4NX5A

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx5A00
4O28A 3G1HA 4O1CA 3N2MA 3ZR4A 4IOTA 1K8YA 2Y7DA 3G22A 3ZWSA 3E9AA 3B4UA 3W7RA 1GPWA 3MHUA 1EWDA 4JR5A 2Y88A 5D02A 4JTSA 4ORIA 1LLZA 2VC6A 3W6YA 1EWEA 2OZ0A 3GXNA 2X2GA 1EP2A 4JTEA 5D2TA 2EKCA 2X1RA 2VFIA 5LZLA 4LRSA 4RV8A 3NR0A 2TSYA 1QO2A 4MIMA 4O18A 3O6CA 4LRTA 1ZNNA 5HULA 3P80A 2WPBA 4NJKA 3EX1A 4MFDA 4O14A 1IXNA 3L67A 1YPFA 4GNJA 1NSJA 4Z0JA 4GUIA 3W7DA 2R94A 4AHOA 1JR1A 1KV5A 1GVOA 4A21A 3S42A 3PAJA 4U4MA 2DZSA 3THAA 5AOUA 4ADTA 4O4WA 3LI0A 4Z1AA 3PWAA 4N4QA 1EP1A 1QMLA 4JX5A 4DPQA 4UTMA 3NQAA 2DZPA 3MBDA 5MHBA 3ATZA 5EKYA 3NAVA 1AW1A 1ME9A 3OEXA 3Q37A 3W75A 2AGKA 5D2VA 3UZ5A 1XBXA 1KFCA 1R47A 3KX6A 3CHVA 3M5YA 4MVAA 5AYZA 2ZTJA 2V8ZA 3A22A 2V2DA 1C8VA 1AW5A 3M0ZA 5DBUA 1VCGA 3QW4B 2TPSA 3NPUA 4DEFA 4E2BA 3P74A 1QOPA 3E96A 4XTIA 5I3GA 1VS1A 2Z6IA 3B03A 3C2FA 3RFAA 1LZOA 4LVDA 4WY0F 4PEKA 3LCFA 3S8HA 4HT3A 1AMKA 3KVJA 3FJLA 1H50A 4Z1BA 4CNNA 2QCMA 1CW2A 1HG3A 3L0GA 4JTIA 3LHVA 2Q3RA 3LXAA 5C55A 1SO5A 1YDVA 4O10A 2B4GA 2HS8A 3NQ6A 4UTWA 4Y90A 4YLWA 1RR2A 3W1LA 1JRCA 3HGRA 1W5PA 3C4UA 1FY6A 5AHNA 1BEUA 3CT7A 3IIZA 1GTHA 1AL8A 1X1ZA 3GXPA 1VC4A 3IGXA 4JTKA 5F4WA 3W1TA 5LNVA 1LM1A 2WJZA 1W8SA 3W23A 3P60A 3F4WA 3QEZA 4HHPA 1H1ZA 5KZMA 2ATMA 3EXRA 2BLEA 3LLDA 3SGZA 3TH6A 3W1UA 4IGHA 3T55A 3WK1A 2ZZ3A 3S9YA 1OX6A 5K9XA 1TPWA 3TQVA 2ZFAA 1EB3A 1TRIA 3EKZA 1SPQA 1W5MA 4MY1A 2QAPA 2C3ZA 3IIPA 3Q58A 1G7UA 2JKAA 4ZZ9A 2FFCA 2A1YA 3JS3A 3RMJA 3HG4A 3HPXA 4K39A 1F76A 4NJIA 1N55A 2YZRA 1GOXA 3DFPA 1QOQA 2CU0A 1TYGA 2XN2A 3O16A 3OHIA 4GWEA 4UMAA 4UFHA 5CKSA 2ALDA 1DV7A 3NQ7A 4O4VA 4JDBA 2C18A 1A5SA 1TREA 4IMGA 3GAKA 1H7XA 4RZ4A 5HR6A 4N9DA 3GYEA 1LBLA 4NJGA 1QPQA 4FNTA 1SO3A 4UTWC 3W7LA 4KWVA 3RU6A 1R2RA 3E49A 4FEZA 2E6DA 2RH9A 1D3HA 4AH7A 1OFAA 3LXBA 1FWTA 3LRMA 4AF0B 1XFBA 2JKPA 2CLHA 1SSGA 1WV2A 3EWWA 2Y63A 1YLVA 1QPRA 1DQXA 3G1VA 3TQ0A 3TSDA 2PE4A 5EBUA 3SFKA 4LOCA 1SZGA 2GQ9A 4MZ1A 3S1WA 4WY0A 4S1FA 3LI1A 3IV3A 4DBEA 4M19A 1KTCA 4FNQA 2EHHA 4PH6A 3SJ3A 4AAJA 2ZA2A 5EPDA 5KITA 1M6JA 2WNZA 3UWUA 2E6FA 2ABAA 3CLMA 3STCA 3H54A 1OYAA 1KFKA 2C19A 4LV4A 4R7JA 1OF8A 1ZAHA 3KOFA 4RR4A 4PTNA 5K4ZA 5F1VA 3A9IA 5G2WA 1H7WA 3QZEA 1W5NA 1HO4A 2H8XA 4UTTA 2ZRZA 2FDSA 3LCXA 1KM0A 4EWND 1ZHAA 2C14A 1L2UA 4AWTA 4IMDA 5K3VA 1ICSA 1VCVA 1YTKA 3TK7A 2ZZ2A 3HO8A 3I6RA 1T8XA 3O8AA 4JEQA 1PHQA 3PG8A 4DF1A 1VQTA 4CCDA 4XQ6A 1FWSA 3RLUA 4GUGA 2XN0A 1GVSA 4NU7A 3N14A 4L4LA 1YADA 1SO4A 4Q4KA 5FI8A 3GVGA 3EX6A 4H6KA 3TC6A 3DENA 1O4UA 4ZVJA 1EX5A 1DJNA 4ADSA 3UPWA 4POCA 3W7KA 3TDFA 1OG0A 1EPXA 5C6MA 3QSTA 1XUZA 3GDLA 3GXTA 4QAIA 4O0KA 1TTPA 4FNRA 3TXVA 3W76A 3MYPA 4ZQCA 4O53A 3L65A 5HUOA 4OV4A 1ICQA 3CTLA 3OG3A 3TJLA 1FQ0A 1TTIA 3MW7A 4RLIA 2UV8G 3LTSA 1FWWA 1KV8A 3INPA 1PIIA 5GVJA 3NO5A 3UPBA 3BLIA 1XKYA 4ZMGA 2NV2A 2VFEA 4PODA 1FWNA 3HGJA 2O7QA 4KFNA 1W31A 1TJPA 3LLFA 3TNOA 2FTPA 3N19B 4MYAA 1A53A 4I7UA 3EXTA 1VYSX 1I2RA 4O57A 5G1YA 3LCIA 4DBDA 4TIMA 1SO6A 2JGYA 1LOSA 4BWLA 4O15A 3W1AA 5CSRA 2GOUA 1X7FA 3EX2A 3E0IA 2OT0A 3NQFA 4JX6A 4E38A 1H1YA 3GNDA 3DFSA 1Y0EA 4QISA 3GR8A 1UBSA 3W1XA 5FEZA 3DI1A 4Y96A 1D3GA 2VEIA 1R2TA 1Q45A 3A23A 1I2NA 1OFRA 1IXPA 2QCEA 3IRDA 2NZLA 4HPJA 2FPVA 1P4CA 4QIUA 1WYIA 1VPXA 2A7RA 5J5RA 4NZFA 4FB7A 4MZYA 3NDOA 3QW3A 3PUEA 3M9YA 1GVFA 1JUKA 1LRQA 4K7YA 4LY8A 4U28A 4O16A 3TCEA 1UUMA 1GEQA 2Y62A 2YFNA 5AHFA 3W70A 2B7NA 3FEMA 2C13A 4ONVA 1EP3A 3NQGA 3FKKA 5HWNA 1VYPX 1JVNA 3G3DA 4FXSA 2Y85A 3QPYA 1TV8A 3STEA 1WBJA 2QCDB 2EPHA 2DZUA 1B57A 1KM3A 2VFHA 3B0VC 2GUUA 4FX8A 1YTEA 1UUOA 3NPXA 2DP3A 3NXFA 5LKYA 3P61A 3EKLA 2A6LA 3FYPA 3TSMA 4JTLA 4EF9A 1B9BA 4N6EA 4BK9A 5AHIA 1KBJA 2QEZA 3BW4A 2V5LA 3LM7A 4I7WA 4PFMA 2PC4A 1SR9A 2ZCGA 3QJAA 3OBKA 3W7CA 3F4NA 3SI9A 2QR6A 2QUTA 3M7WA 1VLWA 1TMHA 1G69A 4KFPA 3B04A 3HGOA 3PBYA 3PUOA 3QSRA 3UZJA 5K7JA 3R12A 3QYQA 4MZ8A 2C0AA 4LVBA 4O0ZA 5T26A 1HTIA 3WJWA 1TV5A 1WXJA 5AHLA 2KZHA 1TPB1 5DN1A 3SR7A 2PCQA 3NGJA 2WSYA 1GJPA 3KVLA 1TQJA 2F7FA 3QRHA 3CQ0A 2H90A 2H8ZA 1MEIA 4RXFA 2GJLA 5DELA 5BMWA 4WXZA 3W7MA 5AYXA 2V82A 3W72A 1KW1A 2BX7A 3W1MA 1B3OA 5DCEA 5IBXA 4IPJA 4K36A 3KVKA 3NQ8A 5HJLA 2RDTA 3WFAA 2B7OA 3CIXA 3QF0A 3BG5A 1K7XA 4MJMA 3DFTA 1OFBA 2CZ5A 4OHQA 1ZY9A 1WOAA 2OX1A 3QMSA 4K8HA 4NUWA 5F2GA 4XTDA 4LS2A 4O1DA 3G1XA 4XKYB 5HMSA 3W7OA 4AMAA 3MO7A 3S0CA 1SFJA 3N73A 3PY2A 2QCFA 3B8DA 3NEVA 4Z1CA 4UCGA 3L66A 4KKXA 2FLIA 1P1XA 3G8EA 3W7PA 3NL2A 3UXDA 2CFFA 1R2SA 4JYEA 2NXHA 1JUBA 1OF6A 3ABOA 4Q33A 3CPRA 4JTFA 1XM3A 1D9EA 1A5BA 4LTSA 1G6CA 3L5LA 1G67A 1EUAA 1L6YA 4BR1A 4UR7A 2QCDA 4UTHA 4YCOA 5FEPA 2R8WA 3MBFA 1DKWA 3GKAA 1TRDA 4FHAA 1UASA 2FQIA 1JULA 4JY9A 1KLYA 1RPXA 2X16A 4MLRA 4FIRA 5L6UA 4AHPA 4AWSA 3LOTA 4GUJA 1XBYA 2H3BA 3S6DA 1V5XA 4CQAA 1KFEA 3SECA 2BXVA 2CZEA 2GQAA 3QH2A 3DAQA 1YDOA 2YW3A 3GDTA 3RK8A 3DHDA 4LS1A 3C8FA 2NX9A 3C6CA 2YCEA 3HGSA 1Z44A 1DVJA 3O63A 3C61A 2A2IA 2CLIA 2QCNA 1TPEA 3TROA 2C1HA 5AYYA 2X1TA 1G4TA 5DXYA 2GVLA 1ALDA 1OFOA 2QCLA 2YYTA 4JIPA 4EVZA 3IGUA 