B;  3E4R A;  1SPI A;  4PGP A;  3UA8 A;  3G7W A;  3OEL A;  2VD2 A;  1IMB A;  1FPJ A;  2ZZW A;  2Z22 A;  5ICQ A;  4PF6 A;  5H8N A;  1IXC A;  2HHM A;  2WKY A;  2DXR A;  1SW1 A;  4XEQ A;  1FBE A;  1NV7 A;  3ECR A;  2XX9 A;  3IO4 A;  2CMO A;  4FBP A;  1JW1 A;  4BDR A;  2MKZ A;  4LA9 A;  4JSD A;  4IO2 A;  1FPL A;  2FNC A;  1N76 A;  1Y20 A;  3TQW A;  4PCD A;  4N8Y A;  2Z23 A;  5H8F B;  4F19 A;  3W9W A;  1NH8 A;  1SYI A;  3VXB A;  3MPK A;  1ELJ A;  2OWZ A;  4MF3 A;  4LAT A;  5ISU A;  4DCX A;  2DE3 A;  3K0V A;  4C1T A;  4OVP A;  3A09 A;  1Y4C A;  1FPB A;  1B0H A;  4AB5 A;  2FIE A;  4X04 A;  1XHY A;  4DZ1 A;  5IAI A;  2ZZX A;  5TP9 A;  2F3D A;  2UVI A;  1ZJL A;  2QMX A;  1LAH E;  1MG1 A;  2HXW A;  2XXR A;  1BTJ A;  1Z7N E;  1MQI A;  2YJP A;  1B7U A;  2XXV A;  1JEV A;  4PP0 A;  3ROJ A;  4FOR A;  3KC0 A;  3JYR A;  3FVO A;  3LUY A;  5HM4 B;  2QL3 A;  1VR5 A;  2XX8 A;  3D4C A;  5HPQ A;  3O6H A;  1B05 A;  1NH7 A;  4I3Y A;  3UN6 A;  3N26 A;  3TUS A;  3KG2 A;  3G3H A;  2DS9 A;  2KR0 A;  5LOM A;  3T9U A;  2I0C A;  4N4U A;  3RPL A;  1B52 A;  5JK4 A;  1KWH A;  1SYH A;  4HCW A;  1NV5 A;  5IZ3 B;  4I40 A;  2Y7W A;  3MJN A;  1D9Q A;  4JVD A;  2PMS A;  2VP1 A;  2WX9 A;  4NTL A;  2A5T A;  1JNF A;  3HST A;  3PTY A;  4NF4 B;  4NGU A;  2I49 A;  1NUX A;  4R9G A;  2PCR A;  4MIJ A;  1DOT A;  4GBW A;  5ITO A;  5J1D A;  4OYV A;  1UIV A;  3KEI A;  4EQ9 A;  1MH4 A;  4XXU A;  1QKA A;  1P1Q A;  3BIH A;  2FYI A;  2H98 A;  3T93 B;  1B58 A;  4Q30 B;  4IGR A;  5FHO A;  1A40 A;  3CRB A;  4AS4 A;  4PDH A;  5L8D A;  4POW A;  2NWJ A;  3LSX A;  3WAE A;  4LON B;  2ZNT A;  1NNK A;  2VPO A;  4RJZ A;  2Q9T A;  1B51 A;  4X48 A;  2DP8 A;  3O29 A;  2UXA A;  4Q5T A;  3Q28 A;  2V4C A;  1TWY A;  1VDW A;  1A54 A;  3N6T A;  4GX6 A;  4MNI A;  4N17 A;  2XXI A;  3PPO A;  3VE1 B;  1B4Z A;  1MQG A;  4WXJ A;  2F36 A;  1I69 A;  1IMC A;  5EYG A;  4NG7 A;  3RN8 A;  5A5L A;  3OOA A;  5ICT A;  4GWX A;  2IEE A;  4ESX A;  2F6G A;  5I2N A;  1Y1M A;  4ZZA A;  4GX3 A;  2OX3 A;  3VXC A;  3PUW E;  1DPP A;  4ELQ A;  4NE4 A;  2ZYN A;  3MP6 A;  1LFH A;  2HCA A;  1DTZ A;  3FBP A;  2BJI A;  4MFI A;  4YKJ A;  4P11 A;  2CZL A;  3I3V A;  3DM0 A;  