4NX5A

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx5A00
1DJQA 5HQEA 3GB6A 4S2CA 4GRSA 3HMJG 4N9CA 1TREA 2C3ZA 3W2KA 1TTQA 5CG7A 4JTEA 5E0KA 3BGJA 3PUDA 3Q37A 4FNPA 5CZ0A 3W1XA 4P2VA 3CHVA 1B3OA 4LVFA 4O4WA 4OV4A 5HMSA 2QJGA 3ATZA 3O1NA 2GVLA 3GR8A 1S5WA 4MKNA 4MOZA 3TV8A 3O05A 3NQDA 5G1YA 3BG3A 3F1QA 1JCJA 3KRSA 4NNAA 3LI1A 1GEQA 5E1QA 1W3IA 4KFPA 3LXCA 3TC6A 3ABRA 4A21A 4Z0SA 3T44A 5IM51 1FDJA 1KM6A 1WOAA 5KTLA 1EEPA 2QCDB 5H2ZA 4BI7A 1Z41A 4LVBA 3TQVA 4NXKA 4LUIA 3DHDA 1ML1A 4NNBA 1R2SA 4O10A 4TX9A 3EWWA 1FXQA 4LWWA 1KV8A 3UWVA 3PM6A 1XL9A 1K7EA 1FDYA 1W5NA 1B9BA 1GYNA 4MY9A 3TCEA 1WOBA 4L4LA 1H1ZA 1OK4A 3STEA 3LCFA 4M7SA 4D2JA 3GKFA 2C15A 1SO4A 3NQ7A 1OYCA 2NUXA 4NZFA 3W7GA 4RZ4A 1TPFA 3R13A 3UWZA 2E6AA 4DQWA 1VS1A 2XN0A 2ALDA 2X30A 2QCDA 1F05A 5F4WA 1F6KA 4TR9A 2WNNA 4UTMA 3GYEA 1LM1A 2ZZ6A 3BW3A 5D03A 1LYXA 1GVQA 5AHMA 4MLJA 1OYAA 5DY2A 4DO6A 1H51A 3KRZA 3QFEA 2YYUA 1VYSX 4FX7A 4DF1A 5D2XA 1ZENA 4OE7A 5L6UA 2A6LA 5HR6A 4RR4A 4UTIA 1KM3A 2WV8A 3G8EA 4EF8A 3BG5A 3HQ1A 2QCFA 3W7OA 3FOKA 3CLMA 1GVFA 1HL2A 4OT7A 2O7QA 1FWNA 1GVRA 1H62A 1EPXA 2GOUA 2EHHA 2YGYA 2VFDA 4WQ6A 3FKKA 3M16A 1KM1A 4JN6A 1SZNA 4IX2A 2E09A 2CLOA 2NLIA 3W70A 4BWLC 2B7QA 3IGXA 4UMCA 1QO2A 5FF7A 3QYQA 4S1FA 1TQXA 3A22A 3W7CA 1GQNA 3TQ0A 3UPWA 1FDZA 5E93A 4JTGA 1IIHA 4Q32A 1DL3A 3HBLA 4HPJA 1WBHA 2O7SA 4C1KA 1ZAJA 1XCFA 4CLMA 3LCGA 4JICA 1X1ZA 5EKYA 5LZLA 2F84A 3SFKA 3W83A 3NPUA 3W87A 1Q6LA 2X1UA 1S5TA 3MHFA 3O6DA 4JTHA 4N9EA 4NJKA 4RZ6A 2PRLA 1QFEA 1H7XA 4LW7A 3B06A 3VE9A 1M7OA 1OX4A 4GC4A 2DORA 3T4CA 1UCWA 2WSRA 5DBUA 2A0NA 5F2MA 1LCOA 3HPSA 1OJXA 4WY0B 1VC4A 4UTKA 1I2QA 2J9ZA 3D0CA 3LDVA 4YL2A 5KMYA 2NUWA 5D37A 3F4NA 1S3HA 4JGDA 3KVLA 1SFJA 3H55A 4AHPA 5U7SA 3IIPA 4E2BA 8TIMA 3NOEA 1MEWA 5J5RA 4N4PA 1JUKA 2CWNA 3P7YA 3T78A 3GDTA 3I7SA 3M5ZA 4MJZA 2ZRYA 3LBMA 3L5AA 1Z44A 3O15A 1LBMA 1VH7A 2YZRA 4YLWA 3EX4A 5AFDA 1EWDA 1ICQA 3SJ3A 2B4GA 3DFSA 1MEIA 1I45A 2ZRUA 4RLIA 4ADSA 3M43A 1Z48A 1TPEA 1WXJA 3W22A 1LLZA 3LV5A 3GXTA 3W1NA 5HR7A 1QPRA 4Q4KA 3QJAA 3WK2A 2GUUA 4CQ8A 3OEXA 1OG0A 3LHYA 4FNTA 3LHVA 1SW7A 4UTWA 4PC8A 3THQA 1ONRA 3B0VC 1WBJA 1I2RA 1OVDA 3S0CA 5MHBA 3PB2A 3QZEA 4Y90A 4QAIA 3M41A 3MO7A 2B7OA 4H3DA 2NUYA 2VFHA 3W74A 2Z6JA 5ABTA 1H7PA 1SQ7A 2Y6ZA 2OT0A 3TMLA 5C55A 2LLEA 1XC4A 3HPZA 4JDYA 4MZ8A 5D2TA 4TMBA 3TW7A 4EWND 3BG9A 4YXGA 3GNDA 5D2VA 4UNLA 1EP1A 2PRHA 4R7JA 2QUVA 1FCVA 5CZTA 1KTCA 2Q8LA 4AH7A 5LNVA 1F7BA 4OU1A 3B8DA 2J27A 3IV3A 3CTLA 3L66A 2NX3A 3P62A 2J6XA 2Y63A 5GVJA 1H1YA 3CIWA 3GVGA 4YCPA 3DFOA 4M6QA 4K36A 3V1PA 1IGSA 2C6QA 3DFQA 4NUWA 2CFFA 3HGJA 3HG3A 5CSSA 5FEPA 3MW7A 1J2WA 4GFSA 3VNDA 5BRBA 3PUOA 4AHQA 3M5XA 4IMCA 3P67A 4FEZA 1I2PA 2YXGA 3B03A 1ZHAA 3L21A 3GLCA 2FPTA 4A3UA 1LORA 1ZNNA 4NJIA 4O1CA 3M5YA 2CZ5A 4M6PA 1LZOA 1QWGA 3ABOA 4ORIA 5HJLA 3LCLA 3FS2A 5D32A 4K7VA 5K9CA 2V30A 1VCGA 1WQ5A 5LHFA 3L68A 1LTDA 1G67A 1TPDA 1C29A 3HIJA 3W86A 2IQTA 2DZPA 1UUMA 2Q8ZA 3EX2A 2VEKA 4RXFA 4RKAA 1XKYA 3IRDA 5F4XA 3MUXA 5DXXA 2JGQA 4X22A 1VR6A 1FUYA 3LHTA 5J5DA 1YLVA 1H61A 2PRMA 1XFBA 2YFOA 3NZ1A 1K7FA 3T7VA 3MI2A 4JIQA 4NXSA 1TYGA 5G1TA 4XBKA 4HNTA 3FJLA 3LRKA 2C0AA 4AMAA 2Z2UA 2ISVA 4WY0F 2RDUA 1LLWA 1XXXA 3M5VA 4IWWA 4O52A 4BK9A 4ZQNA 1BWLA 4NVTA 3NAVA 2WPBA 1LOQA 3T40A 3ABSA 3SR7A 4O1AA 1OX6A 5DCBA 3HJZA 3W1LA 4LRSA 1AK5A 3W2UA 3BK0A 1KTBA 4O18A 2A7PA 3S1VA 2DJLA 4UTUA 1UBSA 5FF3A 3W1UA 3W3OA 1YDOA 1SR9A 3GDKA 5H91A 4MFEA 1AW5A 3W1AA 4O8RA 3G3DA 3SY5A 3OVQA 1C9DA 3PBVA 4GE8A 3HG4A 3WJZA 4MJMA 1TPVA 5A8GA 4IJBA 5D2YA 6TIMA 3NQGA 3EB2A 2FB3A 1SUXA 2P1FA 1K02A 3C3NA 4QSHA 3NQVA 2TRSA 3LTPA 3PS7A 3KRUA 1R30A 3A5VA 2ZQ0A 1YDVA 4LNYA 3EXRA 4WZHA 1W3NA 5SWUA 1TCDA 3IIZA 4DELA 3NL2A 4M5PA 1A5AA 3UWQA 3EWBX 4ZQPA 3BARA 3TJXA 3PVFA 3EKZA 1Q6QA 4JTTA 3SSJA 2V5LA 4DF2A 1DHPA 4RV8A 4XWUA 2ZZ2A 3IIXA 2GQ8A 4YMZA 4UMBA 3QC3A 3E96A 1TPH1 5EMUA 3P74A 2XN1A 4QNEA 2HS8A 3JRKA 3L0NA 2FPVA 4UTHA 3BVJA 3EEGA 2WOQA 1XUUA 1DJNA 1LBLA 1PV8A 3B0PA 4LS1A 1UJPA 2YW4A 1KBIA 4UTTA 2ZZ4A 2FTPA 3BPWA 2Q3OA 5DBTA 3LX9A 4UR7A 1OF6A 1ZFJA 3O63A 1LRQA 3KVKA 4ZVJA 3H53A 4O13A 5C5YA 1CX9A 1QMLA 1W5PA 4LC8A 5DN1A 2FDSA 2A85A 4X2RA 2ZTJA 2G5WA 3TAKA 2VC6A 4ADTA 1MSSA 1UUOA 1JUEA 1Z42A 2QCGA 1XM3A 1OFRA 3C2EA 2QDGA 1JQVA 3FFSA 3CWOX 4O1BA 4FF7A 5AHIA 1P0KA 2WQPA 4WXZA 4JS3A 1ADOA 2YSWA 2J9XA 1QCWA 1HTIA 1TB3A 3FJ6A 4OWGA 1TRDA 4O16A 3DU0A 3O6CA 3UQNA 3PWAA 4FIQA 3VI2A 3MHGA 3TMQA 4I7WA 4O53A 4XZ9A 2V2HA 2RHGA 3WJYA 4IOTA 3UY7A 4YCOA 4UTLA 1GVSA 3PF3A 1PHQA 1XBXA 4DPQA 1GZGA 1KFLA 1K8ZA 1KLZA 3W23A 1WDWA 5CSRA 3NPVA 3CU2A 1QAPA 4N2YA 3NQ8A 3JS3A 3M6YA 2A4AA 5EYWA 1GJPA 3UYCA 3TSMA 2Y7FA 4MZYA 3VFLA 3QM3A 1YPFA 2E6DA 3W76A 3UZJA 2WSYA 2RKXA 3FKRA 2E1DA 3WK0A 1K03A 2E77A 3L0KA 4NJGA 4OGZA 4RCXA 3RK8A 1OFAA 3UXAA 4CNNA 4O11A 2FIQA 1SZFA 3G1DA 1ALDA 3S9YA 3BO9A 4MY1A 4FXRA 4AAJA 3C2FA 1QOPA 2VFFA 4JXCA 1ZAHA 3F4WA 2Y7GA 4JR5A 3FA5A 1H7NA 1XBZA 3NDOA 2NV2A 4JTSA 3IEBA 5K9XA 5AB3A 7TIMA 4AXKA 5DCDA 1TRIA 1ME8A 3W7EA 2ZYFA 