2YX0A 3PB2A 2TMDA 1YTDA 3W87A 1LLWA 4JTHA 1IXQA 2PRMA 2V2HA 3BW2A 1A50A 1F2JA 1F5ZA 2VFFA 4UMCA 1HL2A 5CZSA 5F4SA 1OFPA 3DI0A 5G4EA 3VI2A 4CQ8A 3ATYA 3MI6A 1BTMA 4W9TA 1OFEA 3AJXA 4ICNA 3QQ0A 2GJNA 4AHQA 3N3MA 3DXIA 1F6KA 1M5WA 2LLEA 2QUVA 3HG5A 3M6YA 4QITA 3TXZA 4JDYA 2W0UA 2ZZ6A 1FCBA 1W3IA 4QJ1A 4X2RA 4OT7A 1THFD 1TIMA 3QPZA 5DY2A 4NNBA 4RJEA 1QO5A 3FLUA 2QF7A 2C16A 2YYUA 1Z42A 1IIGA 2VOMA 4NZJA 4CNPA 3T4CA 1VGAA 2Z6JA 1F6PA 3S5ZA 1RZMA 4GXMA 4ORMA 3FS2A 4FNUA 3JRKA 5FF4A 3L2IA 3PSWA 3L68A 3GDMA 4O11A 1LOLA 1LOQA 2QJIA 3TJXA 1VRDA 2F84A 1HUVA 1XXXA 3GAYA 4N02A 3EWXA 3RNDA 4FF7A 5LSMA 4QSHA 2YDAA 3NQVA 3W83A 4LS0A 5K9DA 3P81A 3C56A 3G18A 1ML1A 1VJIA 5BMXA 4LC8A 3KRUA 3SZ8A 1C9DA 3N9SA 4GRSA 3F1QA 4RK8A 1O94A 4LUIA 2G5WA 3P62A 4PC8A 3B05A 4TMBA 1YDNA 1O5XA 4LT9A 1OFDA 3NPWA 3W22A 5LHFA 1TPC1 3LCLA 4O52A 3QMTA 2Z0IA 5LGZA 3LERA 1CX9A 2J24A 4NJHA 4FX6M 2GQ8A 1Q6QA 3LV6A 3S1VA 3L0KA 1ZAIA 1W5QA 4O12A 4KFOA 1FDYA 1KBIA 3GDRA 3PB0A 2RDUA 4A22A 5C2XA 2VENA 4XUGA 4M6PA 1H62A 3M43A 5CPMA 3P5ZA 3DKJA 2G97A 3NQMA 4WUIA 3KXQA 3W7HA 5EA9A 5DLCA 1U83A 2V9DA 4K7VA 5EY5A 3QQ1A 4P2VA 2WSQA 4GJ1A 3QM3A 3W74A 1LDCA 2E5BA 4XBKA 3MHFA 1B4KA 2CLFA 1YPIA 5F2MA 4QNEA 2NX1A 5CZ0A 4HPXA 3NNTA 1K8ZA 2CLKA 3G1YA 1XDLA 3TMQA 1F74A 2J6XA 5CZJA 2GPTA 1KM4A 1K02A 1FXQA 1LRTA 4DO5A 4E0CA 1Q6OA 3LB0A 4A3UA 2J9YA 2C6QA 4WQ6A 3WK2A 1AK5A 2ZRXA 1FUYA 2CWNA 4LC6A 4NNAA 1UB3A 2JK2A 4FNPA 3TSBA 2TRSA 1K03A 1EUNA 4S2CA 1K3UA 3G24A 3M1ZA 5KMYA 2E68A 3F03K 1NAL1 2CW6A 1L9WA 1W0MA 2VXNA 3KAOA 3HF3A 3UY8A 3EWYA 2FB3A 2Y7EA 1QFEA 3LHTA 1OYBA 1ZJIA 3VE9A 2I9EA 2VFGA 1W3NA 1SW0A 5HNRA 4DF0A 4I9AA 2ZA3A 1W37A 1TPH1 4UC5A 3TUUA 3MUXA 3N2XA 3IGSA 1O5KA 3R8RA 3DBPA 3C0JA 3YPIA 2A7NA 3M16A 5TBOA 1JQVA 4CLMA 3P67A 5F2LA 4AVFA 3O07A 2C15A 5E93A 1AG1O 3PG9A 3HOJA 3TKFA 2V2CA 2Y61A 3W84A 4OWGA 3OVRA 5D05A 1XBVA 3W1RA 1OJXA 1RV8A 1WDWA 1VHNA 1MSSA 2G96A 5D04C 4N4PA 2AQWA 2CLMA 2CLEA 2NXIA 3HQ1A 4NX5A 4X9SA 4N9BA 4K6AA 2O7SA 3ZS4A 3UYCA 1VH7A 3NYZA 4UTUA 2QDHA 1LBFA 1H61A 4UTTC 5FF7A 4N6FA 1FDJA 2ZDRA 2J27A 3L9CA 2ZZ7A 3LHYA 3R2GA 2A21A 1JCNA 2ZZ1A 3FIGA 3LHUA 4O54A 3TAOA 1T0OA 3HBLA 4IXXA 1ZENA 1OX4B 3DFOA 4AF0A 1XC4A 2A4AA 3TFCA 1NF7A 3CB8A 1G7VA 1K7EA 4I7VA 4MKNA 4NX0A 3G1FA 2QCGA 1VR6A 4N9EA 1CI1A 3T7VA 1DL3A 3IIXA 1GQNA 3T40A 2A0NA 4O17A 4Q32A 4LU0A 1S5TA 2V0TA 3TFXA 3PULA 2WNNA 3KRSA 1SQ7A 1A5CA 2QCHA 3TW7A 3CU2A 3W73A 5AFDA 4UTJA 2YXGA 4IMEA 1YXDA 1JUEA 2G95A 1PHWA 1SW7A 2ZRYA 1M7PA 3EWBX 5CG7A 4MJZA 3ZWTA 2NV1A 5FEXA 4UFIA 1KM1A 4EF8A 1N8FA 3FKRA 3NM1A 4GUHA 3W7GA 3MP3A 3MP5A 3PVFA 5HWMA 5G5IA 1HO1A 3W07A 1JCJA 2HTMA 2Y70A 2DORA 4WJEA 2BSLA 3WJXA 1N7KA 4XZ9A 3W2LA 3W2NA 1LBMA 1FXPA 3GKFA 2YPIA 3P5YA 1VLIA 3USBA 3G1SA 1TB3A 1GWJA 4MOZA 5D03A 4BWLC 1I45A 4D2JA 2W6RA 3W2JA 5BOOA 3N9RA 5G1TA 4IPIA 2NX3A 1H5YA 1TPUA 3E12A 4MPQA 1WAUA 3WK3A 5I3IA 2Y89A 5I3HA 3TX9A 4PCFA 4AEOA 5D37A 5C5YA 2JGQA 1GYLA 5AC7A 3LTYA 5TQLA 1TQXA 4RZ6A 2P10A 3Q94A 5C54A 4P61A 1MZHA 4MFEA 4S2BA 4UFMA 3G0UA 2A7PA 1WX0A 1TV7A 1WBHA 1QR7A 3BW3A 2D73A 1MO0A 3O6YX 4ZQRA 2Q8LA 3ABRA 4HN4A 2RDWA 1PCKA 3S5OA 1C29A 4JY8A 2QJGA 1LCOA 1OABA 3UQNA 4UMBA 3U8GA 3THQA 1H51A 2JBMA 3MI2A 4R34A 4C1LA 1F05A 4LW7A 3GX9A 3NG3A 3O06A 3W7NA 1J5TA 3H55A 3FYOA 2PRHA 2EAWA 2WOQA 3MI3A 1GVQA 3BARA 1SZNA 2QUUA 3LRLA 4AXKA 3U6WA 5E1QA 2A5HA 5G2HA 4ZQNA 5AHMA 3DH7A 4QM1A 2GVJA 1LTDA 1HFBA 1AL7A 1DORA 1FX6A 1EEPA 5IM51 2OJPA 3PSVA 4MUZA 1SU5A 2J9ZA 3HPZA 3BLFA 1Z41A 1OHLA 5F1UA 1I8JA 4FX7A 4H4IA 2WNQA 4AB4A 3GLCA 2X1UA 1SW3A 3NQEA 3JR2A 4GBUA 4IUOA 2OMAA 5D32A 1K7FA 5FESA 1RQEA 4JYDA 3P82A 1W5OA 3C2RA 3L5AA 3LHWA 3UWYA 5AN7A 3IEBA 3BLEA 5AB3A 2RHGA 3UY7A 3V1PA 2WSRA 3TAKA 3W2UA 5LNSA 1H7NA 4CNOA 1V7YA 1FWRA 2DZXA 1UJPA 4DXVA 4L4MA 4RX0A 4RCXA 3WK0A 4DF2A 4X22A 1JCXA 1GYNA 3CWNA 4WXYA 5FF3A 3W2MA 4NVTA 2QCCA 4J9JA 3CEPA 3LCWA 1W54A 1DBTA 4YL2A 2ISSA 1VYRA 4M5PA 1NVMA 3TIMA 2JKEA 1NF0A 1M7OA 1R30A 2WQPA 3O1NA 2R91A 2X30A 3C2EA 4FO4A 3LV5A 3A24A 5IBXC 3W71A 1X1OA 1UCWA 3IVUA 2IQTA 2RFGA 1QPOA 3BG9A 5BW6A 2YGYA 2FPYA 3ZFHA 2CLOA 2ISWA 2BTMA 3LXCA 2YFOA 4QNWA 3W85A 1JJKA 5AC8A 2RKXA 1GTEA 3WJZA 1OK4A 3LHZA 1KM2A 4OQVA 5KZDA 4BFAA 5CPNA 1W1ZA 5HWJA 1KFBA 4OV9A 1PV8A 2Y6ZA 5I3KA 3BO9A 3TMLA 2DJXA 3A21A 6TIMA 5EYWA 3O05A 3LBCA 2WO5A 3LTPA 2Y7GA 2E09A 2ISVA 4NNCA 1TTQA 3C3NA 5H2ZA 4UXDA 3FA5A 3FJ6A 4YWIA 3QFEA 5EL1A 3NOEA 3T44A 5D33A 4O13A 3MHGA 4ZQPA 2VEKA 2W79A 4JGDA 3PUDA 3O15A 2AAMA 3PM6A 1TTJA 4JICA 3WJSA 1WA3A 4IMFA 3GR7A 2DU2A 4EIVA 1DJQA 1EA0A 3N34A 5A5WA 1GVRA 4A29A 4QQ3A 1SSDA 1ZAJA 4CCEA 5D38A 3A5VA 4WY0B 2V81A 3VE7A 5BNKA 5AHEA 1RQHA 2I14A 3LX9A 4NQ1A 4HNNA 3DU0A 5DBTA 3IVTA 1QWGA 4UTKA 4IXHA 1XI3A 3M44A 3P84A 2ZYFA 4XKYA 3L21A 3FOKA 1PS9A 4UTLA 2EGZA 1Q6LA 3ABSA 1L6SA 2ZQ0A 3DFQA 1W3TA 3PC0A 2EF9A 2VELA 4LNYA 2E6AA 2VFDA 2A6NA 1G4SA 3LCGA 1PCWA 3M41A 3LBMA 2ZZ4A 3NZ1A 3SW6A 2ZRUA 3AO0A 3W86A 3W7IA 3DFNA 2X1SA 1VHCA 1MXSA 3KVMA 4JD4A 4HNTA 4IQLA 2NWSA 3GK0A 4K37A 1WOBA 4HNUA 