4NXKA

Crystal structure of abp-d197a, a catalytic mutant of a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
total genus 149
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nxkA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nxkA01
1VYRA 5K3VA 4LC8A 4FNPA 3TFXA 1UH3A 1TQTA 3A4AA 1KXTA 1AMKA 3QM3A 2QCHA 5HPOA 3HF3A 3GDRA 3TQVA 3QSRA 2FTPA 4JTFA 4ZQMA 3OLIA 1VRDA 4LS0A 4CVWA 3BW4A 4AHQA 2GJPA 1GG1A 2OJPA 4NJJA 5GVJA 3BVTA 1CYGA 1I8JA 2ZBTA 3QYQA 3L9CA 4JDYA 5KITA 1CXFA 2WVTA 1QI5A 1QOQA 3GAKA 2EO7A 1CXEA 4HT3A 3SY5A 5E70A 2E4TA 4IMDA 2I14A 4MLJA 2BY3A 2FPYA 3TW7A 1VQTA 2TSYA 2BSLA 2JGYA 4U31A 1QW9A 4Z1BA 1Y7VA 2ZRVA 3GLCA 3FYPA 1KXVA 2YW3A 3P61A 4OBTA 2OT0A 4RXFA 4XUGA 3VU2A 3DBPA 1JL8A 1W8SA 1H7WA 1P4CA 1TPC1 3VI2A 1JQVA 2WNZA 3G8RA 3W7NA 2QCDB 1JCNA 4IX0A 3QW4B 3FW6A 1AW1A 2PWEA 4O52A 6TAAA 3BK0A 3W7HA 1FCQA 1UD5A 1SZEA 3TAKA 1OYAA 1LCOA 3QEZA 4IXXA 2HMCA 4UFIA 3M47A 4GIAA 3GXNA 3RFAA 2OW6A 1XFBA 3NGJA 4IXHA 1TQVA 4UTWA 2PWGA 5LGZA 4TR9A 3B4UA 5J5RA 1DJQA 1DKWA 4ZVJA 2O7QA 3II1A 4O17A 2CLHA 4YLWA 3LOTA 4LVAA 3PS7A 1W1ZA 3AO0A 3W7LA 3HGRA 4AHPA 3WDIA 2PCQA 4AWSA 1EA0A 3T40A 1RPXA 2FYVA 2ZTJA 3PR2A 3W76A 4U3CA 1XD0A 3WY3A 1HO1A 1YXYA 3TXZA 3HQ1A 4XB3A 1WDWA 5I23A 3M5XA 1EUNA 2QMJA 3M1ZA 3FFSA 1GZGA 1LWHA 2Y6ZA 1BF2A 3D52A 2AGKA 3GAYA 1HX0A 4JTEA 1FCVA 1H7XA 5DCEA 2NUWA 4OIFA 3GDMA 5F2GA 2FE0A 4FMVA 5KTLA 2VKZG 3W7EA 2C1HA 3L66A 3W37A 2ZXQA 4HOXA 1TQJA 2CW6A 2NX9A 1VJIA 5KSWA 1I75A 3HMJG 1JF5A 3DENA 3OEXA 1T8XA 3DFTA 4O11A 3VMNA 5FF0A 4KWVA 1KCKA 3W1AA 1XUZA 1LROA 3H54A 5BW6A 4LV4A 4MIMA 1X1ZA 4FHAA 4GNJA 2BY2A 1MFVA 3W1TA 2B4GA 2BY0A 5HQEA 3UQNA 6CGTA 4WY0A 1NEYA 3W7IA 1BAGA 1KTNA 3TSBA 2YKKA 1FDJA 3L4XA 5LSMA 1UJPA 1LWJA 2X1TA 4CNPA 3HZ3A 2QCCA 4HIBA 5AHMA 3LGEA 1A53A 3TAOA 2FPTA 1LRQA 2FH6A 1GTHA 3P8IA 1TRIA 5DELA 3GB6A 3UWYA 1DQXA 1DL3A 4IQLA 1CXIA 3FKRA 2NSXA 1V3KA 4JCMA 1TREA 3FAWA 1GEQA 3K8KA 1NF7A 1MEWA 3W71A 4ADTA 2E5DA 1XSIA 3A24A 3UNDA 4OHQA 1IV8A 1W5MA 2G96A 2ZCGA 1GVRA 3QZEA 3ANYA 4ADSA 1GT8A 3GR7A 3WFZA 3PSVA 4RXGA 1A50A 4JICA 4MJMA 1VH7A 4FXRA 4O1BA 5C2XA 2VC6A 3BG5A 4LUIA 1U5JA 4O15A 3KE0A 3VGEA 1K7EA 3P81A 1ZENA 4GJ1A 3D4ZA 4CLMA 2QJGA 3W7JA 3JS3A 4TX9A 3L67A 1NM9A 2CLEA 2GJLA 4JTKA 3W1QA 2EACA 3B0VC 1QW8A 2F1AA 1WOAA 3BUQA 3DX1A 2H8XA 4AWTA 2A7PA 1QHPA 4B9YA 4E2OA 1SSDA 1OFRA 2B0MA 4MKNA 5TBOA 2OSYA 1U83A 3W1UA 5K2ZA 3MWAA 4IPJA 1Z48A 2RH9A 3SECA 4O4WA 3TK7A 1BVZA 3W1NA 2OYKA 3UERA 5HWMA 3UWVA 2DU2A 2BTMA 4P61A 4CNOA 1JCXA 2G3MA 3B0UX 5D03A 1MW3A 2Y61A 5TQLA 1JCJA 5FEWA 1L0PA 3TOPA 1KM3A 1OFPA 1Q6LA 3DU0A 3QPZA 3BAIA 1G7VA 3WDHA 4C1LA 4JFWA 3UWWA 1KCLA 3T55A 3B06A 4JD4A 5CPLA 3UG3A 2ZUUA 1I4NA 3GXTA 3WNLA 3A23A 4FLRA 4WF7A 5HMSA 3U8GA 1DEDA 4ZZ9A 3NZ1A 3O8AA 1D9EA 2QJHA 3LBMA 4JX5A 3BW2A 3P74A 5C55A 1UUMA 1YDOA 3PVFA 3W2LA 2ZX6A 4OJYA 5F1VA 4PL2A 2OCZA 2V3FA 4C1KA 1EUAA 4K39A 1ICSA 1N8FA 3L4TA 2O7SA 2GQAA 4U2YA 1JD9A 4FLSA 4HOWA 1YLVA 2I9EA 