5CPMA 4FX6M 1QNVA 4N9BA 4NT0A 4O4VA 4Y8FA 3K30A 1ZALA 3TSBA 4AVFA 3TXVA 4DBDA 1KV5A 1DKWA 4QITA 3I68A 3S5NA 5CKSA 3P60A 1KFBA 3RMJA 3NG3A 1OABA 1W3TA 4LS2A 3ANYA 4O28A 2YX0A 5D2WA 1VGAA 3NQ6A 1W37A 4M19A 4HNUA 5EPDA 2ZRWA 4IQLA 3LCWA 4JEQA 3W7IA 3KVMA 4NJHA 5HINA 1W0MA 1WYIA 5G4WA 4JX6A 1V5XA 4HT3A 4OBTA 3LTYA 1O4UA 3L65A 4H4IA 4IMGA 3W6YA 3GR7A 5C6MA 2H8ZA 3NXFA 3NR0A 1DQXA 3PUEA 4RXGA 3NPXA 3WJSA 1MXSA 3CEPA 3HGSA 1B57A 2ZA3A 1TTJA 5LSMA 5K4XA 6ALDA 4UCGA 4FHAA 5K4ZA 1QDSA 4GUGA 4ONVA 2J88A 1FY6A 4POCA 1GG0A 3TE9A 2A5HA 3PSVA 4HSNA 3A9IA 3NL3A 4KWWA 4GUFA 2EPHA 3RF9A 3GXPA 3N14A 3HPXA 2AQWA 3VE7A 2ZZ3A 2ZZ7A 2NWRA 4Y9AA 2WNZA 1JVNA 1OYBA 2VEIA 4UIOA 5FEXA 3W7JA 2CLEA 2WO5A 1GVOA 2A7NA 1YXYA 4IMFA 2ZZ5A 3NL6A 3E9AA 3S5YA 2CZFA 3WJXA 3G1XA 4G1KA 4JIPA 3TQKA 1GOXA 2Y7DA 5F1VA 3N73A 1QPQA 1Y0EA 5AC8A 4Y96A 2B7NA 3QRHA 5CGQA 3BLIA 4Z1AA 5FEWA 1NF7A 2Y89A 1PL9A 2W6RA 2R91A 2H6RA 3W2MA 1I2OA 3CT7A 5D09A 1A53A 1IXQA 1YYAA 2HS6A 3EX1A 4I7VA 4IXXA 4O1DA 2TMDA 3UWWA 1KBJA 3TA6A 1DVJA 1KFCA 1E51A 3C56A 3LHUA 2GPTA 5IBXC 5AHFA 3ZWTA 5BMWA 3QEZA 3UNDA 2P10A 1EB3A 2YW3A 3SI9A 5TBOA 2ZRZA 4DPPA 2VEPA 2C1HA 4O12A 1F76A 1M6JA 3ATYA 5FI8A 1O94A 3LV6A 5G4EA 5BW6A 1QPOA 3MBFA 1XDMA 3MHUA 3R2GA 2W0UA 1VQTA 3LXAA 1N7KA 3EX3A 5CPNA 3ABQA 3S6DA 3DKJA 2ZBTA 4UUIA 4AEOA 5F2IA 1TV7A 3CM4A 3M1ZA 3BW2A 4L4MA 3C4UA 2WKJA 1G4EA 1ZCOA 1T96A 2FFCA 4OHQA 5AC6A 2VXNA 1ME9A 1HG3A 3PB0A 5IBXA 3RFAA 1YDNA 5C54A 1TJRA 3W9ZA 2OMAA 4K8EA 1FWSA 4EIVA 2VELA 4AWUA 1LOSA 3W7DA 2I14A 4KKXA 2QEZA 5T26A 3DAQA 3F03K 1TV8A 4TIMA 3R8RA 3UY8A 4AF0B 2XN2A 4NX5A 1A5SA 4QJ1A 1OFDA 1SU5A 1RPXA 1VHNA 2DZUA 1BTMA 3STFA 2VENA 4JYEA 4O0ZA 3QPZA 1D3HA 1JRBA 1RQHA 2CLHA 2JBMA 3C61A 2X1RA 3G1AA 3N2XA 1GYLA 3S1UA 4HHPA 3LCIA 2QUUA 3SIZA 3KAOA 4JX5A 4A22A 2UV8G 2YDAA 4MY8A 2A2IA 4U28A 3CC1A 4BF9A 3QSTA 4ZQOA 2ABBA 4IXHA 5TIMA 4QNWA 2WJZA 4Z08A 3NQCA 5AOUA 3P5ZA 5FF0A 1NEYA 3O07A 2AAMA 4AF0A 1VLIA 3P81A 2QAFA 2EKCA 3HGRA 3W7LA 1WV2A 1IXPA 2PURA 5AHLA 3C0JA 4I9AA 3TFXA 4R34A 3W84A 1JCNA 4B5NA 3L9CA 4JYFA 3DI0A 5D38A 5EY5A 2ZCGA 5CZSA 2V82A 3QSRA 3DH7A 4J9JA 1VPXA 1GWJA 1X7FA 4IUOA 4Y6GA 5DCEA 2YPIA 4HKPA 2HSAA 2J24A 5D30A 4LUJA 3TUUA 1KFKA 3NL5A 1H50A 2YFNA 1L6YA 3Q2DA 4NU7A 1T0OA 5G2HA 3L0GA 3TR2A 3DHFA 4WUIA 2QF7A 1LBFA 3W7HA 2H90A 3G0SA 4X3ZA 3PBUA 5FF2A 2GQAA 2GJLA 3NGJA 2QCNA 4QQ3A 1JULA 1H5YA 4GWEA 1A50A 4ZQRA 4IPJA 4LY8A 1I2NA 4PCFA 1SO6A 2JGYA 4EF9A 4JTUA 4JYDA 5HWMA 1TSIA 3LGEA 1S5VA 3L5MA 3P8IA 3DZ1A 2WNQA 1TJPA 2Y88A 4Q33A 1H7RA 1P1XA 3DBPA 2C18A 1BKSA 1AL7A 2EAWA 4ML9A 3ZR4A 3W7QA 4MLRA 2NXHA 1TPC1 1KW1A 2NV1A 1SZEA 2C13A 3LB0A 2ATMA 4ADUA 2ATSA 2ABAA 1X8FA 1TO3A 5LGZA 2HMCA 2Y61A 3CIXA 4IGHA 3WJWA 2QKFA 1BEUA 2EGZA 4XKYA 3C6CA 4K38A 5G2IA 1D9EA 1YTKA 5I3FA 2R94A 4FNQA 3TK7A 4AB4A 3G3MA 3QF0A 4YWIA 4AWTA 1F2JA 3KVJA 4UFKA 4LU0A 3USBA 1XBVA 4RX0A 3B4UA 3SGZA 2E5DA 3P80A 4UMAA 5D33A 1L6SA 1NVMA 2FJKA 4FXSA 4ORMA 2RDTA 1P4CA 2E68A 3EWXA 2TSYA 1FCUA 1IF2A 3PC0A 3W7NA 1TTIA 5HUPA 5DELA 5I3GA 4O17A 2RFGA 1EA0A 1RQBA 1GT8A 1G6CA 3M47A 4LRTA 3HGOA 3QH2A 1FQ0A 5D04C 4UNKA 3W1QA 2C16A 3DFNA 4O50A 1C8VA 1YPIA 2ZZ1A 2W79A 3OHIA 3EWZA 3P82A 3AO0A 3GXNA 1F73A 3S1WA 2Z0IA 3WK3A 3W1RA 1MO0A 3O16A 4WOQA 5K9DA 3LXBA 1XUZA 4LS0A 3M0ZA 3QW4B 1I8JA 3N9RA 3C2VA 4MYAA 1ZY9A 3QQ1A 3N34A 2C19A 4E38A 1U83A 2X1SA 4IMEA 3GDLA 3G1FA 5AN7A 3SW6A 2ZA1A 1F6PA 1R2RA 1W8SA 3IIOA 3EXTA 4TO8A 3VKJA 3PG9A 1LDCA 4K37A 2X2GA 1TPUA 2NX9A 1PE1A 2HTMA 2Y70A 1YXDA 4GXMA 1HFBA 2Z1BA 1FWRA 1HO1A 3FLUA 4N6EA 4PL2A 5AYXA 1G69A 3UZ5A 3G24A 4RK8A 2I1OA 1K8XA 3TXZA 4XTDA 2A7RA 5TQLA 3HOJA 1L2UA 3MYOA 5LKYA 1OFEA 3GNNA 4PTNA 3W73A 4BFAA 4NQ1A 1RVGA 2YR1A 3HF3A 3CWNA 1UB3A 2ZA2A 4XBSA 1F74A 1I4NA 2G95A 2X16A 4RZ5A 3NM1A 4EVZA 2QCEA 3QW3A 1W5MA 4UFIA 4XTIA 3U8GA 3NM3A 3SGUA 3TX9A 5KITA 4LVAA 1WA3A 1WAUA 3DGRA 3ZFHA 2EF9A 2TYSA 1QPNA 3DI1A 1W5QA 3Q94A 1VCFA 3QQ0A 1PCKA 3INPA 4BR1A 2CW6A 4FNUA 1VYPX 4XUGA 2G96A 2BLEA 1SO5A 1SW3A 1KM2A 4XQ6A 3DFTA 3IGSA 1YTDA 5KZEA 3KHJA 4A2RA 2H3DA 2DU2A 1XI3A 3IVTA 1VZWA 1TPB1 2GQ9A 3W7MA 2BXVA 2YYTA 3LRMA 1DORA 3KOFA 3NEVA 3M7WA 4JTKA 5BNKA 4Z0JA 3W7RA 4ALDA 2OCZA 4DF0A 3A24A 1XBYA 3OBKA 4ZQCA 2VFGA 4EOUA 3LHWA 1AW2A 4UTJA 1R47A 1TPWA 1XDLA 4UC5A 1TTPA 2VEMA 2CLKA 2OZ0A 4MZ1A 2V9DA 1OFOA 2QUTA 3UWUA 4ICNA 2V2DA 3TU9A 2PE4A 2CU0A 1K3UA 4FX8A 1ME7A 4Z1CA 2DZXA 3RLVA 1CI1A 3GIYA 3LCHA 5DY3A 3NYZA 3KX6A 2TPSA 3W1MA 1T99A 2B0MA 2JKPA 1EX5A 3DENA 2FB2A 3EWUA 4O15A 2ZFAA 4HSOA 2G97A 3LBCA 1RR2A 4FO4A 4O0KA 4N4QA 4GUJA 2C14A 3PAJA 3NQAA 5FF4A 1AMKA 2QDHA 1W31A 1EUAA 3NA8A 4FNRA 4MPQA 5K3VA 4GJ1A 4OV9A 1O95A 5CPLA 2AGKA 3JR2A 3EKLA 1Q6RA 4JY9A 4TU1A 5F2GA 4LOCA 2FLIA 4CCDA 3CQ0A 3RLUA 1A5CA 5HWJA 3Q58A 3DFPA 4JTJA 3NVTA 4E0CA 4QM1A 1N8FA 2Q3RA 4JDBA 1PHWA 1GTEA 1LP6A 3TFCA 3MI3A 2FPYA 3QMSA 4WD0A 3RU6A 1NFBA 3L67A 3A5FA 2RH9A 2DZSA 2V8ZA 4QIUA 3LTSA 3G1VA 3UWYA 1NF0A 3GK0A 1FXPA 2BSLA 4HPXA 1TMHA 4DXVA 4S2BA 3BLFA 4BWLA 1GPWA 4KFNA 1PIIA 3PR2A 3FIGA 