4NX5A

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nx5A00
2YXGA 1ZFJA 2FTPA 1J5TA 4X22A 2P10A 1A5BA 4NXKA 4LVAA 1BWLA 3KRZA 4WXYA 3TIMA 1SZGA 8TIMA 5KITA 2X1UA 3TDFA 1HG3A 4N6EA 5F1UA 2YYTA 2Z6JA 1OJXA 4BI6A 2WKJA 3BGGA 3EWYA 4NJHA 1JJKA 2CLLA 1DJNA 1GG0A 2Y7DA 4FIRA 2H8XA 3OVPA 3I68A 3GR8A 3CLMA 5D2XA 1SO3A 3LCFA 2FB3A 4Y6GA 5CPLA 3LXAA 1TQJA 3KVLA 5EL1A 1RQEA 2EHHA 1XKYA 1QFEA 5LKYA 1TPUA 3LX9A 1EP3A 3T7VA 3M47A 2JKEA 3UWWA 3IIOA 2A6LA 5LSMA 3L5MA 1L6WA 3PF3A 1D3HA 3TCEA 1EEPA 2DZUA 2Q3RA 5DN1A 3HJZA 4MPQA 4RZ6A 3OVQA 1TTIA 1LDCA 2RHGA 4JD4A 5F2IA 4LWWA 3W85A 5T26A 1LOLA 1GT8A 4M7TA 3T78A 4OU1A 2XN1A 3W74A 1XUZA 4A2RA 2GQAA 4NJKA 1KM1A 1DJQA 1Z44A 1NF7A 3LHVA 5DBUA 1FBAA 3KRUA 4HPXA 4QM1A 4Y9AA 3W22A 4JTTA 4IMFA 2V2DA 1IXQA 3DFQA 2QAFA 3IGUA 4Q4KA 4N02A 1X7FA 4Y96A 1W5OA 3MI3A 1FDZA 2EGZA 3K30A 5HMSA 2RFGA 3NYZA 1O95A 1Z48A 4BR1A 3S1UA 3PG8A 3KVMA 1LTDA 1KM0A 3HPXA 1OX6A 4O4WA 4X2RA 2QUVA 2C19A 2ZRXA 5BRBA 2CLFA 1ZHAA 4FX6M 3LBMA 3NAVA 3PWAA 3QZEA 2QCEA 5FI8A 4JS3A 3P61A 3W75A 3NQMA 3C2FA 2QCMA 4JDBA 3NQ2A 4YXGA 3LXCA 4JYFA 1F76A 4BWLA 2CZFA 5CPOA 1DQXA 4O11A 4UR7A 2E6AA 4KFPA 4O19A 1NVMA 2DU2A 1K7XA 2NX1A 4RCXA 4O12A 4WZHA 3EWWA 2VFHA 5K9DA 1XM3A 4X9SA 4WD0A 5D2TA 3HF3A 2YGYA 1A5AA 1XBXA 4ORIA 1PHQA 3N9SA 4M6VA 1Q6OA 4Y90A 4JTJA 3HG2A 1B3OA 1FCBA 3DI1A 4MZYA 3M16A 3GZ3A 4IMGA 5KTLA 1JUKA 2E6YA 3TJLA 3BO9A 4IXHA 3NQGA 1ADOA 1O5XA 1SO5A 2VELA 3STEA 1TSIA 4E2BA 1SW0A 1SW3A 2WV8A 1AMKA 4NQ1A 1KFJA 3ELFA 4MYXA 5AYXA 3PB2A 3P84A 2Z0IA 5KSWA 3C2EA 1GZGA 5HULA 2QUUA 2ZZ6A 2GJLA 5F1VA 2RDTA 4LVBA 3W1PA 1T0OA 3M44A 4MLJA 1BWKA 3G1XA 3H54A 4B5NA 1HFBA 3R2GA 4R7JA 5CZSA 3H53A 3W7QA 2BSLA 2YW4A 2DZTA 4GRSA 3KOFA 5AHMA 2PRHA 2J9YA 3PUEA 1FWWA 3DHFA 3MYPA 5D30A 1F7BA 4N6FA 1R30A 2H6RA 3IEBA 4NNCA 2I1OA 5HR7A 1SPQA 2CLKA 1GEQA 4PCFA 5L9FA 4OGZA 1UUOA 4PODA 5D03A 4KWVA 4ZQOA 2ZA3A 3C0JA 3O6DA 5CKSA 3C6CA 5BMWA 4RXGA 5E0KA 4MZ1A 3UXAA 3EXTA 2NLIA 3GDRA 1GYNA 4UTJA 5LGXA 4WXZA 3OA3A 1OFQA 3VI2A 2GVJA 1AW1A 3C3NA 3CTLA 3BARA 4CLMA 1A50A 4UMBA 5AN7A 4Y8FA 1JRCA 3PVFA 4A21A 4KWWA 4QISA 3RF9A 2RDUA 2H90A 3HMJG 1R2TA 2JKAA 6TIMA 5HJLA 4NVTA 3UNDA 4JY8A 2VFGA 3LLDA 1JCJA 3M5XA 1YTDA 3S9YA 1HUVA 3ZR4A 1VYRA 2B4GA 4DO5A 4A22A 3W1AA 5MHBA 1A53A 3BW4A 4UTUA 3KAOA 3NQVA 4WUIA 5KZMA 3TMLA 1FCQA 3EEGA 2OT0A 4K38A 4BK9A 2JK2A 4YWIA 2A1YA 2WPBA 2NV2A 5G4EA 5AC6A 4DF1A 3CB8A 1LYXA 3LCLA 4LS2A 3ZWSA 2J27A 2BZNA 1KM5A 3UWQA 3NQ6A 2B7QA 4E0CA 3LXBA 5BOOA 3P67A 1C8VA 4OHQA 4ZMGA 4LRTA 1WXJA 1XBYA 4OQVA 1T8XA 4IPIA 3OG3A 1YTEA 1I2RA 3SFKA 3PSVA 4UTWA 5K9XA 2YYUA 4ZQMA 1M7OA 3SW6A 2VEKA 5AHIA 2Y63A 3L0GA 3MP5A 4WY0B 4I9AA 4NJGA 2HS6A 1IIGA 1GPWA 2W0UA 5IBXC 1GTHA 2C15A 4K39A 3A24A 4LVFA 3T4CA 3S1VA 1TV7A 4NX0A 1DBTA 1IGSA 1QWGA 2OJPA 3I7SA 1M7PA 3NDOA 3IVSA 4IQLA 4MJZA 5FF7A 4M5PA 3O16A 4FEZA 4EVZA 5C6MA 3LTYA 1VCVA 4WOZA 2HTMA 3W1UA 1G4EA 3SECA 4IJBA 4LT9A 1I2OA 3TQKA 1HO1A 4OV9A 1AW5A 2VC6A 2J6XA 3JRKA 1UUMA 3UWUA 1JVNA 3E12A 4U28A 4AHOA 3NOEA 4XUGA 1TQXA 3I7RA 1VCFA 1SO6A 2ABAA 3RMJA 3G24A 4N9DA 3VNDA 5TBOA 4UTMA 1A5SA 4DXVA 2E5CA 1VGAA 2DP3A 3ABQA 3N19B 5G2HA 1RZMA 3MHUA 4W9TA 4FNRA 3UWYA 4HNVA 3ABRA 1S3HA 2C14A 3FA5A 3QMTA 4FX7A 5D02A 3HG5A 3O06A 3MWAA 2A21A 1YXCA 4O52A 1ICQA 3N9RA 1DQWA 3RLVA 2NV1A 3G0SA 2LLEA 3ZS4A 2DZVA 3FIGA 3LRLA 5G2IA 4LVGA 5TQLA 5HWNA 2C18A 1NSJA 1OFPA 3P80A 4JTUA 2Q8ZA 1YLVA 3E9AA 4DPQA 3BG5A 2YX0A 1GVFA 3LBCA 1SU5A 3QFEA 3W2MA 3O6YX 1ZY9A 1BTMA 2QCGA 3EXRA 4M7SA 1KV5A 1KBIA 3W1QA 1ME7A 4ZVJA 1ME9A 1AK5A 3FKKA 1L6SA 5BNKA 3DENA 3Q2DA 3EX4A 1EB3A 1ME8A 2BXVA 3L67A 3LDVA 3W1MA 1DOSA 3TSBA 2G95A 1MXSA 3MI6A 3OHIA 4WJEA 2H3BA 1C29A 1THFD 3ZWTA 3PS7A 3UYCA 3S1XA 1QDSA 2TRSA 1EUAA 3B06A 4QITA 1WOAA 4AWSA 5GVJA 3MUXA 1LRQA 5K4ZA 5K7JA 3H55A 3P62A 2QCDA 1XFBA 1OFDA 2ZZ5A 3P8JA 5D32A 3WJXA 3M9YA 3M5VA 2DORA 2Y7FA 4PL1A 5LNUA 2A6NA 3W1NA 3MP4A 2CU0A 4JIPA 3VFLA 3RK8A 2F7FA 4JTHA 3VKJA 3BG9A 2DZSA 2ZYFA 5DXYA 1GJPA 1OK6A 4NX5A 1ZCOA 2R94A 1OYCA 1H62A 4EOUA 3IVUA 2CLEA 2ZZ1A 1RQBA 3GNNA 3E49A 3PAJA 5FEZA 2GVLA 1FUYA 1XDMA 4Q32A 3HQ1A 3NPXA 1OYBA 5FF3A 1AG1O 4MY8A 3ABSA 4P61A 3C2OA 2V8ZA 4O53A 2GUUA 4UTTC 4IXXA 1K8XA 3NL6A 1LBFA 4JGDA 4NUWA 3TW7A 3R13A 1H7WA 4Z1AA 1KTBA 3P74A 3NQDA 1H7PA 4BI5A 2ZQ0A 4DF2A 4UTLA 1Q6LA 4N9BA 5AOUA 3PM6A 1SFLA 1HO4A 3HPZA 3W7EA 5E93A 3GB6A 3PB0A 3W1XA 3W9ZA 1KTCA 1Z41A 3DKJA 2QF7A 1W5NA 3QEZA 3DFOA 4MY9A 1OFRA 2FQIA 3W7KA 4LOCA 2YPIA 3STGA 1LROA 5LNVA 3G1SA 2J9XA 4S1FA 3I7QA 3C61A 1QOQA 1G4SA 5AHFA 1G4TA 1ZAJA 3FLUA 4O1AA 2QR6A 3GDLA 4HHPA 4YMZA 5F4XA 3CT7A 2I14A 3F03K 1DL3A 4LVDA 4NNBA 3S5NA 2VOMA 4JR5A 2BX7A 1TV5A 3QSRA 1G6CA 4O18A 4UXDA 5KMYA 4IX0A 3FYPA 1Q3NA 2A85A 3L66A 4FX8A 2V2CA 3B0PA 3S5ZA 5AHEA 5I3GA 1W0MA 2DZXA 4E38A 1VJIA 5LNSA 1IXPA 4ICNA 1EUNA 2RH9A 3WK0A 1J4EA 3P5YA 2QKFA 1OFEA 4Z1BA 1NFBA 5LNRA 1GVRA 2ZRZA 3THQA 4LNYA 4WY0F 1FWNA 4Q33A 2A7PA 5D37A 2ATSA 5EYWA 1KFBA 1QR7A 4J9JA 4OBTA 4UTIA 1B57A 1PS9A 4LC6A 3LCXA 4NZFA 3BW2A 2NXIA 3V75A 