3OHIA 3CEPA 1TV7A 3VGGA 1RD5A 3L5MA 3TC6A 1WA3A 3NPUA 2NWRA 2QAPA 3W1MA 4IUOA 3TJLA 4XTDA 4HNVA 2CZFA 5AHFA 5AB3A 3EEGA 2EF9A 3EJRA 3O05A 4FNTA 3PUOA 1KWKA 3E0IA 1TQUA 3WN6A 2C6QA 2VUYA 1TCDA 1UD6A 3ABQA 4XZ9A 1EX5A 3Q58A 2ZFAA 3VMPA 3AMLA 1I2OA 4OWGA 3TC7A 3W85A 2BHYA 2ABAA 1J2WA 3G1FA 5I3JA 1YXDA 5HJLA 5AHIA 4YCOA 3ZR6A 1VJSA 4GI9A 2NX3A 3TDFA 3GXIA 4IMCA 1D3HA 4MLRA 3BLFA 1E40A 5LNSA 2J27A 1NFBA 5K4XA 1LBLA 1OVDA 3GDTA 1SSGA 4NX0A 2C19A 3VM5A 3VSUA 2YDAA 3BUPA 1H61A 3EDFA 2ZUTA 2P0OA 1ML1A 1KFBA 3GYEA 1F5ZA 4AXKA 1I2RA 3ABRA 4M7SA 2OSWA 1JRBA 4IMFA 2R14A 3P60A 5F4WA 2ALWA 3BW3A 1JCLA 4CCEA 3BAJA 2A6LA 3CPRA 3FLUA 1VFUA 3STGA 3P5YA 4K36A 1KBJA 4ZL1A 2WANA 1OFBA 4A3UA 3JR2A 4JTGA 3LB0A 3W7PA 2ZA3A 3DI0A 2EADA 2E0PA 4JY9A 3TU9A 3P67A 2IGTA 5CGQA 2YYTA 5DXYA 1RP8A 1H60A 3HG2A 3C61A 3WJZA 4JYEA 5MHBA 4AH7A 1AQMA 2XVKA 1K02A 1SFJA 2DJXA 2E6DA 2YYUA 4K7VA 4ORIA 4PCFA 5LNRA 1G7UA 5CLTA 4JYDA 4YMZA 3W2JA 3S1VA 3SZ8A 4RX0A 4I7WA 3MO7A 3IIPA 3PULA 2ZXAA 2QCFA 3PB0A 5K4ZA 3DHDA 2EQDA 3BUDA 2E6FA 3O6DA 1R30A 1XH1A 1H1YA 4NX5A 3W6YA 2OMAA 1F2JA 4WSJA 4WOZA 4GWEA 1H7RA 2VFHA 1WBHA 4UFJA 1UH4A 1OSEA 4UR7A 1HNYA 1QPNA 4MYXA 4GUIA 4GO9A 1QHOA 1XKYA 3VKJA 1ZJBA 2CPUA 4LS2A 5LZLA 3EKLA 1TYGA 1B3OA 5DY2A 4UTKA 1W37A 1D3GA 3ATYA 4JTLA 1QNVA 2GVYA 4CGTA 2V8ZA 3KRUA 3FAXA 3NQCA 3IIOA 4O19A 2EABA 3W74A 1AG1O 4MB1A 2ISVA 3WEMA 1JVNA 1JGIA 5AHEA 3LRLA 4UQDA 4AEEA 7TAAA 3NL6A 3NVTA 4UFKA 1XL9A 1OJXA 1ME8A 1V3MA 3N34A 5C54A 1BEUA 3ZT5A 3VSTA 3KVLA 3A5VA 3CZSA 2C7FA 3DHUA 2FB3A 1WBJA 1CXLA 3M43A 1MEHA 4GXMA 3NQMA 4O16A 3D0CA 1AW2A 5LNUA 1LZOA 1NAL1 3N9SA 3U6WA 4W93A 1O5XA 5G1TA 1Q4NX 1OFDA 1YYAA 3G1SA 1DJNA 3C2VA 2WSKA 4K37A 5CLWA 1JXJA 3DI1A 5EYWA 4CCCA 3UYCA 2Z1KA 1LLWA 3HG4A 1YDVA 1GYLA 5AC6A 3PUDA 4AYSA 1QO2A 1I2PA 1NF0A 2ATSA 2VXNA 1RPKA 3VM7A 2DZPA 3DHPA 1B57A 2B7PA 5HUOA 2YR1A 3BG3A 1X1OA 1CLVA 3E9AA 1HUVA 3Q37A 3SJ3A 1DHPA 3S1WA 1WOBA 1KV5A 4MUZA 3CLMA 1BG9A 1MXSA 3IV3A 3TSDA 1G69A 3W38A 2A4AA 3TNOA 5CZ0A 4UMAA 5KMYA 2NT0A 2ZA2A 1JULA 2J9XA 4RKAA 3G0SA 3N3MA 1DVJA 1GOXA 1UD8A 4NZJA 4CN4A 1J0HA 1GYNA 1KM4A 1P6WA 4HPHA 4JTSA 1R34A 2BHZA 1LBFA 3HPZA 2Y89A 1QDSA 1OFAA 1M5WA 5A5WA 3UWZA 2VEKA 3CM4A 2ZX5A 4TIMA 1XCXA 3LHWA 3V75A 3TR2A 4FNSA 2ZUSA 4A2RA 2CZDA 2RHGA 4YWIA 4Q4KA 2QCEA 5D37A 3WFAA 1KA9F 4GINA 1QR7A 2P10A 3I7SA 3GXMA 3R5EA 2E09A 3HJEA 2VOMA 3G1HA 3BLPX 3NNTA 4IJBA 4ZQNA 3DX3A 3L0GA 1XGZA 4JTTA 1SO6A 2FIQA 4X2RA 3M41A 5BRBA 3W2NA 3STFA 1F76A 2YXGA 3LCGA 1R46A 1U33A 3AJXA 1A47A 3HOJA 2YJQA 2YX0A 2FFCA 2KZHA 1WZLA 2V0TA 5G4EA 4LXFA 3LPPA 1F6KA 3F4NA 3W7DA 4ML9A 1QI4A 4O0ZA 4AWUA 3C8FA 3HGOA 4S2CA 1LBMA 2V2CA 4S2BA 1QMLA 1DORA 1VGAA 5A6MA 4MFDA 1KW1A 5I3IA 1WZAA 5FI8A 1AW5A 4S1FA 2FHBA 4FNQA 2EPHA 5F2MA 3DX0A 1RZMA 2WSQA 1LP6A 5ABTA 3M0ZA 7TIMA 3S6DA 3L21A 4JFUA 5LHFA 1H3GA 1SO5A 3S0CA 3C2FA 3W7QA 3NYZA 2G5WA 3O1NA 4OQVA 3EJPA 2V81A 2AMGA 4OGZA 3MI3A 1VFOA 5DY3A 3L4YA 2NXHA 4GFSA 2D0HA 1XSJA 