5KZDA 1FWTA 5F4SA 3LI0A 2PC4A 1OK6A 1EUNA 1PCWA 3W88A 3C52A 3UXDA 1A5BA 1JRCA 3IIVA 5C2XA 1O5KA 3H54A 1YADA 3DKLA 3TAOA 3MP3A 3EX6A 1KM0A 2FQIA 1LRNA 2GVGA 1JCXA 1FBAA 4NZJA 3SECA 1H7WA 3LCXA 3NQFA 3B04A 1L6WA 2ISWA 1OFQA 1RD5A 4JNMA 4ZQMA 4UFHA 4GUIA 1OFBA 5D05A 4ZMGA 2YCEA 1K8YA 1Q3NA 1SSGA 5HULA 1AL8A 2VFEA 3BW4A 3B0UX 4CQAA 3RNDA 4UFJA 1G4TA 1X6UA 1W56A 1R2TA 1F5ZA 3LOTA 3MP4A 5BOOA 4GNJA 2CLMA 4CCEA 1Q45A 5A5WA 3W7PA 2GVJA 4R53A 1RQEA 3LLFA 4K8HA 3YPIA 4BI5A 3UPBA 1VJIA 4MUZA 5LGXA 5LNUA 2A21A 3PULA 3VCRA 3TKFA 2V5BA 4K39A 3LLDA 2Y62A 4IX0A 4N6FA 1R46A 1HUVA 3TC7A 4CQ9A 1LRTA 1J5TA 1TV5A 3P61A 1ZJIA 2ISSA 1G4PA 1DV7A 1KM5A 3I7QA 4QISA 5FESA 3G1HA 1ZAIA 1VHCA 3PY2A 3IVSA 4DBEA 2CLLA 4PFMA 4ZZ9A 3BLEA 1OX4B 1VCVA 1PVNA 1G4SA 3R12A 2DP3A 3E02A 5F1UA 3E0IA 2R14A 4JX4A 3L2IA 3GDRA 2VFIA 4LVGA 5AC7A 2QJHA 1B4EA 5CZJA 4OQVA 3TW6A 1OFPA 3E12A 3NZRA 3W1PA 2D73A 3NNTA 2A6NA 2ZRXA 3GX9A 1LROA 3A23A 2ZTKA 4UFMA 3FYOA 1BWKA 3PG8A 5HNRA 1SSDA 4PEKA 1NSJA 3P84A 3N3MA 3NQEA 2BWGA 4KFOA 4JY8A 4WX2A 3PBYA 1CW2A 3GAYA 3A21A 4PH6A 4R33A 5KINA 4N02A 4O57A 3N9SA 3W72A 1KFJA 2JKAA 3MMTA 1GTHA 4UXDA 4X9SA 3NQ2A 3NPWA 2NZLA 1L9WA 3W75A 2P0OA 3TNOA 2CZEA 1YTEA 1EP2A 5KZMA 4O54A 5FEZA 3L5LA 3S42A 4BI6A 2WSQA 4K7YA 1PS9A 3U6WA 1AG1O 3OVRA 3LM7A 3W85A 3S5ZA 1JQXA 4KWVA 5EA9A 5D02A 3GDMA 4LC6A 4WOZA 1X1OA 3OG3A 3MYPA 3TSDA 3GZ3A 1M7PA 3N2MA 4WJEA 3IGUA 4RJEA 1Q6OA 1G7UA 3C2RA 1IIGA 3G18A 3OA3A 5BMXA 1OHLA 2RDWA 4O14A 3THAA 3G0XA 1B4KA 4IMDA 4DO4A 2NWSA 1N55A 2ZRVA 4MVAA 4C1LA 3N19B 5I3KA 2NXIA 3O6YX 4LV4A 1FCBA 4CNPA 3NO5A 2OJPA 3TJLA 2DZTA 1NAL1 1VLWA 1SPQA 5DLCA 2JK2A 2QCHA 3LRLA 3PBWA 3ZS4A 1TIMA 2QCCA 4PODA 4FB7A 3I7RA 3MBDA 3QPYA 1H60A 5I3JA 3G0UA 4AWSA 3HG5A 4I7UA 3KXQA 3IVUA 4P61A 4IPIA 1G7VA 3BGGA 4NX0A 1TQJA 1QR7A 2V81A 3W2JA 5AHNA 4ZL1A 3EXSA 3G22A 4PA8A 2J9YA 2E6YA 4CCCA 1W1ZA 1UASA 5CPOA 2PCQA 2JKEA 2ZDRA 3W2NA 4M7TA 1M5WA 4MFDA 2A1YA 2X1TA 3W71A 3W7KA 3HO8A 4JTIA 1SW0A 2H8XA 4DO5A 3V75A 1J4EA 3I6RA 1EWEA 3CPRA 2DJXA 4DEFA 3R89A 1O60A 3P8JA 1O5XA 3G1SA 1KM4A 3S8HA 3I65A 3GKAA 3R5EA 2BX7A 1AW1A 1QOQA 1DBTA 1IXNA 3PSWA 3TROA 3MJYA 2XFWA 4GBUA 3WFAA 5U4NA 4LV9A 3S1XA 2KZHA 1T8XA 3HG2A 1ICPA 1OX5A 3FEMA 4LT9A 1KLYA 5G2WA 3FYPA 3O8AA 4NJJA 3TH6A 1JCMP 5L9FA 2I9EA 3M9YA 5HWNA 2NX1A 1SO3A 1VRDA 4M6VA 1YXCA 3MI6A 1FWWA 1KFEA 2DZWA 2BZNA 4O19A 3MP5A 2F7FA 4XKYB 3AJXA 2E5CA 3CB8A 5LNWA 1EP3A 4CNOA 4NNCA 2R8WA 5I3IA 3UD6A 4TMCA 1JCYA 3S5OA 4LVDA 1JJKA 5AHEA 3C2OA 3G1YA 1P5BA 5LNRA 4E2DA 2QAPA 1W5OA 1MEHA 4GUHA 4HN4A 3CEUA 3HB9A 1P0NA 3DXIA 1DOSA 3SZ8A 1GG1A 1K7XA 3C8FA 5LNSA 4WXYA 4U4MA 4UFLA 2H3BA 3STCA 4FIRA 4MIMA 5KSWA 3T55A 1V7YA 2VOMA 4HNNA 4PL1A 3LERA 2Y7EA 4LTSA 1VYRA 3OIXA 2DZVA 3WK1A 3MWAA 4FNSA 1IXOA 4A2SA 3E49A 4Z1DA 2QJIA 2E6FA 2CLIA 3BV4A 4MYXA 2VKZG 5AYYA 2Y85A 2QR6A 2B7PA 2GJNA 1WX0A 1OF8A 1KTNA 2V0TA 1RV8A 3ZWSA 4W9TA 3GAKA 3LHZA 2OT1A 5EBUA 3M44A 1RZMA 3U2OA 4AHOA 1H7OA 3W1TA 1DQWA 4H6KA 1D3GA 1THFD 2QCMA 1JCLA 1JR1A 3QMRA 4UTTC 3QMTA 3KFTA 2QCLA 5K7JA 1W54A 1JUBA 5I3HA 1EIXA 2E5BA 5F2LA 1FCQA 1SZGA 3EWYA 4HIBA 1FX6A 1KA9F 4UR8A 5LHEA 2CZDA 4UTWC 3OVPA 3G8RA 3W07A 3P5YA 4K6AA 5G5IA 3B05A 2NXGA 3TDFA 2BTMA 5DXYA 3NQMA 1H63A 4JD4A 1U5JA 4HNVA 4A29A 1ICSA 3O06A 2Z6IA 1MZHA 4JTFA 3STGA 2CLFA 1SFLA 1HO4A 2OX1A 5EL1A 5AYZA 5HUOA 4Z1BA 3TIMA 1LOLA 1QO5A 3W2LA 4WY0A 5K2ZA 4N9DA 4JTLA 3ELFA 2V2CA
chains in the Genus database with same CATH superfamily
1HKWA 3H6OA 4NZ1A 3UGRA 3ONCA 1TKKA 5T91A 3VOGA 3HMJG 4DM1A 4GI8A 1TREA 1Q7ZA 2CWXA 2ZIDA 4JTEA 3BGJA 4YTTA 7A3HA 3PUDA 4P2VA 1XLJA 1AQFA 2ZVIA 1RK5A 3GSMA 2DIKA 1EO7A 3GUWA 2WWCA 2GVLA 3KOYA 4MKNA 3O05A 1LF1A 2VC7A 1GEQA 2OGJA 5E1QA 3KL3A 3ABRA 1VP5A 5E70A 4Z0SA 5IM51 3N4FA 1FDJA 1KCXA 1WOAA 2J25A 4DBUA 3AS3A 1JEZA 3CV1A 4AVOA 5H2ZA 4XB3A 1JZ4A 5BU6A 3MANA 1KXHA 1V6WA 1PKYA 4O10A 4AU0A 1GCYA 3S83A 2PPGA 1DJIA 2PU1A 2DUAA 3TP4A 4H9UA 3LNMA 5HJXA 3PM6A 1W5NA 4DWDA 1BD0A 2PDGA 3B3DA 3R11A 3LCFA 3B40A 2PDKA 3MJMA 4NKCA 2OQLA 2C15A 4D6EA 1Q8AA 1P0DA 1SO4A 3ITXA 1JXJA 1D8CA 4NZFA 4DAIA 4WVXA 1GNXA 2E6AA 5F4WA 2X30A 1XLMA 4H9VA 5CBIA 4L6DA 4TR9A 1PJ9A 1LM1A 4QJ3B 3WLTA 1DIEA 2PWFA 1LYXA 3CQIA 2VR4A 1FKXA 1E3XA 3N3TA 4EPEC 2UY2A 4FX7A 3PTDA 1ZENA 5HR6A 4UTIA 2DGAA 2WV8A 3K1DA 3BG5A 3I10A 3AS0A 3EGJA 2QCFA 4XZLX 5AYBA 3EBVA 1FWNA 3CZ8A 4ZOAA 1H62A 2NT0A 4ZSUA 4AEEA 3M0IA 3RPMA 1P7TB 1RSCA 3GH7A 1ZJHA 2VL4A 3M16A 3TOYA 1SZNA 3EDFA 3W70A 4DWSB 1W3KA 4C91A 3LN3A 1F4AA 1TQXA 4GZEA 1GQNA 1BKHA 3TQ0A 2EG7A 3UPWA 5JU6A 4JTGA 1MQQA 3WMBA 4C6KA 2WVTA 1PIGA 1ZAJA 4CLMA 4JQ2A 3NPUA 3QC0A 4Q4QA 4LPCA 4E4UA 3AC0A 3PZOA 2PRLA 1QFEA 1BYBA 4V1XA 4I5XA 4IPLA 2AQVA 4GCXA 1KD0A 2AOSA 1VIWA 2JIWA 4LGXA 5DBUA 3AUJA 5F2MA 1LCOA 3HPSA 1VFLA 1RCQA 4IG2B 3AHVA 5CSYA 4Y8EA 3OLIA 1CENA 5DO8A 3LDVA 5KMYA 2G37A 2GDVA 3XISA 2O0TA 4YTRA 1S3HA 3H55A 2BGNE 1EXPA 8TIMA 4U2YA 2XIIA 4DO7A 1LQAA 2W66A 1FHVA 3GUGA 1XQLA 3M5ZA 4MJZA 2BVYA 3LBMA 4F2BA 4YHEA 2DT0A 2WC7A 2X09A 3EX4A 2ZOXA 