3W7NA 2TSYA 2J24A 3WJYA 4Z0SA 3P5ZA 4O10A 2CZEA 4MOZA 2GJNA 5HR6A 3W2LA 3C56A 3CU2A 4UR8A 3N2XA 4GNJA 3R5EA 4WX2A 3KRSA 3M7WA 4O13A 3UY8A 4ZQPA 2E1DA 3EKLA 3UWZA 4AMAA 3HG3A 4O16A 1ZENA 4DBEA 1Z42A 3B04A 3MYOA 4R34A 3WK3A 1GG1A 1OX4A 2QJGA 4YCOA 3CC1A 2OZ0A 2WNQA 3MP3A 4O14A 1CX9A 1VYSX 4FB7A 4NXSA 1YPIA 3QW3A 3GXTA 5A5WA 4C1KA 4KFNA 5CZ0A 2B7NA 2YCEA 3TU9A 5CZJA 4UCGA 1SUXA 5F4SA 1LCOA 1QPOA 3ATZA 3TC7A 4NZJA 1ALDA 1WV2A 1LP6A 3PSWA 4LV4A 5DY2A 4M6QA 2V9DA 4JTIA 4LS1A 4CQ9A 1TTPA 4DO6A 3LHYA 3NM1A 3F4WA 1KLYA 1TRDA 4LV9A 4N9CA 2C0AA 3S8HA 1UASA 2AGKA 3G1AA 3QMSA 3EX1A 3PULA 2JGYA 1DKWA 1W3TA 3FS2A 2QCNA 3FEMA 1EX5A 5IM51 4MYAA 3W7JA 5D2YA 4ADTA 4JTLA 3GLCA 4K36A 5DCDA 3NL3A 4PH6A 3PG9A 5K3VA 3W73A 2VENA 3RNDA 1UB3A 4MUZA 2E77A 1Q45A 3KVKA 3W07A 2CLIA 4AEOA 2CLMA 3MW7A 3DI0A 2B0MA 4JICA 4UMAA 5LHEA 3B4UA 2CFFA 1WBHA 3G3DA 1OFOA 5I3KA 5HUPA 3G1YA 2DZWA 4HSNA 4FF7A 1LOSA 3KVJA 4AWUA 2FPYA 1KFKA 2NWRA 4AXKA 3QJAA 3TUUA 1OFBA 3E96A 2XFWA 4MVAA 5G4WA 3UZJA 2WNZA 3C2RA 4RV8A 2V2HA 2WSQA 4CQ8A 2KZHA 1TTQA 3CEPA 5AC8A 2ZZ7A 4A2SA 1AL7A 4UTWC 3NO5A 3G1DA 2IQTA 3NVTA 2OMAA 2VEMA 2Q8LA 2ZRWA 2TMDA 1HL2A 4HPJA 3QM3A 4KKXA 3NZ1A 4EF8A 1H1ZA 1ZJIA 2YZRA 1VRDA 2YW3A 3W87A 1RPXA 1MSSA 1NF0A 3B03A 2NUWA 3DFTA 1H7RA 1TIMA 2CZ5A 3A9IA 1ZNNA 4H3DA 4AB4A 2VFIA 5CSSA 4XWUA 1I2PA 3QPZA 4RJEA 5D33A 5J5DA 3MI2A 2WJZA 4ZZ9A 3DHDA 1KFCA 3C8FA 3LI0A 2YR1A 4ZQCA 2R14A 4IMCA 3SGUA 2ZA2A 3GK0A 4FO4A 5BMXA 4HSOA 3PBVA 4ML9A 2V82A 4TIMA 4ALDA 1GWJA 2V5LA 4WQ6A 3THAA 3U8GA 1VLIA 5HQEA 2NZLA 4QSHA 2AQWA 3OBKA 3W7DA 2PRLA 4QIUA 1EP2A 5EY5A 3BPWA 3HBLA 4CCCA 2ALDA 3C2VA 5D05A 4JTEA 3I6RA 4MFDA 3LM7A 3OVRA 1TRIA 3QQ1A 5I3IA 1LZOA 3RU6A 3NPVA 3FFSA 1TPVA 1ZAIA 2BTMA 3LERA 2Y7GA 5H2ZA 3S0CA 1XXXA 2CW6A 2P1FA 2WSRA 2NUYA 3NQEA 3W76A 5CZTA 1JCMP 2Y6ZA 4LUJA 2V81A 1PVNA 1VYPX 1XI3A 3T40A 1FWTA 2Y70A 1H7OA 3Q58A 3OEXA 2ATMA 2E68A 4BFAA 1P0NA 2A4AA 4UUIA 4UTTA 3STFA 2OCZA 1S5WA 4HNNA 4MJMA 1PCWA 1SR9A 2GQ8A 1OVDA 3TA6A 3ABOA 1VH7A 4Z0JA 1K8YA 4NJIA 1Q6RA 5E1QA 2DZPA 4PA8A 3M41A 3Q37A 4GUGA 4O1CA 4K8EA 3B05A 4O0ZA 2ZDRA 4AVFA 4JY9A 3DKLA 3LCHA 3G8EA 1K03A 1OF6A 3C4UA 4L4MA 3W7GA 2Y88A 2RDWA 3NQFA 1SFJA 4XKYA 3MHFA 2HS8A 3TXVA 5D09A 1O94A 1BEUA 1PCKA 3LI1A 1P1XA 3WJZA 1F5ZA 3SIZA 3IIVA 5I3HA 1JULA 3N34A 1QOPA 3MBDA 5C5YA 4JX4A 4LUIA 1MEWA 5C55A 3TFXA 1TPB1 4IWWA 3GR7A 1JUEA 2F84A 5FEWA 4OT7A 3WK1A 4UNLA 2PRMA 3DBPA 3E02A 5CPNA 3QW4B 1SO4A 4CCEA 1EP1A 4GFSA 3L65A 4S2BA 3TE9A 1PHWA 2EKCA 3L5AA 3W84A 4GWEA 1KM6A 4JYDA 1P5BA 1TPH1 4IGHA 5DCEA 5G2WA 3TQ0A 5LNWA 4IMDA 3LB0A 4AH7A 2ZTJA 1QO5A 4BWLC 4AWTA 3SZ8A 1FCVA 2DJLA 4JX5A 3B0VC 1YXYA 3KXQA 2HSAA 3E0IA 5TIMA 4YCPA 4O17A 4AHPA 2ZZ3A 3WJWA 1H5YA 3T44A 1GVQA 3O15A 3O1NA 4UMCA 3DGRA 2E5BA 4O8RA 2JGQA 3YPIA 1D9EA 3TXZA 3UQNA 3N2MA 1DVJA 1T96A 3HPSA 5LGZA 1GVOA 2E6FA 3W7IA 3HGOA 4TMCA 4N4QA 3VCRA 2O7QA 4FNQA 1TYGA 3HG4A 1O5KA 3N73A 3KX6A 2JBMA 1YDOA 2QDHA 4HKPA 5KINA 3DFNA 3WK2A 2CZDA 1J2WA 1XC4A 4XZ9A 3F1QA 2QEZA 3LRMA 2A0NA 4JXCA 4K8HA 1EIXA 3CWNA 4HN4A 1N7KA 4RX0A 1I45A 4IUOA 3HGSA 1YDNA 4UTKA 5AHNA 1I8JA 3A22A 3L21A 4X3ZA 3G18A 1R2SA 3VE9A 4TU1A 1MZHA 1YTKA 4XTIA 2D73A 2NX3A 1JCYA 2TYSA 4TO8A 1VR6A 3PBUA 1G69A 3W7RA 1FWSA 3EX3A 2FPVA 1EPXA 1SSGA 4EWND 1LORA 1WX0A 3SR7A 5F2GA 2G97A 1VHNA 3G8RA 3HGRA 1K7FA 3W7HA 1QPNA 2E5DA 4A3UA 3W7OA 5FF2A 4XQ6A 4N2YA 4DEFA 3GDTA 3TJXA 4HNUA 3LCIA 1K8ZA 4O57A 1QPRA 1X1OA 3CHVA 4LTSA 4NT0A 2FDSA 4QAIA 3UPBA 3STCA 3W86A 2BLEA 4H4IA 3EWBX 4PFMA 1H50A 1DV7A 2ZRUA 4WY0A 3IVTA 4I7UA 1KLZA 4TMBA 1DHPA 1H60A 4OE7A 1XL9A 4CNPA 1YYAA 3W6YA 5AYYA 1ICPA 2VXNA 3O63A 2VFEA 4KFOA 5DLCA 1EA0A 2XN2A 1QPQA 4UNKA 4ORMA 3W2UA 3HO8A 2PE4A 4EIVA 5KZDA 4HNTA 3UXDA 2ZTKA 4K7YA 3L9CA 3EWZA 3W1RA 4K6AA 1B4KA 3EXSA 3BG3A 5CPMA 1ZAHA 3U6WA 3M1ZA 2FPTA 4JTSA 1VHCA 2RKXA 1TB3A 1VQTA 3BVJA 3N14A 1W5PA 3W72A 1F6PA 3NL5A 4FNTA 4DPPA 1GYLA 3M6YA 3W23A 2X1RA 3UY7A 2ABBA 3VE7A 3NXFA 1L6YA 4PTNA 1PE1A 4OWGA 1JUBA 3W1TA 1TTJA 5EMUA 3CWOX 2VEPA 3P7YA 1WA3A 3FJLA 4RXFA 4JEQA 2A7NA 3SSJA 3WJSA 1ICSA 3L2IA 4O4VA 3TFCA 1OK4A 1VLWA 4RZ4A 3PUDA 3A5FA 4AF0B 2UV8G 1IIHA 2YDAA 3TAKA 5J5RA 5SWUA 2GPTA 1MEIA 2ZZ2A 3GDMA 1KM3A 3R89A 4D2JA 3QRHA 3ATYA 5K4XA 1UCWA 3W7CA 1KA9F 3N3MA 3T55A 3W88A 2QDGA 3EWXA 2I9EA 3LHWA 1RVGA 3P82A 3NPWA 2EF9A 1MO0A 3EX2A 1JQXA 4QNEA 3PBWA 3W2JA 3AO0A 1GOXA 2ZBTA 2QJHA 3JR2A 3A21A 3LHZA 1H7NA 1X8FA 3PY2A 3NR0A 3BLIA 3LTPA 1U83A 2TPSA 2E6DA 3C52A 4TR9A 4MZ8A 4JN6A 2FIQA 1R2RA 2FFCA 4JYEA 2NX9A 5CG7A 1SSDA 2QCFA 2Y85A 2WNNA 3TSDA 4POCA 5IBXA 1F05A 3TH6A 5FF0A 3MHGA 3A23A 3EX6A 2C13A 4RK8A 1YADA 1W31A 5KZEA 1TMHA 2Y61A 5HNRA 4DF0A 4IPJA 4RR4A 3SI9A 4JTFA 3D0CA 4ADUA 1WDWA 3CPRA 3L68A 3S5OA 4P2VA 1G67A 1RQHA 1LM1A 1SZFA 3GNDA 4QJ1A 1P4CA 2QCCA 2H3DA 1O4UA 1A5CA 2QUTA 4ZL1A 2R8WA 4O54A 3HGJA 2P0OA 4FHAA 4JDYA 1OFAA 4PC8A 3RFAA 5AHLA 4JNMA 5FESA 4MIMA 3RLUA 1XUUA 3QQ0A 4JX6A 1LBLA 3B8DA 4GUIA 1H1YA 5I3JA 5D38A 5U4NA 2E09A 2Y62A 5C2XA 3G1FA 4XBSA 3BLEA 4ADSA 1IXNA 