4AW7A 4R7JA 2GQ9A 4UFLA 4NXSA 1VR6A 1G9HA 2ZX8A 3AXHA 3T7VA 2HTMA 2ZZ4A 2V82A 4N6EA 4RZ5A 3LCWA 3CC1A 4Z1CA 1X6UA 2DZXA 1MSSA 4UNKA 3ATZA 4QAIA 3LV6A 2QLYA 5FF7A 4PSRA 3UG4A 1H7NA 3MUXA 4X0NA 3L5LA 2YFNA 3QH2A 1O94A 3NXFA 1A5SA 1C29A 1F05A 2G95A 3EX1A 3S8HA 3PWAA 1R2SA 2GJNA 1UB3A 2E8ZA 1N7KA 1TQXA 2NV2A 2CFFA 2VFFA 4NJGA 4QSHA 3SGZA 4K7YA 4O1AA 3OLDA 3NR0A 1IGSA 4XQ6A 3F03K 3E49A 4UTTA 4OT7A 1M6JA 1K8YA 3IGSA 3VNYA 1QWUA 3FJLA 3NQ2A 4KFOA 4JN6A 2WNNA 2D3NA 2NX1A 1VLWA 1GVSA 5SWUA 3UEQA 4WLCA 5AYZA 1UKTA 3H53A 4YCPA 4H8VA 3EDEA 4IOTA 4JL1A 4ONVA 4E0CA 1QPOA 3TONA 1FXQA 1G4SA 5BMXA 1SMAA 3W2MA 2X2GA 4Z0JA 1ZALA 4FIRA 3BPWA 4MZ1A 2EHHA 2P1FA 1AL8A 4WD0A 5IM51 2V9DA 3NQAA 4KWWA 2ZX7A 2J25A 2XVGA 1XCWA 1CGTA 4W9TA 2DH3A 2FH8A 4OV4A 3LBCA 1QFEA 4XKYA 3LHYA 5BOOA 1D3CA 4FB7A 1PAMA 2VRQA 1JCMP 2ZICA 2NXIA 1ZAHA 4FIQA 3KLKA 5I3FA 4XBKA 1SFLA 1PZ3A 4H8UA 2BLEA 5CZSA 4PEEA 3GR8A 1KXHA 4ADUA 3IEBA 3WJYA 3W7CA 3W86A 3TW6A 3TQKA 3ZWTA 8TIMA 3HIJA 1PPIA 1PV8A 3NG3A 4O50A 3CQ0A 2OT1A 2Q8ZA 2XN1A 3UXDA 4PFMA 3TXVA 3G8EA 4MVAA 4IMEA 1X8FA 1TTIA 1EEPA 5HR7A 4DO4A 1PS9A 3RILA 1XH0A 5KZEA 2WNQA 5I3GA 4Y6GA 1RVGA 2DZUA 3CZNA 4QNWA 3NA8A 2ZWZA 2RDWA 3EX2A 4N02A 4LUJA 2WKJA 1BSIA 3L68A 3C2EA 4GI6A 3DKLA 2QPUA 3S5YA 3FOKA 2YFOA 2BXVA 3NPWA 3GBDA 2E5CA 3WK1A 2HS6A 2ZX9A 2YSWA 1KLYA 3VGFA 3WMSA 3MP3A 4X9SA 5G2WA 4CQ8A 4ZMGA 2ZXDA 4BFAA 1CX9A 5DCDA 3G18A 3O6CA 1MO0A 3GKFA 1CGVA 4KWUA 3VX0A 7CGTA 1NSJA 1S5VA 2TYSA 3G1YA 1NVMA 3Q2DA 3BC9A 1W5OA 3EJQA 2WSRA 2ATMA 5D09A 5KZMA 3QQ0A 1SPQA 1PL9A 2C15A 2ZZ1A 4JTUA 4O12A 4DXVA 5A6LA 1ALDA 2A2IA 4Q33A 1FY6A 1QPKA 2QJIA 2OZ0A 4ZQRA 1DTUA 1EH9A 4LVDA 3NL3A 5D2YA 2F61A 1QCWA 5CZTA 4GI8A 3LM7A 4WOQA 1G94A 3S9YA 1H7OA 1HTYA 3ZR4A 5F4SA 3UXAA 2TMDA 1EHAA 1SUXA 3HG3A 4GKLA 1N55A 3K8MA 2QUTA 1O5KA 3EDDA 4N2YA 4ATWA 1PIGA 2G3NA 3WJWA 3O63A 4Y90A 2YCEA 5DXXA 5A8GA 2H8ZA 4YL2A 1VC4A 4NT0A 1B9BA 1HL2A 1JDAA 3NM3A 4O18A 1B4KA 3W7RA 2YA1A 1YXCA 1KBBA 3SR7A 3HBLA 1CGWA 5A2AA 3CU2A 2X1SA 1KFCA 3LXBA 3PG8A 3VGDA 1EB3A 1F7BA 4ZQPA 4AMWA 2R8WA 2C13A 1E51A 1HTIA 1JAEA 1JUEA 5L6UA 3PF3A 1XCFA 1JR1A 3B03A 4O13A 2WVVB 1ZCOA 9CGTA 1E3XA 4UQ9A 1WE5A 3OLGA 4AYGA 1GVOA 2QDGA 1TQWA 2H90A 2QR6A 5HDRA 3QFEA 1OG0A 1WX0A 3BVUA 4TMBA 5D02A 6ALDA 3TTSA 1G6CA 3DGRA 3DFSA 1IZKA 3ZT6A 4AHOA 1XD1A 4TVUA 1YADA 2PC4A 5C5YA 4HSNA 1JJKA 3WJSA 2NZLA 3LTSA 3AXIA 4LNYA 5LNWA 3WENA 4UNIA 4O10A 1OGSA 4JGDA 4IPIA 5I3HA 2V3DA 1A5CA 3EWBX 1XUUA 3F4WA 2C18A 1UA3A 3ZS4A 3T78A 1GG0A 5E6ZA 2DZTA 2QCGA 3NM1A 2FQIA 1B0IA 4LW7A 3MI2A 3QMSA 2J6XA 4LY8A 3TV8A 1OF8A 5AYXA 1W0MA 3EB2A 3BCFA 3UCQA 4J3VA 1QOPA 3GBEA 3GXFA 4Z1DA 4NJHA 4R34A 1W54A 3S5OA 1KWGA 4I7UA 4WY0F 4X22A 2ZRZA 2CHNA 3LCFA 2E6AA 4XBSA 1RV8A 1GPWA 3NQ7A 2E1DA 1V3JA 2Q8LA 2D2OA 2F1BA 2VFGA 3L0NA 3L4VA 1Z42A 1J4EA 2A85A 1VYPX 3MHUA 4QJ1A 3SFKA 1SZGA 4JNMA 2Z0IA 4NQ1A 5FEZA 3BCDA 1FWRA 1S5TA 1UKSA 4K8EA 3RMJA 3NAVA 2A1YA 3NOEA 4RZ4A 3NO5A 4DF0A 2RFGA 2Y5EA 