3C52A 2E5CA 3OVQA 1KLZA 3I7SA 1OYCA 1X8FA 5LHEA 1XDMA 4ZQMA 4HIBA 4HKPA 3ABQA 3GZ3A 5DY3A 4UNLA 3W7QA 2I1OA 4MY9A 1KFLA 1QDSA 3P7YA 3UWZA 1OVDA 4GC4A 1BWKA 2Q3OA 5A8GA 3NL3A 3U2OA 1RQBA 4NXSA 1P0KA 2J9XA 2PURA 3QMRA 1KM5A 1KFJA 4ADUA 2YSWA 1R46A 3NM3A 3E02A 3M5VA 1Q3NA 3V75A 1T99A 2Q8ZA 3UD6A 1LRNA 1PE1A 2HSAA 4PA8A 3HG3A 3STGA 3RLVA 4WZHA 3WJYA 3SGUA 5KINA 1FCVA 3TQKA 3NQ2A 4HNVA 2Y7FA 4LVGA 5U7SA 1P5BA 1IXOA 1XUUA 3DZ1A 1MEHA 2NLIA 1L6WA 2B0MA 4LV9A 3LCHA 5KZEA 3TE9A 3TR2A 1H60A 2GVGA 3M5XA 2ZTKA 3MP4A 1K8XA 2HS6A 5E0KA 3VCRA 3UWQA 3W1PA 3H53A 1QNVA 4WX2A 3MJYA 1S5WA 5F2IA 1RVGA 1ADOA 2QJHA 3MMTA 4BI5A 4N9CA 3SIZA 4CQ9A 3M47A 1H63A 3L5MA 5FF2A 1B4EA 2VEPA 3MWAA 3NVTA 4KWWA 3DHFA 4TU1A 5LNUA 4G1KA 4GFSA 1I4NA 2XFWA 3SSJA 4H3DA 3LRKA 3IIOA 3BGJA 1NFBA 4TX9A 3R5EA 1LROA 1Q6RA 5J5DA 1ZCOA 1YXCA 5DCBA 1XBZA 1F73A 2HMCA 3R13A 5K4XA 4JTGA 2TYSA 4MYXA 1IGSA 3GB6A 3OVPA 3W9ZA 3PR2A 1FBAA 2VEMA 3A5FA 4IX2A 3OA3A 4JNMA 1E51A 2NUYA 2FB2A 4M6QA 2R14A 4OE7A 2ZRWA 2V30A 4HSNA 1DHPA 2B7PA 3HMJG 3BV4A 4Y9AA 2E77A 4TMCA 5KSWA 4ZL1A 1KTNA 3TC7A 2DJLA 1QCWA 3EX3A 3P8IA 4X3ZA 3NL5A 2E5DA 3EEGA 4PL1A 1JCLA 4OU1A 1IF2A 5D2YA 3KFTA 1VCFA 4M7SA 4BI7A 3NQCA 3W7EA 4RXGA 3PF3A 4HSOA 4WD0A 4UR8A 4JX4A 3L0NA 2P0OA 4TR9A 1DQWA 3NL6A 2VKZG 4OBTA 5ABTA 2FJKA 1G4EA 4M6VA 1I2OA 1H7OA 4NT0A 1LP6A 4LVAA 4DELA 4ZQOA 5DCDA 4ALDA 3PS7A 4IX0A 5D2XA 4UUIA 3BK0A 3G3MA 4WOZA 1DOSA 3NPVA 1J4EA 3D0CA 5FF0A 4FXRA 3MYOA 3GNNA 3EB2A 3LGEA 3S5YA 3W88A 5F4XA 5G2IA 4YXGA 2DZTA 1GG1A 3G1DA 3NQDA 1LYXA 3B0PA 4R33A 6ALDA 5I3JA 5CZTA 3G8RA 4A2SA 3TA6A 1S5VA 3STFA 2QAFA 1OFQA 1SFLA 4JTUA 5D09A 1IIHA 1RD5A 1TPFA 2ZA1A 4UFKA 3TW6A 4BI6A 3IVSA 4DO4A 3ELFA 2NUWA 3W1NA 3HIJA 5D2WA 1JCMP 1A5AA 4B5NA 1KA9F 2CZFA 1SZEA 5FEWA 3TV8A 1O95A 1OX5A 3UWVA 2WV8A 1ME7A 5CSSA 1TO3A 4OGZA 5H91A 1P0NA 4IWWA 1VZWA 3VFLA 4TO8A 5SWUA 3O6DA 4Z08A 3EWZA 4O50A 1O60A 3BG3A 3ANYA 4R53A 2XN1A 2A85A 4DO6A 3B06A 2BZNA 2YW4A 3BGGA 1H7RA 4UTIA 5CGQA 4FIQA 3KHJA 5CPLA 5AC6A 4M7TA 3I7RA 4JS3A 1EIXA 4K8EA 3DGRA 2BWGA 4YMZA 4XWUA 3BVJA 5HINA 1GT8A 3W2KA 5D30A 3C2VA 4A2RA 7TIMA 4RZ5A 1ZFJA 1U5JA 3C2OA 4JTTA 3QC3A 4Z0SA 3I65A 5LNRA 2FPTA 3HJZA 4UIOA 3CEUA 3HG2A 5I3FA 1Z48A 3LDVA 1FCQA 2P1FA 1XL9A 1MEWA 1JRBA 3Q2DA 1TCDA 4N2YA 4EOUA 2CZDA 3M5ZA 3P8JA 2NWRA 5HQEA 4O8RA 2WKJA 1QAPA 5K2ZA 2V5BA 4UNKA 4DQWA 1SZFA 1FCUA 1GG0A 4CCCA 4C1KA 4GE8A 4XBSA 5DXXA 3UXAA 3R89A 3K30A 1X6UA 4WOQA 4O1BA 5K9CA 2DZVA 3RF9A 4LUJA 5HR7A 2FIQA 3UWWA 1ZALA 2ATSA 2E6YA 5EMUA 5LNWA 4Z1DA 1TPDA 3CWOX 4AWUA 1YYAA 1YXYA 4RKAA 4YCPA 4DPPA 4O19A 2ABBA 1KTBA 3NA8A 3PBWA 1OX4A 5HUPA 3NZRA 3S1XA 3I68A 5LGXA 1G4PA 2CLLA 1I2PA 2H6RA 2DZWA 2OT1A 2ZZ5A 2PRLA 2H3DA 1KM6A 1QPNA 2Z1BA 3TU9A 5KTLA 2ZRVA 1PL9A 2E1DA 1ONRA 4JIQA 1SUXA 1TJRA 4NXKA 4PL2A 3DKLA 4GUFA 4LWWA 1ICPA 4JTJA 3W3OA 4BF9A 3T78A 1W56A 4O1AA 3G0SA 1ME8A 2NUXA 3W1QA 4UFJA 5BRBA 4NJJA 3I7QA 5G4WA 2QKFA 2NXGA 3VKJA 4IMCA 8TIMA 4JYFA 2OCZA 3UNDA 1NEYA 3B0UX 1PVNA 4E2DA 2YR1A 3CC1A 3OIXA 2QDGA 3PBVA 1BKSA 1XCFA 3GDKA 4Y8FA 2ZBTA 1WQ5A 3IIVA 2B7QA 4LVFA 1H7PA 3VNDA 3W7JA 3S1UA 3G1AA 4MLJA 3SY5A 1JCYA 3PBUA 1T96A 5L9FA 1AW2A 1OK6A 3FFSA 1I2QA 3GIYA 1BWLA 1FDZA 1TPVA 4ML9A 1GZGA 4FNSA 3BPWA 3S5NA 4UFLA 3HB9A 1S3HA 3EXSA 1TSIA 4JN6A 2J88A 4Y6GA 4JXCA 3EX4A 3KRZA 4K38A 1F7BA 1JQXA 4MY8A 3G0XA 5CPOA 3HPSA 2Z2UA 3CM4A 4IJBA 5U4NA 1J2WA 5TIMA 1LORA 3EWUA 3CIWA
chains in the Genus database with same CATH superfamily
2Y5JA 3P0XA 2BXZA 3N2MA 3PZOA 3WBXA 4HOWA 3B4UA 1GPWA 2ZX7A 4UZSA 1EWDA 4NZ1A 1S2TA 3H4XA 3OP2A 3H7VA 3RM4A 4M82A 3B8WA 1JYNA 2VMFA 3W6YA 1EWEA 4JTEA 2YB4A 2EKCA 2VFIA 4JOMA 5LZLA 3U5YA 2TSYA 1QO2A 1BAGA 3O6CA 3R4IA 3OLEA 5HULA 1S2VA 3P80A 4NJKA 1VBGA 3LS9A 4GVFA 2V3DA 2VM8A 3STPA 4L7ZA 4XB3A 3WEMA 4IIGA 4JL2A 5BRQA 4H00A 3PHAA 4HN8A 1JR1A 3THDA 3ARVA 4LH8A 3GNXA 2PLKA 4XD3A 4QS5A 3OJGA 4WKHA 3RUBL 3SAZA 5I06A 1O12A 1JGMA 2NSOA 1QI2A 1FH8A 3DC0A 4R7OA 4D9PA 4YVPA 4QP0A 1JF6A 3N04A 3MBDA 3ATZA 1Q6DA 3TTOA 3NAVA 1RP8A 3BURA 2ZE0A 3G6LA 3CYJA 1I6NA 1R47A 3KX6A 3A22A 1E1CA 3IJQA 3TN5A 1EJUC 3M0ZA 1N8IA 1VCGA 2IW0A 2YDQA 3E96A 3C2FA 3KM8A 1LZOA 1H1NA 4LYQA 3AMCA 1OB0A 4HT3A 1RLCL 3KVJA 3FJLA 3VIKA 4CNNA 2CC0A 4G1NA 2QIIA 1J18A 4UQAA 3VCNA 4O10A 2B4GA 1ZRQA 3WD0A 3B40A 3AC0A 1W5PA 3P6LA 1E6QM 5AHNA 3IIZA 1GTHA 3PPFA 3IGXA 5CZKA 1Q8JA 5F4WA 3LZ5A 4DAFA 5JH1A 2WJZA 1W8SA 3T8QA 3W23A 5DRCA 3AIEA 3KBMA 4S3AA 2Y1HA 1UBPC 4HHPA 5KZMA 4XIAA 2BLEA 3TH6A 3RG6A 3T55A 4JFUA 1IEVA 4OZOA 1IR1A 3WK1A 2ZZ3A 1EEXA 4W7WA 5GNZA 3H26A 5C9XA 1NDYA 3S5SA 4J7RA 1SPQA 2QAPA 3IIPA 5HOSA 1LUCA 2FFCA 2A1YA 3JS3A 1DJGA 2PDIA 3RMJA 2FKPA 5HXMA 1GOXA 3DFPA 4KRUA 4JFTA 2DFAA 5DMNA 4NYYA 4GI9A 1UOKA 3PTMA 4TX6A 1IYXA 1A5SA 3N12A 2B81A 4CGTA 1TREA 2GGJA 1J0ZA 4HD5A 3GYEA 4KEMA 1LBLA 1D7KA 4JFVA 4NJGA 2AGTA 2XSXA 4UTWC 2FHBA 2G4JA 3ARXA 2HISA 1W3JA 4PZVA 2RH9A 3T81A 4R85A 4DX3A 1OFAA 2SFPA 1FWTA 1XYLA 2V69A 2CLHA 1XYFA 4U3CA 1DQXA 3G1VA 3TQ0A 2Z4GA 2PFHA 3WUGA 2PE4A 3SFKA 