3IIXA 5HINA 4DBDA 3EB2A 4ZQNA 3NQAA 1YDVA 1QCWA 3A5VA 2ZFAA 3S5YA 4A29A 5HWMA 2Z1BA 4G1KA 4PL2A 3QYQA 4O15A 3W3OA 3LHUA 2G96A 1AW2A 1WBJA 1W5QA 3BGJA 4XBKA 3LV5A 2X16A 4GBUA 3W70A 1RR2A 3BLFA 5EPDA 3KFTA 3P81A 3GAKA 3GX9A 1B9BA 2CLHA 3JS3A 3L0KA 3S6DA 5DY3A 1K7EA 1WQ5A 3LRKA 1JCXA 3PUOA 1G7UA 5K2ZA 1TO3A 1XDLA 4Z1CA 1FDYA 1W37A 1NEYA 5D2VA 2X1SA 3W2KA 4AHQA 4CQAA 3PR2A 4MLRA 2Y7EA 3NQ8A 1I2NA 3LTSA 4FIQA 3P60A 4LW7A 1GVSA 3TW6A 2G5WA 1CW2A 4ZQRA 4GUHA 3F4NA 4XKYB 1FXQA 2A5HA 4ONVA 5EKYA 1RD5A 3MJYA 4GXMA 1XBVA 1W3IA 1PV8A 4HIBA 3UZ5A 2V30A 5HUOA 5C54A 5F2LA 5LZLA 4O50A 3G22A 3B0UX 2CLOA 1GTEA 4M6PA 4DO4A 2Z2UA 1KM2A 3M5ZA 3W71A 2ISWA 2J9ZA 2XN0A 2ISVA 4LC8A 1EWEA 1FX6A 2WQPA 3TMQA 4K37A 2Z6IA 3UPWA 1LLZA 4GUFA 4YLWA 1OX5A 3S1WA 3MO7A 1JQVA 5CSRA 3W1LA 3TAOA 3G1VA 1U5JA 4M19A 3NPUA 3HIJA 3R12A 4JTKA 4S2CA 4Z1DA 1WYIA 4UTHA 5F2MA 1LLWA 3IV3A 3W7MA 2WSYA 3O07A 1ZALA 3MMTA 3NA8A 3G0XA 4NJJA 3GIYA 1S5TA 1TCDA 1H7XA 5FEPA 1Y0EA 3ANYA 3NG3A 2A7RA 4RKAA 4DELA 2O7SA 3UWVA 3PC0A 5AFDA 1PIIA 1UJPA 1LOQA 3TNOA 2OT1A 5AB3A 3TSMA 1JCNA 1W8SA 4EF9A 2C6QA 5DBTA 4MFEA 4CNOA 1XBZA 1TPFA 3AJXA 3QMRA 3QPYA 3GAYA 2H8ZA 3CIWA 2DJXA 2VFDA 3HOJA 3NQCA 4GE8A 3TX9A 2FJKA 1FDJA 1H51A 3GKFA 3O6CA 1TREA 3FYOA 1P0KA 3BK0A 3G1HA 1JCLA 5AYZA 3QH2A 2GOUA 1O60A 4GJ1A 2J88A 1TPEA 3LV6A 4O28A 2QCDB 3SY5A 3CM4A 1CI1A 4AF0A 2V0TA 3O05A 1OHLA 4H6KA 3EWUA 1AL8A 1R46A 3Q94A 3FJ6A 5HWJA 1TJRA 2C16A 3TKFA 4NNAA 5AC7A 4I7VA 1OYAA 4UIOA 5I3FA 2Q3OA 4TX9A 4LS0A 1H61A 3HB9A 2VEIA 3L5LA 3TROA 1K02A 3FKRA 1DORA 1MEHA 4I7WA 1G7VA 5F4WA 2JKPA 1QNVA 3IRDA 5L6UA 2CWNA 3CIXA 1IXOA 3NL2A 2ZZ4A 3W7PA 4IOTA 2EAWA 5EBUA 2QAPA 1K3UA 1E51A 1W54A 5A8GA 5DCBA 1M5WA 2FB2A 1QO2A 3M5YA 3NGJA 4U4MA 3U2OA 3BV4A 4JTGA 1Q6QA 1TJPA 3GVGA 3MBFA 2NWSA 3DAQA 3WFAA 1LRNA 3LCWA 3W2NA 1V5XA 5FEXA 3TK7A 1PL9A 4UFJA 1FY6A 4BI7A 1F73A 3IIPA 3L0NA 1TPC1 3QC3A 2YSWA 3G3MA 1VCGA 4IX2A 4O0KA 3USBA 4UFMA 1YPFA 5G1YA 5BW6A 1LBMA 4UFLA 3ZFHA 3QF0A 1KW1A 3CQ0A 4OV4A 1SZEA 3LHTA 2QJIA 3P8IA 4LU0A 4MKNA 4NU7A 1B4EA 4IMEA 4CNNA 4FNPA 1IF2A 2Y89A 3I65A 3TR2A 2VFFA 1QAPA 2AAMA 5U7SA 4N9EA 4PEKA 3PBYA 2ZCGA 1H63A 2X1TA 1W1ZA 3BW3A 4LY8A 3UD6A 2YFNA 3S42A 2V5BA 1T99A 5D2WA 2B7PA 1KM4A 1D3GA 2R91A 1OG0A 1I4NA 3V1PA 1HTIA 1I2QA 4UC5A 1FCUA 2QCHA 5DXXA 3KHJA 3DU0A 1V7YA 1YXDA 1N55A 5G1TA 1XCFA 1WAUA 3SJ3A 3G0UA 1L2UA 4FXRA 1KV8A 1L9WA 3DH7A 3DXIA 3LGEA 4GUJA 7TIMA 1JR1A 2B7OA 2A2IA 2HMCA 3NEVA 3OIXA 1OF8A 1VPXA 1X6UA 4JIQA 4XTDA 1X1ZA 4YL2A 3INPA 1OX4B 4UFIA 2OX1A 5LHFA 2EPHA 3NQ7A 4GC4A 4N4PA 3LLFA 5CGQA 4CCDA 2GVGA 1W5MA 1LRTA 3DFSA 3GXPA 4E2DA 2NXHA 1KFLA 3TV8A 4C1LA 3NZRA 2QCLA 1W3NA 4UFHA 1KFEA 3QSTA 1VC4A 4K7VA 5D04C 3DZ1A 5FF4A 2GQ9A 4RZ5A 2VKZG 2PC4A 2ZRVA 4R53A 1NAL1 2BWGA 2NUXA 3TC6A 5K9CA 1F2JA 4O1BA 4HT3A 3LCGA 3W7LA 6ALDA 1S5VA 3EKZA 1RV8A 2X2GA 1KBJA 4FNSA 5H91A 1VZWA 4LRSA 2ISSA 1SQ7A 3CEUA 2WO5A 1GQNA 2WOQA 4Z08A 1SW7A 4AAJA 1M6JA 4R33A 3IIZA 3GDKA 2W79A 2W6RA 1F74A 4QQ3A 3GYEA 1N8FA 1FWRA 1QMLA 3GXNA 1TPDA 1F6KA 1R47A 2ZA1A 1VS1A 1TPWA 3GKAA 1FQ0A 4O1DA 4DQWA 2X30A 2C1HA 1UBSA 4FXSA 3IGSA 3M0ZA 1WOBA 3NNTA 3W83A 2C3ZA 2ZRYA 3O8AA 5EA9A 1W56A 5DELA 1G4PA 2PURA 4L4LA 4FNUA 4QNWA 4BF9A 1FXPA 5ABTA 3NM3A 2FLIA 1OABA 1ONRA 1JRBA 1ML1A 1KTNA 4RLIA 3DFPA 1EWDA 3LOTA 3SGZA 3M43A 3IGXA 4UFKA 4MY1A 3R8RA 1SZNA 2YFOA 3TQVA 1BKSA 4WOQA 5G5IA 2NXGA 1TV8A 2PCQA 3FOKA 1C9DA
chains in the Genus database with same CATH superfamily
2YXGA 1U30A 2W91A 1UR8A 4C7FA 4X22A 2OYMA 4NXKA 3H26A 1G0CA 1SZGA 4JIIX 1HG3A 4N6EA 2YYTA 1XF0A 4K3ZA 4LXFA 4YVVA 4WDUA 4PMJA 2TAAA 3EWYA 1PKLA 4L1WA 2YA0A 3S2MA 2H8XA 5A1AA 3GR8A 5HMEA 5FOOA 3LCFA 2ACQA 1VBJA 4LCRA 1RQEA 2EHHA 1QFEA 5LKYA 1TPUA 3WH8A 1YEYA 3M47A 2CXEA 2JKEA 4BCEA 5LSMA 1WDRA 4HOZA 1L6WA 6A3HA 2O55A 2C1GA 2ZWZA 3HJZA 3OODA 2J25A 4RZ6A 2RHGA 4IIDA 2VD9A 3N13A 4GKLA 1GT8A 3S6TA 1VFFA 3BSMA 4J40A 3AALA 2GWNA 1A80A 3RMEA 1KM1A 1DJQA 1LL7A 4MNKA 1K70A 2E8YA 2R1MA 5DBUA 1FBAA 4HPXA 4JTTA 2V2DA 4E8GA 4L4OA 3AXHA 2PUZA 1X7FA 5HMSA 3NYZA 1BVZA 1MI3A 3R0KA 2J8TA 4BR1A 2XH7A 1XYMA 1E55A 4GYJA 1EYWA 2GSEA 4I8DA 3EGJA 1ADSA 3QR0A 3KCJA 2C19A 1ZHAA 3LBMA 1XPYA 1NELA 3QZEA 4DZIA 5GJPA 1BVNP 5FI8A 2D69A 3IJ6A 3EDEA 3UETA 3WNMA 4M24A 2W63A 3NQ2A 4YXGA 5A95A 1F76A 3WUBA 2CZFA 3BAWA 2NT0A 2INEA 4O11A 4O19A 1NVMA 3QN3A 4ACZA 4EP8C 4RCXA 1R7OA 1XM3A 3VOJA 5TF0A 4LYKA 1DTNA 1WDDA 4X9SA 4WD0A 1XBXA 4ORIA 1PHQA 2HE8A 3HG2A 5JMUA 1B3OA 9RUBA 1HW6A 1S2AA 4MZYA 3BQ5A 1W9BM 3CUJA 4K8GA 2PD9A 3TJLA 3WF0A 3NQGA 3RILA 4S38A 2CCRA 1TSIA 3U4AA 3WDRA 4AZCB 4P7RA 1HN1A 3R0UA 1SW0A 1XG4A 5LIWX 3JZEA 3SN4A 1KFJA 3LPPA 5CLTA 3ELFA 4R85A 4ECLA 2DSKA 2OO0A 1IT7A 1LG1A 3N15A 3MUZ1 3RU8X 5CC6A 2QUUA 2ZZ6A 2OWCA 1A49A 3W38A 3DDMA 5B80A 4ICCX 2WXDM 4LVBA 3AU2A 3QBUA 3TN4A 3S46A 4R7JA 4Q8NA 1XGZA 2OYLA 2DZTA 3KOFA 2J9YA 3PUEA 3N6QA 3DHFA 1ITQA 4TTUA 1PUDA 3IEBA 4NNCA 4D6CA 1KXVA 2Z7GA 1SPQA 2VC7A 2E9LA 2QULA 1UUOA 4PODA 2V3EA 5D03A 4ZQOA 2Z26A 3FAXA 3URBA 5CKSA 3KP0A 