2V3EA 3P80A 3YPIA 1W5PA 4KFPA 4FF7A 2ZDRA 3CLWA 1AL7A 3DDGA 1FDZA 2J9YA 1TPDA 4E2DA 1EWEA 3KVMA 1KTCA 3DDFA 3CZLA 1OX4B 1UCWA 4ALDA 1UD2A 1HO4A 5IBXA 3FJ6A 4RCXA 4POCA 1WAUA 2WVVA 2CLIA 3UWQA 2JKEA 3FS2A 4X9YA 3PAJA 4QAWA 3DZ1A 1OYCA 2Y63A 1TJPA 4UOQA 3BLKA 1GTEA 5DN1A 1MEIA 3W3OA 1ME7A 4GBUA 2HSAA 4XWUA 4UTIA 3GNDA 2YIHA 1JUKA 3BLEA 2CLLA 2ZUVA 1JCYA 1SW0A 2Z6JA 3BH4A 1X7FA 2ZZ5A 4M56A 3EDKA 4NI3A 1TRDA 2Q3OA 3IJ8A 1B2YA 4HSOA 5CGTA 2H3DA 4NNAA 3EWZA 4U33A 1QWGA 1YTKA 1PHWA 4GE8A 2W79A 2DIJA 4O14A 4DBEA 1TJRA 3LTYA 1EIXA 3LHUA 4UTWC 4UZSA 2YA2A 3C6CA 3PUEA 1CI1A 5K7JA 1WYIA 3WK0A 2WKGA 2V5BA 5DLCA 1VZWA 4I9AA 3KVJA 3HPSA 5AYYA 2C8NA 4J7RA 4JXCA 3G0UA 2C0AA 1UD4A 4AEOA 3DXIA 5G2HA 2ZZ6A 4CNNA 3UWUA 3TUUA 1PE1A 3C2RA 4EIVA 2Y24A 2W0UA 3NPXA 4RR4A 4TU1A 3G1AA 2WKLA 2DZWA 4UC5A 1H7PA 3DHFA 3EX4A 2QV4A 2VEMA 3EX3A 4UQAA 4LV9A 2QUUA 3HGJA 5I5RA 5FF2A 1Z32X 4AF0B 3IGXA 3FA5A 1A5BA 3TQ0A 3M9YA 1BWKA 5AFDA 4JEQA 4QISA 4DF1A 1PCKA 1VFMA 4O57A 1RR2A 4YXGA 3W72A 4O4VA 2YOCA 5FEPA 1G4EA 1TMHA 3B05A 5D2VA 2NUYA 5K9CA 5DCBA 4BI6A 2F7OA 1HG3A 2J9ZA 1TV8A 4UZUA 2TRSA 3BUBA 1BTMA 3VX1A 3M6YA 3M07A 3L2LA 4FLOA 3VNDA 3CT7A 4GQRA 5AHNA 4J3SA 1KFJA 2B7OA 5EY5A 2E8YA 4H4IA 5E0FA 2YGYA 1BWLA 1JUBA 4NVTA 3W1XA 2BHUA 4NNCA 5LGXA 1QI3A 2X1RA 1HFBA 1CW2A 1L6YA 1TTQA 4QNEA 3R13A 4JX4A 2V5LA 4U4MA 3W23A 1H5YA 3M5YA 2D73A 3LX9A 4DQWA 1S46A 4FX8A 3ZO9A 1KFKA 1PHQA 5I24A 4Q32A 3WELA 2VFIA 3S1XA 4TMCA 3M5VA 1BPLB 4BWLC 1JDDA 2ZTKA 4H3DA 1ICPA 4PA8A 5L9FA 3TIMA 5E6YA 3KHJA 1ZY9A 1Z44A 2OW7A 4UQBA 4H6KA 1FBAA 4GUJA 3BVXA 4A29A 1JFHA 1IXOA 1JQXA 1SMDA 1KV8A 2X16A 5HNRA 1WXJA 3INPA 3I68A 4PCSA 1TPVA 3R8RA 1RP9A 4NJKA 4MYAA 3PBYA 3PBVA 1KFLA 1KM1A 1XBYA 1G4PA 3I65A 4J3TA 3CGTA 1M7XA 4LRSA 1MVYA 1G1YA 3C4UA 3I7QA 2V2DA 3MJYA 1RQHA 2GVJA 3C52A 4PODA 4UFMA 3P7YA 3CTTA 2WVUA 2ISSA 3S2CA 1LOQA 1YPIA 3KFTA 3W9ZA 2D0FA 2FPVA 2JKPA 5EBUA 3WEOA 4LVFA 1R33A 1LOLA 4DPQA 3KL5A 2FLIA 1O7DC 1HT6A 3EJSA 4AIOA 3LXAA 1KLZA 5CZJA 4DO6A 1OK4A 3DX2A 4JDBA 3S5NA 3W1PA 4O1DA 3BARA 2NV1A 5BMWA 4PC8A 3I6RA 1OHLA 3WK3A 3PC0A 4CCDA 3LHTA 3WK2A 1DHKA 3T4CA 2ABBA 1LYXA 4CQAA 2BZNA 5I0DA 1TPB1 1EO5A 4M5PA 3P62A 1PJ9A 1W3NA 1VS1A 4OV9A 2Y70A 1XH2A 3L0KA 4MY8A 1JIBA 3A47A 4L4MA 1K8XA 1QWNA 1TQSA 3WY1A 1W3TA 1TPFA 1FXPA 1MXDA 2HS8A 1OFOA 3VMOA 3LRMA 1IZJA 4MPQA 3K30A 3NL2A 4Y9AA 1EO7A 4BI7A 1F6PA 3SGUA 5G1YA 3LCLA 2F7FA 3VSVA 4KMQA 3WY2A 3TROA 1G4TA 1S3HA 5EMUA 1SO4A 3G24A 5D2TA 4OE7A 4M6PA 2X2HA 5CPMA 3HJZA 4WY0B 3GNNA 1FCBA 3USBA 1H1ZA 1K03A 4J27A 4B5NA 1OB0A 3MBFA 3M44A 3KL0A 4KKXA 2PRMA 4A21A 3ZFHA 4O8RA 1L6WA 3MP5A 5TIMA 1CXHA 1E43A 2PRLA 2ZZ3A 3Q94A 1VYSX 3QMRA 4GUHA 1GJWA 3GVGA 3CIXA 1BKSA 2WQPA 2BWGA 5TD4A 1HL9A 2W6RA 4GO8A 1T99A 4IWWA 1CXKA 3LI1A 4IMGA 1TIMA 1WZMA 3P84A 4WX2A 2AQWA 1U30A 3A9IA 2D3LA 3THAA 2E5BA 1YPFA 1XDLA 4PCTA 2VELA 3RLVA 2ZA1A 2FGZA 3EKZA 1VHNA 2E68A 3G1XA 4JCLA 1JXKA 4LOCA 2Y7DA 3MBDA 3THQA 1OK6A 3QSTA 4DPPA 4UTUA 