2GQ9A 4AUBA 4EE9A 1XG3A 1YW1A 3IV3A 2HNHA 3GH7A 4FALA 2EG8A 4LB4A 1M6JA 4DRSA 3R94A 1PKLA 2E6FA 2ABAA 3CLMA 3GFXA 4GIRA 4LV4A 1OM0A 2DW7A 4RR4A 3A9IA 5G2WA 4LAUA 1H7WA 2VC9A 1EOKA 3PNUA 1HO4A 2H8XA 1U5HA 2FDSA 2FFIA 3HJEA 3QTPA 1A4LA 4PMYA 3SY8A 2C14A 1L2UA 1DWAM 5K3VA 2ZZ2A 3CASA 4C6PA 2WMHA 1ZP3A 1WZLA 3MA8A 4PMXA 2P53A 1VQTA 4CCDA 2MANA 5C7HA 1ZSXA 4GUGA 4XISA 2XN0A 3ARTA 1GKQA 4S38A 3SCWA 2QLYA 2P76A 1AH4A 3MQTA 3QKEA 3EX6A 3CZKA 5FD0A 3CYVA 1EX5A 1DJNA 4YWSA 3UPWA 3R8GA 2QPUA 3R0KA 1XUZA 4LJ3A 4EP8C 3VD4A 4JN8A 1TTPA 1X6LA 4J3VA 4Z42C 4FNRA 2CCRA 9XIMA 4GXWA 5HUOA 1UKQA 5BXSA 3CTLA 3OG3A 3TJLA 4RLIA 2NQ5A 1C93A 1KBKA 1HT6A 3INPA 1PIIA 4FZIA 2J13A 3NO5A 3ZJ7A 3BLIA 3T0DA 3WEOA 4ZMGA 1CGUA 3HPAA 5GJNA 1MZRA 1FWNA 1UD5A 2P0IA 1W31A 4QE1A 3VFCA 2FTPA 1B31A 2YBVA 5G1YA 4TIMA 4A3RA 1XHGA 5I3DA 2CLPA 3APTA 3QY6A 3EEZA 2ZADA 3WBAA 1X7FA 1TKKA 3EX2A 1ADSA 1V3KA 2YCIX 3NQFA 3ZYZA 3HN3A 4B3ZA 2E0PA 3GNDA 1JD7A 4ML4A 5H8PA 3GR8A 3GWQA 4HZ8A 4GVHA 2YCKX 4C91A 1XD0A 1L8NA 1TFVA 1R2TA 3A23A 2GSJA 4LGXA 1OFRA 1SJBA 2NZLA 1JPIA 4HPJA 4GACA 1P0DA 1P4CA 3EMQA 3WG6A 5J5RA 4AIUA 3QTGA 3VXGA 1XV8A 1WE5A 3NDOA 5HQLA 2INEA 2WSKA 1UC4A 3K8KA 5EU9A 1X98A 1Q63A 2XFFA 2YFNA 4ZOEA 5CC7A 1XIHA 3RCMA 5HWNA 2XINA 4FXSA 3STEA 1TV8A 3DGBA 1KM3A 3B0VC 4FX8A 3RR1A 1YTEA 1QNRA 1UUOA 3GH5A 3P2VA 3RHGA 3EKLA 3WENA 2A6LA 1S46A 1S1RA 4JTAA 4JTLA 3LUTA 1JFHA 2CEQA 4YVXA 1S2WA 3BW4A 2V5LA 4PFMA 1SR9A 2A3AA 3W7CA 1K6AA 4LAOA 4CD6A 4KEVA 3UF9A 2F6KA 3W0KA 4Q22A 1DWIM 1D8CA 3QYQA 4MZ8A 5T26A 1HTIA 1QTWA 2XH7A 2O0TA 4Y2WA 1GK8A 2VUNA 1P1MA 4KH2A 4C6EA 1TPB1 1S5MA 4DYJA 5HNUA 2WSYA 1GJPA 3KVLA 3AYTA 3KZPA 4NF7A 5DF0A 2IS7A 2QJNA 3KCJA 4RXFA 2GJLA 5DELA 3BOFA 3UR2A 3W7MA 3UG8A 2BX7A 3W1MA 3U57A 1B3OA 4IPJA 3NQ8A 4JPGA 1EQPA 2B7OA 3RX2A 3BDKA 4MJMA 4QLKA 2OX1A 4NUWA 4MHBA 1UROA 3UGVA 4E4UA 4O1DA 4DLFA 2VEGA 3ITXA 2CBVA 2WM1A 3MO7A 3ZJKA 3H7UA 1WKEA 3DFYA 2NV9A 3BICA 3M0IA 2QCFA 5BZAA 3D46A 4UCGA 3ARWA 3IJDA 1XW8A 3NL2A 3FA4A 2XH4A 2F9RA 1RCOB 3B0YA 3CHEA 2WZMA 4JTFA 1XM3A 1A5BA 2BV9A 3E2SA 3PTDA 1EUAA 1PBGA 4BR1A 4UR7A 2QCDA 3OODA 2HZGA 3WN6A 3WNMA 3VZYA 1DKWA 1NWTA 3IAPA 1TRDA 3TWBA 6PTDA 8XIAA 1I9CB 3VK5A 4XZMX 4WJXA 3C5QA 5CLWA 2E9MA 3GC2A 3VINA 4AD4A 4QDPA 3ARSA 2BXVA 4MAVA 3GDTA 3RK8A 1L0PA 4LS1A 1R7OA 4C6FA 4DJEA 2VP8A 2UY5A 1DVJA 4W7VA 1CWYA 2CLIA 1B3WA 3TROA 3PBMA 4CU8A 4ERGA 1OFOA 2ZX9A 2YYTA 3BAYA 2TMDA 1YTDA 4QJ4B 1C91A 2YCJA 3VKBA 3A64A 3DI0A 3OZMA 1KKRA 3N25A 1C8YA 4W9TA 1XICA 4NAFA 3MUAA 3WBYA 1EDTA 3DXIA 1KKOA 2QUVA 4QITA 3TXZA 4GCAA 4JDYA 1MW0A 2ZZ6A 4H7CA 3CMJA 4IF2A 4L6HA 3VKAA 1TZZA 3FLUA 1P7TB 4C6BA 1IIGA 2VOMA 1VGAA 3L4XA 1JAKA 1DJHA 1NP0A 1NY1A 3QLDA 4RNFA 4ORMA 3FS2A 3B8VA 3IUIA 4X61A 4DWSD 3CHDA 4B15A 3KLKA 3DBNA 1CNVA 4PRTA 4Q4PA 2PDMA 4QSHA 2PBGA 1KQYA 2XZ9A 2P8BA 4O8AA 1CTNA 1CXKA 3EOUA 5ECUA 3EZ4A 3G18A 1VIZA 3IACA 6XIMA 2DIJA 3EYPA 1UKOA 4GRSA 4AX6A 4LF1A 4LUIA 2O4QA 3DYOA 2OEMA 1AJ0A 1RSCA 1YDNA 3V16A 1OFDA 5LHFA 1PX4A 4O52A 3QMTA 3KBJA 2BY0A 3OYXA 1CX9A 4NJHA 2J8FA 5JBEA 3B0XA 3HU7A 2FH6A 3GDRA 3RAOA 2RDUA 2OTDA 4PMJA 1IEWA 1T5AA 4XUGA 1H62A 3WF2A 2W61A 2ZX5A 3W7HA 1U83A 1V02A 1JYXA 3QQ1A 4GJ1A 4IP4A 3QM3A 2XIQA 2REQA 3BOXA 3MHFA 5A94A 1YPIA 4QNEA 2NX1A 2C1GA 4HPXA 3NNTA 2CLKA 3TMQA 1XDLA 4AD2A 5C9RA 4EACA 2GPTA 4B3LA 1K02A 1LRTA 1TELA 4DO5A 4E0CA 3LB0A 4A3UA 1ZBKA 1OQFA 3HQPA 4WQ6A 2ZRXA 4HA4A 2CWNA 2PCEA 4FOKA 4NNAA 2OZ3A 2JK2A 3O3RA 2A79A 2TRSA 4XG1A 3M1ZA 2D24A 1XRTA 1JDFA 1NAL1 2PSNA 2PP1A 2PEVA 4PE8A 2VXNA 2XVKA 3UY8A 1ONWA 3AHZA 1QFEA 4OBRA 1VBHA 2R1LA 3M0HA 2DT1A 3V3WA 2I9EA 4AD1A 3LPPA 2WZEA 3W01A 3VGBA 5HNRA 3ARYA 1A3HA 4P5UA 2ZA3A 1XLAA 1TPH1 2VT0A 1EXPA 3IGSA 2X0HA 4M1RA 1TUXA 1XR2A 3QV9A 2QW5A 5TBOA 2BOGX 4X0VA 1UA7A 4AVFA 3O07A 3O7UA 1FWBC 1AG1O 3PG9A 2OFJA 3TKFA 3KTSA 2V2CA 2Y61A 3W84A 4S3DA 4MF4A 1PIGA 2JQXA 4HHLA 1KRBC 3VGEA 2DQWA 3RJYA 3AS1A 2G96A 5IHSA 3BGAA 2AQWA 4HA0A 2OLSA 3K46A 1Q7ZA 2Z28A 4N9BA 4K6AA 2PDJA 4D71A 3ZS4A 1VH7A 4UTUA 2E7FA 2QDHA 1BG4A 4JHOA 5XIMA 3SCSA 2J27A 3LHYA 2A21A 1JCNA 2VNCA 3T09A 1RLDA 4AZHA 1OX4B 3DFOA 1EF3A 1XC4A 1NF7A 1G7VA 4I7VA 3RGTA 3SQSA 2GVEA 3G1FA 1VR6A 1CI1A 3IIXA 1ZJHA 2ACQA 1EYWA 3KRSA 4ICCX 4AXNA 1A5CA 1V0MA 5FCZA 4YHGA 5AFDA 2YXGA 1JUEA 4F0MA 1QWKA 2ZRYA 1M7PA 5M1TA 1BGGA 2NV1A 4UFIA 1QNQA 1KM1A 3FKRA 2Y8UA 1ZCCA 3W7GA 3MP3A 1BQGA 3PVFA 4U5KA 5HWMA 3GU1A 3W07A 2BVDA 1R3QA 3M0JA 1JCJA 1UUQA 3GY1A 3WUFA 2XDFA 4QAWA 3WJXA 4XZ9A 4LUTA 5BXTA 3W2NA 1LBMA 2ISDA 3G1SA 3KL3A 2VO5A 1GWJA 2X1IA 3J7HA 4EPKA 2DIEA 3GHSA 1RCXB 5G1TA 2NX3A 3GTNA 4GX8A 1VFLA 3E12A 4XZWA 1WAUA 4TX8A 5I3IA 4C6IA 4L65A 5HPCA 3TN3A 4PCFA 1GVYA 3AHXA 3MPGA 2WHJA 5C5YA 2V3FA 1V8EA 5AC7A 1TQXA 3UJSA 2P10A 5JMUA 4P61A 2XUCA 4KEZA 2F6UA 2PLJA 1XLLA 4J3ZA 2ZUTA 4L1XA 1OCQA 3U2CA 4BY3A 4HOXA 7TAAA 5CPQA 2RDWA 2WC7A 1Q13A 4HBKA 4JY8A 2FTYA 2QJGA 3GC5A 4FMVA 1I1WA 3UQNA 3U8GA 4YJ5A 2QDDA 1H51A 2JBMA 3T2QA 3TW9A 3VO0A 3W7NA 1SYTA 2G3MA 2PRHA 1IT7A 3WQGA 2EAWA 1JFXA 2IKJA 