4RXGA 4BF5A 4LF2A 4B5UA 4FR1A 2NLIA 3OLDA 4UTJA 1Z9AA 5LGXA 1GW1A 3GM8A 2PZNA 3C3NA 1JDCA 4BEUA 4UMBA 2AOSA 4Y8FA 1JRCA 5HXMA 3PVFA 2GGGA 1NWUA 6XIAA 3HMJG 2JKAA 1A5NC 6TIMA 3MUIA 4EWJA 5E9AA 1NDZA 3C0SA 3UNDA 4E2VA 1BVWA 3BCJA 3SUUA 3WKZA 1YTDA 1ZJBA 3WQDA 3ZR4A 4YVPA 1OGSA 5CJMA 1KGXA 4LFYA 4IG2B 2YDRA 1DJHA 3AS1A 1E9YB 4JTCA 2Z29A 1WKFA 1GKPA 5DT5A 1TG7A 7PTDA 4UCFA 1MRQA 1KM5A 4GK8A 1X97A 4Q8QA 3N1AA 2EXOA 1MUWA 1WXJA 4HBKA 1I2RA 1MW3A 3SFKA 3E38A 4UTWA 5K9XA 1CLVA 5HK4A 3KLKA 3SW6A 4YPJA 4U33A 4IQEA 2OG9A 1B5TA 2Y63A 4PUUA 3MP5A 3GFXA 4I9AA 1Q65A 3ARWA 2ZUWA 1Q2RA 2C15A 3T4CA 3ARRA 1TV7A 4NX0A 1DBTA 2OJPA 3I7SA 1QW9A 3NDOA 4F48A 4IQLA 4L5ZA 1V93A 5FF7A 2ZUMA 4FEZA 5C6MA 4HNOA 3MV01 2HTMA 3XINA 2EPMX 1QHZA 4F66A 2GK1B 4LT9A 1I2OA 4GXPA 4IPLA 3THDA 4TQTA 2VCAA 3M4HA 4C91A 3RJXA 4AYGA 5DEZA 1Q7ZA 2J6XA 3JRKA 3BLPX 2DPEA 1HVQA 1UBPC 4CD7A 4AHOA 1A3XA 2JALA 5HQMA 2X09A 4ZSUA 3BSGA 3AIRA 1XRVA 1W3KA 3VNDA 3C3UA 2PTWA 1JD9A 4JCMA 2DP3A 3ABQA 2J7HA 3QLDA 3BZJA 5G2HA 3URNA 2EPOA 1TX2A 2DFAA 3ABRA 4J3VA 3GH5A 4EPKA 2OLAA 1RP9A 2DQXA 4KESA 4HN8A 3POHA 1DQWA 3WBEA 2NV1A 3G0SA 2DZVA 3FIGA 4UBPC 3PWGA 4KEMA 4LVGA 4E3TA 1PO9A 5TQLA 5HWNA 1Q6FA 1NSJA 3MY9A 1NDYA 3TYEA 3E9AA 2XUCA 3PTQA 5H8MA 1GVFA 2OEJA 3W2MA 1JAEA 2AGTA 1JYNA 1ZY9A 1VKFA 3QVQA 3EXRA 1KBIA 4HA1A 1ME7A 2VURA 3MMWA 1ME9A 2WVTA 1L6SA 4BZYA 4ROPA 1EC8A 3Q2DA 1EL3A 1XIEA 4CN6A 3VGGA 2Z00A 4H7CA 3VD5A 1O6IA 3TSBA 3KBSA 4Z2LA 3OHIA 1AZ1A 2Q6ZA 5A2AA 1C29A 3ZWTA 3PS7A 1QDSA 2TRSA 1EUAA 1RK5A 3WDQA 3MS8A 1VF8A 1GOWA 3P62A 1XFBA 1K9FA 1F3XA 3FVMA 3RK8A 2F7FA 5J8LA 1SJDA 2HV5A 2EG7A 3SQSA 3VTRA 3PJXA 4NX5A 1JNDA 2R94A 1JPHA 3A3HA 4PB3A 2GVLA 3WQGA 1FUYA 1XDMA 2V69A 2XZ7A 1JI2A 1YE4A 1JPMA 3ZZ1A 3M07A 3VVGA 3AIVA 2GUUA 3D3AA 4UTTC 3NL6A 4O1FA 3ABXA 3WG6A 2E28A 3NQDA 3RCNA 4BI5A 1H4PA 4JIHA 5EMYA 5E6YA 3T9PA 4N9BA 3QY7A 3SCOA 3HPZA 1NQ6A 4U2YA 3N11A 1GKQA 3DKJA 1MXGA 1ZP4A 1OFRA 2FQIA 4QAWA 5T91A 3C86A 4LOCA 4C6BA 5FJTA 1PSCA 1AJ0A 3C61A 3TTYA 2HPIA 1ZAJA 4O1AA 3W82A 3GDLA 3D3FA 3CJPA 1AJZA 4WSJA 5F4XA 4NF7A 1WUFA 1Q7MA 2I14A 1JIBA 3CH9A 2VOMA 3G77A 4WJXA 1TZZA 3QSRA 8XIMA 4UXDA 5KMYA 4G7EB 1XFCA 2OQHA 4QQUA 3WQWA 3B0PA 1KCZA 5AHEA 3VM5A 4ERGA 1Q8AA 4ICNA 1EUNA 2RH9A 1XSIA 3ARVA 3TOPA 3CGTA 3THQA 4WY0F 4H8HA 5I0DA 3GTHA 1C90A 4W88A 3N6JA 3UW6A 2A7PA 1W9VA 3MU7A 2ATSA 4RDVA 1EDQA 4US5A 3ZJ6A 1KFBA 1QR7A 1TWSA 3GU9A 3LCXA 3BW2A 2NXIA 2TSYA 3WJYA 2YA2A 2GJNA 3W2LA 2PP1A 5DMNA 1NFPA 4UR8A 2YIHA 3WLNA 4ZQPA 2XFFA 2PGWA 2E1DA 3EKLA 1B2YA 4YVXA 2WC7A 4O16A 3GUGA 4R34A 3WK3A 1GG1A 4JIEA 2OB3A 3MP3A 1CX9A 4BF7A 4NXSA 5A5WA 1XQLA 1JDEA 4Z42C 1XQKA 4CD8A 3H7RA 3PFRA 3S2NA 4A6GA 4BHYA 3IJ7A 1PX8A 4HTYA 3TU9A 4Q8UA 2OR2A 1LCOA 3TC7A 1ZPTA 2C0HA 2VZOA 3S6OA 4E6MA 1UWQA 3B8IA 1VBGA 1PJ9A 1FHVA 3ZR5A 3H70A 4NIRA 1HKMA 1UASA 1REQB 2AGKA 4KWSA 3G1AA 3QMSA 3PULA 3V5CA 3E5BA 2WMGA 1EX5A 2VVNA 5IM51 1J0IA 1JGIA 3GY1A 4ADTA 1JGMA 4K36A 4AY1A 5DCDA 2VWTA 3K46A 3PG9A 2I56A 2ZICA 3FDGA 3VX1A 2D3NA 5C8BB 5D9MA 4AEOA 2CLIA 3CUFA 2CLMA 3REQB 2J7BA 3GG0A 2FZMA 1EZWA 2CFFA 1WBHA 2WKLA 4GQ0A 3CYJA 3WLHA 4PUEA 5AYBA 1PIFA 1FRBA 1ZQ5A 3EKGA 5I03A 5A8MA 5XIAA 1KFKA 4U5KA 1OFBA 3B40A 1YX1A 5G4WA 1EJTC 5CC3A 2BP1A 2B31A 1EDTA 2KZHA 7REQA 4DI8A 5MKGA 4MDPA 5C9ZA 2ZZ7A 1AL7A 4JN7A 5LXEA 1W2PA 4ZCWA 1JAKA 3O0FA 4LJ3A 2TMDA 1HL2A 3B8WA 4QCFA 4XO6A 3GRIA 5D4YA 1NF0A 1QI0A 2NUWA 1DXEA 5EMKA 3S3GA 4DYJA 1H7RA 1JPKA 2PDGA 1KXTA 4AB4A 1BRLB 1E9ZB 5ABFA 4IP7A 3DHDA 3C8FA 4ZQCA 3GK0A 2CPUA 3SCQA 3PBVA 1I1XA 4KETA 3T42A 3U8GA 3OBKA 3BLDA 3W7DA 4D6GA 3CHFA 3VPLA 2Y1HA 4E3VA 5D05A 4HYVA 4DO7A 3OVRA 2QUNA 1U22A 3DHUA 1LZOA 2V3DA 3FFSA 1EHNA 1E0WA 1GEHA 1TPVA 3LERA 3IJLA 4HZ8A 2WK2A 3EPNA 4IH3A 1A4LA 1BSLA 2P1FA 2WSRA 1VBRA 4W7UA 2NUYA 3W76A 5CZTA 4F2BA 1JCMP 1HKVA 2Y6ZA 4LUJA 4PSRA 4TV6A 3DEQA 2PWUA 3ANUA 4ZXLA 2WMIA 2P76A 3OEXA 2ATMA 1VFHA 3GH4A 1C91A 1DPMA 1UA7A 4EK7A 2J78A 2A4AA 3ZO9A 3KZSA 5E5CA 3CYVA 5REQB 4Q3MA 4TXEA 1K8YA 1J11A 3EDKA 4PA8A 4ZE4A 2J8GA 2Y2WA 2DT1A 2R82A 2HXUA 4K8EA 4O1CA 2Q71A 4AVFA 3DKLA 3Q65A 1OF6A 4L4MA 2Y88A 2RDWA 5A6MA 4ZSTA 2O9PA 1C7SA 1O94A 1PZ2A 1XIDA 3ARPA 5LXXA 1P1XA 1EZ2A 1QW7A 2DUXA 4H6QA 4JFSA 4OUIA 1B3YA 4J3SA 5C55A 3MUCA 4JQAA 1TPB1 4F2TA 5CBBA 5FEWA 4AD3A 4XK2A 3WK1A 2VI0A 4UNLA 3ITCA 3WH5A 2ZX9A 1SO4A 3QW4B 2O0TA 2DVXA 4ZOAA 3VMNA 4PMRA 4S2BA 2BGQA 3COTA 3TE9A 3L5AA 3W84A 4JYDA 2WBGA 1TPH1 1XYBA 1RCOB 4E4UA 1DJZA 4HMDA 4NYUA 2ZTJA 4AWTA 1B3ZA 4LANA 4JX5A 4DJFC 1YXYA 5ECUA 4YCPA 3VOIA 1KXQA 1H5YA 4JKLA 3T44A 3RX4A 1JZ8A 3O15A 4X60A 1X1NA 5DQPA 3DGRA 2E5BA 1W2VA 2A3LA 1WDSA 2JGQA 4LUSA 2VGBA 2CBUA 2QJMA 3WIJA 3DCPA 4AUBA 1Y8BA 4PMOA 3HPSA 5A8NA 3BAXA 1GVOA 2WMKA 2YDQA 1E0UA 4N4QA 3QOMA 2G0WA 3PZGA 4XZWA 3ZJ8A 1KC7A 4HKPA 4C6CA 5KINA 4DWSD 4IFOA 4IT1A 4XZ9A 3U2ZA 1U5VA 4IJRA 2X7WA 1DXIA 4K8HA 3MCNA 4WF7A 5CAHA 4PMYA 3A22A 4X3ZA 1R2SA 4ZFMA 4C60A 1KQYA 4L6DA 5HA7A 5IDZA 4DUXA 1VR6A 4PMZA 1G69A 1CT5A 2D24A 3HM7A 1SSGA 2XM2A 1E6XM 2G97A 4H6RA 