3MUAA 3VXGA 2YA0A 3D46A 1CLKA 1KO0A 3M43A 4M24A 3OIHA 1WXJA 4PR4A 3LV5A 3K8LA 4CN4A 5IFPA 4CEXC 2ACQA 1QW9A 3UPMA 1IHIA 1E73M 3ARUA 1GUVA 3LYEA 3OEXA 1OG0A 1W9BM 4FNTA 5JMUA 4JTQA 2OYKA 3THQA 2VDIA 4AD1A 4HU3A 4U3CA 1OVDA 3S0CA 3WQCA 3QZEA 5DMLA 2DSWA 1KGXA 3MO7A 4OECA 4BCEA 1V0LA 2VMFA 2E8YA 4F0LA 2LLEA 3VD4A 4JDYA 2PA6A 1CT5A 4TMBA 1J0YA 1UD3A 3VM5A 3GG0A 4AY1A 1X97A 1EP1A 3M64A 2PRHA 4PTMA 4B2DA 2ZE3A 2Q8LA 4AH7A 4GMEA 1F7BA 5CLWA 3GVGA 4YCPA 4M6QA 4K36A 3V1PA 1DTNA 2C6QA 1B30A 2WMFA 3ZT6A 4C6FA 3MW7A 4DJDA 4OFCA 2WCGA 1NM9A 3N29A 2DQWA 3VGFA 4QG9A 3FDKA 4NF7A 2WHKA 4X61A 1K4GA 1Y5VA 2DSVA 3AIQA 2OYMA 2FHFA 5A6JA 4A3UA 1ZNNA 4NJIA 2CZ5A 1PZ1A 4ORIA 4RL3A 1VFMA 1VKFA 4PMQA 1IV8A 3FS2A 5IXEA 3JUGA 4AZ6A 5LHFA 5EB8A 2IQTA 2JE8A 2Q8ZA 1UUMA 3EX2A 3SUVA 1XKYA 2I57A 3DG3A 4F2TA 3HFTA 3KZPA 4PMVA 4X22A 2X7VA 3LHTA 3W53A 3PPGA 3NZ1A 1JNEA 5JIPA 1F4HA 1H49A 2PWHA 3FJLA 2C0AA 4XX6A 2PLCA 1XINA 2Z2UA 4J3WA 3LQLA 1UZHA 3WNPA 5FJRA 2ISVA 2RDUA 1LLWA 1DWIM 4KESA 3UCQA 3CYVA 4V27A 1EJRC 2VWSA 1VAHA 2ALRA 5DCBA 1QW8A 2PSNA 1TZZA 4LAMA 1YBQA 4O18A 2A7PA 3S1VA 2DJLA 2JF6A 4MNJA 4HA0A 2QJNA 2AMXA 1GORA 2R6OA 5CJNA 3W1UA 4XK2A 1IZJA 3JZEA 4S38A 4W8BA 4CNTA 3PBVA 4GE8A 3VOIA 1F3EA 2P3ZA 4MJMA 5D2YA 4M81A 3AQUA 3NQGA 4U10A 1SUXA 2DIEA 1HJQA 4JQ4A 4DVOA 3C3NA 3NQVA 1F6YA 2QPXA 4H1ZA 1ZU8A 1R30A 1BTCA 2BB0A 2ZQ0A 3A5VA 4YN5A 4GZ7A 1I60A 2DV0A 2QIIA 2W91A 3IIZA 3EDJA 3NL2A 1GOKA 3EWBX 3BARA 4CN6A 3EKZA 4JTTA 3SSJA 3NYDA 4LH8A 3WQGA 2NSOA 2GQ8A 1XG4A 2ZKMX 3LZ5A 3E96A 4NSBA 2XN1A 5LYRA 4ZEPA 2OQYA 3EDDA 3BJFA 4UTHA 4GLEA 2YB4A 4LCSA 4B2DD 4GQRA 5XINA 4CD5A 3GRIA 4AY7A 3GWQA 3ARQA 5C70A 3LUTA 3KW3A 3S2CA 1A5UA 3LX9A 1OF6A 4LBSA 1A0CA 1ONWA 4O13A 4F0HA 3SRFA 2WBKA 4HBKA 4LC8A 2WJEA 5REQB 3SFWA 2ZTJA 3TAKA 4ADTA 2XDFA 3H7UA 4GYJA 1R3VA 1JUEA 2XFYA 3T8QA 2I56A 1R87A 3C2EA 1Q2RA 2QDGA 1JF6A 3E0FA 4CD6A 3WD1A 4BF5A 3N13A 4JS3A 3GFYA 4NRRA 3DFHA 4HCLA 3WKZA 1TB3A 1RP9A 3AXHA 6XIAA 2BS9A 3N2CA 3UQNA 4J7RA 4FIQA 3VI2A 2V2HA 1WDDA 1R3TA 4KEVA 4ROQA 4LAKA 3G77A 4UTLA 1XBXA 4DPQA 2DH2A 5JBEA 4HPHA 1KFLA 1EZ2A 1WDWA 3GTFA 2HPMA 2PGFA 3JS3A 3QTPA 2J13A 2V3EA 5EYWA 3UYCA 2Y7FA 3BOFA 3O2LA 4MZYA 3VFLA 4LXFA 1YPFA 3PK7A 3MVIA 4G6CA 1G1YA 1ISZA 3WDIA 2XYLA 3L0KA 5A6BD 4O11A 4RV3A 6REQB 1SZFA 3G1DA 2VM8A 1GQLA 1XD1A 4B16A 4FXRA 2W4XA 1XLIA 2E3ZA 2ZX9A 3GE7A 3PTQA 4AX7A 6PTDA 1QBAA 1XBZA 7REQB 1SFTA 3AXXA 3A4AA 5H8UA 2WW5A 3AJ7A 2TAAA 2XG9A 2D2OA 2VCAA 2XVKA 3UVIA 3CUHA 7TIMA 2VC5A 3WLOA 3W7EA 4FX6M 4N9BA 3K30A 3EYPA 1W8GA 4H6RA 2HISA 4DBDA 4D6DA 1KV5A 1R9ZA 2DZBA 1MXGA 4D72A 3QLLA 3RMJA 2VD9A 4C6DA 1WZLA 2EO7A 4I5UA 4PCTA 2Z4GA 2YX0A 4GH1A 5A2CA 4M19A 3UJ2A 4HNUA 2V5DA 4IFKB 3LCWA 3WF1A 4N7QA 3KVMA 3UCCA 3KEHA 4YVVA 5D9PA 1M04A 1QT1A 2P5NA 3W6YA 4IMGA 3GR7A 2WHLA 3WJSA 1MXSA 4YTQA 1VFTA 1SJAA 2ZA3A 1TTJA 3QHMA 5K4XA 1KFWA 2UY3A 1S5MA 2P0IA 4FHAA 1P48A 3XINA 4DJFA 1FY6A 1XYBA 2YBUA 1GG0A 3A9IA 3T9PA 2EPHA 3UZZA 2AQWA 3VE7A 5M5DA 4Y9AA 3T0AA 3BOXA 1OYBA 1UOKA 3QR1A 3NOYA 3TYEA 3BSHA 2A7NA 5C0QA 4QSFA 1YX1A 4QE5A 3AS2A 4EXQA 4HA3A 1NWTA 1KGWA 2FVMA 5AC8A 1FP9A 2BOGX 1NTHA 3QRHA 3TYBA 1NF7A 3V36A 2R91A 2H6RA 1VFUA 3W2MA 1A47A 2J66A 4K3ZA 3URAA 2BDQA 3CT7A 2JF7A 3MY9A 2PMQA 1IXQA 1HJWA 3WCZA 3TJ4A 4IXXA 3IS4A 3AFBA 5TD4A 4S3AA 4MAVA 1KBJA 4PBFA 2F61A 1E51A 1R7OA 3LHUA 4AEFA 2GPTA 2PI6A 3NZGA 4P5UA 2PFHA 3ZWTA 1KBBA 3PJUA 4S3JA 3IJ8A 2YW3A 1S1PA 5TBOA 1XSIA 1CWYA 1GJWA 4DPPA 4LSBA 3VX0A 3WUBA 2X0SA 2J7GA 4BS0A 1F3WA 3ATYA 5FI8A 1XCWA 1QPOA 2GDQA 4PMXA 3KWXA 2VX4A 2RJGA 1JCTA 1GYMA 2CLPA 3N12A 3EX3A 2YLLA 3SCUA 3S6DA 3AIUA 2ZBTA 3QBUA 4UUIA 1TV7A 4AZ7A 3VZYA 3AHXA 1US2A 3PJWA 3RYSA 1BQCA 3BW2A 2PDMA 1SVDA 2HK0A 5HXMA 3MV01 2FFCA 4Q7NA 5CAKA 2ZDSA 1S3TC 1GOWA 1YDNA 4C6NA 1WDPA 2FZDA 1ISYA 4EIVA 4AWUA 2YCIX 4AD5A 3W7DA 4PTWA 4EPBC 4FALA 2XZ9A 1B31A 3P0WA 1XLHA 2QEZA 3WD3A 5T26A 3DAQA 3O3RA 4V15A 1J12A 2QXWA 5IHRA 1R9XA 2DZUA 1UR3M 4IZGA 2XUCA 3V0TA 4H8NA 2BHUA 2VENA 4JYEA 3DESA 3GC4A 2ANUA 2JBMA 3LLXA 3KTXA 3K13A 2PLMA 2QPSA 3G1AA 4ZB0A 4HHPA 4DUWA 1J11A 3SIZA 3KAOA 2EJ1A 3CC1A 2QVHA 1GK8A 1ITQA 3FJ4A 4BF9A 3CUJA 4QNWA 1EA9C 2W27A 5FF0A 1ITCA 4IH3A 4DZ5A 4AF0A 4GY1A 3P81A 1X6LA 3HGRA 8XIAA 5AHLA 3WQ6A 1BAGA 3C3UA 3MKVA 2PWGA 2XH0A 3U7VA 2G4FA 1VPXA 3KTSA 3KTCA 2DSKA 4FA3A 4FPSA 4LUJA 4C65A 1H50A 2NLYA 1L6YA 1US0A 1T0OA 5G2HA 3L0GA 4LYPA 1KR1A 4WUIA 1LBFA 2CCRA 3AAMA 3WUGA 2H90A 2YB1A 1PIFA 2GQAA 2ZUTA 2HCVA 2QCNA 5I00A 5A8QA 1JULA 2MNRA 3VCNA 3WQ4A 1S2WA 4IPJA 4LY8A 4PCFA 4XD6A 3U48A 1Q65A 3LPFA 5FA5A 3T42A 4JYDA 4EF9A 1VBHA 3LGEA 1CGXA 1J01A 5EMKA 2X8RA 1YIXA 1BKSA 1AL7A 2EAWA 3ARXA 3W7QA 2Z7GA 4MLRA 4E3TA 3PHAA 1TPC1 3GG8A 2OLHA 1SZEA 3BV7A 3LB0A 2ATMA 4C6MA 2ATSA 3C0LA 2ABAA 3GS6A 1X8FA 5CCZA 1CCWB 3H70A 4TTUA 1XLKA 1BXNA 5FKYA 2PP0A 2Z26A 3RX2A 2EGZA 3C6CA 4K38A 4Q8MA 3ZVIA 1D9EA 4AG0A 4TVDA 4OUIA 1YTKA 5I3FA 1OGSA 2R94A 3TK7A 4AB4A 4YWIA 4UFKA 2Q09A 2Z00A 2V69A 4RX0A 4US5A 4DY1A 5B7ZA 3RO6A 1L6SA 5BXTA 5CBJA 1OD0A 