1A5UA 3PZTA 3K8MA 3TLLA 1XLKA 3BARA 3PTQA 5A8PA 2QPSA 3TYDA 3VNIA 3ZSTA 3U6WA 3R7MA 1XLDA 3E0VA 1V3MA 3K5XA 2A5HA 3W82A 5AHMA 3DH7A 4QM1A 1LTDA 3K4DA 1AL7A 1DORA 1FX6A 1M9HA 4MB3A 2VGIA 1OC6A 1SU5A 4H04A 2QQ6A 4FX7A 2WNQA 3BMVA 4PYSA 4AB4A 1UMLA 4QXIA 2X1UA 4B91A 5CAHA 2DUZA 4YTSA 1PB0A 4IUOA 2OR2A 1ECQA 1XSIA 3UWYA 3IEBA 2RHGA 3LSCA 1FHVA 3W2UA 3LEPA 3M7SA 5LNSA 1H7NA 4WLCA 1V7YA 4D8ZA 4DXVA 1U1HA 1MRQA 4RCXA 2QZRA 1UWRA 1JXKA 2P3ZA 2DDXA 1GORA 5LA0A 4EKJA 1EQCA 1GYNA 2G50A 2WVSA 3CAKA 3CWNA 4WXYA 5FF3A 2D0HA 5A8NA 4J9JA 4H8VA 1PWMA 3FHQA 2QPXA 4FI4A 4GXPA 4PULA 4PTWA 2DZAA 2Q02A 1XIDA 3C2EA 4S3BA 4FO4A 1IEQA 2CHOA 2RFGA 1V0KA 3QHNA 3ZFHA 2Z25A 4H7VA 1CGYA 2ISWA 2BTMA 1LUCB 3ARPA 3IJ7A 4QNWA 3W85A 1JJKA 4L64A 1GPFA 4S39A 3WJZA 1OK4A 3LHZA 5DRIA 4HNOA 3WF1A 3UCQA 4BFAA 4DNMA 3T0BA 1E72M 3POHA 1W1ZA 2Y6ZA 3BO9A 3U48A 1YX1A 3A21A 6TIMA 1Q2SA 1ECEA 2E09A 4AEFA 1JZ4A 2ISVA 4DZIA 4MJ2A 4QE5A 2YA0A 3E74A 5AZ1A 3WLHA 5D33A 4KWOA 1V51A 4P8XA 3NWRA 1W3KA 4GYFA 4PMOA 4JICA 2CESA 1E71M 3WJSA 3GR7A 4GJJA 1B9ZA 4EIVA 1DJQA 1DHKA 1REQB 4G9PA 5A5WA 3AMGA 1JPKA 1LL6A 1MUMA 2V81A 2I14A 2QJMA 3DU0A 5DBTA 2WK2A 4AISA 1W9XA 4J3XA 2ZYFA 4XKYA 3BZGA 3TZNA 1OGGA 1W8GA 4KIEA 3G2GA 4PSPA 2EGZA 2PP3A 1Q6LA 4IPPA 3H2CA 3DFQA 3OGSA 5T8GA 3PC0A 2A3HA 1CGVA 4RDZA 1MDRA 4JFSA 5HPOA 4PUNA 1K9TA 4GBDA 9XIAA 3NZ1A 4DJEC 4OTKA 3GDBA 1I1XA 1ELSA 2X1SA 3ZT5A 2NWSA 2HCVA 2VD9A 8XIMA 4D6CA 3PZVA 4M56A 1PTAA 2DW6A 2OYMA 3I7SA 1OYCA 1XD1A 1X8FA 5LHEA 2P50A 4E3VA 4DYKA 2PTWA 1CXIA 3BCFA 3WUEA 1FWJC 4WF7A 1GONA 1KFLA 3CUJA 1QDSA 4WGXA 3ZLHA 1BWKA 3KTXA 5A8GA 3U2OA 3NL3A 4KS0A 1H11A 3N17A 1DIOA 2BVYA 1KM5A 1JG9A 2WB5A 1R46A 3QV8A 3NM3A 4PRRA 3M5VA 1T99A 3A4WA 1LRNA 4H6EA 3FV9A 3RLVA 3IARA 3SGUA 4JTDA 4H6RA 4K8GA 5PTDA 5U7SA 4HTBA 4TOQA 4L5ZA 3IS4A 2XIIA 4LV9A 4N7QA 3NXLA 1OADA 3CL8A 7ENLA 2NT1A 2ZTKA 1K8XA 5E0KA 3MTWA 3UWQA 3UT0A 2WANA 1A0DA 4CVWA 2IKGA 4GG9A 4M24A 5F2IA 1WXZA 4HCDA 3VOFA 2WVVA 1ADOA 4BQ4A 3GTFA 4Q8PA 4N9CA 4CQ9A 1B4EA 4LAZA 3NVTA 1CT5A 5LNUA 1W9DM 1M1BA 1I4NA 4DWSA 3URNA 4HHMA 3SY1A 2OWXA 1TVLA 3LMYA 3BGJA 2GJPA 1LROA 2WHMA 3TLQA 4DZ5A 5IHRA 1WDDA 4HYRA 3UGRA 2Z27A 1F73A 2HMCA 1PZ0A 4GJIA 3O0FA 3R13A 5K4XA 4JTGA 2VDGA 4MYXA 1TR9A 3C0QA 1KCXA 3AS3A 3OVPA 4IX2A 3OA3A 2JALA 1UW9A 3IJIA 4JNMA 4MUPA 2FB2A 3FW6A 4NRSA 4DUOA 1NDZA 3M0MA 8CGTA 2IUZA 3REQA 4ZL1A 5HATA 4BKNA 2ZC1A 3TCSA 1TCMA 2DJLA 1QCWA 3QFWA 3EX3A 3D47A 2DY3A 5D2YA 1EJWC 4QX4A 1MXDA 3DG7A 3VZZA 3SN0A 3NQCA 3UJFA 4RXGA 4WD0A 1ZZMA 2P0OA 3URBA 2VJXA 4FLQA 3NL6A 4OBTA 3COTA 1H7OA 4JTRA 1BD0A 3WF4A 4DELA 4IUGA 1GKRA 1LLOA 1IT0A 4OUEA 2XIOA 4UUIA 3G3MA 4WOZA 2PWEA 4D8AA 1EC8A 4DM1A 1U33A 3D0CA 4FXRA 4XKMA 3LGEA 1NIUA 4YXGA 4HU4A 2DZTA 3VGDA 3NQDA 1AODA 1LYXA 5I3JA 1R5YA 1RK6A 3K4WA 1SFLA 2W4XA 1RD5A 3QYSA 3V36A 2TODA 2C0HA 4A3QA 1TWZA 3IVSA 2OGYA 1WKDA 3THUA 1TR1A 3PBGA 2NUWA 3W1NA 1OC5A 2GDQA 4DJFC 4B5NA 1KA9F 2QYGA 1SZEA 3TV8A 1LG1A 5AZ0A 1OX5A 3HZ3A 2WV8A 2R82A 1M68A 5HNNA 4OGZA 4LF2A 3EAUA 1UJQA 3AYSA 5B7ZA 1VPQA 4ILSA 3TOYA 4TO8A 5SWUA 3WUBA 4Z08A 4O50A 4KETA 3AYVA 1O60A 4HZ7A 3ANYA 4R53A 3SRDA 3Q4DA 1S5NA 2A85A 4DO6A 5ECVA 2BZNA 1JCTA 4UTIA 5CGQA 1NOFA 5CPLA 1OD0A 4M7TA 1R6WA 2FGLA 1EIXA 1VBRA 4YMZA 1PZ3A 4MWAD 3MANA 3E2RA 3C2VA 4RZ5A 5CH9A 3S9IA 1U5JA 3QC3A 3CEUA 5I3FA 2F2KA 3QXBA 3GHUA 2ALRA 1F9CA 1MEWA 5EMJA 4GKTA 4IP5A 4R9OA 4N2YA 1MW3A 3K1DA 2CZDA 3AS2A 2I5IA 4CU7A 2OKTA 4EAMA 3ES7A 5K2ZA 1V02E 3AAMA 4UNKA 4DQWA 2OG9A 1FCUA 1MI3A 3FK4A 2O4MA 2WWCA 4S3JA 1UZ4A 3GTHA 3K30A 3EPNA 3L2LA 3WEZA 3AZSA 1GZJA 2AAAA 3ZVHA 2FZ9A 4HA1A 2FIQA 4D8LA 4GVIA 2XM1A 3BAWA 1L6FA 3TTSA 1YPXA 4OOZA 4ZE4A 5HNTA 4S3GA 3CWOX 4AWUA 2XYLA 1YE4A 1YYAA 4RKAA 4YCPA 1FHDA 4I8DA 5JIWA 3PBWA 3OB8A 4AIOA 3I68A 3HURA 4GO8A 2OT1A 1KM6A 1QPNA 2Z1BA 3LBOA 1AD4A 1US2A 1PL9A 2FVMA 1HJQA 4G56A 4HHHA 1MWOA 2NUXA 4JTQA 3P0WA 3W1QA 4JNZA 3E5BA 2HROA 1GOQA 4E6MA 2FZ8A 4IMCA 4G7EB 3VIGA 4JYFA 4ERIA 2OCZA 4W93A 3EA2A 1J6OA 4X0NA 3TQPA 4PN2A 3CLWA 3CQKA 1NFGA 2ZBTA 5MKGA 1LQAA 1TE1A 1H7PA 3W7JA 3BMWA 3VILA 1JCYA 2R9RA 3FFSA 1PWLA 3CGTA 1FDZA 1BLIA 3T05A 1GZGA 3EXSA 2CWXA 4JXCA 1JQXA 1FWFC 2Z2UA 3CM4A 5U4NA 1J2WA 4JNYA 1HVQA 1BRLA 1V4YA 3AJ7A 4WEVX 4IOTA 3SCTA 1K8YA 1PXGA 2Y7DA 3I3EA 3ZWSA 1RBLA 3M0KA 1X1NA 4ZB5A 1Q8AA 2Z24A 2EG6A 3LLXA 3WF3A 2G37A 2VC6A 4K2SA 5E6ZA 3GXMA 3VOIA 4LRSA 4PR4A 4F0RA 5AVNA 1FP9A 4X9YA 2WPBA 1V08A 4O14A 3L67A 1YPFA 4GNJA 4NP7A 4OJYA 1NSJA 4Z0JA 2Z7GA 3A3HA 2XTKA 3PTKA 1KV5A 1C7SA 3QR0A 4W4QA 3ZIZA 3PAJA 4U4MA 2DZSA 1TWWA 3TTYA 3N1AA 5AOUA 4O4WA 4S23A 3KS5A 5CSYA 3PWAA 4N4QA 1V3IA 1EP1A 1TJ0A 4JX5A 1X97A 1NQ6A 1T6MA 3NQAA 2DZPA 1S2AA 5MHBA 1EF2A 1YRRA 1AW1A 3UZYA 3NO3A 3W75A 2AGKA 2J25A 5D2VA 2INFA 3M5YA 5FAJA 5AYZA 2ZTJA 4EPEC 4E5TA 2V2DA 1C8VA 4HU0A 4DEFA 2CHRA 4XTIA 3U7VA 2Z6IA 4F40A 3B03A 2YKKA 3S8HA 2VR2A 3CZ8A 2QCMA 3B9EA 1HG3A 2XVPA 2Q3RA 1LT8A 3LXAA 5C55A 2HS8A 3NQ6A 4Y90A 2A3CA 1RR2A 4KWUA 2F6XA 4Y7EA 1BEUA 3CT7A 4E8GA 5AC5A 1VC4A 2PLMA 1LM1A 