3VC6A 1O12A 3UXKA 2E5DA 1ZSXA 2DY3A 3UCDA 2PDKA 1CXFA 4DEFA 3TJXA 1K8ZA 2E8ZA 1QPRA 2ZIDA 1YRRA 2AQVA 4HVXA 4ZR8A 4QTGA 4Y2WA 3UVIA 3EWBX 2MUCA 4OKDA 1IT0A 3EB4A 3NSMA 1ITUA 1EA9C 5CLWA 4XIAA 1XLGA 4OE7A 3UT0A 5AYYA 1IEWA 1OWQA 2I16A 3O63A 4PBGA 2VFEA 2ZX8A 4KFOA 5XINA 3V0TA 5DLCA 1EA0A 1QPQA 1AQ0A 4UNKA 1KWKA 4ORMA 3W2UA 4EIVA 1KRBC 4K7YA 5E0FA 2VOTA 1DHKA 3M1ZA 2FPTA 2RKXA 1J0ZA 3MWCA 1W5PA 1DTUA 1F6PA 3SCUA 4DPPA 4REQB 3MV11 1QNPA 5ABGA 3VIHA 2ACRA 5TNVA 3GDBA 1L6YA 4OWGA 5C2CA 4FOJA 1JUBA 5EMUA 4V27A 3ZLGA 3FJLA 2PB1A 5IRPA 4W8LA 1W9UA 4DY1A 2F2HA 1ICSA 1C8QA 4QBXA 1OK4A 4JAWA 3PJTA 3WNPA 1MQQA 2X1IA 5SWUA 1TIWA 2VP8A 1KM3A 1GYMA 3A9BA 2YOCA 3GXFA 5AZ1A 3EA3A 3JUGA 1UCWA 3N3MA 3S4TA 3EWXA 3LHWA 2FHFA 4Y9OA 2O92A 2EF9A 1MO0A 2CBVA 4MWAC 1RSCA 4YTTA 3WQOA 3ZQ9A 3NSXA 1UKPA 2WYSA 4DJDC 1H7NA 1X8FA 3PY2A 2G3NA 4GMEA 4IFKA 3T2QA 2FZDA 4MZ8A 2OLSA 2J77A 3QV6A 1V4YA 1RA5A 3DYPA 3U2EA 3USZA 3KE0A 1LF1A 1UMYA 5IBXA 3TH6A 1GQJA 5I00A 3MHGA 3VDHA 4C65A 5FSEC 1YADA 5KZEA 5HNRA 2HK1A 1VB9A 4JTFA 2V5DA 2W5FA 5GJMA 3GU1A 2POZA 1E0TA 4FMVA 1LM1A 1SZFA 2ZX7A 3GNDA 1FH8A 2VR5A 3BJSA 4NAEA 1A5CA 4JBRA 4B9ZA 5AVHA 1PX3A 1V3MA 1G01A 4FHAA 1Q6GA 3SB0A 1V6XA 3RR4A 1EPVA 5FESA 1MRAA 4UZSA 3QQ0A 1W3LA 1LBLA 3B8DA 5FD0A 3HQPA 3GS6A 2E09A 4M6UA 3CXOA 1HP5A 3BLEA 4ADSA 3SRHA 3LMYA 3BC9A 4ZQNA 2ZFAA 2PDUA 3W3OA 1NY1A 1WBJA 3BGJA 1W5QA 2XH0A 3LV5A 4XZBA 3ZT7A 2QMKA 3WMLA 3UJSA 5EPDA 3GAKA 1OADA 2QPSA 3QHMA 2CLHA 1XLEA 3JS3A 1V51A 3KL0A 3L0KA 2G8ZA 1BF6A 1MQRA 4MHBA 1Q8JA 4OUEA 1FWHC 1PYMA 4L9XA 4Z1CA 1NWRA 1W37A 4L1XA 2PU1A 4KH2A 1XLMA 3PR2A 3WBWA 2Y7EA 3NQ8A 5LIYX 1UQYA 2G5WA 3N18A 3F4NA 5DFAA 1FXQA 2FZBA 1HNYA 3MJYA 4N42A 2QXWA 3UZ5A 1GORA 3H24A 3SADA 3WD0A 3UWEA 3G22A 4XZMX 4GPNA 2CLOA 4XSMA 1U1HA 1XICA 1XYCA 5HMDA 3UA3A 4BY3A 1J96A 3W71A 2ISWA 3AIQA 3EWCA 3R8GA 2VM8A 1EWEA 3KOWA 1FX6A 3TMQA 2Z6IA 4YLWA 1OX5A 5FKYA 3KUMA 3WLOA 1ZBCA 1U5JA 2VDGA 2PWEA 1LLWA 1R3YA 3BAJA 3V5OA 5FA5A 3KS5A 3W7MA 1HJXA 4ZO7A 3MMTA 1TCMA 3GIYA 1S5TA 4L80A 4RE3A 4CD4A 4DELA 3VGHA 3UWVA 5AFDA 3KBWA 3TNOA 2OT1A 2VD8A 1JCNA 2ONEA 3DHPA 5KZ6A 2HQAA 4DUVA 1XIMA 1Q13A 2IW0A 3GAYA 2H8ZA 4H9XA 2FGBA 3CIWA 3WLKX 2DJXA 2F8QA 4GE8A 2FJKA 1ZBVA 1AMYA 1ISWA 3B0XA 1TV3A 3C8NA 2P53A 3FYOA 3VGEA 2GVEA 1S2WA 1H0IA 3WLJA 1XRSA 4RE0A 3LV6A 4O28A 3SY5A 1CI1A 1R9YA 5BRQA 3IAQA 4F9DA 3O05A 1PKYA 2OXNA 2J7GA 4NNAA 1VFTA 1BLIA 1OYAA 5I3FA 2OSWA 1H61A 2OZ8A 4PGLA 4W84A 2R6OA 3L5LA 4CVWA 4MUPA 4QGCA 3B8UA 2X8RA 3BZGA 3OYXA 1EO5A 1MEHA 4I7WA 5E70A 4S3KA 2UZ9A 1W8GA 4KCUA 2ZZ4A 2EAWA 4UQCA 4X0NA 1CGVA 5EBUA 3QR3A 1E6NA 1ZP3A 3B0YA 5CJ5A 4PMNA 5JVLA 3S47A 3U2OA 3FDKA 1TJPA 2KAUC 1Z3NA 3WELA 4DJFA 2BVYA 1LRNA 1QI3A 1PZ0A 5FEXA 1HKIA 3FXYA 4XB3A 1QATA 1R8LA 3JW7A 1I9CB 1BXBA 1VCGA 3UZZA 5CPTA 4UFLA 2CEQA 3NDYA 1KW1A 3CQ0A 1SZEA 1RUSA 4JTAA 4CNNA 1KNWA 3LSCA 2Y89A 4WSHA 4JCLA 4Q4RA 1HKWA 1QAPA 2AAMA 4N9EA 4PEKA 1DJGA 1XLLA 3PBYA 3AYSA 3DG6A 5C9UA 2YCLB 2YFNA 1SMAA 3S42A 1NTHA 1U2YA 2UY2A 3EMCA 1M9HA 1KM4A 1D3GA 2X42A 1OG0A 4B16A 3B9NA 1HTIA 1YXDA 1WAUA 2DUAA 2NQZA 3G0UA 2J8FA 1KV8A 1F07A 1L9WA 3DXIA 3LGEA 1JR1A 2A2IA 5CGMA 4FP1A 3MUAA 2XISA 4ACZB 5LIUX 1OX4B 3H4WA 4J3ZA 3KCLA 4CCDA 1LRTA 3DFSA 3T05A 5A3HA 3TV8A 2PLMA 4C1LA 3GHUA 4H6EA 3LZ3A 1W3NA 4UFHA 2WW5A 3N4FA 4YNGA 1XLJA 1DJWA 1S5MA 4XIMA 2GDQA 2VKZG 2PC4A 3DFYA 2ZRVA 4PBFA 4HHMA 3SDOA 1NAL1 3GR4A 4I5UA 3H4XA 3W7LA 6ALDA 1RBAA 5GQBA 1RV8A 3UGVA 1UZDA 2X2GA 4FNSA 2PDCA 3U9IA 2VX6A 4Q8VA 4QS5A 3BOLA 4ILSA 4R33A 4D1IA 3ONBA 2W79A 4QQ3A 3MKKA 1PDYA 4L64A 4G5DA 1F6KA 1E6RA 1TPWA 4O1DA 4FXSA 3IGSA 3LENA 3TNBA 3SO7A 1WOBA 2C3ZA 2ZRYA 1QNQA 3O8AA 1S3TC 3BMWA 3UG4A 1OC7A 1FXPA 2Q09A 4BF9A 5ABTA 1ONRA 1HF6A 3TC3A 4HJFA 2G4JA 3LOTA 3SGZA 1KKRA 4UFKA 3BE7A 2YFOA 1RCQA 4WOQA 1R0MA 1TV8A 4RUBA 2FTPA 1M03A 1NOWA 3M0VA 1QJWA 4QCEA 4UQBA 1DE6A 2BODX 1HQTA 4WXYA 3TIMA 8TIMA 1XINA 1GOIA 1V0LA 5F1UA 1E1FA 4LAUA 4ATDA 3DG7A 3G6MA 4UWMA 1JZ3A 4BI6A 4B2DA 4KIRA 5I02A 1QHOA 4MDOA 1ONXA 5EU9A 3BGGA 1FTXA 3A4WA 3OA5A 1DJNA 2ACUA 4TVCA 3I68A 2VVSA 3VKCA 1UYQA 3BDKA 3D6NA 1KXHA 5CPLA 3LXAA 1TQJA 5BWFA 3DFHA 1ZJAA 3S83A 3GW3A 3LX9A 1CXIA 1W1PA 3T7VA 5A6JA 1SJCA 3UWWA 4GYKA 2A6LA 4EX4A 1EEPA 1MXDA 1CPUA 4RNHA 1E6QM 1BYCA 4C7DA 3W85A 3CBWA 3CAWA 3OZMA 1LOLA 2J66A 3U57A 5KEZA 1VFMA 3W74A 1EGVA 1XUZA 2PLJA 4A2RA 2GQAA 4NJKA 3IV8A 4H41A 3A47A 1NP2A 2E0PA 3GH7A 2AAAA 3QV7A 3UJEA 4OBSA 3SCTA 1VFUA 3NWRA 3IGUA 1E5JA 1JL8A 1QVBA 3T81A 4HPNA 3DBNA 1JFHA 2PP0A 1EYEA 1FDZA 2PBOA 2RFGA 2AKZA 3DC0A 2Q8XA 4MWAA 5MF5A 4A8LA 4W86A 3VOFA 3W6MA 3K8KA 2V3FA 1KM0A 3VKKA 2VR4A 4QDMA 2WC3A 2GUBA 3W53A 5C70A 1P0BA 2QUVA 2CLFA 3CMGA 4RZBA 3OGRA 4FX6M 3WQ4A 2WMIB 1JXKA 4DLFA 3NAVA 1F9CA 3VNIA 4AMCA 4JS3A 3P61A 3SCSA 3WLSA 3QZ6A 4UQEA 3R4IA 2PDXA 5C7HA 3UG5A 1LWHA 2QCMA 1T41A 4KPLA 4JDBA 3LXCA 4JYFA 4LCSA 2HDJA 2X40A 4JHZA 4J35A 1DQXA 4FS9A 1US2A 1N8IA 2NX1A 4GLEA 3OBAA 4WZHA 2DZAA 3MJMA 3NUKA 3KTXA 1BKHA 2J75A 3W81A 5D2TA 4D9PA 3DYMA 4DB7A 2ZUUA 