3GG7A 2E68A 4HGXA 2C1IA 4MHBA 4AYSA 1OG6A 3W6LA 3PC0A 2PDCA 2XWEA 3FYYA 1RQBA 4KIRA 1S2TA 3TN5A 3UEQA 4JQ3A 3BLLA 3DG6A 4JKKA 3WDQA 3W1QA 3HQOA 3EWZA 3WQFA 3SCOA 2UBPC 3B8IA 3WK3A 4B3KA 4WOQA 5FL1A 3APGA 3LXBA 1XUZA 3M0ZA 3U4AA 4C6QA 1I8JA 1E6XM 4GISA 3KWSA 1TWWA 1ZY9A 1MFUA 1R0MA 1U83A 4IF2A 1GZ1A 4XAZA 3G1FA 4W85A 5AN7A 7REQA 1C9WA 3SW6A 3A13A 5LIKX 3C5QA 1F6PA 1W8SA 1H1NA 4TO8A 3VKJA 5BZAA 3CTTA 2J78A 3E0VA 4DXKA 3CUFA 4I6KA 2D22A 3ENLA 2NX9A 1PE1A 3VKDA 4GXMA 1HO1A 1UD8A 1ECQA 3ITYA 5AYXA 4W86A 1XGDA 3G24A 2I1OA 1KC7A 5TQLA 3MYOA 3BUVA 3L4WA 4NAFA 4HK7A 3IPWA 5PTDA 4AD2A 1CXEA 4R88A 4XBSA 1I4NA 1EQCA 1W5MA 3QV8A 5LXXA 2W3ZA 3Q45A 5KITA 5FJJA 3F4VA 2ONEA 3ZFHA 2DW6A 2A3BA 4XAPA 3C0QA 1PCKA 3INPA 4FNUA 1QI4A 1VYPX 2G96A 4CNSA 1SW3A 1RD6A 4XQ6A 4M3PA 3ZO9A 3U5YA 2H3DA 2VDGA 1XI3A 1VEOA 4J3SA 2HV5A 3W7MA 4L61A 1H11A 3OLGA 1Q4NX 2CYGA 1AZ1A 3WBAA 3NEVA 2XH7A 2QUNA 1JL8A 4EK7A 4Z0JA 2OCZA 1OC7A 4ZQCA 3RR4A 3CHEA 3LHWA 4UTJA 5CAHA 3VOCA 5JH2A 3UWUA 3VU2A 4H01A 1K3UA 4KPLA 3FN9A 1CI1A 3ARRA 2FZMA 3CPGA 4CCZA 3VGHA 3KX6A 2RUSA 4GPNA 4HYVA 1AFSA 3DENA 1CLXA 1PDYA 1RR2A 5A6SA 3CQKA 3WLPA 4GUJA 4AXNA 2EG8A 1EUAA 2V5JA 4Z42C 5K3VA 5CPLA 4HZ6A 4CGTA 3PANA 5A6AA 3T2OA 1DJZA 1IR1A 5F2GA 3MDWA 1OZMA 3ZSSA 1A5CA 3Q58A 3NVTA 1UKSA 4JTRA 4QM1A 3SAZA 3CL6A 1N8FA 4JDBA 1W1VA 1PHWA 1GTEA 3W02A 3MI3A 1FFRA 2FPYA 3QMSA 4K1GA 1NFBA 1E56A 3G1RA 3GHRA 3DC0A 3LTSA 1BF6A 2VX6A 3OGRA 1O68A 1Y5XA 1FXPA 5C9WA 4HPXA 2VDHA 1TMHA 1V3IA 4DXVA 5KZ6A 4S2BA 4BWLA 3VOHA 3WELA 3PR2A 4GIYA 3FIGA 1M7XA 5KZDA 2OWCA 1HJUA 2WNWA 4KWSA 1E72M 3CZEA 3RLGA 1PCWA 1DIKA 2Y1HA 3E2QA 4DUXA 3UXDA 3R0UA 2WVVA 1JRCA 3IIVA 3UR5A 2E28A 1LRNA 4X0VA 2SFPA 5ABHA 3B8VA 1HL9A 4D1JA 4TQTA 1E55A 1BGAA 4UFHA 4YVXA 2WJDA 1K8YA 2VTFA 1SSGA 5HULA 2VFEA 3B0UX 3BSMA 3FCPA 2GFTA 1HP4A 5G4HC 3WEMA 3RNDA 4O1FA 5ECVA 1X6UA 1W56A 2AL2A 2IPGA 5AZ0A 3POCA 3HV8A 8CGTA 5LA0A 4GHRA 1BXCA 2GVJA 2VRKA 4DYKA 2DVUA 4R53A 4HHMA 1RQEA 3W28A 4MUZA 1F61A 3J7HA 1E0WA 3VCRA 3VPLA 4IX0A 3CMJA 1HUVA 4ATDA 1J5TA 2AMGA 1LUCA 1YW1A 2ISSA 1XRSA 3GVVA 4S39A 1KM5A 1NWUA 1VHCA 3GXMA 3PY2A 2HE8A 5HPCA 4A8NA 3ZQ9A 3BANA 3KBWA 1G4SA 1CGVA 5HBFA 3GDBA 3BGAA 4IL0A 4QP0A 2R14A 4JX4A 3L2IA 1FWEC 3VNIA 1CIUA 4LVGA 5AC7A 3ZVHA 4W7WA 5CZJA 5LIWX 2OXNA 3E12A 3SJNA 3VK5A 3LG3A 4GI6A 4KIEA 2P76A 1W9VA 3CT2A 1P1MA 3MUIA 4UFMA 4ICMA 3FYOA 5CPTA 3VKKA 2PTDA 2P53A 2OU4A 1XF0A 2FZNA 1BRLA 3P84A 2BWGA 4WX2A 3PBYA 4UB9A 1W9UA 4PH6A 4R33A 5KINA 5FACA 2NZLA 2P0OA 3R43A 1YTEA 3QV9A 3S42A 4BI6A 3STPA 4K7YA 1CTNA 3W85A 3WQ5A 2JEPA 4L4OA 5D02A 4NZ4A 3RR1A 4WOZA 1XGEA 3OG3A 2IPJA 3MYPA 3GZ3A 1TVNA 1E6PA 2BODX 3UZWA 1OQFA 1UROA 3NDZA 1SFSA 1G7UA 3C2RA 3G18A 1V03A 4HMCA 4Q22A 3GVWA 3EZ4A 1EYWA 4HA4A 3THAA 2RDWA 3G0XA 3GHTA 3AYVA 1U33A 4IMDA 4I8DA 2CZVA 4DO4A 2NXIA 3O6YX 1UWAA 3Q65A 5A95A 3KL0A 3QOKA 2PUZA 1WZKA 3LSCA 3LY0A 3QKEA 2OJPA 4A3YA 5HQLA 4WIWA 1TUFA 3AZSA 5DLCA 4E8GA 1TIMA 3PZMA 3BMWA 2GVYA 1FHDA 3TTYA 5I3JA 4AWSA 3IVUA 4P61A 3UFYA 1R7AA 4W8LA 1YNPA 1G7VA 3W2JA 3TTSA 3RJXA 4DLFA 4ZL1A 1E4IA 2E6YA 4CCCA 4ZTXA 3RCMA 1UASA 5M03A 4M7TA 4Q8VA 1IE7C 1M5WA 2X1TA 3LU2A 2XIQA 2H8XA 4G7EA 4URIA 3CQHA 4G9PA 4RNHA 3I6RA 2VD8A 2DJXA 3R0KA 3KUMA 1XHGA 3MSYA 2EXOA 2QT3A 1RLCL 3CB3A 3HQNA 3R5EA 2BX7A 1AW1A 4IIFA 1DBTA 3MJYA 2XFWA 1LQ0A 5U4NA 3PWGA 5ABGA 1T8XA 3FGCB 1QATA 4HOXA 2WB5A 5G2WA 1KLYA 2HRWA 3FYPA 3DBNA 3E5BA 2DDXA 2PDXA 4P7LA 5L9FA 3M9YA 1SO3A 1VRDA 3ECQA 1YXCA 1V0KA 3MP5A 1Y65A 4PRTA 4JKMA 3AJXA 2R8WA 3UD6A 2OG9A 3QYSA 1XG3A 1K8CA 1HVQA 1WKDA 5J04A 4E2DA 2QAPA 1WB0A 1Y8BA 4IP5A 4HTBA 2XVLA 4U4MA 1P0EA 1DYSA 1UG6A 3WDRA 1C7SA 3V7PA 4HNNA 1XLGA 4PL1A 1K4HA 1IWAA 1EQPA 1TR1A 3L4UA 3MWAA 2P8BA 1X1NA 2D23A 3EPMA 1GW1A 4Z1DA 4HB7A 2QJIA 3BV4A 5AYYA 2VKZG 2Y85A 1HJXA 2B7PA 4ZOCA 1OF8A 1RV8A 1KXVA 2OT1A 5EBUA 1RZMA 3U2OA 2O92A 4AHOA 3GVRA 1VPQA 4RNIA 4H6KA 1D3GA 1WKEA 3H12A 4KW2A 3IJ6A 3QMTA 3KFTA 3CAQA 1EIXA 2E5BA 2NVCA 3PZUA 3VIMA 4H2HA 1ZP4A 4UR8A 4HNOA 2P88A 3VINA 4UTWC 3OVPA 3G8RA 3P5YA 3KHDA 2INEA 2NXGA 2BP1A 5KETA 4WLCA 1FRBA 5DXYA 3NQMA 1H63A 2ISDA 3BICA 4YPJA 4NRSA 5A3HA 4PUNA 1XS2A 1VFSA 3H4WA 1HO4A 3FV9A 5HUOA 4JEJA 4Z1BA 7ODCA 3TIMA 1LOLA 4QLKA 3RG6A 4WY0A 3F5KA 3ELFA 2V2CA 2OVLA 1WCGA 1TELA 9XIAA 4V2XA 1MW1A 3VC6A 1TTQA 4QFUA 1PTDA 5E0KA 3Q37A 3CZKA 3CHVA 4I3GA 4XO7A 2QJGA 1W3LA 1C8YA 1V6YA 4KETA 3O1NA 2WWDA 3VDBA 4M51A 1V51A 1P6WA 4GACA 3ZOAA 1I1WA 2VT0A 5G1YA 1D7KA 3F1QA 5GJNA 1JCJA 4NNAA 3TW9A 2GGIA 3LI1A 4UBPC 1JFXA 3VGDA 2HE5A 2Z2AA 1UR4A 3WUFA 1E5JA 1R6WA 1KM6A 5KTLA 1AUSL 1EEPA 1ADSA 4AD0A 1NFPA 3VOJA 1LL6A 5C7VA 1NIUA 4NNBA 1R2SA 2IPFA 1B9ZA 2PDPA 3NTYA 2PD9A 1RP8A 4NG3A 3VM7A 4OIFA 1XL9A 4TTGA 3BLPX 1FDYA 1B9BA 4MY9A 3TCEA 4FR6A 1KQYA 4D2JA 3DECA 4X0NA 4G2DA 5A8MA 5HNTA 3TJIA 4PE8A 3W6MA 3W7GA 1TPFA 3COTA 1MW0A 4DQWA 5A8OA 4H9MA 4UOZA 1Z69A 1XRVA 1F6KA 4UTMA 1TMQA 5D03A 3UJEA 4I9JA 4MLJA 1OYAA 4KRTA 5DY2A 1H51A 4Q8UA 2Z1SA 5C9ZA 2YYUA 4B5UA 5D2XA 1BVNP 5H8MA 3AIBA 1KM3A 1FWAC 