2WEF A;  3C9H A;  4OWD A;  1NUY A;  4DE8 A;  1NKX A;  3MPL A;  4PBH A;  4Z0I A;  1MXW A;  3IOT A;  2I3W A;  3VVF A;  5IKB A;  4YMB A;  4R6Y A;  3TFL A;  4FJP A;  1S7Y A;  3G3G A;  4U22 A;  3KOS A;  2YPN A;  3E79 A;  4MMP A;  5AA2 A;  1OLA A;  5EYH A;  1YAE A;  4OET A;  4IGT A;  4WED A;  3WAF A;  3VV5 A;  1OQH A;  4U1Z A;  3MBP A;  1MQJ A;  4I1D A;  3FXR A;  2VPN A;  3LSL A;  4H0W A;  5DVI A;  3SEV A;  2UYE A;  3IJO B;  1XC1 A;  4PFY A;  3IR1 A;  2CZI A;  1VFD A;  2QS3 A;  4H5G A;  2F78 A;  1O7T A;  4P56 A;  1B3L A;  3R7X A;  2QVR A;  4F29 A;  4ECF A;  3CHG A;  1AL3 A;  2H5Y A;  4MLV A;  5AA1 A;  1VE4 A;  5H8S A;  4N13 A;  3R26 A;  4N8G A;  1Q35 A;  3IOU A;  5F1Q A;  4N07 A;  4R74 A;  3UK4 A;  2O7I A;  4DLD A;  2W7Y A;  3VVE A;  1IXI A;  3EQ1 A;  1RYO A;  2KQZ A;  5IZ3 A;  1YXI A;  1AOV A;  3O2A A;  2I4C A;  4F39 A;  3TZA A;  2WYP A;  3KFM A;  1EZ9 A;  1NV4 A;  5IZ1 A;  3PPR A;  4H5F A;  3E78 A;  4AQ4 A;  3PPP A;  3RPL B;  4RK2 A;  4DI4 B;  2F3B A;  4KYE A;  4G8N A;  1WOD A;  1DTG A;  1NV2 A;  3DP6 A;  4F22 A;  3A3U A;  3KBZ A;  2DVZ A;  2DWA A;  3KJT A;  2CEX A;  3PPN A;  4XKP A;  3G3I A;  3TCG A;  3Q27 A;  1QW0 A;  1UIU A;  4YAH X;  3PMW A;  4P0I A;  4FED A;  3MZ1 A;  5L9O A;  1Y3Q A;  2FIX A;  2UVJ A;  4OXV A;  4O3B A;  4PAK A;  5LTC A;  1MS7 A;  3H4Z A;  2R9J A;  2HXR A;  1M5D A;  2F34 A;  3RT8 A;  4L17 A;  3OO8 A;  1H3D A;  4AB6 A;  2ZMB A;  1RDY A;  1HSL A;  4MHF A;  1EZP A;  3RTF B;  4PAI A;  3SEX A;  1GR2 A;  4YIC A;  5TP9 B;  3PV0 E;  5AA4 B;  1MPB A;  5H8F A;  4RXL A;  4ZEB A;  4ESW A;  4KR5 A;  1H45 A;  4OQO A;  3R6U A;  2QJE A;  3S9E A;  4LZ8 A;  2F35 A;  1NV6 A;  4GWW A;  4U2R A;  2D3I A;  4U4X A;  2Z8D A;  2WYK A;  3IK6 B;  1JW5 A;  5KDT B;  2AIX A;  1MXY A;  4NWC A;  1D9V A;  3B6T A;  4GVO A;  1FPK A;  4PF8 A;  3Q26 A;  4LQ2 A;  1B3G A;  1FPE A;  3FJM A;  4ONY A;  2NUV A;  2OWT A;  3PUZ E;  4IY5 A;  3T66 A;  2XWK A;  4JXI A;  2D21 A;  3MP1 A;  4NAP A;  1NUZ A;  4QSC A;  4PFR A;  2QMW A;  4NED A;  3EKI A;  4FAT A;  4JWO A;  2F8D A;  4O3C A;  4ELO A;  3MST A;  3CFX A;  2GHB A;  4OMB A;  2DSF A;  2O1M A;  3QAX A;  3OEK A;  1NNP A;  4QFN A;  4DDD A;  