5G2IA 1KFEA 4IGHA 2ZWYA 1JG9A 3MP4A 2GJRA 1H62A 2EEXA 1OABA 1FX6A 2H6RA 4HPJA 1T96A 4J3UA 1V7YA 1OT1A 1GJPA 4FEZA 4KFNA 3EX6A 3KEHA 3NDOA 3LERA 1UKQA 2YW4A 4DELA 4EWND 3TSMA 4UUIA 1R2RA 3C3NA 4UQCA 5BRQA 3NEVA 4Y96A 1XDMA 3H55A 2ZQ0A 5HXMA 5EPDA 2Z6IA 2D0GA 2YA0A 1HXKA 3NQFA 1ZHAA 3W83A 2WC7A 1KGUA 3KWXA 3PY2A 4I7VA 1MFUA 4JS3A 1CGYA 1TTPA 4AB4A 3ZQ9A 1HWWA 3C0JA 2OYMA 3LCIA 4M19A 2GUYA 2EAEA 2VR5A 3QF0A 3IGUA 1IF2A 4LQ1A 4PL1A 1WZKA 1CGXA 2DH2A 3ABSA 2IQTA 5DBTA 4FX6M 3N19B 4JFVA 2ISWA 3BLIA 1EP2A 1KGWA 5LKYA 2WCGA 3CWNA 3PBWA 4UFHA 3RU6A 3O07A 3EWWA 4UR8A 2A5HA 1Q6QA 4WUIA 3LPOA 2Y62A 4WZHA 3SIZA 4N9DA 2EAWA 2QCMA 1XXXA 3ZWSA 4E38A 2R94A 3IVTA 4K6AA 3ZT7A 2LLEA 1VIWA 3TTYA 3B04A 3MHGA 2F84A 4HNNA 3W2KA 5EMYA 1MZHA 1IXPA 1EP1A 3CZEA 4AIEA 1VCGA 4EOUA 1F74A 1ME9A 4AF0A 3BAXA 4FO4A 1JI1A 1ADOA 1EWDA 5E93A 3BVVA 1ZJIA 1YTDA 2XN2A 2QAFA 3STEA 1ODUA 4CN1A 1TTJA 2ALDA 3L4UA 3AMKA 1AQHA 3SI9A 1EA9C 3JRKA 2FJKA 2VEIA 3PM6A 2ZRUA 1Q3NA 5HUPA 2Y7EA 3PG9A 2RDTA 1G67A 1EP3A 4MY1A 2ZE0A 3V1PA 3W1LA 3HPXA 3STCA 3FYOA 3VCRA 3W88A 4NZFA 3G1DA 5EKYA 1VCFA 2E6YA 3N73A 2Y2WA 1GCYA 3L4ZA 2V30A 5E9AA 4HNTA 5K9DA 1LM1A 4NU7A 1XBVA 1Q6RA 4HN4A 2Z1BA 3RLUA 1QPQA 5LHEA 3OVPA 4PTNA 4RK8A 1LRNA 1GJUA 2BY1A 2XFWA 1OF6A 3UY8A 3GDKA 3ZR5A 3N14A 2XIIA 3LRKA 4WQ6A 1SZNA 1TO3A 3ZSTA 2BXYA 3F1QA 2XIBA 3DAQA 3KRSA 1OFEA 4MAZA 3WNMA 3UG5A 4O0KA 2EJ1A 3EXSA 3VE7A 1VAHA 5KEZA 4AMXA 1WV2A 1KM5A 3BSHA 2G97A 2CLMA 3TE9A 1L6SA 3TH6A 2WNWA 4EF9A 3D4YA 3TJXA 3W87A 1Z41A 3QMTA 1TPWA 1I45A 2OX1A 5HINA 4PEKA 2CLOA 3N2XA 2ZXBA 1JF6A 2PWDA 3G1VA 2WOQA 2GVLA 3KOFA 4JL2A 3ELFA 5U4NA 4L4LA 4GC4A 3NQ8A 3BAKA 3A5FA 2OYLA 1IIHA 2NLIA 3BV4A 5G5IA 3IVSA 4JX6A 5KINA 1CPUA 2CXGA 3RK8A 5CPOA 3MHFA 3RF9A 2X2JA 1DBTA 3A22A 3BSGA 2ZZ2A 3CEUA 4H7VA 2A6NA 4NXKA 1QPRA 3L2MA 1ZJAA 3E12A 5D05A 1O95A 2EKCA 1J0JA 3CV5A 3MW7A 1I2NA 3VO0A 1K3UA 4JTJA 1UD3A 2J88A 2C3ZA 1LLZA 4K8HA 1UA7A 2X30A 4FNRA 1MWOA 3VGBA 1KM0A 4X3ZA 1XC4A 1L2UA 3HGSA 3IK2A 1MW0A 1FDYA 3BAYA 1SU5A 3GZ3A 4R53A 1THFD 4UQEA 5D2XA 5IBXC 5HWJA 2GPTA 2X2IA 3NQEA 4BK9A 3KAOA 3WDJA 2CWNA 4UMCA 3I7RA 4O1CA 4ZQCA 2WSPA 4RLIA 4WJEA 3ABOA 1YTEA 1LOSA 1XV8A 3QQ1A 3N2MA 5F4XA 2DZSA 2PE4A 5FEXA 3IJ7A 3QW3A 4U28A 3UZ5A 1YDNA 4JY8A 3VE9A 4TO8A 1C8VA 4JFTA 4XTIA 2Y7GA 3LHZA 3S1UA 3QJAA 4UIOA 4O28A 5CSSA 1XI3A 1QO5A 3O16A 1UASA 3L5AA 5D04C 3NQDA 2QPSA 4NJIA 2CLFA 3E02A 5H2ZA 3RIKA 3ZOAA 3TFCA 3N9RA 2XN0A 1OFQA 2EGZA 3MYPA 3NZRA 5F2IA 3W22A 3LCHA 3O06A 8CGTA 1J0KA 3DC0A 1JD7A 5HULA 2YZRA 3IIXA 1P0NA 2GQ8A 4MOZA 3W07A 4O54A 1RQEA 4ZQOA 3WY4A 3ZSSA 5D32A 1CDGA 3DKJA 5E1QA 1SQ7A 1VCVA 3T44A 1EPXA 4RZ6A 4LVBA 4B9ZA 4UTHA 1VB9A 3KX6A 2ZRXA 1TV5A 3LCXA 2BXZA 2AAAA 4M7TA 2WJZA 1D7FA 4HPXA 1WP6A 4BI5A 4DF2A 4AVFA 2WV8A 3LV5A 5I3KA 5DBUA 5AN7A 1H51A 3DFNA 3BVJA 5D30A 4UCFA 4LTSA 1OT2A 1QX1A 2Y7FA 4J3WA 3LHVA 1P5BA 5LNVA 5F2LA 2B7NA 4BR1A 1TB3A 2WPBA 4N4PA 4BF9A 3EJUA 4BWLA 1P1XA 3RNDA 2JBMA 3UZJA 2XWDA 