4E4PA 3GG8A 3GQYA 1W2PA 4A4AA 1GNXA 3F4WA 1KQZA 4IHCA 2ATMA 3LLDA 5A8OA 1X7IA 3WKZA 1PAMA 3S9YA 1XKJA 5IRPA 2ZFAA 1TRIA 3GG0A 3U9IA 1CZ1A 1HJWA 2QXWA 3EMCA 3I3BA 3VIPA 1R38A 3CHCA 3AS0A 3VDGA 3HPXA 4K39A 4GGHA 4RE2A 3EGJA 1QHZA 2V3GA 4D1JA 2XN2A 5CKSA 5D9NA 1SM9A 1HNYA 4JDBA 2VDIA 3AWOA 1H41A 2Y8VA 1EX1A 4GQBA 4IMGA 4PUKA 3NOYA 4LCSA 4FNTA 4BS0A 1POKA 3VTRA 2ZXDA 4FEZA 3WLLA 3H8AA 1D3HA 1QW8A 3PP7A 3LRMA 3RX3A 2Y4SA 4W86A 4ZGYA 3F4VA 2XU2A 4IIHA 5A8MA 1O7AA 1JI1A 5T9CE 1AH3A 1KFWA 3TSDA 5CC6A 3E2QA 3UCCA 1SZGA 4UWMA 3S1WA 4WY0A 2FGBA 2RAGA 1XQKA 1S2UA 3AFBA 4M19A 1KTCA 1ISXA 1DXIA 4W8BA 4PH6A 1QNOA 5HDRA 1SVDA 2PDNA 2ZA2A 5TNVA 4R88A 4ZODA 3UR8A 3PPGA 2D69A 1PZ2A 2BOEX 5JIPA 2EBNA 1UD4A 1OYAA 1VKFA 1KFKA 3OLGA 2C19A 1Q2RA 1OINA 5F1VA 3EDDA 4H2CA 3AU6A 4R27A 3S6TA 4UTTA 1MQRA 1E9IA 2X7WA 2ISFA 4AWTA 2BFGA 3GXFA 5KETA 1ICSA 3OYZA 3TK7A 3HO8A 4LUTB 3GXIA 3OOQA 3MZNA 3O8AA 1V03A 3BH4A 5EMLA 3PG8A 4DF1A 3LG3A 4QS6A 1UA3A 1VEMA 2WBGA 1GVSA 3ZLGA 1SR0A 4IL0A 3UP8A 2OWWA 4Q4KA 5FI8A 4H6KA 3AISA 3ARRA 1GVEA 3DENA 4ADSA 3W7KA 1OG0A 5C6MA 1G5AA 3GDLA 1XF0A 4O0KA 2Z1KA 4ZQCA 4O53A 1PJ9A 4HSHA 4OV4A 5I02A 3SSZA 3VZXA 3MW7A 3ORWA 4M3PA 3LTSA 1U30A 1GJUA 4ENLA 1FWWA 1XINA 2CYGA 1QT1A 3WQ6A 5GJPA 2NV2A 3HGJA 3VOHA 3N2TA 2O7QA 2VL4A 3TYEA 4ZO6A 3N19B 3LU2A 3ARZA 1I2RA 4O57A 1TG7A 3SRHA 1NP2A 1SO6A 2JGYA 1Y7VA 3DERA 5CSRA 4IG2A 1A4MA 3S2LA 3DN5A 3ARQA 1EJRC 4E38A 4TVDA 1WCGA 4J3UA 4DUXA 4QISA 3E3HA 3BCJA 3W1XA 4C5YA 4KT2A 2VEIA 1CEOA 1B3ZA 1J93A 4C65A 4K3ZA 1VIWA 2FPVA 4P7OA 1A5KC 1J5SA 4QIUA 3N3TA 2PODA 1VPXA 3SCRA 2VZSA 3ES8A 4NZFA 4U33A 3TYBA 2VZOA 2BP1A 1C7TA 4LANA 1LRQA 3DYPA 4O16A 4QR6A 1J0YA 2RJHA 5AHFA 2ODOA 4XSMA 2B7NA 4ONVA 3H2MA 3OVGA 4AZ6A 3NQGA 3FKKA 4J2PA 1UD8A 1IZCA 3G3DA 1WBJA 2EPHA 2G0WA 1B57A 1BKHA 3ALFA 2WMIA 1US0A 3ITVA 3GH4A 2DP3A 1EFZA 3P61A 1W6TA 2XPKA 2WZHA 3DYMA 1JZ2A 4EF9A 3IK4A 4F9JA 4N6EA 5AHIA 1CXFA 3OQEA 4XVEA 4CEXC 1EYEA 3QJAA 1BXBA 4E8CA 3OBKA 3SI9A 2QR6A 1XX1A 2OO0A 3HGOA 3GW0A 3QSRA 3R12A 4F79A 2VX6A 4LVBA 1EHAA 1TV5A 2DSWA 1JXJA 5FL1A 3WYZA 5DN1A 3SR7A 4YNGA 1BVZA 3QRHA 1VPYA 2WCSA 3A13A 4IQJA 1MEIA 4X2PA 2VX5A 4WXZA 1Z69A 1A3XA 3P3BA 4GCXA 3UJRA 3DECA 4ZCWA 4P8WA 2BDQA 2YB1A 3KVKA 5HJLA 3WH5A 4ROQA 1UOZA 4MWAA 3V5CA 4IP7A 4WVXA 1K7XA 2CZ5A 3NSXA 1ZY9A 1WOAA 4K8HA 2VRKA 3GFYA 2B31A 3IRSA 3WD3A 1JYWA 4XKYB 4CVUA 2PWUA 5HMSA 3W7OA 4AMAA 3N4AA 3UPMA 4L4OA 3T0CA 3AXMA 1ZBWA 4XAZA 1WNOA 3XINA 4KGJA 1FTXA 4HCHA 2X7VA 4M8UA 3A3WA 1E40A 4QDMA 2FLIA 1E4IA 4ZB2A 3UXDA 3THCA 1MRAA 5HJYA 1J10A 4JTCA 4U31A 3WQWA 1ITUA 1OWQA 2NXHA 5TF0A 3URQA 2QV5A 4Q33A 1HQTA 3QHOA 3GUGA 4LTSA 3SRKA 3SUUA 4QFUA 1OD8A 1L6YA 3WD2A 5FEPA 3B3DA 3VCCA 1B3VA 3BAIA 3BJFA 1RPXA 3VOGA 3NURA 4AHPA 2HE8A 4LYRA 4AWSA 1OBAA 3RO6A 4HPNA 1S39A 2AL1A 2WCAA 3WNNA 3S6DA 1V5XA 1UQYA 4OECA 2DSUA 2EJAA 2GQAA 3QH2A 3I4EA 2YW3A 1A0EA 3TJ4A 4HPGA 3C6CA 3HGSA 3ITTA 3O63A 3C61A 4TVCA 4IFKA 2QCNA 5FJRA 2PZ0A 2X1TA 3DHUA 5DT5A 2HBXA 2XFYA 4JIPA 2Z1WA 3IGUA 3PB2A 4JIRA 5FJJA 4PUMA 1OSEA 3SUSA 1YDYA 1F3TA 1IXQA 3CZEA 1F2JA 4UMCA 2CHNA 3WMBA 4I6VA 1HL2A 1BYBA 5F4SA 5G4EA 4DWSB 3EMZA 1WZAA 3CAWA 3N9KA 3ATYA 2P8CA 1J96A 2EEXA 4GX9A 3QQ0A 2LLEA 3EPMA 3CL7A 2W0UA 1FCBA 3PANA 3U7BA 4NL1A 2MNRA 4OT7A 4OFCA 1DJWA 1TIMA 5DY2A 5A6LA 2PDLA 2XSAA 4AX7A 1QO5A 4GZ7A 2QF7A 4UOZA 2HQAA 1XG4A 2YYUA 1MXGA 3UEQA 3GIQA 4NZJA 3T4CA 1FWDC 5JQ9A 3GW3A 2Z6JA 4FF5A 2VUYA 1F6PA 4OOUA 1RZMA 1MQQA 1XLCA 1KGWA 1ZB5A 3ZVIA 4JQ2A 3L2IA 3L68A 4O11A 1LOLA 3TJXA 1VRDA 1HUVA 4N02A 1QNSA 3REQB 1LJYA 1WZKA 3QBUA 2V5DA 3WY1A 3SQLA 5K9DA 1JNDA 3RLHA 3WBWA 4K68A 3T9PA 3S4TA 3SZ8A 3ICJA 1W1VA 3F1QA 2HPIA 4RK8A 1O94A 2G5WA 3P62A 4HYWA 1E0XA 1QASA 3ZO9A 2HNEA 1UPMB 6TAAA 3M0VA 3SURA 3N2BA 3OTRA 3OIHA 5LGZA 3LERA 2J24A 1HJSA 1QI4A 5H6HA 2GLKA 1W5QA 3MMWA 4KFOA 1FDYA 1KBIA 4HMEA 3PB0A 2O9TA 1B2YA 4A22A 5C2XA 4M6PA 3D5HA 3M43A 4HZMA 4RL3A 3TN4A 3OQ8A 1EJXC 4WUIA 1E1EA 5EA9A 2V9DA 5EY5A 4P2VA 3ABXA 3W74A 1LDCA 1FKXA 2NQZA 4LX4A 3WQCA 1M41A 3MUCA 4BEUA 4ACZA 3TC3A 1QVBA 1Q6OA 1W3LA 1U5VA 5LIYX 1FUYA 2DIKA 1XIMA 4B5SA 1EJVC 2P88A 2VQUA 3ERPA 2CITA 4FNPA 2L5HA 3TTEA 5EMKA 1K03A 4S2CA 3ITOA 1ZJBA 4WSHA 4PUWA 2E68A 3F03K 1AQ0A 1W0MA 3KAOA 3CV1A 3HF3A 2OLHA 3EWYA 1UKPA 4GMEA 2Y7EA 1ZJIA 1WKYA 3K13A 5H8UA 3BAXA 4AZIA 1J0JA 2FHFA 1WP6A 4B4HA 2PDGA 3TUUA 5C71A 1J0HA 3WMCA 3N2XA 2ZXBA 2XIBA 5C9ZA 1O5KA 4REQA 3C0JA 2IQ0A 2A7NA 3EB4A 1JQVA 3F4DA 2FMNA 2ACSA 3W00A 1CB2A 2G3FA 3T0TA 3BMXA 4OWGA 7CGTA 5D05A 1WDWA 3SQMA 1VHNA 1QI3A 3BL3A 1HJVA 1XISA 2CLEA 2PF0A 3APGA 4AYGA 1CIUA 1BVWA 1GYMA 5FIPA 1RH9A 1WPCA 3ZVHB 2O7SA 3UYCA 2UZ9A 1H61A 4UTTC 1VENA 2ADAA 2HK0A 4A3YA 3VUSA 3FIGA 4MNMA 1EZWA 3SO7A 1EH9A 2X0SA 3NJ3A 4WCJA 2FH8A 3E1F1 3PZ9A 2D2HA 4V33A 2J79A 2WZTA 4MKNA 1NOWA 1W17A 4GY0A 3H22A 3T7VA 3T40A 1GQNA 2VGGA 2VQTA 3BOLA 2V0TA 4Z2JA 2WNNA 5ABHA 2WYSA 3ZQ9A 1SQ7A 2PWFA 1G01A 3W73A 4UTJA 1BVNP 4IMEA 2AMXA 1YE6A 3VU2A 5I24A 3SUTA 3B4YA 1PHWA 1PEZA 1SW7A 1KXVA 1D2KA 4MJZA 