2D2OA 3F7JA 1YE6A 3DI1A 3M16A 3SY1A 4H9YA 3R6IA 2E6YA 3CB3A 3ISIX 3BO9A 4GCAA 4EXBA 1J2BA 4IXHA 4XZNX 1O5XA 3QTPA 4CVUA 3GHRA 3RLGA 3KZPA 4E2BA 2FMOA 1SW3A 1DJXA 2OSXA 2WV8A 4NQ1A 1HL9A 2P3EA 3CZ8A 4PTMA 4MYXA 1JEZA 3NGFA 4GVFA 3BLKA 1GZGA 1G5AA 4ICMA 5F1VA 4A3RA 4B9YA 1T0OA 4RDYA 3G1XA 4TVUA 1HFBA 3W7QA 1P7TA 1HL8A 1QT1A 2PRHA 3WQVA 1FWWA 4PCSA 5D30A 1IEIA 4A3QA 1IZJA 3B8VA 2QHAA 4H9TA 3AMKA 4ES4A 1TE1A 3O6DA 2CWXA 3LU2A 3C6CA 5BMWA 3RG6A 5E0KA 2DIJA 3O7UA 5DT7A 5BU6A 4KQNA 4YIWA 3SN1A 2HE5A 3DOPA 3VZXA 1P6WA 3NZQA 1H5VA 2X0HA 5HANA 1MZRA 1OFQA 3TW9A 2V5CA 3MZ2A 3VNJA 4CLMA 1BXCA 2FZ9A 4A21A 4KWWA 2RDUA 4MM1A 1R2TA 5HJLA 4L65A 1B0IA 2WCGA 3MT1A 1JCJA 1BSIA 3M5XA 3NO3A 3HA1A 5FL0A 4DO5A 2GJXA 1TR1A 3F2DA 3FV9A 5MHBA 3T08A 3EOOA 2VUNA 2WWDA 3KAOA 3NQVA 4WUIA 1LWJA 5KZMA 3EEGA 4K38A 3W4RA 1MDRA 3V4BA 3A3WA 3ZXWA 3FXGA 2NV2A 1H2JA 4DX3A 5AC6A 1KGWA 4RNJA 2VZUA 3CB8A 2YLLA 4CD5A 1LYXA 4IGMA 1CGXA 4KRUA 2BZNA 3UWQA 4UQAA 4C6QA 1C8VA 5IFPA 2H9AA 3PN8A 4AIEA 1XBYA 4OQVA 1T8XA 1V03A 3PPHA 3E1F1 3PSVA 3H23A 3PTDA 4B90A 2YYUA 2BGNE 4HB7A 3UPMA 1KRAC 2VEKA 1ZU8A 3VCCA 3B9DA 5AHIA 1XIIA 4NJGA 2BV9A 4OZOA 2W0UA 5IBXC 3PP7A 2W61A 3A24A 1XW8A 1OCJA 4J3UA 1IGSA 1M7PA 3VIJA 3IVSA 4DBWA 1U5HA 1XGDA 3NVDA 5E6ZA 1M1BA 3ITLA 4EVZA 1VCVA 1ZBWA 4FZIA 2VDHA 1PTGA 1VRXA 3W1UA 1G4EA 3SECA 4DYEA 4IJBA 2CBIA 4LPCA 3BGAA 1AW5A 1RHCA 1P48A 2XDFA 4U28A 1V6WA 1EO7A 3NZPA 3MSGA 2BFGA 2RUSA 2V3GA 3N17A 4XUGA 2Z24A 1TQXA 3VXGA 2ABAA 4IIHA 4I6VA 5TBOA 4UTMA 2XIBA 2E5CA 1V77A 5FL1A 3AWNA 3ECQA 4X63A 3RXZA 3APGA 3MHUA 1E71M 4W9TA 4FNRA 2EO7A 3UJFA 4PE8A 1U1UA 3RPDA 3QMTA 3VD7A 4C6EA 1F3EA 4QROA 3GXIA 2IS7A 3LNMA 4JHMA 4O52A 4I9TA 3AMLA 3RLVA 5I3DA 1P6CA 3G1RA 2LLEA 1E3ZA 1BD0A 1OFPA 2RDXA 1FWJC 1TJ0A 5GPRA 4DPQA 3BG5A 2YX0A 3VNMA 4H8NA 3LBCA 1REQA 2CXGA 4Q7IA 3ARYA 1BTMA 4M7SA 1KV5A 3W1QA 4C7GA 4IF2A 4IZGA 3M0IA 1AK5A 3DUGA 2V5KA 2HRWA 2BY2A 4NAFB 4MMWA 2REQA 3W1MA 1DOSA 2FVKA 1JZ5A 2DGAA 1HKKA 3WH7A 1Q6EA 1EX1A 2H3BA 1THFD 3E2SA 1MW1A 3UYCA 1WP6A 4GI6A 3QR1A 1OGGA 1LRQA 3ZVIA 4A3HA 1RBOB 3SCWA 3WJXA 1OFDA 3H22A 1PYFA 3M5VA 2DORA 5LNUA 2OEMA 3MP4A 2CU0A 4JIPA 3VFLA 3M46A 3BG9A 1GJPA 3QHOA 3LNPA 1OCBA 3LSBA 3AIWA 1WE5A 1H62A 3MKVA 5MKGB 4R9XA 3AYTA 3IVUA 3I3EA 2ZZ1A 1B90A 1RQBA 1JZ4A 3E49A 3JVAA 4Q32A 3HQ1A 1CGYA 1ZZMA 3NPXA 1OYBA 4XO7A 2VC5A 2BY1A 4MY8A 1X6LA 4P61A 3C2OA 1UKQA 2WBKA 4JGDA 1LBFA 3GG8A 3E0LA 3CO8A 3P74A 1H7PA 5CG0A 2Z4GA 2ZQ0A 1PWLA 4DF2A 5EFDA 2CESA 3QGVA 3TYDA 1S2VA 3HV9A 4IHCA 4YU1A 5E93A 3PB0A 3W9ZA 1Z41A 2QF7A 1W5NA 2NVAA 2XH2A 5D8ZA 1E72M 4HHLA 4YHGA 3DERA 2YPIA 5B7ZA 1XC6A 3WNOA 2CKRA 3STGA 1GHSA 5LNVA 4L4PA 4US5D 4R9OA 3LMZA 1G4SA 5AHFA 3VIGA 2QR6A 2VL4A 1XWYA 4D6FA 3BMXA 4HHPA 1ZGDA 3II1A 5HQLA 2VRQA 4NNBA 3RAOA 4JR5A 2BX7A 4O18A 5CH9A 3TJIA 4QE1A 3ENLA 1Q3NA 3BUVA 1WCGA 4LEFA 2V2CA 2E9MA 3S5ZA 5I06A 4WCJA 4IICA 1W0MA 1LT7A 1VJIA 1KFWA 1LL4A 4AZHA 3OOQA 3LQLA 2FVMA 3W0KA 3L4TA 4LNYA 4W7VA 4DZHA 3M0JA 3A6OA 3KHDA 5D37A 5EYWA 3HU7A 4AXNA 4CCZA 4CEUC 3IJIA 4UTIA 4LC6A 3EPMA 2BXYA 3W7NA 3N25A 4O10A 1MNZA 2VZTA 1AUSL 3C56A 3MB9A 4UB9A 3R5EA 3RITA 3WYZA 4AD0A 2PLKA 4ASTA 4NRRA 4I9MA 3UWZA 4AMAA 3HG3A 4QDWA 1UWUA 3MYOA 2QJGA 4YCOA 3CC1A 2WNQA 4O14A 4QHRA 4Z1YA 3QW3A 4GIAA 1ZJHA 1I6NA 1FWFC 4U3AA 2D0HA 3ERPA 4C6OA 1EGMA 3BJFA 2YCEA 3EMQA 4UCGA 3WBAA 3ATZA 3PSWA 4JFWA 1GJUA 1K1DA 3CHCA 3KBVA 4GVHA 2G4FA 1HP4A 3LHYA 3T1GA 3F4WA 5BZAA 2PBGA 5H1WA 5E0CA 4C6NA 1E43A 2C0AA 4D6HA 3V16A 4TTGA 3VILA 1QK2A 3ID7A 1K9DA 4I90A 2QCNA 3HFYA 3PZUA 5EFFA 5D2YA 3GLCA 1NWSA 5CSYA 1QASA 4E4PA 3W73A 5M1TA 1TJ1A 3RNDA 6ENLA 3GC5A 4QG6A 3TCSA 3KVKA 3KBMA 1RAKA 2BNJA 3MW7A 3DI0A 2B0MA 4JICA 4Q4OA 1P0EA 1XD1A 2V68A 1IT8A 5HUPA 1WZMA 3G1YA 4FF7A 4HSNA 3APTA 2FPYA 1YNPA 4AXKA 3E96A 5CQ1A 3MO4A 5BU9A 2WNZA 4HU8A 1WNOA 2V2HA 2WSQA 4CQ8A 5AC8A 4A2SA 1RJPA 4IJCA 3WX7A 2OX4A 2Y5JA 4G1NA 2QW5A 3NVTA 3S9ZA 2ZRWA 2YBTA 1ODUA 2YCLA 2MANA 3ALFA 4KKXA 2O9RA 3LN3A 3OZOA 4EF8A 1H1ZA 1ZJIA 2YZRA 1UC4A 2YW3A 4TV5A 1Z89A 4RPQA 3EYPA 4LNCA 4GA8A 4HD5A 2VFIA 3CV1A 1I2PA 3QPZA 4RJEA 4ZB2A 4GNVA 4B5XA 2JEQA 5CPSA 1KFCA 3LI0A 2R14A 3SGUA 5C7VA 2BOEX 3VUSA 4FO4A 3TYAA 5BMXA 4JNYA 2ZE3A 1AQHA 2V82A 4DAIA 1GWJA 1VLIA 3FCPA 2HBXA 4KEUA 3L4WA 4PYSA 2B81A 2PGEA 3PTMA 3HBLA 3AAMA 4ACYA 3TR9A 3KCOA 2PS2A 3C2VA 4TVDA 4JTEA 4MADA 1HIZA 3QQ1A 2HNEA 3GVRA 1ZAIA 2NQHA 2Y7GA 1XXXA 3VNZA 2BHYA 1EBGA 3WZ0E 1HJSA 1PVNA 1XI3A 2V81A 4M1BA 1H7OA 1UHVA 3Q58A 1T5AA 2QPUA 4GG9A 2ESCA 3P0WA 3OGVA 3S9IA 2FYMA 2GZXA 4UTTA 2OCZA 3GBDA 1S5WA 4MJMA 1NWTA 1PCWA 1SR9A 1L6GA 4GVGA 2GQ8A 1S2TA 3VX0A 1VH7A 4Z0JA 1IHIA 4NJIA 3QC0A 1Q6RA 2C8NA 3GU2A 4P8VA 4AD1A 4H19A 1A0DA 2ZUVA 1JFXA 2ZDRA 4CU8A 4JY9A 4HPGA 4GH1A 4EPBC 3LCHA 3DN5A 1K03A 2EG8A 3W7GA 4HZ6A 2V5JA 3AISA 4XKYA 3MHFA 5CGTA 3TXVA 1RY8A 5D09A 1BPLB 3CTTA 4E8DA 2G3JA 4L9ZA 4OVXA 5CAKA 3HPFA 1QU4A 2OGYA 4GBDA 1NDVA 3OQ8A 3WJZA 5C71A 1F5ZA 3SIZA 5I3HA 1W1TA 5CZKA 1NJJA 4IL2A 4QS6A 1RLCL 2XG9A 4JX4A 3TTEA 1G9HA 1C7TA 