5CKSA 3BLBA 5KZDA 3L2IA 5A2BA 1TPH1 3M7WA 3G3MA 5CG7A 3DFQA 4LVGA 4QIUA 2PURA 2QMKA 2FDSA 4N9EA 2E77A 3CZGA 5K9XA 1XBZA 4QQ3A 2VEPA 3R2GA 1L9WA 2JKAA 1MW1A 1ZNNA 1LDCA 1K7FA 3OVRA 5D2WA 2FHCA 4WSKA 1V5XA 2VRKA 3MI6A 2WSYA 5FF3A 1MW2A 4AEFA 5T26A 2NUXA 2VNCA 3L65A 2F7QA 1Y0EA 2FB2A 3UD6A 2VT0A 2BX7A 2QDHA 2ZRYA 3OBKA 2GVGA 2CZ5A 1PZ2A 2WVSA 3W2UA 3R12A 3S42A 1QAPA 3FKKA 1SZFA 1KM2A 4J3XA 3D50A 1O4UA 3CWOX 5AC8A 3WNPA 4OKDA 3BMWA 1KBKA 2F7PA 1M53A 2YPIA 4M8UA 3LLFA 2WO5A 3MMTA 3A21A 1IXQA 4GRSA 4MY9A 4MZ8A 5CSRA 2QCNA 3KXQA 2QEZA 4JR5A 2QUVA 3R89A 4WXZA 1KBIA 5DFAA 4Z08A 1CGUA 6TIMA 1GVFA 3PB2A 4WXYA 3SSJA 3TX9A 4U2ZA 1HVXA 1AVAA 3K1DA 2C16A 4R33A 3BO9A 4LC6A 4N9BA 1PIFA 1A5AA 4HOZA 2DZVA 3OVQA 4LS1A 3W75A 3FIGA 1J0IA 4BA0A 4M6VA 1OYBA 3IJ9A 3DX4A 1ONRA 4HA1A 5J5DA 1W3IA 4LPCA 1TSIA 1JI2A 3OLEA 3WNNA 4Y8FA 4UTLA 4HNUA 3B8DA 4GUFA 2A7RA 4P2VA 3BGGA 2ZZ7A 3QGVA 3TMQA 2ZUWA 1FWTA 1R2TA 4N4QA 1VPXA 5C6MA 2AAMA 3OG3A 3CB8A 3LLDA 1TPUA 4UTTC 1K8ZA 1W5NA 3DFOA 3W7GA 1GVIA 5EL1A 5FESA 1C9DA 4E2BA 5CGMA 2TPSA 3BUIA 3GDLA 3EXRA 3TKFA 3KLLA 1SO3A 2UV8G 4J28A 4UNLA 3LXCA 2DP3A 1TMQA 2V2HA 1Q45A 2NWSA 5DO8A 1HL8A 3WJXA 2Q3RA 1UH2A 2RKXA 2CU0A 4ICNA 3UY7A 3GXPA 1Q6OA 3GK0A 3W7KA 1LTDA 1C8QA 1XSKA 4M6QA 5F1UA 3LTPA 1KM6A 3NL5A 2QCLA 1OX4A 4Z1AA 1GQNA 2DIEA 5AC7A 2FHFA 3UPBA 2R91A 4EF8A 2A0NA 5CXPA 5D33A 1FCUA 2GUUA 2PWFA 1W9XA 4UCGA 3W84A 1U2YA 4PSPA 1M7OA 4MZYA 2X1UA 3IIZA 1UOKA 4CKQA 4UXDA 2Y88A 2QKFA 4ORMA 3DH7A 4DBDA 3GTNA 2F2HA 2J24A 4QM1A 2QF7A 3CIWA 3K8LA 4UTMA 3W70A 1BLIA 2B7QA 3ECQA 4LU0A 3CZKA 2XVLA 3VGHA 2ZIDA 3TCEA 1WO2A 4FX7A 3AJ7A 2RDUA 3HG5A 1ZAIA 3EWXA 1PEZA 3EJTA 3NQGA 3BMVA 3IVUA 1FUYA 1GVQA 2I1OA 1PVNA 4JIQA 1PIIA 3W7MA 1JDCA 1V3LA 4AAJA 2JK2A 3DFPA 3L4WA 1M7PA 1FWSA 3CHVA 1XBXA 4BZYA 3KL3A 3O15A 1K7XA 3A6OA 1TPEA 4HKPA 4RJEA 3EXTA 3PSWA 1S5WA 2WCSA 2A21A 2A7NA 2VFDA 3W7OA 3BGJA 3GXDA 3C56A 1AK5A 1DOSA 5BRPA 4GQQA 5AOUA 1MXGA 1GWJA 3EDJA 1IIGA 3G22A 3SW6A 1BVNP 4JYFA 1ZFJA 1H63A 1CIUA 3IIVA 5AHLA 1DQWA 3LDVA 5F7UA 2F18A 3C2OA 1KB3A 3S5ZA 1XM3A 2OSXA 4FXSA 5HR6A 5U7SA 3B0PA 2CZEA 3QRHA 3UPWA 3D51A 1VLIA 2WPGA 1OX6A 1SW3A 2CLKA 3BG9A 3G0XA 4QITA 3KRZA 2ZRWA 2TAAA 1SR9A 2E9BA 3CTLA 4GUGA 3WNOA 2Y85A 1IXNA 1UBSA 3NQVA 4OU1A 3GKAA 2XWEA 1W5QA 4NNBA 1KTBA 1R75A 4J9JA 1I2QA 4MJZA 4JTHA 1W56A 1T0OA 3VNZA 5D38A 2DJLA 4CN6A 4UOZA 4K38A 4JFSA 1AMYA 1E3ZA 1VHCA 2PRHA 4MFEA 2PWHA 3OIXA 1O60A 4HP5A 1P0KA 1W31A 3FEMA 4LWWA 1G5AA 2NT1A 2H3BA 4N9CA 3NPVA 5HWNA 3G3DA 3QPYA 4FNUA 2NXGA 1R47A 4DEFA 2Y4SA 4PH6A 3P82A 4JTIA 1H50A 3P8JA 4N6FA 5EA9A 1LORA 3KVKA 1JRCA 3P5ZA 2QCDA 4H8HA 3EWYA 2VFEA 4LT9A 5CPNA 4H2CA 1DV7A 1RQBA 1PS3A 3TA6A 5BNKA 1NOFA 3CPUA 1TCMA 2DORA 3O6YX 3W73A 3OA3A 4RV8A 4UTJA 3EWUA 3VFLA 4UMBA 1UUOA 1PCWA 3BVWA 3WNKA 4LRTA 3GIYA 1KXQA 3M5ZA 1FWWA 4FLQA 4JIPA 3E96A 1F73A 1J5TA 3GX9A 5E0KA 1WQ5A 4AMAA 1ICQA 4CQ9A 3HB9A 1ZS2A 4NUWA 3PBUA 5FF4A 4A2SA 1KGXA 3IRDA 3BAWA 5G4WA 2GOUA 4XKYB 2VENA 3HO8A 3M16A 4HHPA 2ZYFA 3TMLA 2Z2UA 4D2JA 4Z0SA 3W1RA 1WPCA 2C14A 4EVZA 3NQ6A 1B4EA 3MYOA 3QC3A 1OX5A 4IX2A 2F7RA 4DO5A 5A2CA 1ZAJA 3U2OA 4A22A 3LI0A 1SW7A 4G1KA 1FWNA 2JGQA 4O53A 1LRTA 1FQ0A 5H91A