3CL6A 3WLJA 3QZAA 5MKGB 4RNJA 5CXPA 1VEPA 2C79A 5EFFA 3GR4A 1G0CA 2MUCA 1JI2A 4IGSA 2HTMA 2Y70A 2DORA 4WJEA 1HVXA 4XVDA 2YPIA 3BSGA 3USBA 1TB3A 4GZEA 4I9JA 3WQEA 4EK7A 4D2JA 2W6RA 3N9RA 4IPIA 2W67A 1H5YA 1BRLB 3WK3A 1RXOB 4Q8UA 3WH9A 4PUUA 3TX9A 1E3ZA 4S3EA 1GYLA 6XIAA 5TQLA 1W1YA 3VABA 4TTUA 4GY7A 2GWGA 2PF8A 1MZHA 4MFEA 4UFMA 3DESA 1TV7A 3W6MA 1WBHA 4JZ5A 2IQDA 4Q4RA 1FWEC 4RE4A 3UJEA 1S1PA 1C29A 1LCOA 3SCQA 2OOGA 4UMBA 1F05A 4LW7A 3NG3A 5TAOA 3CO4A 3VIMA 3S2JA 1ISYA 1WUEA 5A2AA 3MI3A 1GVQA 1UG6A 1J01A 4LEFA 3OLDA 4PMZA 3FX4A 3LRLA 3OO2A 4GYPC 4ERAA 5E1QA 4DUWA 1VF8A 3II1A 1EEPA 5IM51 3E0LA 4WJ8A 3AIRA 1RJRA 1O68A 3NEHA 4C6OA 4ICMA 3G5EA 4PMVA 4W5UA 1I8JA 4H4IA 1SW3A 3NQEA 1IHIA 4FR1A 2ZOXA 1B30A 5D32A 3WL0A 5FESA 4P8UA 1RQEA 3WF0A 1W5OA 5FKYA 3L5AA 4G6CA 5AB3A 1QI0A 1R3YA 1GOOA 1QHPA 3UY7A 3T2OA 1OG6A 3W53A 3KL0A 4AY8A 3TAKA 4U5IA 3FY1A 3M4HA 1FWRA 2DZXA 1UJPA 5DT7A 5E5CA 3CUIA 4L4MA 1GOIA 4RX0A 5CBIA 3WK0A 4ZSTA 4DF2A 4PMQA 4UOQA 3EDKA 2YDSA 1UWQA 1SMAA 3UA4A 4KERA 4MKVA 1G1YA 4B5UA 1K4GA 3U4FA 3IK2A 4YL2A 2ISSA 1VYRA 1K9FA 1NF0A 4BEQA 2E8YA 3AICA 5E6YA 3OZOA 4JQ4A 2OB3A 3U0HA 2J74A 4DZHA 2YGYA 2VVNA 3WQ5A 3LXCA 1DPMA 2Q01A 2NQ9A 5AC8A 2PGWA 2RKXA 2YL6A 3RPTA 3FSUA 7ODCA 2ZVIA 5I78A 2HJPA 4GO9A 4YTRA 1UR3M 1E73M 5HWJA 2EG7A 2J8TA 1VFMA 4C60A 4F0SA 2NSXA 1OCBA 2DJXA 2DZBA 1YIXA 1Y5WA 5C70A 1OGSA 3FGCA 3CZJA 1DE5A 1CXEA 2WAGA 3C3NA 3CT2A 3VM5A 5LIXX 2QVNA 4C6JA 3GRIA 4YWIA 5EL1A 3DOPA 1W91A 1BYCA 3SM0A 3O15A 2AAMA 4GABA 2PD9A 1GHSA 1WA3A 2VRQA 3GFZA 3RR4A 1A5LC 1EJSC 4B92A 4D6EA 3S9ZA 1TWSA 5JXQA 2PTYA 1KR0A 1EA0A 4DNHA 2OZTA 4DIAA 4Z17A 4UCFA 4HJFA 3A12A 4CCEA 3DX5A 4QBXA 3A5VA 4WY0B 2DEPA 1M7JA 5BNKA 4C5ZA 1EBGA 1RQHA 1XWYA 4HNNA 1FWGC 3IVTA 1OT2A 3L21A 5T91A 3FOKA 3ABSA 1R3VA 2W9MA 1QOXA 2D3LA 3A4XA 1W3TA 2BODX 4V2XA 1Z6KA 2A6NA 1G4SA 1H09A 1JPMA 2Z2AA 3GE7A 1PCWA 3M41A 3RYSA 1UWSA 2HBVA 2CKRA 4RNHA 3KBSA 3W86A 1T8QA 3KVMA 1VHCA 1MXSA 4HNTA 4K37A 1XPYA 4AC1X 4ZO7A 2PTXA 3OVQA 4D6FA 3F4CA 2HPMA 1O5RA 1Z89A 3PWIA 2QJJA 2JF6A 3C8NA 3ITGA 1XDMA 3AUJA 3CUGA 3ABQA 2OZ8A 3WDHA 1XYZA 1XLJA 3N6HA 3KW3A 4MY9A 1L2QA 3G77A 1NARA 3QR1A 3P7YA 3GUWA 2PTZA 2YOCA 4PBEA 3QMRA 1KFJA 2H9AA 4D6DA 3AROA 3MV11 2DSVA 3WBEA 1AA1B 1KRAC 3E02A 3H12A 3OBAA 3OZYA 4GQ0A 4INFA 4KEUA 3V75A 1U22A 3UD6A 2GSEA 4AY1A 3C86A 4LYKA 3S2MA 1PE1A 2DUAA 3CB3A 1JZ6A 1QW9A 2WSPA 4WZHA 3WJYA 4GHRA 4MWAE 4AZCA 4HA3A 1IXOA 1XUUA 1Y65A 3DZ1A 3UWEA 4AIBA 2NLIA 1L6WA 1LF1A 2C1IA 5XINA 1ODUA 5ABFA 2HS6A 3VCRA 2W3ZA 1F8IA 1KR1A 1QNVA 2ZUWA 1RJQA 2OQLA 3UERA 4NSBA 3UU0A 1AQMA 2IKIA 1S5WA 2PS2A 1E0TA 1CXHA 1H0GA 2VVSA 1RVGA 1UP3A 1B1YA 4IG2B 4ATWA 3NUKA 3F2CA 2BY3A 4LUYA 3AXIA 1H63A 1K77A 5FF2A 4Z2GA 5A6BD 1JZ3A 4KWWA 1EKOA 4TU1A 4GNVA 4GFSA 2PGEA 2XFWA 1REQA 3IIOA 4ZOCA 2NQLA 1UR1A 3M07A 2DH3A 1Q6RA 4WSJA 1ZCOA 1NWRA 1XBZA 1PPIA 3W37A 3PZQA 1JEZA 2DV0A 4IICA 3GB6A 1X6NA 4YTUA 3WNPA 1JD9A 2VEMA 2VWSA 4PMRA 1E51A 1GHRA 2XVGA 3GBEA 4GC3A 4M6QA 4EWJA 2P3EA 4OE7A 2JEQA 1PIFA 2CBUA 4KESA 1E6XM 2V30A 4GI8A 2ON3A 3TWAA 1DHPA 1I0BA 1FWAC 1XDJA 2E77A 1HKJA 1Y5XA 3BQ5A 5D9PA 3SCNA 4TMCA 5KSWA 1KCLA 3C3UA 1DTNA 4ZOBA 5CQ1A 2WMIB 4C6MA 3BJTA 4X3ZA 2E5DA 4PL1A 3HV8A 1JCLA 4OU1A 3E5PA 2HE5A 1O1HA 1D7FA 1VCFA 5H1WA 2VC7A 5FJOA 3W7EA 3L0NA 4L1GA 1NWSA 4GNKB 4TR9A 4B4FA 2VKZG 1Q4NX 3BAJA 4S3FA 4TV5A 2FJKA 4M6VA 1TWDA 1WUFA 4CD5A 3CHFA 4LVAA 1V0LA 1IWPA 4ZQOA 4GQGA 4HU8A 7PTDA 4QCFA 3NPVA 3MDWA 5I07A 3MYOA 3DIPA 2ZUSA 3GNNA 4LY4A 4JQAA 3S5YA 3W88A 1RUSA 5F4XA 5J8LA 4R33A 6ALDA 1W1PA 3GIPA 3TA6A 3STFA 2QAFA 1OFQA 5D09A 1E9LA 1B3YA 1TPFA 2ZA1A 4UFKA 1ZBVA 3TW6A 4PB4A 1CYGA 3N15A 1PTDA 5A6SA 4MWAB 2D2GA 2CZFA 1HW6A 1HP5A 3EB3A 1DIKA 5CSSA 1TO3A 5H91A 3OPSA 2I56A 4CD7A 1TV3A 2J78A 3VFLA 2PGRA 3EWZA 4CNTA 4DI9A 1BSIA 2IPFA 3T0AA 5AVHA 4C1NA 4NILA 2YW4A 5IDIA 3BGGA 3KOZA 1H7RA 4AZ7A 4KIRA 5HK4A 4FIQA 4DHGA 3KHJA 3W38A 3QKZA 4RDVA 5AC6A 3DGRA 4ZO8A 2BWGA 3MUZ1 5HINA 1GT8A 1N2VA 1E6NA 5D30A 3EDFA 5DANA 5I79A 4A2RA 2WW5A 3C2OA 2X40A 4C6DA 1FWHC 5LNRA 3HJZA 2J7CA 1FCQA 2P1FA 3LD5A 3UBPC 1F61A 3Q2DA 2O55A 2EXOA 2CNCA 1DWHM 4M29A 3M5ZA 3P8JA 4AZBA 5HQEA 1C8XA 1XLBA 3T08A 2WKJA 1QAPA 3DFHA 5FJUA 2V5BA 1ITCA 2J7GA 2GJXA 1GQIA 2PTDA 3UXAA 5BXRA 4PMUA 2VC5A 1EDGA 5A8QA 4J3TA 1H5VA 1EOMA 4LUJA 5BWFA 3UWWA 2ATSA 2E6YA 3SB0A 5E9XA 4GOAA 5LNWA 4YYFA 1TPDA 4TVUA 2V6AA 3IUDA 1YXYA 4IFKB 4FOJA 2ABBA 3S1XA 3NZRA 3V35A 1PYMA 4BQ2A 3BLLA 1GKPA 2CLLA 3PZUA 2ZZ5A 4KCVA 3GG1A 3TU9A 5KTLA 5ABEA 1PKYA 2ZX6A 4NXKA 3DKLA 4LWWA 3FJNA 2VZUA 3W3OA 4AZ5A 2HK1A 4BF9A 3LM3A 2QIWA 1QJWA 4YTTA 2Y2WA 5BRBA 4NJJA 3VKJA 2EPKX 3VD7A 3KE0A 1DXFA 2VR4A 1JDCA 5DEZA 3B0UX 1O66A 2QNEA 2YR1A 3CC1A 3ZSSA 4CQBA 1TMQA 1ZLPA 3TYUA 4UQ9A 3PBVA 3R11A 2VTFA 1J79A 2WWDA 4UZUA 1WQ5A 5I23A 3G1AA 4DBWA 5LIUX 1T96A 3BSMA 3UXKA 1NWUA 1OK6A 2YXOA 3JZEA 1BWLA 1CLXA 2WZIA 4ML9A 3VD3A 1OZQA 1E6RA 3B9DA 4UFLA 4XO7A 4L9YA 2J88A 3WDRA 1P6BA 3LNMA 4L9ZA 3G0XA 1FH9A 3WX7A 3HPSA 5TIMA 1LORA 4AQLA 4B16A 4MM1A 