4HTBA 2AKMA 3LGDA 1OCQA 4IWWA 1XIGA 2F84A 4OT7A 3SSZA 2PRMA 3E02A 3ZT6A 2CC0A 1HGYA 3RUBL 2X2YA 3ITYA 4DM2A 3DX5A 4GO8A 1YIXA 3ONCA 2Z1SA 2WZTA 3OYZA 1V02A 2EKCA 4GWEA 1KM6A 1P5BA 3BANA 5DCEA 4IGHA 2QGYA 5LNWA 4IMDA 2NQ9A 4CNTA 3LB0A 1J01A 1QO5A 3SZ8A 2DJLA 3B0VC 5TIMA 1EGZA 4B3KA 4O17A 1QOXA 2ZZ3A 4CN1A 3S5SA 4HK7A 3H4GA 4KGJA 1R5YA 2CHNA 3GTXA 4GJIA 1VAHA 1BAGA 2OGJA 3YPIA 2WHMA 1D9EA 4LUYA 1KRMA 4PCPA 1WPCA 1O68A 3GTNA 1SVDA 2I7GA 1F4HA 2RAGA 4HQVA 4C6PA 1O5KA 1UA3A 3KX6A 3H2NA 3WD3A 4GHRA 1J0HA 1J2WA 2QEZA 2GDUA 2A0NA 1EIXA 3CWNA 4HN4A 1N7KA 3OW1A 4IUOA 3ITTA 1I8JA 1IR1A 2ZDSA 3G18A 3POCA 1MQPA 3VE9A 4B5TA 4XTIA 1UROA 3CUGA 3KEHA 2G50A 5GJNA 1JCYA 3IUHA 1MUCA 4TO8A 3LY0A 2QUMA 3SCRA 1UH4A 3EX3A 1HKJA 3UR8A 2YXXA 1VPQA 4GZJA 5DO8A 1GW9A 3G8RA 1ZRQA 1X6NA 4GZEA 4MB1A 3L23A 4M0XA 4DJDD 1QPNA 4XSLA 2V63A 3W7OA 4IFRA 1RJRA 4N2YA 4KMQA 5A6SA 2F9RA 1X1OA 4GI4A 3CHVA 4LTSA 3E74A 4NT0A 4P7LA 2FDSA 3VOCA 3STCA 2FGLA 5LA0A 3L12A 4M81A 2PTZA 1S39A 1DE5A 4B5VA 5DX7A 4F9JA 1H50A 3VABA 3VGFA 2ZUTA 1A3WA 1DV7A 4WY0A 1NFGA 4C6IA 4LAOA 1DHPA 1H60A 4F2UA 3FEQA 2GUYA 4NY2A 3ARTA 5FJJA 1B9ZA 5A2BA 3TEVA 2ZTKA 3W1RA 1QNOA 1B4KA 3EXSA 3SCPA 3PFMA 4QFUA 3ARQA 3TTQA 4CKQA 3AXIA 3KL5A 1AQMA 3N14A 3CQHA 4QEEA 3BL3A 2VO5A 3NL5A 3WDIA 2WVSA 1UC5A 1GYLA 3R25A 3W23A 5TD4A 4GGBA 2A3HA 3VE7A 2ABBA 1GVYA 1VEMA 3R10A 3SUWA 4KIEA 2R1KA 4RV3A 2WB5A 3IK2A 2GK1A 4F4RA 1FKWA 4JEQA 1QW8A 1VIZA 2A7NA 3ME3A 1V3JA 3WJSA 1Q63A 4R7WA 3AHXA 2OTDA 3WFZA 3RO8A 3TFCA 1VLWA 4FLRA 3A5FA 2XH4A 1EFZA 3WFLA 2GPTA 3R89A 3UFYA 2Z1VA 1BG4A 1RVGA 1LJYA 3A4AA 3NPWA 3OIHA 4C1NB 3EX2A 1XLHA 5CEWA 2ZBTA 2YBUA 1CGTA 2PDJA 3BLIA 2E6DA 4TR9A 1SMDA 2FIQA 1QRQA 2CERA 2FFCA 1ISVA 4WLCA 1UKTA 2YCIX 3PBMA 4HZMA 5CG7A 1SSDA 2PWGA 2Y85A 1NH6A 3R94A 4OOUA 4A4AA 4POCA 1ITCA 3VIIA 3A23A 4D8AA 3EX6A 4RK8A 1W31A 1TMHA 2Y61A 3T4WA 1CIUA 4IPJA 4DF0A 3AS2A 1TZ7A 3QFWA 3P14A 5D8WA 3FX4A 1BQCA 4CNSA 3CPRA 2ANUA 4P2VA 1RQHA 3IK4A 3O6AA 2QCCA 1TUFA 2O9OA 2JFEX 4ZL1A 1LL6A 1TZ9A 1ONWA 2A3CA 5I23A 3SRDA 1OINA 1T7LA 5IHSA 4JX6A 3P0XA 1TMQA 1XGEA 4GUIA 3ABZA 2Y62A 5C2XA 1KBLA 2H9AB 3G1FA 2QJJA 2GLKA 1H41A 3AHZA 3IIXA 5HINA 2Y8UA 7TAAA 3DESA 3A5VA 2NVCA 3S5YA 3HV8A 4A29A 3MA8A 4G1KA 4PL2A 2DH3A 4DZ5A 1TVLA 2G96A 3A4XA 1EIBA 1K4GA 1A4MA 4XBKA 1AW2A 2X16A 3TYBA 3GVWA 4GBUA 3W70A 3MC5A 4URIA 1P43A 3GX9A 4XV0A 3DECA 3S6DA 1JCXA 3PUOA 4GO9A 1G7UA 4W89A 3BH4A 2XFYA 2QJNA 1SJAA 1UIPA 3ARSA 1TO3A 4PTWA 4MSSA 2QPXA 2QIWA 3FJ4A 1FDYA 5HAOA 5D2VA 1SGJA 4C6MA 2X1SA 3N29A 2PGFA 5LA1A 1I2NA 4LW7A 1GVSA 3PK7A 4AW7A 4ONVA 3NZGA 3EAUA 4QDPA 1RD5A 4TX8A 3ZVHB 1XBVA 1PV8A 3LBOA 2OYKA 4C6LA 5HUOA 5C54A 1UKOA 4S3EA 1TWWA 5CJNA 1R3WA 3L4YA 1GTEA 3OB8A 3VGBA 4DO4A 3NQBA 2PWDA 2Z2UA 3VIMA 2WVUA 1ESWA 3WQCA 2CETA 4NZCA 5D9OA 4QEHA 4WGHA 4GUFA 2WSKA 3CS2A 5M17A 3MO7A 4CQBA 2VEGA 3W1LA 4UR9A 4M19A 1PDZA 3NPUA 3HIJA 4JTKA 4UTHA 3LYEA 4I5XA 1IYXA 1RH9A 4UOJA 4J1OA 1R86A 1VD6A 3PPFA 3KWXA 1WXYA 2G41A 2A7RA 4RKAA 2O7SA 4S3FA 4HK6A 1V02E 3CK5A 1XLKA 3TSMA 4F0HA 1W8SA 4EF9A 4AC1X 3K5XA 3SEPA 1OZMA 4CNOA 5D9NA 3AJXA 2OQLA 4WKFA 2DW7A 3QMRA 3QPYA 2GFTA 4KERA 2VFDA 3TX9A 4LYRA 1FDJA 1H51A 1XV8A 2QDDA 3O6CA 3GKFA 1OZQA 3T07A 1ZUAX 3MVIA 3BK0A 1S1PA 3G1HA 1DIKA 1LWIA 2GOUA 4GGHA 2J88A 1TPEA 2I9UA 3CM4A 2BASA 2V0TA 1OHLA 4PRTA 3UZYA 3U5UA 4AYSA 5M3WA 3Q94A 1V6VA 4PRRA 5HWJA 1TJRA 5AC7A 2IPGA 3W26A 4AZCA 3PNUA 3RGTA 4WHBA 1X8CA 2DSWA 5JQ9A 1GVEA 1UD6A 3TROA 3BOFA 5BYWA 4F79A 5A8PA 1DORA 4FLQA 2YLAA 4IQDA 2JKPA 1Z69A 3IRDA 3LPOA 2TODA 2CWNA 1A5KC 3NL2A 2OFJA 5DMMA 1HJVA 3WQ8A 5DCBA 1QO2A 3NGJA 4U4MA 3UG8A 1UWSA 3BV4A 2WNWA 2FGZA 3FSUA 3GVGA 3MBFA 5E09A 2NWSA 3DAQA 3WFAA 3N6HA 1EQCA 3W2NA 1GGOA 1JYXA 1PL9A 3K2GA 3PJUA 1F73A 1OB0A 3QC3A 2YSWA 5BROA 4IX2A 3CAKA 4UFMA 1LBMA 1L0PA 1P1MA 2P8CA 3QF0A 4OV4A 4AVNA 1CGUA 4LU0A 4MKNA 4DWSC 4IMEA 1EOKA 3WD2A 4FNPA 1TVPA 4IIEA 3TR2A 2Y24A 2VFFA 1VEPA 4W5UA 1H63A 2X1TA 3NXLA 2MNRA 1J0YA 4LY8A 1YBQA 3CUIA 2V5BA 1T99A 5D2WA 1R3SA 2R91A 2R24A 1S5NA 3V1PA 4UC5A 1BGAA 1FCUA 1H49A 1R6WA 1SR0A 1LLOA 1XCFA 3Q4DA 3SJ3A 4P7QA 1AD1A 3THUA 2WZIA 1UD5A 5IOBA 2IKHA 1ISXA 3IJ8A 4IG2A 3UJRA 3OIXA 1VPXA 2DVTA 4PBEA 4JIQA 1UW9A 9XIAA 4XTDA 4UFIA 2OX1A 4JTQA 3UNTA 2L5HA 1WXZA 2Z28A 3VKDA 4N4PA 3LLFA 2HK0A 3UR5A 4AZ7A 2Z1WA 1KFLA 4GYPC 2P88A 4ROQA 2QCLA 1IEVA 3GTFA 1MW0A 5FF4A 1Q6CA 4RZ5A 1VJZA 4K68A 3UR2A 4WR3A 2WM0A 1EOMA 2Y8KA 2BWGA 5K9CA 4GISA 4HT3A 2PDYA 3LCGA 4FXFA 2X05A 4IP4A 2D3LA 3PZ9A 5H91A 1TV2A 1XH2A 1GQNA 2WO5A 2WOQA 4AAJA 4HK5A 5FAGA 4XD5A 4M51A 5BRPA 2BOGX 4B2DD 3I6EA 2PDBA 1P7TB 1FQ0A 4PUWA 3EMZA 3ZT5A 4DBUA 3RPTA 2J7DA 3EPOA 1GCYA 2WAGA 5DELA 4GABA 4Y8EA 4X2PA 3B8SA 3AXKA 1KTNA 4HMCA 4RLIA 3IJQA 3WLRA 3PANA 5C2GA 4MY1A 3R8RA 2CIPA 4WVXA 5G5IA 4QP0A 1OY0A 3AU6A 4QJ3B 4GXWA 1ZFJA 1J5TA 1J79A 2P10A 2F61A 3BCDA 4LVAA 1BWLA 3WH9A 1EH9A 5KITA 3TDFA 1W9XA 5JH1A 3WQ5A 1FHUA 4AZGA 3VM7A 4L56A 4G9PA 3N2CA 1BGGA 2DDXA 4UQ9A 1JYWA 1C92A 4GVIA 3VDGA 2F6KA 2CLLA 1GG0A 1FVPA 