3TTR A;  4H8I A;  4NN3 A;  3FV2 A;  4MBP A;  1URD A;  3RYD A;  4M1V A;  4POX A;  1N3W A;  4NF5 B;  3FAT A;  4E0W A;  3CG1 A;  1PB8 A;  1XS5 A;  3FAS A;  4U21 A;  3THI A;  4NF8 B;  3K6X A;  3IL1 B;  1LB9 A;  1N0T A;  2B65 A;  3ILT B;  1MY0 A;  3IJX B;  3TTN A;  2XXX A;  1MM7 A;  2P3V A;  5T3J A;  4N81 A;  4OA4 A;  1UQW A;  2QFL A;  2Z8F A;  4OEV A;  2F6P A;  3IOV A;  2XXH A;  1LGB C;  3QUF A;  1IQ7 A;  4E0X A;  4JB7 A;  1B7Z A;  3SEY A;  1QKB A;  2V3U A;  2YLN A;  1O63 A;  4NF6 B;  4ZZE A;  4BDM A;  3GBA A;  4U1O A;  3O6G A;  1N7W A;  1LBY A;  3BKI B;  1XI6 A;  3KN8 A;  3CG3 A;  3VLV A;  1A8E A;  1B5J A;  1AIV A;  1B5I A;  4GRK A;  1OQG A;  4R72 A;  1DSN A;  4C1U A;  4EDP A;  5I5P A;  1PBP A;  5JTY A;  4NWD A;  1XOC A;  5HBC A;  3OSQ A;  4P1L A;  1LFI A;  1RKM A;  1BLF A;  4R2B A;  1Q1K A;  3CVG A;  4QFK A;  5I57 A;  1LAG E;  1CNQ A;  3H03 A;  1OVT A;  1IXG A;  5A5X B;  3K01 A;  2I4B A;  2PYY A;  4PQJ A;  4I9D A;  3FVG A;  1MY1 A;  3C31 A;  4IY6 A;  3IFA A;  1MXX A;  1I6A A;  1B4H A;  1HSE A;  3PMX A;  5K2X A;  1MY2 A;  3T9H B;  1FW0 A;  4P9K A;  3OO6 A;  1UTB A;  1Y9U A;  3BFU A;  3UOR A;  4U4S A;  4QFP A;  1QUJ A; 
#chains in the Genus database with same CATH homology
 1QGX A;  1FBC A;  1FPF A;  2L5V A;  1FBP A;  3QMF A;  3ROJ A;  3KC0 A;  4HE0 A;  3LUZ A;  2P3V A;  4P1E A;  5T3J A;  1K9Z A;  5CM6 A;  1EYJ A;  4N81 A;  3KC1 A;  4NHB A;  4OA4 A;  5J16 A;  1DCU A;  4MEV A;  3SZP A;  2QFL A;  4PC9 A;  1IMC A;  4N8G A;  2XXK A;  5I3S A;  5EYG A;  1AWB A;  4H45 A;  1SPI A;  4PGP A;  3D1R A;  4MX6 A;  4NG7 A;  1NV6 A;  2WBD A;  4GWW A;  4PGN A;  2XWV A;  2PFY A;  5EQ8 A;  3W9V A;  4MNP A;  2Y5L A;  5A5L A;  5I7I A;  1IMB A;  1FPJ A;  2WYK A;  4OVQ A;  4GWX A;  1FBH A;  4MCO A;  1Q9D A;  2XWO A;  2CZK A;  2ZZW A;  1FPG A;  4LN5 A;  4HE2 A;  1BK4 A;  1KZ8 A;  2PFZ A;  2ZZV A;  4OVS A;  4QBA A;  2HPG A;  2KQZ A;  1K9Y A;  5IZ3 A;  4GX3 A;  5ET6 A;  4PET A;  1YXI A;  2OX3 A;  1IMD A;  2FBP A;  4PFI A;  4I3Y A;  1RDZ A;  4PF6 A;  2HHM A;  1KA1 A;  3NOH A;  4HE1 A;  1FPK A;  3LV0 A;  1NUW A;  4OVT A;  4PDD A;  2WYP A;  2CEY A;  3GYY A;  1FJ6 A;  2HZL A;  4G61 A;  4PF8 A;  