2DT0A 1E6ZA 2PWVA 4GZJA 3JVAA 4O28A 1ENUA 3G1HA 3ZR4A 2NVDA 3HPFA 4MJ4A 4E2OA 3E9AA 1R0MA 4ZXLA 4I9MA 4GH1A 3MHUA 4JR5A 2BASA 1R3SA 4JTSA 1ONXA 5KZ6A 4ORIA 2PWHA 1LLZA 3NIYA 1DTUA 2J75A 2OZ0A 2X2GA 5D2TA 2X1RA 3VGFA 2WXDM 1TMLA 4RV8A 3NR0A 1UD6A 4MIMA 4O18A 4C6KA 4LRTA 2J7EA 4I5UA 4N0RA 3GXDA 3EX1A 5BOEA 3XIMA 3W7DA 2R94A 4EAYA 1FWIC 4AHOA 4B9YA 1JZ8A 3SJNA 3S42A 4J28A 4CD8A 4ADTA 3MSYA 3CAVA 1HL8A 4Z1AA 2FZMA 4H8NA 4F66A 1SGJA 4DPQA 4LCQA 4L61A 3GNOA 1LL7A 4HU3A 5EKYA 5EMYA 1RPKA 4JQ3A 4ACZB 3CHVA 2V8ZA 3IAQA 2BHYA 1AZ1A 2QUNA 2TPSA 4E2BA 5I3GA 1VS1A 4Q4MA 1SZRA 3RFAA 4LVDA 4PEKA 3LCFA 4GA8A 1FVPA 4F2TA 1Q85A 4G7EA 4Z1BA 4YTQA 1CW2A 2QF8A 3L0GA 4JTIA 1OY0A 3LHVA 2V68A 2WJFA 1YDVA 4UTWA 4YLWA 3WELA 4HNCA 5AYIA 3W1LA 1JRCA 1UR0A 3ITLA 4KMQA 1IT8A 1X1ZA 4JTKA 4F2BA 5LNVA 2BGQA 1EC9A 2W92A 2J66A 5HANA 4Q6XA 3FNDA 1V6YA 2J7DA 3VAVA 1EGMA 1OX6A 5K9XA 4ZTXA 3TQVA 2XIMA 1EB3A 1JPHA 3EKZA 4REQB 2G3NA 4MY1A 3O6AA 5HA7A 2C3ZA 3Q58A 3D3FA 2VZTA 2XIJA 4HJWA 4ZZ9A 3GU2A 4GI6A 3CQIA 3QQWA 3HG4A 3BCDA 4MSSA 4XAGA 1F76A 4NJIA 1N55A 2YZRA 2ZUMA 3VNKA 4JAWA 5DFAA 2CU0A 1TYGA 3SEPA 3OHIA 4UFHA 3NQ7A 4O4VA 2OWCA 1DJYA 4A3HA 3F5LA 3RX4A 4IZGA 2OGJA 3CK5A 4CUCA 1TZ9A 2YDRA 3K4AA 3GAKA 3V0TA 2KAUC 1UD3A 2PDYA 1MUCA 2OSWA 2QT3A 2OPJA 3R0UA 5FACA 3W4RA 4YVVA 3K2GA 4LBUA 2WM0A 3W7LA 4KWVA 1FH7A 3U3HA 5I6SA 2CKSA 3E49A 2QV4A 2E6DA 2ACRA 4AH7A 7A3HA 3WL1A 4PEEA 1XFBA 3WQPA 1HF6A 2JKPA 4IGNA 1SSGA 2GJRA 3KP1A 5FAGA 3L7RA 4DBSA 3EWWA 4JCLA 1YLVA 1QPRA 4AYSA 3N18A 5JBFA 5FJIA 2F38A 4LOCA 1CGTA 2R1PA 4WKAA 3BLKA 3LI1A 3JU2A 4DBEA 2PD5A 2WHKA 2VEFA 4FNQA 5B80A 2EHHA 3RO8A 4AAJA 5EPDA 2AL2A 1XYCA 3CS2A 5KITA 3UWUA 4GIEA 1GJWA 1V6TA 2QGYA 3GTXA 3H54A 3IJLA 5HBFA 4R7JA 1ZAHA 3SCPA 3CO8A 5K4ZA 5D9OA 3QZEA 1JDAA 3LCXA 3GYCA 3LQGA 1VCVA 1YTKA 2J6VA 3ZT7A 3I6RA 1BG9A 3VMPA 3UJ2A 2NQJA 5GQBA 1PHQA 3FJ4A 3RLUA 4PFHA 3V5OA 1V7AA 1OZMA 5BRPA 1DWGM 3IV8A 1B3XA 2WHLA 2GZXA 4L4LA 1YADA 1SO4A 3GVGA 4H41A 1K6WA 2QUMA 4ZVJA 3SFWA 3TDFA 5BU9A 3GXTA 3OU8A 3SUWA 3W76A 1LL4A 3MYPA 4FAMA 4US6A 3FVMA 1HGYA 2OOFA 5GNYA 3ABZA 3L65A 1FQ0A 5A6BA 2UV8G 4B9ZA 3I6EA 3RPDA 5CC5A 4F0LA 3WQFA 1O5QA 1KV8A 4XZNX 3UPBA 4Q8OA 1J0IA 3IUHA 1LWHA 1AVAA 4Z2IA 4HGXA 3WLNA 1BGAA 4KBXA 1VBJA 2VFEA 4KFNA 4X60A 4F48A 4QLLA 3NCOA 2OO6A 1KNWA 1A53A 1VYSX 3W6LA 3WSUA 3LCIA 3QPEA 5C9UA 4BWLA 2PDKA 4H9MA 4O15A 3W1AA 4LCRA 2GOUA 3CH9A 4C6QA 3E0IA 2FMOA 3A4AA 5I7GA 1H1YA 3MSGA 5A2BA 1YHTA 4HCLA 5FEZA 3DI1A 2XH2A 1D3GA 3EWDA 1VJZA 4P7RA 5A2CA 6A3HA 1Q45A 1I2NA 3PZMA 1A0CA 1RALA 1IXPA 1XLFA 2QCEA 3IRDA 4ATLA 4E4FA 1V3HA 4P7NA 4W85A 4CCZA 1WYIA 1HXJA 4DUVA 2Q8XA 5C2CA 4FB7A 4MZYA 1YBQB 2WKLA 4HNLA 3PUEA 1XYMA 1JUKA 4K7YA 4LY8A 4U28A 3TCEA 1UHVA 1UUMA 1GEQA 1PYFA 3R25A 5BOFA 4H01A 3W70A 4HP5A 1EP3A 1TZ7A 3UXIA 5E70A 1EBHA 1JVNA 1VFHA 4Z2LA 3ZM8A 4DAIA 3GSMA 4NI8A 2DZUA 4I3GA 4WHBA 5DMLA 3N2CA 3AMDA 2RUSA 5LKYA 3UETA 3FYPA 4Q4OA 5TD4A 4JHZA 1KBJA 5IDZA 3VD9A 2BVTA 2PC4A 3UNTA 4QG8A 2HDJA 3CUFA 3LK6A 5MF5A 4NZ5A 1GOMA 3F4NA 3MUIA 2QUTA 1VLWA 4TV6A 1TMHA 1G69A 1A47A 5A95A 4KFPA 1FKWA 3A3XA 3PBYA 2POTA 3PUOA 4DWDA 3UZJA 5K7JA 4M80A 1RVKA 3H2NA 3KWXA 3A4JA 3WJWA 4JFWA 5CBBA 2YL9A 1WXJA 3FGCB 1DJIA 5AHLA 3MKKA 3WO8A 4F0HA 3NGJA 1TQJA 1BXCA 1X96A 1KRCC 3CQ0A 5EGRA 4O1FA 2H8ZA 2V5KA 3NVDA 1CENA 4PRWA 2V82A 1KW1A 5RUBA 1BYDA 3EA1A 2C91A 4NHVA 5IBXA 5DCEA 3WH8A 4K36A 1KGXA 2RDTA 4GD0A 3MSDA 1E4NA 3WFAA 3AWNA 3CIXA 2E9LA 5CJNA 3QF0A 3BG5A 4OHQA 2D23A 4NASA 3N6JA 5F2GA 3BLDA 3UXLA 4XTDA 2Q71A 3T42A 4LS2A 4LEQA 1J8VA 1SFJA 2BMBA 4Z2HA 1XCWA 3NEVA 4GGBA 3L66A 4KKXA 3L4UA 3AQUA 4WKFA 3ZMRA 2BB0A 3W7PA 2HXTA 1R2SA 4YYCA 3NSMA 3BLOA 4RPQA 1XRFA 4JYEA 1RCQA 3PK7A 1Z9AA 1OF6A 3UZWA 2Q6ZA 9RUBA 3ABOA 1V6VA 5CC3A 1P48A 1JAEA 1QXLA 3B8TA 3T6CA 3GD6A 5EMMA 3CZLA 1D8WA 4UTHA 3RU8X 2R8WA 2PDPA 2XZ7A 2ZUNA 3GKAA 3TNBA 3C2YA 1KXHA 3FAXA 4FHAA 1UASA 1JULA 2H9AB 1KLYA 3WCZA 3MCOA 4DY1A 4MLRA 5C2GA 3CPUA 1ZP4A 3LOTA 3TYAA 1XBYA 1VFSA 2H3BA 2O56A 3CIVA 4FXJA 1HN1A 4CQAA 3VNZA 1DIEA 1KFEA 3SECA 2CZEA 3DAQA 1F4HA 2WLYA 4AZCB 1EJ7L 3CQJA 4US5D 2NX9A 3AZRA 2YXXA 4C7DA 3ZOAA 5ABFB 3TONA 4AEEA 1TPEA 3IJ6A 1G4TA 3H7RA 1ALDA 2QCLA 6CGTA 4EVZA 2DVUA 2YX0A 2WQDA 4IIFA 1E5JA 2XWDA 2R24A 3W87A 3M64A 4JTHA 2PRMA 2V2HA 2WMGA 4P8VA 1F5ZA 2VFFA 2DSKA 2X8RA 2ZXQA 1ODZA 1M65A 3LZ3A 1OFPA 4C7FA 3CUHA 4WSKA 1QBAA 3VI2A 4CQ8A 3UYIA 2DQXA 1OFEA 3AJXA 4ICNA 3UA3A 4XD5A 4AHQA 1TUFA 3HG5A 3M6YA 3VOCA 3V0SA 3V0UA 1TJ2A 4QJ1A 2ZXAA 4Q4SA 3ZT6A 1THFD 2J7FA 2DVXA 1FRBA 4NNBA 2Z26A 1UH2A 1XYBA 4CNPA 1RHCA 4LYPA 3S5ZA 4AZGA 1C92A 3LQLA 4EXBA 2YCLA 4FNUA 3I6TA 1LOQA 2QJIA 3MSRA 1XXXA 3FYYA 1KB3A 4FF7A 4KW2A 2WC3A 2G4FA 2PDFA 3S2CA 3NQVA 4WK9A 5HAOA 3W83A 1R3WA 1E1FA 4LS0A 1K4HA 3C56A 2GDUA 1ML1A 2PU1A 1VJIA 3QGAC 5D8WA 5BMXA 4WDUA 4LC8A 3USZA 3ISIX 4JQ1A 3M0LA 1OCNA 3SCOA 4RPPA 3KRBA 1XP3A 3WLRA 3KTCA 1N82A 4LT9A 3W22A 2PA6A 3SIMA 4Q8MA 2PI6A 2Z0IA 4JHMA 3K1GA 3GZAA 3QGVA 3S1VA 3L0KA 3MVIA 1ZAIA 3W26A 4O12A 4DJFD 1JL8A