chains in the Genus database with same CATH superfamily
1LK2A 1RJYA 4CC4C 1CLCA 1JK9B 2L0DA 5CUSH 2ZWKA 3QEGL 1AMKA 1B0GA 3OYZA 4W4OC 3HF3A 5GGSA 5HPOA 1QI0A 3RY6C 1KULA 4JFQB 4BRVA 5AD0A 2Y23A 1MCNA 5IMLB 4JTFA 4LS0A 2P44B 2CJTA 2EUXA 1VRDA 3O2DL 4Q6XA 2ZTBA 3KYKH 5D1QE 5I6LA 3SGDI 1G7JA 15C8H 3RUGA 1GG1A 4YS1A 2CGRH 1BWVA 5DT1L 1JZ3A 4Y9MA 5C0CA 3CMFA 1LD9A 1ND0A 4AM0Q 5TQ2L 1QNQA 3QYQA 5IP4A 1F3DH 2Z64C 4LSRL 3S36H 3UO8B 1RCQA 3NZGA 2NY3D 1D5ZA 3M7OA 1QOQA 3GAKA 3IJEB 3QKZA 1CXEA 3NVQA 2E27H 3D3VD 2D31A 3CHPA 3ES6B 5I77A 4GY1A 4Y2WA 3UIYA 1I8MB 5DRCA 2IAMB 1M7JA 1DCEA 2DT3A 1J0YA 2I14A 2W63A 2J8FA 4MLJA 3IE4A 3S4SA 4F9JA 1VQTA 4HBQA 1WIOA 1DLFL 4QRQB 4Z7WF 2L7EA 3NAAL 3VNLA 3UPMA 2ZRVA 4URTB 3V36A 4Y5XA 3GMQA 2OT0A 4LCCA 3LCYA 4QR7A 3QJZA 4XUGA 1ASOA 3VU2A 1KBGH 4E8CA 2APFA 4GBXD 3PZNA 1UOWA 3S0PA 1A5KC 3QOKA 1ZE3C 3BYYA 3UR5A 5HSFA 4OHQA 4U1HA 3UACA 3G8RA 3W7NA 3RDTC 2BLFA 2Z1VA 1QWHA 1KRBC 5JORB 3FW6A 1OW0A 2VWEC 3D25A 4FHJA 1AW1A 5BO0D 1V8EA 1NINA 2H3NA 4JHOA 4PV8B 4UB0H 3Q06A 3BK0A 4O52A 4LB4A 3ZKSD 4WDXA 1NDMA 3FCTA 4Y9BA 1VENA 1FCQA 4Y4FB 3TAKA 4N8CH 3V5HA 1OYAA 4MNGE 1IQWL 3LKSA 6ENLA 4YIQA 2QJNA 5DQDL 5CR1A 1GOIA 4HWEL 3BKYH 3BZFA 3E6FA 2KT6A 1JEZA 4IXHA 2WSDA 1G6RA 5GJPA 3BIKA 4O12A 2VN6A 2H8PA 3RIAK 2A3TA 3R89A 1QBAA 5AB2A 4KNQA 4F37K 3RXZA 3AWEA 1AIZA 3UTSE 1DJQA 1E0TA 1KIRA 1DKWA 3LQGA 4EO5A 4DWSD 5J5RA 1WEJL 5D7JB 2CLHA 1RK5A 3OMZA 5HVHC 4PU2A 1HEZA 3O8XA 4XPTL 3VC6A 3W7LA 4AHPA 2OQYA 3MJ6A 3N5AA 4FN0A 3MPCA 4ZJ9A 1YEYA 1EA0A 3T40A 5FPIA 3QG7L 2ZTJA 2ZCZA 3BGFC 1K8IB 4JFZH 3TXZA 3AXLB 3S7GA 3HQ1A 2AEPL 4XB3A 1WDWA 2XXFA 2ATPB 4QKTA 5FXCH 2FVKA 1SXZA 4DBUA 1FZMB 4LSTL 4JFEB 1MRQA 5H1WA 3ATFA 3CN0A 4EVNA 1LWHA 3S98A 4RMTA 1GZGA 3MUIA 2XSXA 1A4KA 4NO0D 1ESWA 2NYYD 3UDWC 3AS3A 1H7XA 4XKMA 2ZCKH 5DZAA 3GDMA 1IIIA 1ZANL 1E9QA 1RV6X 1E9QB 1S2AA 5DUBA 4Q8WA 4WDTA 3MV11 4QEGA 3MRBB 4KKLC 5SWQA 3TWCL 3CO4A 3RK8A 3ETBJ 5AAPA 1E5NA 1QW7A 4FL4C 4CVZA 1B3VA 4MB5A 2CW6A 4OF7A 1Q8JA 1RJRA 2GK1B 5I1KH 2MCPH 3WLQA 3HC0B 1V08A 1KZQA 1XHGA 4F2UA 3HMJG 4YNGA 3DENA 3TW9A 3O6FD 2WQWA 1GAFH 4KJPC 4TQ8A 5EOCL 4O11A 3VMNA 4ELME 3BP7A 2P5WE 1XLHA 4DJFA 1KB5H 4QSFA 5EEVA 3W1AA 5BW6A 4K8RC 5AEAA 1DWGM 3WQOA 1HZYA 4FHAA 1R3QA 5LYRA 2B4GA 1OK0A 3RAJH 3COOA 3O8XB 2QHRL 3WF3A 1PLCA 3W7IA 4MDPA 5K1VA 1BAGA 1HKVA 1XLAA 2X7WA 4UQ2A 3QHNA 4WI4A 1IGML 1QR4A 5DEGA 3WD5L 1UJPA 2NQHA 5LSMA 2X1TA 4F2BA 3MV7D 1FYHB 4MFHA 3SKJL 4B41A 4HPOH 2OMVA 4GPVA 5D7KE 3RURA 3LGEA 4DJED 5L9FA 3NRPA 1C12A 2JELL 4R27A 1NMCB 3X14A 1LRQA 4ENLA 1GTHA 1Z9LA 1CCZA 3ZKMC 1JZIA 4CNTA 5DMMA 1KBLA 2WUBH 4ZMYA 4M5YL 3NSJA 1HKLL 1L7TL 4NQEE 5ENWA 1DQXA 4JO2H 1CXIA 2CBMA 3WAJA 3FKRA 3LQZB 1U3HD 1BXBA 2C91A 4JCMA 3ZDYE 5SWZD 