1Q6FA 3W7OA 4IQDA 1RCXB 3E2VA 1GVFA 4OT7A 1PBGA 2O7QA 1UC5A 5HAOA 1GVRA 3F4CA 2EHHA 4F0RA 3BAJA 2VFDA 4QEHA 3IJDA 3ARYA 4JN6A 4IX2A 7TAAA 2CLOA 4BWLC 1OCQA 4GINA 4UMCA 1QO2A 2ACRA 3L12A 2YLAA 4MPKA 3PZ9A 3A22A 3W7CA 4XKMA 2IQDA 1FDZA 4Q32A 2VYOA 3EB4A 1TE1A 4AY8A 1WBHA 1NELA 1LT7A 3JU2A 2O7SA 4C1KA 2BBFA 1NWSA 1X1ZA 1KCKA 4D6JA 3OHMB 5LZLA 2F84A 3SFKA 1Q6LA 2X1UA 4C6IA 1E6ZA 3MHFA 3O6DA 5MF5A 4LUTB 1BVWA 1A80A 1M7OA 4R7OA 1OC6A 3N9KA 2PWEA 1ZUAX 3T4CA 1OJXA 2GGJA 1VC4A 4X60A 2J9ZA 4L4PA 4UTKA 3BCDA 3IIPA 4J1OA 4AZCA 2DFAA 3P2VA 3GDTA 1J96A 4EANA 4DZHA 1NDZA 2UY5A 3O15A 1LBMA 3RPTA 4H6EA 4MTVA 2XVPA 4YLWA 3A47A 5HMEA 1EWDA 1ICQA 4V28A 3SJ3A 2B4GA 3DFSA 1MEIA 3ZMRA 4RLIA 3RGTA 4B90A 4ADSA 2W61A 2D20A 4J3UA 4MF4A 1TPEA 1V93A 1Q63A 1LLZA 4F0KA 3AIEA 4A3QA 2RGMA 5HR7A 1QPRA 4TV6A 4Q4KA 3QJAA 2GUUA 4E8CA 2HXTA 3RN6A 2XISA 3B0VC 4UTFA 1I2RA 5MHBA 4LBUA 3PB2A 1NOUA 3BL3A 4QAIA 3TQPA 4H3DA 2L5HA 3W74A 2Z6JA 3NO1A 5A6KA 3U2CA 2Y6ZA 1EDTA 2GWNA 3K1GA 3TMLA 3F2DA 3NSXA 3LEPA 3HPZA 1DIDA 4MZ8A 3CO8A 2Z28A 6CGTA 3IK2A 4EWND 4HOZA 3MCOA 4YXGA 3REQA 5D2VA 3OODA 2QUVA 1V8EA 4OU1A 2J27A 1Y5WA 4WJXA 3IV3A 2XIOA 1B3XA 2J6XA 3CGTA 3WYZA 2Y63A 5GVJA 3MUCA 2IXVA 2CFFA 3HGJA 3HG3A 5FEPA 4PUEA 4B9ZA 3SEPA 3NDYA 3PUOA 1W3JA 1BF2A 5EFFA 2RDXA 3P67A 1LL4A 1A4MA 3K8MA 1I2PA 2VZVA 2J79A 1EHNA 1ZHAA 2WYSA 2WMIA 5HMDA 3FHAA 4PUJA 3GHSA 1NQ6A 1Q85A 4O1CA 1OZQA 3N17A 3WH5A 4Q8TA 4S3CA 1LZOA 3VIPA 3FX4A 1E0UA 2X2YA 3NIYA 4IM4A 4L9YA 2D2HA 4W84A 1VCGA 4QBXA 3CH9A 1G67A 3SBFA 3TZFA 2DZPA 1VF8A 3IRDA 3NUKA 3WBEA 1PZ0A 5F4XA 2JGQA 5HATA 3OB8A 3VZXA 2BY2A 2YDSA 1K7FA 3T7VA 1M68A 1JYWA 1ELSA 4JIQA 4XD3A 4JZ5A 1TYGA 5G1TA 1VFFA 2FKPA 4AMAA 1EKOA 3L4TA 1U22A 4JFWA 1S2UA 1O1HA 3KRBA 5JXQA 3W81A 3NAVA 1J2BA 3MPGA 1DHKA 3ABSA 2EPOA 3UXIA 5C9UA 3HJZA 3IAPA 4MNLA 1AK5A 3W2UA 1ZJAA 5A8PA 3BJTA 4H7ZA 4HA1A 3H2OA 1UBSA 5FF3A 3TYCA 2OO6A 1ZCCA 4U31A 4H9XA 2D0GA 3LPOA 5H91A 3VIKA 4K1WA 4MFEA 2PB1A 5LIYX 1AW5A 3W1AA 3SQLA 4O8RA 5DQPA 3SY5A 1GONA 3TR9A 3N15A 4IJBA 1XPYA 6TIMA 4CVWA 2CEQA 3IJ7A 2WMGA 5DEZA 2P1FA 4HU8A 4W87A 1K02A 4QSHA 2TRSA 2XPKA 4LAUA 2BY1A 3PS7A 1TWDA 3EXRA 1VFHA 1TV3A 1HGWA 3T08A 1VENA 2JIEA 1JNDA 1HGYA 4MAZA 3IRSA 3LMZA 2Y4SA 4M5PA 1A5AA 3QPEA 3LGDA 3WH7A 3TJXA 1W32A 3WNKA 1BQGA 3VIIA 4GQBA 3WG6A 1DHPA 3B0YA 1LQ2A 3U4FA 4YMZA 3M07A 1TPH1 3VNMA 4QNEA 2HS8A 1PXGA 5EBAA 3RRAA 1TZ7A 3BVJA 3RMEA 3EEGA 4W8AA 5CZKA 3RJYA 4M8UA 1XUUA 1DJNA 3QV7A 1R9YA 3VOFA 1UHVA 1UJPA 2BMBA 4UTTA 2ZZ4A 3M0MA 1J0KA 2VGBA 1U2YA 3BPWA 4UR7A 1ZFJA 1PZ2A 3QGVA 3O63A 4WF7A 3D5HA 1NH6A 5H6HA 3BDKA 2G5WA 4RW5A 3P0XA 1MSSA 1UD6A 4Q6JA 2QCGA 4E2VA 3APTA 1XM3A 4FOJA 4US6A 1OFRA 4JTAA 4ROPA 4M82A 1G9HA 1HKMA 3CWOX 4RPQA 4FF7A 5AHIA 1H3GA 1P0KA 2WQPA 4WXZA 3CJPA 1ADOA 1XLFA 1IEIA 4DWSC 2R1PA 2NQ5A 1QCWA 1HTIA 3SCRA 5AKQA 5DX7A 4OWGA 4O16A 3PWAA 4B5VA 3GU9A 3I4EA 3SGGA 1GOQA 3TMQA 1R3RA 3CLWA 4AW7A 3RU8X 4H19A 1GVSA 1MQRA 1PHQA 2VX7A 1IYXA 3GTIA 3B8UA 1GZGA 4P7OA 2GUYA 1QU4A 3GIQA 1OC5A 3ZLHA 2BOFX 1YNYA 3CU2A 4L56A 4J3XA 4N2YA 1UPPA 4TVUA 1L8NA 3LD5A 2R1NA 3QM3A 3VKCA 3UBPC 3UZJA 2POZA 2PWVA 1UD2A 4IMAA 3WK0A 1K03A 2E77A 4NJGA 4OGZA 4RCXA 4PULA 3UXAA 3WL1A 4ECLA 4LNCA 3SN1A 1XIJA 3GNXA 2DUZA 2Z25A 4CD4A 2VFFA 4JXCA 3OGSA 3SADA 4JR5A 4UZUA 1QNPA 2WC3A 1H7NA 1EC9A 1NOFA 1QJWA 3H2MA 3NDOA 4AZHA 4LB4A 3ITTA 5BXPA 3OZMA 2CHNA 2X7WA 4JTSA 5K9XA 1XWYA 4JIIX 1DXFA 1TRIA 4IP4A 3T2QA 3Q67A 4P7NA 2ZYFA 4Y8FA 1QXLA 2ACSA 4O8AA 3HURA 3TSBA 3HM7A 3LSBA 1DKWA 1M03A 1UD4A 4WDWA 2ZX8A 2O9PA 1AQHA 2OEKA 3P60A 2VRQA 3NG3A 1WUEA 3CL8A 4DB7A 3GD6A 3MMWA 4LS2A 3ANYA 5JBDA 1EPVA 4MNMA 1TV4A 4JCLA 2QF8A 4S23A 4WR3A 3F5LA 4GJIA 5EPDA 4YWSA 3KL5A 3W7IA 5FIPA 1WYIA 4JX6A 3RAOA 3SCNA 3S9ZA 4HT3A 4S3GA 3AWOA 2PGRA 1W2PA 4FOUA 2H8ZA 3NXFA 5IFTA 4RXGA 1E9IA 3HGSA 3VCCA 1B57A 1RALA 4Z2JA 1FWDC 4IT1A 3VDCA 1QDSA 4ONVA 4IJRA 2ACUA 2A3HA 4UOJA 3O7UA 1ZBVA 2Z27A 3NL3A 1KKOA 3GXPA 3CUZA 2NWRA 2WNZA 1JVNA 1C92A 4K2SA 1XIMA 3SRKA 3NL6A 1O5QA 3AROA 3V5CA 3QZAA 4JIPA 1ISWA 4Z2KA 3TQKA 4F79A 4GKLA 2Y7DA 1EJ7L 5F1VA 3N73A 1Y0EA 3BCJA 1KCLA 5EGRA 5CGQA 3FW6A 2Y89A 1UKOA 1I2OA 1XLBA 2HS6A 3CZGA 1RJRA 4MB1A 5AYIA 2TMDA 4WEVX 3WLIA 2PDLA 2WKLA 1SMDA 3TA6A 5E0CA 4JN7A 1Q2SA 1BSLA 4Q8PA 2P10A 4DYEA 1ESWA 1GVYA 2YL9A 2J7FA 2ZRZA 4LCQA 3URNA 4O12A 4GIAA 1M6JA 1O94A 3LV6A 1BYAA 3MBFA 1JDFA 3EA2A 3R2GA 1VQTA 2GOKA 1NQKA 4MWAE 1QOXA 4QDPA 2VCBA 1XIIA 3ABQA 4NYYA 2FZ8A 5XIMA 5F2IA 4GGHA 3BZJA 3NZQA 4L4MA 3C4UA 2WKJA 2HNHA 3WFZA 4XAGA 5B80A 3O6AA 2VXNA 5IBXA 4B5XA 3SN4A 6A3HA 1TJRA 4LANA 2V5KA 3CZJA 4K8EA 1FWSA 4J3ZA 4JPGA 1LOSA 2I14A 2WBGA 1YKWA 1EX1A 3F03K 4L65A 3WDPP 1GZJA 4M0XA 1K9DA 2XN2A 4QJ1A 3AYTA 1SU5A 1VHNA 3M0VA 4QR6A 4O0ZA 5BYWA 3VGEA 2IUZA 1JRBA 1RQHA 2AGTA 3C61A 3GY1A 2ZWZA 3N2XA 3DG7A 3LCIA 2QUUA 3T1GA 4J4KA 4A22A 5JH1A 4GI9A 1DWFM 2YDAA 2TODA 2A2IA 4U28A 1J93A 1WZMA 3U0HA 4ZQOA 2OO0A 2ABBA 4KMQA 2D69A 2WJZA 4Z08A 3P5ZA 1NEYA 2Y24A 4GZJA 4C5ZA 2AAMA 2IKIA 1GKQA 1GPFA 2PEVA 2EKCA 