3T1B A;  1FBF A;  1LBX A;  2Q74 A;  1NV4 A;  2VT5 A;  4XEQ A;  5IZ1 A;  1FBE A;  1FPE A;  1NV7 A;  4F18 A;  1FBG A;  4MNC A;  3E78 A;  1NV3 A;  4GWU A;  1YZ0 A;  4FBP A;  2CZH A;  4KXP A;  1LBY A;  2B4L A;  4GBV A;  4HCY A;  4PFB A;  2MKZ A;  4N6K A;  1LEV A;  2KR0 A;  2XWK A;  2BJI A;  2DDK A;  3FBP A;  3FXB A;  4H46 A;  4N4U A;  4JVC A;  3RPL B;  3RPL A;  2DE4 A;  4NAP A;  1NUZ A;  2WEF A;  1XI6 A;  4F1U A;  5JK4 A;  1DK4 A;  5IM2 A;  2F3B A;  2FVZ A;  4DI4 B;  4HCW A;  4PBQ A;  4NX1 A;  5LDZ A;  1NV5 A;  1FPL A;  4IR8 A;  4PFR A;  4I40 A;  5IZ3 B;  4OAN A;  1NUY A;  1FTA A;  1NV2 A;  1EYK A;  1D9Q A;  4JVD A;  3KBZ A;  4N91 A;  5ET8 A;  5FBP A;  1KA0 A;  1EYI A;  4NQ8 A;  4PBH A;  2DVZ A;  1NI9 A;  4PCD A;  2B4M A;  1LBV A;  2WX9 A;  3EKI A;  4N8Y A;  2CEX A;  4P47 A;  1INP A;  2FHY A;  4GWY A;  4PTK A;  4XFE A;  3PTY A;  4F19 A;  3HFU A;  4NGU A;  3W9W A;  2DE2 A;  1FSA A;  1NUX A;  5EQ7 A;  2PCR A;  2HZK A;  4MIJ A;  4OVR A;  4O8M A;  4GWS A;  5ESY A;  4GBW A;  3A29 A;  1LBZ A;  4PAF A;  2P3N A;  3MST A;  4DI3 D;  5J1D A;  2OWZ A;  5DW8 A;  4NF0 A;  3E79 A;  5I5P A;  4JVI A;  4MMP A;  5IZZ A;  1NV1 A;  2QPQ A;  1G0H A;  3ISP A;  1IME A;  1JP4 A;  3BIH A;  4X9T A;  2XA5 A;  2FIX A;  3BIG A;  4GWZ A;  5EYH A;  2DE3 A;  4MAG A;  5EQ9 A;  1DBZ A;  3MYU A;  2GQ1 A;  1G0I A;  1IMA A;  3IFC A;  4P1L A;  4PAK A;  5LTC A;  5F24 A;  4OVP A;  4AS4 A;  4NN3 A;  4PDH A;  4AS5 A;  1FJ9 A;  4MJO A;  1FPB A;  1CNQ A;  4N6D A;  3T0J A;  1IMF A;  5EQA A;  2FIE A;  2R8T A;  2V3Q A;  2XWI A;  4X04 A;  3RYD A;  2HXR A;  2JJK A;  4M1V A;  1FRP A;  2VPN A;  4PE3 A;  4I3E A;  2ZZX A;  3B8B A;  1YYZ A;  4P3L A;  4XF5 A;  2F3D A;  2VPO A;  2WBB A;  4F1V A;  4X8R A;  3IFA A;  4QXD A;  1RDY A;  4GX4 A;  4MHF A;  2Q9T A;  1NV0 A;  2Q8M A;  3U65 A;  5ET5 A;  3B50 A;  4O7M A;  4O7I A;  5IGA A;  2CZI A;  2Y5K A;  4PAI A;  1FPI A;  1LBW A;  1FBD A;  4P9K A;  4YIC A;  2QVU A;  1RDX A;  4P56 A;  4YZZ A;  4HXV A;  2V4C A;  1VDW A;  2QVR A;  4N15 A;  5ET7 A;  1FPD A;  4GX6 A;  2QVV A;  2F5X A;  4MNI A;  4N17 A;  4P8B A;  3CHG A;  4O94 A;  4UAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...