1AA1B 3CLMA 1TA3A 2FB3A 2NQJA 4UZUA 1SFSA 3KVLA 2XFRA 4JZ5A 1DWFM 3CPUA 1EP3A 3IIOA 3PF3A 1D3HA 2DZUA 2Q3RA 2QGHA 4MPQA 4RPPA 1W3HA 1TTIA 4JD4A 5F2IA 1OT2A 1CYGA 4PTVA 2DIEA 3MCMA 1EQPA 3AS3A 3T78A 1GPFA 2BOFX 4JQ4A 5T9CE 2XPKA 1XSJA 6REQB 1LT8A 2X41A 1TMLA 3BOXA 4KWUA 1Z44A 4P5UA 1V0NA 1EJ7L 3LHVA 1E70M 1HJQA 4L6OA 1K9EA 4Y9AA 3W22A 4KT2A 2I17A 1IXQA 3DFQA 4Q4KA 5HNTA 5AYIA 3VDAA 5EBAA 4DWDA 1W5OA 3PHAA 4H04A 1A47A 3G6LA 1OIFA 4NG3A 2GGHA 2ODOA 3S1UA 2VGFA 3HPXA 3FA4A 1OX6A 3U48A 3QOKA 3VINA 4O4WA 3SN0A 3H2CA 2WVVB 1UG6A 4LUTB 4S3DA 3TZNA 1R3VA 2ZRXA 5PTDA 5ABEA 3SBFA 3I3BA 3U7VA 4CUCA 3E0VA 4D71A 3T0CA 3NQMA 5EMMA 4AZ5A 3MMUA 1EKOA 3V1HA 3I6TA 3MSRA 3D46A 4BWLA 5CPOA 4PTXA 3AXXA 2VWSA 1DP0A 4NZ4A 1K7XA 2ICSA 3PZVA 4HJWA 1E0VA 1OT1A 3M0MA 4UNIA 2D0GA 1XLDA 2GGIA 2VFHA 5K9DA 3KOZA 3U3HA 2NW0A 3HF3A 2YGYA 1KKOA 4GKTA 4Y90A 1XG3A 3N9SA 1EJRC 1Q6OA 4KBXA 2WMJA 4LYPA 4PUMA 3GZ3A 4IMGA 1JUKA 1B30A 1HXJA 1ADOA 1FWIC 1SO5A 1W1B1 2VELA 4S23A 3CLWA 1AMKA 1R85A 3GIQA 3GUWA 1RLDA 3PB2A 3C2EA 5HULA 2WHKA 2GJLA 2WWCA 4LQ1A 2RDTA 4GZ7A 4GIEA 4CN4A 4RW3A 4ZXOA 1DIEA 3M44A 2VQTA 5A6TC 4MLJA 3FA3A 3H54A 4R27A 4A05A 2XWEA 4B5NA 3U0HA 1WUEA 2RGLA 4ATWA 1V0MA 4JEJA 4GRSA 3MYPA 5FJIA 4N6FA 4QRNA 2H6RA 1QNSA 3UEQA 4AZBA 2I1OA 5HR7A 3L2MA 1UD4A 2CLKA 1GEQA 4PCFA 1LG2A 4OGZA 3GE7A 3TYZA 3H2AA 7XIMA 1DWIM 4KWVA 2ZA3A 4AU0A 1IGWA 3C0JA 4AD2A 3R58A 4Q6JA 3WF2A 4MZ1A 4Q7NA 3UXAA 2QF8A 4B92A 1Y7VA 5CSUA 1IZKA 3OA3A 3VI2A 3ZLHA 1AW1A 3CTLA 2IPFA 4GYFA 1J12A 1U33A 1A50A 3RM8A 2AL1A 4QISA 3RF9A 2XIIA 2H90A 4YTQA 4NVTA 1YDYA 4BEQA 4E2OA 4W93A 1B3WA 4GQRA 3WUEA 3S9YA 4IFKB 5BXSA 2B4GA 1W9PA 4A22A 4Q8OA 4LGXA 4XZIA 3HN3A 2OT0A 4ZGYA 4F8XA 4BK9A 2JK2A 4YWIA 2A1YA 3GWQA 2FZ8A 5G4EA 3H2OA 3MMDA 4J28A 4GI9A 4GIYA 1XYFA 3A12A 5FIPA 1WKDA 3LCLA 4XAGA 2J6VA 4LS2A 3NQ6A 1PAMA 2B7QA 4WGXA 1W6TA 1Q66A 4D8ZA 2OPJA 3P67A 4OHQA 4ZMGA 4LRTA 3OG3A 3LQGA 1YTEA 2IQ0A 5CC7A 4XISA 4NZ3A 1HZYA 4KCWA 4ZQMA 3TOYA 1XR2A 2GJRA 1M7OA 3FY1A 4XAYA 1X39A 2YDSA 4WY0B 5FACA 1L8NA 2Y0FA 2ZX5A 1D3CA 3RM9A 4K39A 3S1VA 5I7GA 1EJWC 3WEZA 1A0EA 4V15A 4MJZA 4QG8A 1E4IA 5XIMA 4M5PA 1F3TA 4YTRA 4WOZA 3V35A 3JU2A 5DRIA 3OGSA 1AH4A 3TQKA 1HO1A 3WH6A 4AEFA 2XU2A 2VC9A 3NTYA 3WLMA 5A94A 1JVNA 2ZVIA 4EAMA 3E12A 5F7UA 4IIGA 3NOEA 2IKIA 1XS2A 3AWOA 4D6DA 1E4LA 4JPGA 3GVQA 1VCFA 3MDWA 1SO6A 3RMJA 3G24A 1UZHA 1FKXA 4L6HA 4DXVA 1LUCB 1UP2A 2CITA 1VGAA 2VHLA 3F4DA 4HNVA 4NSBA 2C14A 3FA5A 4OJYA 3SRFA 2UBPC 1W1VA 4FX7A 3HG5A 1JDDA 3MWAA 2A21A 1S38A 1YXCA 1ICQA 3AROA 4PMVA 1AZ2A 3PZQA 1Z7AA 3TQPA 5G2IA 1CB2A 3B97A 3LUTA 3OLGA 3P80A 3MTWA 4JTUA 1YLVA 3WF4A 3GSMA 4UOZA 3H2FA 2D2JA 1UH2A 4QLKA 2XIQA 5T8GA 3QYSA 2IPWA 1A5OC 3KP1A 3O6YX 4C6FA 4D8LA 5G1MA 1BF2A 2XSBA 3FHAA 2E7FA 4ZVJA 2CBJA 3FKKA 5BNKA 3AICA 4EANA 3DENA 1NDWA 3VNLA 3EX4A 4D1JA 1DWJM 2BXVA 2DEPA 3L67A 1GQLA 3SURA 2BY3A 2G95A 5I2UA 4DN1A 1MXSA 4FXJA 3A4JA 1OIMA 1UUQA 4P8UA 3C0LA 1UOZA 4M3PA 4Z2HA 3TYUA 5GVJA 1K77A 4ZFCA 3AJ7A 4GY1A 2FZNA 3VOGA 5K7JA 5D32A 4LALA 3M9YA 3PWIA 2Y7FA 4PL1A 3RCMA 3W1NA 2V67A 4K2SA 3WQ6A 1V3KA 4JTHA 3VKJA 4QG9A 4HYWA 2XVKA 2DZSA 5DXYA 1AVAA 4D6JA 4JOMA 1OK6A 4YTUA 1PIGA 2DIKA 2CLEA 3VDCA 3KL3A 4WDWA 5FEZA 4Q22A 3ZMRA 1EF3A 4EPEC 5FF3A 5AECA 3A3XA 3ABSA 2P0IA 1M3UA 2V8ZA 5JUVA 3W6LA 4NUWA 3R13A 5I5RA 4Z1AA 1KTBA 2QZRA 5J04A 4UOQA 4DUOA 4Q4QA 4XVEA 4UTLA 2AL2B 3N2TA 2FVLA 4OTKA 1Q6LA 5AOUA 2ZC8A 1SFLA 1HO4A 2RJHA 1RXOB 4HCDA 2ADAA 3W7EA 4U31A 3GB6A 2DSUA 3QEZA 3W00A 4IPPA 4LUSB 4JFVA 3W27A 4D6EA 3VIKA 1EC9A 1QPKA 3SY8A 2J9XA 4S1FA 3I7QA 1QOQA 2X0YA 1GHRA 1MWOA 3QV9A 3MQTA 4WIWA 1AQFA 3RYSA 3TN3A 3VAVA 4PUKA 3UXLA 4DAFA 3OZPA 4LSBA 3CT7A 1F8IA 3F03K 1DL3A 4LVDA 3DC8A 3S5NA 1PX4A 3R0DA 4H00A 1A5UA 2ZE0A 4MB5A 4IX0A 4X61A 1TFVA 2A85A 3M7SA 3L66A 4FX8A 1JF6A 4Q4MA 2DZXA 1VIWA 5LNSA 4EPDC 1PKMA 1J4EA 3U4FA 5KETA 2ZRZA 4HYRA 1IV8A 2VGGA 2VUYA 4RDWA 1O1HA 5AC4A 2QVHA 1KBBA 1O5QA 3CAQA 3E0WA 4OBTA 2XIMA 1B57A 2WZEA 1YNYA 2FH8A 4Q8WA 4CEXC 3EDDA 3P5ZA 4MOZA 1R3RA 3B9EA 2OLHA 3PTKA 3N2XA 3LGGA 2E9BA 3NFUA 4GNJA 2FKPA 4NI3A 3M7WA 4O13A 1UD8A 1JD7A 3CQKA 4GOAA 5JBDA 3UG3A 2FDMA 1ZENA 1GZ1A 3CT2A 4V1YA 2FTWA 3AQUA 1OX4A 2OZ0A 1VYSX 1AH3A 4ZO8A 1H11A 2B7NA 3RX2A 2ZUSA 1ODZA 4L9YA 4C6KA 4NI8A 1JG9A 2R9RA 1AODA 5F4SA 5BXTA 1CEOA 1BG9A 1WV2A 2EBNA 1LP6A 4LV4A 5DY2A 1Q5MA 4M6QA 4LS1A 2WMHA 1UMLA 4CQ9A 4D6IA 3F4CA 1TTPA 3QGAC 3NM1A 6XIMA 3W29A 1KLYA 4N9CA 1QHPA 3S8HA 3EX1A 4CD6A 1DKWA 2D2GA 4JL2A 3CPGA 3FS2A 1O1ZA 3WF3A 3CV7A 2BB0A 3W7JA 4JTLA 4CQDA 1JI1A 3ES7A 1R38A 1L8PA 2Y5EA 4PH6A 3NL3A 3RRXA 4A35A 1WDPA 2VENA 1D7KA 2YL5A 4MUZA 2E77A 3CZGA 1CDGA 2PZ0A 3VO0A 3ZOAA 4UMAA 5LHEA 3N9KA 3B4UA 1OFOA 3FAWA 3VK5A 4QX4A 2C91A 2DZWA 3KVJA 3SCNA 2NWRA 3QJAA 3TZFA 4RW5A 2XFWA 4MVAA 2X0SA 2YJQA 2IUZA 2QT3A 3P3BA 1GQIA 1RK6A 4EAYA 1V0KA 3LZ5A 3CO4A 3GNOA 3NO5A 2JF7A 4QLJA 3EDJA 2Q8LA 3SJNA 1YBQB 4HPJA 3QM3A 3NZ1A 1E0XA 2FJUB 1MSSA 1RPXA 2CYGA 3RO6A 3B03A 4NZ5A 4DUWA 1JZ6A 4Q8MA 1EJVC 2EG6A 3PUGA 2CZ5A