2QAFA 3AYRA 4B5NA 4JYFA 2ZCGA 1ISXA 2G3MA 7PTDA 1T40A 4CN1A 4ZFCA 4IUOA 2AKMA 4IGNA 4HKPA 4H04A 4XSLA 5D30A 3EOEA 1B5TA 1XLCA 5HJYA 4NU7A 1MMFA 2FVKA 3H22A 4H00A 3W7HA 2GJLA 4QQ3A 1UPMB 3BMVA 4G5DA 4ZQRA 3IANA 4N42A 1SO6A 1EGZA 2A3AA 4MDPA 3MZNA 3MCNA 3SSZA 2PWUA 3BAXA 2WNQA 4LALA 4E8DA 3DBPA 2Y8KA 3A9BA 4JNYA 8RUCA 5JUVA 2NXHA 1KXQA 3CIVA 1UR1A 3W01A 4Q8WA 2C13A 4ADUA 2QS8A 3QXBA 3GNRA 1TO3A 1GOOA 3LM3A 3TZNA 3WJWA 2QKFA 1BEUA 3DC8A 4XKYA 4JAWA 4CVUA 4UOQA 1EDQA 4F9JA 4FNQA 3QF0A 4AWTA 1WDRA 4DJDC 3I4KA 5AECA 1M7JA 3B4UA 3R7MA 4BZYA 4XIAA 2E5DA 3SGZA 1UR0A 3PZIA 1IT8A 1IEWA 2RDTA 4FLQA 1P4CA 1UIPA 4QCEA 1FCUA 4PMUA 3CV7A 4D6FA 4O17A 3DERA 1EA0A 4BQ3A 1GT8A 4QHRA 4U5IA 3PJTA 1BHGA 1G6CA 3ZR6A 1DWAM 3HGOA 5T9CE 5D04C 2V67A 4UNKA 2ZX6A 1YPIA 4C6CA 4H8HA 2W79A 2VX5A 4HZMA 3AO0A 1XPGA 3GXNA 1UUQA 3ISIX 4GI4A 3VDHA 1F73A 3OBEA 4XUYA 3W1RA 1ZBWA 2OZTA 6REQA 4WK9A 4C6EA 2CBIA 3QW4B 4E5TA 1AMYA 1J8VA 3W4RA 2XH4A 1C8QA 2XVNA 1UKPA 4L5ZA 4R27A 4BF7A 1EJWC 4IMEA 3QZ6A 2BVTA 3AI0A 1PSCA 4GYFA 2ZA1A 4DI9A 3IIOA 1EGVA 3DDMA 2D3LA 6XIMA 3PG9A 1LDCA 4Z2IA 2R1KA 4C1NB 3VKAA 1HFBA 3PZTA 1FWRA 1MUWA 2BHYA 2A3CA 4RK8A 3S9IA 1K8XA 3TXZA 1POKA 3I6EA 1OFEA 3GNNA 4PTNA 2BG5A 3W73A 1JYVA 1DQUA 1XDJA 1RVGA 2YR1A 1UB3A 4D71A 1TJ2A 2ZA2A 5RUBA 1F74A 2G95A 3E5PA 4XTIA 3NM3A 3TX9A 4MSSA 1WA3A 1WAUA 4JIEA 2G0WA 2EF9A 1B0IA 3ARVA 4DRSA 1W5QA 2PDHA 3BMXA 3QQ0A 4BR1A 2CW6A 4XUGA 1FA2A 2BLEA 4DJEA 3WNLA 1UWQA 3S46A 3DFTA 2VJXA 1VJSA 2V6AA 5I78A 1DJWA 1YTDA 3IGSA 3GXFA 4A2RA 2DU2A 2B31A 2J7HA 3N4AA 3OOQA 1MNZA 2VQTA 2X41A 5BNKA 4MNKA 4ALDA 4DF0A 5EMMA 1E0TA 1XBYA 1R47A 1XDLA 3U2ZA 2VEMA 4L6HA 1OFOA 4ICNA 3QKZA 2PE4A 1A3HA 3EPNA 4PEEA 4C7GA 3H8AA 4FX8A 5BRPA 3TLQA 1EJTC 5DY3A 3PP7A 1OD8A 3JVAA 3QV6A 2FB2A 3MVTA 4NASA 4HSOA 3BC9A 3AIRA 4Q8NA 2XIJA 4O0KA 3R8HA 2C14A 3PAJA 4EAMA 3NQAA 5FF4A 2DEPA 1AMKA 1KRMA 4FNRA 5EU9A 4OV9A 4GXPA 2V63A 3WF2A 2OSXA 4TU1A 3IV8A 4LOCA 4DIAA 4AX6A 4CCDA 1RHCA 3CQ0A 3ZXWA 2AAAA 4ACYA 1CGTA 4J40A 2Q3RA 1XLEA 4GQQA 3VUSA 3NQBA 4UQ9A 3THUA 1YE6A 1S2CA 4WD0A 1QNOA 2DZSA 4REQA 3G1VA 3UWYA 4ZB5A 3BURA 1CGYA 2D1ZA 3WUEA 4HPGA 1WE5A 1DE6A 1IR2A 5I24A 2O4MA 4W7VA 5F4SA 1EUNA 1CDGA 1JGMA 1FHUA 2OB3A 3W88A 4LUTA 3SY1A 5BOEA 1JZ8A 3DHUA 3UCDA 3TTOA 1O5KA 4YTSA 1Q6GA 1YADA 3W0KA 1ODUA 3DKLA 1AJZA 4FLSA 2FQIA 1M41A 3KZSA 3V0UA 5M17A 3SECA 3LCXA 1L6WA 4ZQMA 2FHCA 1OFQA 1RD5A 2ISWA 4DJDD 1E4LA 2INZA 5D05A 1JDCA 4ZMGA 1E6QM 1V4YA 1LUCB 4JHOA 3BW4A 4C90A 4W88A 2QV5A 4NHVA 4UFJA 3T0TA 1QI0A 2QDEA 2E25A 3LOTA 4RE2A 1FH7A 3MP4A 1W1TA 3QHNA 4H7CA 3W7PA 3AOFA 4K8HA 1ZB5A 1VJIA 1E40A 2QW5A 2A21A 4ML4A 3PULA 1LWJA 1ZL1A 4K39A 1EDGA 4WRHA 1R46A 5CSUA 1S2VA 2F9RA 3P61A 1ZJIA 3RXZA 4QISA 1PTGA 2BHZA 4DYJA 1UH4A 1EEXA 1TVPA 2G3NA 4D6GA 2CLLA 1ENUA 1OX4B 2DP3A 3E02A 5F1UA 3AZRA 1P43A 5I79A 7CGTA 4MADA 3VABA 4ZOEA 4MUPA 4JNZA 1B4EA 4OQVA 3W1PA 3NZRA 3BCFA 3NNTA 2A6NA 3KP0A 4LQ1A 3GX9A 2E40A 1QWKA 4PMJA 2YBTA 3N2TA 3BZGA 3S2JA 3PG8A 3ES7A 1S39A 1SSDA 4WGHA 3N3MA 2FGZA 1BPLB 1CW2A 4R3UA 2DIJA 3A21A 3W25A 1REQB 4PN2A 4ZB2A 1RAKA 4N02A 1CNVA 2JKAA 3MMTA 1GTHA 4X9SA 4H6QA 3NQ2A 3NPWA 1L9WA 4RDWA 3N1AA 4PB4A 3SCPA 2PDNA 2PDFA 5KZMA 4MM1A 4O54A 5FEZA 4TOQA 4S3FA 2WSQA 5GNYA 4R9XA 3TYUA 3U6WA 1AG1O 3OVRA 2C8NA 3H24A 2PTYA 1OWQA 1JQXA 2PDIA 3A12A 2R1LA 3BXWA 2BOEX 4H9YA 3GDMA 1X1OA 4AD4A 3DFYA 4A3RA 4X9YA 2DT1A 5M2FX 4OKDA 4WJEA 3N2MA 3B9AA 1OGGA 4PTDA 2ZUWA 2HQAA 1IIGA 1UOZA 1UH3A 2ZXBA 3RLHA 5A6LA 3WZ0E 4MVAA 1GVIA 4H8VA 4C5YA 1JDDA 3CO4A 4XO6A 5A8NA 3NO5A 2PDYA 1E4MM 4XZBA 2JK2A 1J18A 3WO8A 3FSTA 1UQYA 3M0JA 3G0UA 3WLKX 3HG5A 4L1WA 1FWFC 4WDXA 3CBWA 5A6MA 3WY1A 4HMNA 1KRCC 3E3HA 3EXSA 4PA8A 4C6LA 3GU1A 3PZGA 3ES8A 2HK1A 2PCQA 2JKEA 1Q5MA 4MFDA 1K9EA 2A1YA 1OGBA 1V77A 2GGEA 3HO8A 4JTIA 3DN5A 1SW0A 2NW0A 4NZCA 3V75A 1J4EA 1EWEA 3CPRA 4HMDA 2D3NA 1O60A 3P8JA 3GVQA 3K4WA 3NGFA 4QS6A 5I0DA 3S8HA 2Z2BA 1U5HA 3OO2A 3WLHA 1K9FA 2AKZA 3WL0A 1QOQA 2HPIA 5GNXA 2YIHA 1PYFA 4J2PA 2KZHA 3UR7A 3HG2A 3D6NA 3APYA 1ICPA 3VD5A 3EB3A 2PP3A 3UVAA 4AC7C 2GZXA 4P8WA 3TH6A 3IJLA 1JCMP 4R7WA 1TWZA 3ERPA 1CEOA 1Z6KA 3EEZA 3MI6A 3B8SA 1FWWA 3FVDA 1DWGM 4LJ3A 4O19A 2QNEA 2VZUA 3CB8A 4NNCA 4JQAA 5I3IA 2G3IA 3EMZA 2YDQA 1JCYA 4ATWA 5AHEA 1B54A 4Y9PA 4ENLA 5AVHA 5KEZA 3N6JA 1E70M 1P5BA 5LNRA 1MDLA 5CGTA 5BROA 3VD9A 4GUHA 4KQNA 3CEUA 1P0NA 1CBGA 2E4TA 1U1UA 3KBJA 3THDA 2D0HA 5LNSA 2CBJA 2OZ3A 5DMNA 1CYGA 3STCA 4FIRA 4JKLA 2P50A 4MIMA 4Q8QA 4E2OA 4P7RA 2VOMA 3DIPA 1PWMA 1N8WA 3NJ3A 2Y7EA 4GG9A 4QX4A 1VYRA 2DPEA 1KRAC 3WK1A 3VGGA 4XIMA 1IXOA 4QJ4B 3RHGA 3ZIZA 1WX0A 2V0TA 3ZWSA 4DZAA 4FI4A 1JYXA 1BYDA 1WUFA 2BY3A 5CC5A 2GVEA 3M44A 2C79A 1UKTA 3L7RA 3M7SA 3VD3A 2GJXB 2EPNA 1HX0A 3QMRA 3N6QA 2J8FA 2QCLA 1XH2A 1JUBA 2XVGA 1I1XA 3CH0A 3MTWA 1SZGA 4GO8A 1RBLA 4PRWA 4B92A 1FX6A 1KA9F 3AXMA 3ALFA 2CZDA 2YL5A 3VKBA 1HKKA 3VD7A 3TDFA 1JI2A 4LAZA 2BTMA 2VP8A 5JBFA 1C3FA 1OM0A 1ICSA 3C8NA 2Z6IA 3GTHA 5EMYA 1SFLA 4RE3A 2OX1A 3WN6A 1QO5A 5E9AA 2YL6A 5BRQA 2WMJA 4N9DA 4JTLA 5GPRA 4MWAA 1DJQA 2VUNA 3GB6A 1OIFA 4S2CA 1XLLA 2AQOA 1QHZA 1XRTA 4PCSA 6ENLA 3ZVHB 2C3ZA 3VIJA 3S2MA 4JL1A 3VTRA 5CG7A 4BEUA 4OV4A 3ATZA 3GR8A 4LUSA 1S5WA 4MOZA 4QG8A 2HNEA 3BG3A 3K5XA 3KRSA 1M9HA 2E9LA 3TC6A 1XQKA 1KXTA 2XFFA 4A21A 2WXDM 3SRDA 3W00A 4IISA 2QCDB 1BG4A 4BI7A 3TQVA 4DI8A 4LUIA 1ML1A 4TX9A 2O9OA 3HMCA 1FXQA 3L2LA 2GJPA 1KV8A 3UWVA 5HNUA 1QUMA 3R6IA 4L4LA 1H1ZA 3STEA 4M7SA 1D3CA 3GKFA 2I17A 1KBLA 4LYQA 2PZNA 3NQ7A 1OYCA 2NUXA 1XYMA 1UA3A 4RZ4A 3UWZA 2XN0A 4X63A 2QCDA 5I02A 3BW3A 3AIVA 1XYZA 1IWPA 3PBMA 3DEQA 2XJ7A 2OR2A 1KWKA 1E0VA 4DO6A 2XWDA 4A8RA 3KRZA 4LEQA 5L6UA 1WDSA 2HDJA 3G8EA 3M0KA 4ICCX 4C6BA 3HQ1A 2YCKX 2VUYA 3SURA 6TAAA 3CLMA 3AMGA 3QR0A 2Y5SA 5GJMA 5D8ZA 3GW3A 2GOUA 3UERA 1O1ZA 2YGYA 2OQHA 4EACA 3O9NA 3KDNA 1C91A 1F07A 3ARZA 2BVWA 2WMHA 3FKKA 1KM1A 3V0SA 2NLIA 4IIGA 2B7QA 1R86A 5FF7A 3SM0A 2QV4A 3N25A 1V6UA 2QQ6A 1QI2A 5CH9A 1SGJA 4CU7A 1V0NA 2W62A 5E93A 3IUIA 2Z1KA 2GSJA 1DL3A 3HBLA 2WC4A 4HPJA 1UMLA 5D9NA 4PUDA 2IKJA 2FHBA 4IQEA 4JICA 5EKYA 3W87A 1S5TA 3OQEA 4RZ6A 3WLSA 1B3ZA 1TA3B 3B06A 2E8ZA 1YEYA 4GC4A 3GTXA 3DHPA 2DORA 1J9YA 3B9DA 1EF2A 2WSRA 1AJ2A 3E74A 4WDTA 4A4AA 1HL8A 1XIDA 4ERIA 2AL1A 2NSXA 2CXGA 1I2QA 5JIWA 4YL2A 5C2CA 2NUWA 5D37A 4IFKA 5GQBA 4JGDA 1FOBA 4AHPA 2WSPA 1UKQA 4NZ3A 4AWEA 2VVNA 4E2BA 1J0ZA 1ZLPA 4N4PA 2ADAA 4GD0A 3T78A 3PZQA 1L6GA 3B8TA 1VFOA 4RDZA 4IPPA 4NAFB 1Z44A 4LUSB 1VH7A 2IPWA 2CHOA 2YZRA 3BE7A 3RILA 1E6NA 4PTVA 3A3HA 2PU0A 1V0MA 2ZRUA 1I45A 1JZ6A 4HK5A 1IQ8A 1Z48A 1YQ2A 2QHAA 4GX9A 2FTWA 3W22A 3BAYA 2PODA 4O0QA 5HA7A 1QNRA 4FP1A 3QLDA 4LY4A 4PRRA 3WK2A 4U33A 2UZ9A 3LHVA 2VQUA 3WD4A 2J62A 3OTRA 2C71A 3MSDA 1WXYA 3RO8A 1WBJA 5ECUA 1UH2A 1QASA 4Y90A 1OCBA 3M41A 2B7OA 2NUYA 2VFHA 4ZOBA 2VZSA 8XIMA 4V1YA 5DT7A 1E71M 5C55A 5T9BG 4GY7A 3NSMA 2HBXA 2PLKA 1XC4A 3SUSA 1GQKA 5D2TA 1SR0A 5CPQA 4CQDA 3NURA 3BG9A 3OYXA 5BXRA 4UNLA 4R7JA 2WCSA 1RA0A 4EPKA 1VIZA 3CTLA 3L66A 2NX3A 3P62A 4HNCA 4DHGA 2X0YA 3WQEA 3DFOA 4OTKA 3DFQA 4NUWA 1OB0A 2XIMA 2WHMA 3DX5A 5CSSA 4GH3A 1Q6DA 2CKRA 1C7TA 1M65A 1K70A 4GFSA 1W91A 4AHQA 3VILA 3M5XA 4WKHA 4HPNA 2PBGA 4DJED 1UYQA 2YXGA 4KT2A 2O9RA 1C8XA 3OQ8A 3L21A 1G5AA 2C7FA 3GLCA 4NI3A 4EE9A 2FPTA 3GIPA 5I03A 1V3KA 1TCMA 2DSZA 1LORA 3WLQA 4L64A 4M6PA 5ABFB 3VDGA 4RNJA 1G0CA 3ABOA 5HJLA 2XINA 1NWRA 1BXBA 1JZ3A 1DJHA 4GQGA 3MMUA 2GJXA 1LTDA 3L68A 1X38A 1C29A 1PDZA 1WP6A 4JFSA 3A6OA 3MUXA 3LZ3A 1VR6A 1MRAA 1H61A 3MI2A 4NXSA 1FFQA 4KS0A 3TYDA 1EGMA 4XBKA 4HNTA 3LRKA 3CZLA 2OOGA 4WY0F 4O52A 4IWWA 4P8VA 4BK9A 3ZJKA 2PWDA 3SCWA 1BWLA 4NVTA 4YU1A 4F9DA 2WPBA 1QI5A 1LOQA 3T40A 1JPHA 4RPPA 1EBHA 3W1LA 3POHA 4LRSA 3M0LA 3MUY1 1KKRA 3T07A 5LA1A 3WLLA 3NFUA 1DPMA 3WX7A 1K6WA 1SR9A 3GDKA 3JW7A 1V6XA 1B3WA 2XGBA 4HD5A 1L0PA 1C9DA 2AL2B 1MZRA 3HG4A 5BOFA 2YBVA 1TPVA 3A4XA 5A8GA 3EB2A 2A3EA 1ZBCA 4NIRA 1UR9A 3QY6A 1E43A 4IICA 3LTPA 2ZUMA 4TXEA 3KRUA 4IGSA 1YDVA 4LNYA 1EL3A 1W3NA 2QJJA 5SWUA 2WVVB 4DELA 4DUOA 4IIEA 3UWQA 4HYRA 3TN3A 4M6UA 3PVFA 4PZVA 4PUUA 2YA2A 1VPYA 1UP0A 4RV8A 4U3AA 4XWUA 2PAJA 3VNZA 2BGSA 1MRQA 5EMUA 4JIRA 4NZ5A 4ES4A 4DJFD 1MYRA 3OZPA 3REQB 3PNZA 1LBLA 1PV8A 2GUBA 4D9PA 4LS1A 1KBIA 1N2VA 2FH6A 2FTPA 4Y7EA 4XD4A 1X98A 5DBTA 4ZVJA 3H53A 2OEJA 4YYCA 4MGGA 3B97A 1CX9A 4FMVA 5DN1A 5DMMA 1HJSA 2FDSA 1UBPC 4NILA 3WQOA 1FHLA 2A85A 1KQZA 4X2RA 2VC6A 4UQEA 3ZZ1A 2OWWA 1Z42A 4GC3A 3QR3A 2JFEX 1UR8A 2V38A 5C71A 2HWGA 3EOOA 3K2GA 1GW9A 1JQVA 3FFSA 5HANA 5DRIA 1HVXA 1CGWA 2QDDA 4N0RA 1E9ZB 2YSWA 2FJUB 3UJSA 3FJ6A 2DSUA 4J35A 1TRDA 5HDRA 3DU0A 5CEWA 5REQA 3OBAA 1R5YA 3MHGA 4O53A 3SCTA 4B5WA 4LCRA 3G6MA 4IOTA 3UY7A 2VO5A 3PF3A 1JZ2A 1SJBA 4W5UA 5AY7A 3SDOA 4E3VA 3L23A 4JTDA 1K8ZA 3UR2A 3WF4A 5HMFA 5CSRA 3PFMA 1HNYA 3O0KA 3NPVA 3VNKA 3WMLA 1QAPA 3M46A 3NQ8A 3WNMA 3H2FA 3M6YA 1W2VA 3TSMA 1E1CA 4CU8A 1XYLA 1WAWA 3SUUA 3HFYA 4U2ZA 3UXLA 3W76A 4GABA 2VEGA 2WSYA 3FKRA 2Q6ZA 2E1DA 3RRXA 1J79A 1ITXA 1YPXA 1OFAA 4CNNA 3WBXA 1PX3A 2FIQA 5FSEC 3S9YA 3BO9A 3ABXA 3R58A 4MY1A 1FKWA 4B9YA 4AAJA 3C2FA 5LA2A 3CS2A 3F4WA 3PZVA 1A3WA 4JFUA 2XGIA 2QYGA 3R94A 4BJHA 2ZUUA 3VMNA 3WLMA 1RY8A 3IEBA 3CAKA 3BLDA 4KCWA 3Q4DA 3AZTA 2QGHA 3MMDA 4LB3A 2O9TA 4YS1A 3AMDA 5BCAA 1DWHM 2V5CA 2XSXA 1QNVA 4OBRA 4NT0A 4YHGA 2OWXA 1ZALA 2WMKA 1XP3A 4YJ5A 1W1IE 4DNHA 4MJ2A 1GQJA 1KGUA 3I68A 3S5NA 2YZ5A 5EMJA 4FXFA 4XAYA 5CKSA 5G1MA 5D9MA 1W3TA 4TVCA 2PZ0A 1YNQA 4O28A 5D2WA 3NQ6A 3QQWA 4IQLA 3DCPA 1FWJC 1B3VA 5G4WA 3ZR5A 4OBTA 1HIZA 3LTYA 1O4UA 3L65A 2G50A 1DXIA 9XIMA 3ARSA 9RUBA 3CEPA 2PD5A 2GWGA 1W1A1 4L1XA 1BFNA 3WQPA 2ZICA 5D4YA 6ALDA 1WPCA 2OTDA 1UJQA 3EKGA 3FK4A 3BWWA 5K4ZA 1ZTVA 4GUGA 3E2RA 2J88A 4FOKA 5HQMA 4POCA 3CASA 4P8XA 3MU7A 4B91A 4RDYA 1GVEA 3PSVA 4KWWA 4GUFA 1CXKA 4W5ZA 5E9XA 2ZZ3A 1BG9A 3W82A 2VEIA 2QLYA 5FEXA 3W7JA 2CLEA 2IXUA 1T6MA 3A64A 2DQXA 1RCOB 2WMIB 1VB9A 3S5YA 2CZFA 1MDRA 3SQSA 3G1XA 4CKQA 1GOXA 4ZO9A 4QLLA 4CD8A 1TX0A 2PLJA 5FOOA 5FEWA 5I6SA 2W6RA 5I09A 4BA0A 3QTGA 5D09A 1A53A 4PMRA 3EX1A 4I7VA 4O1DA 5M3WA 4XBJA