3FAWA 1E71M 3IUIA 4H9TA 3K8KA 3SN1A 5DHYA 3BZ4A 2NXYD 2R0LH 4GG6B 2XJ7A 2KHAA 2OR7A 1YDPA 1FVEB 4WI6A 5DMGC 3I75B 2AJUH 4P2QD 3HFFA 1TO5A 5GGUB 3V0WH 3ITTA 5D71H 5BJTB 2AAVA 4K3JH 3AABA 4IJ3B 3ZIMA 2FX7H 3VH8B 1IO4C 3GR7A 1QFOA 5C7ZA 4F2MB 1A50A 2CLZA 3TIEB 4MJMA 2DSZA 3WBYA 5C2XA 5AVHA 1XINA 4Z7QE 5BVPH 3U2EA 1JPGA 4KROB 4V11A 3SE3A 1BEYL 4BXSV 4BGDA 4YK4B 1ONWA 2N4IA 4LUTA 5C0GB 1C7TA 1IGIL 3QQXA 2GJXB 3VGEA 1T1XB 3ES6A 1XF2A 3PDOA 2GEQA 1K7EA 3B8WA 2DWTA 4L48A 1X5GA 1O5PA 4KDWA 4WGWB 2DLEA 3D4ZA 5E6IC 4BEIA 4CVXB 1SVBA 2YUVA 2EKJA 2Z8RA 4BK5A 4CLMA 3ARGD 3GSQA 1A02N 1AHMA 2VLKB 5CEXA 1WWCA 4A6YL 2WLHA 3X14B 9PCYA 1G7JB 2V9UA 4JTKA 4ZNEA 1ZK5A 4BM7A 1E4XI 2DJUA 2WZPA 4AEIL 1HAUA 5E23A 3DDMA 4GQ0A 3DX1A 4HTBA 5TAOA 2DWEA 3UU0A 1UM4L 1N64H 4I87A 5EWIH 5EDSA 2A7PA 3RX3A 4GPNA 1WAEA 3VZXA 2MH4A 3KGTA 1OANA 3PXLA 4NSKA 5B7MA 2ODIA 1OFRA 5TBOA 2OTDA 2XZAH 4EN3C 1QK2A 3PBGA 2YS4A 2CDGB 2Z8WC 1GMEA 4L4PA 1OPOA 5B1AB 1MF2L 5IJBC 4IPJA 2CLRB 3UADA 4ZB0A 4YU1A 2PW1A 4O4WA 3EBVA 4WHBA 4G83A 3SECA 2BSTA 1C1EL 4F7EB 2XFRA 2GJZA 1FWAC 1NWPA 2I17A 3EYVB 3W1NA 4KK8C 5BXRA 2PCFA 5JZ7D 1GOHA 2IF7A 2QDVA 4N2NA 2OYKA 3UERA 2QGYA 1Z7AA 6XIMA 5HWMA 3ORWA 4TULH 4A4AA 5T5FA 3FKUS 2APVA 1MW3A 1N6UA 3SKOB 5D2NA 3IGHX 2BNQA 3BQ5A 3O6AA 1QZ1A 3TOPA 2BNRE 2AXFB 1DJIA 2BIIA 1Q6LA 1V7MH 3ARPA 1T7ZA 3S88L 3H26A 3ATEA 3BAIA 1KT2B 4PUBL 3VXSA 5DA4A 1M6OA 2E7HA 1KCLA 4L0ZA 4CADB 3RI5K 3L23A 3M0MA 2OMWB 5D2LF 4Q4RA 1MREH 1PX3A 2Q0ZX 1LUCB 1TFVA 2ACRA 5J8LA 3MRLB 3TYZA 4M3KB 2ZUUA 1V27A 1I4NA 3WNLA 5MEPB 1RZJL 1KCSL 2MKLC 4HJGB 3ETBF 4WWKD 3RKPA 4N28A 2ICWI 4ZS6D 4EUPG 5IROC 4JFEA 3ZE2E 1F1AA 2NQ3A 3VA2C 3ZYJA 2QJHA 3ESVF 4P8WA 3BW2A 2DEYX 1UUMA 1CLYH 4P5KA 4HYVA 4HCRA 3PVFA 3WLKX 3W2LA 3HCVB 3FTUA 4GGBA 5A8NA 3NEHA 3MTWA 5F1VA 4X8JA 1XS2A 4WK9A 2V3FA 2B15A 4C1KA 3RUGE 4B2DD 4NP4H 5DFVD 4K73A 5IROA 2QDWA 1ETJA 1AH0A 2O7SA 5I74B 2GQAA 2CO2A 3U83A 1GZPB 2CHXA 3NSYA 4NP4L 2QIWA 5GRJL 3C5ZC 1WFIA 4H1LA 5C0NC 3PG2A 4FLSA 1YLVA 1KIRB 1ZQ5A 2GTWB 4BFOA 2DM7A 2CJ3A 2O5ZL 4C57C 5FOBB 1HC1A 1N2RB 2CR6A 1AQKH 4HHAB 5CBAB 3GC2A 5C3IA 3W28A 4X8CA 3NPUA 2FO1A 2NWRA 3ZIYA 5MP6H 4Y1AE 2RTTA 3E9UA 3VKAA 1OQXA 4IUOA 3TJLA 1GMIA 4UMGA 3MVIA 3F5LA 2V17L 5AW9B 4XTDA 2QPEB 3LZFL 3EEGA 1F42A 3EJJX 4P5UA 2NY5L 4H8PA 3X3GH 1XG3A 1OKEA 2W3ZA 1UZHA 1KYDA 1XQ4A 1P4BL 2ITDA 4HHWA 4NPYB 1ZLDA 3DBXA 2C6QA 1MFMA 2V7HB 5AW5B 3OZMA 3BH8B 1UR3M 2CKRA 2GABA 1UR4A 5H37H 4PJIE 3WN5B 3CWGA 4OLWL 1BF8A 3CC5A 3BLLA 5JMRA 1MJ7H 1QJWA 3V4PL 3Q1SH 3W85A 2BHYA 3IJDA 3WF4A 3SEPA 2WXQA 3CVIL 2CJUH 3LEYH 4POZC 5HJLA 5F3BB 2UYLA 1M1BA 1PJWA 3NJVA 3EH2A 4UAOC 1ZT4A 2AEOA 3LEYL 4FQHB 4UM8B 4PW4A 2CJSA 5D5MF 3RTQB 4IUGA 2D31B 2NX3A 2KLRA 3HPFA 3GXIA 2WQSA 3PGFH 3KNBB 1OY0A 5C0AA 3BLFA 1GZQB 1TV4A 1PX8A 4XWOC 1S7TA 3GDTA 1ZE3H 3QJUB 2YD9A 3VM5A 4QRSA 1KRCC 1WCQA 4XT1C 2YZ5A 2P28B 2ENPA 3ABKB 4MASA 4JAMA 3VA6A 5E6IA 4CAGA 5GGRY 5T33L 2XYCA 1ML1A 4RDYA 4RUBA 5HQMA 3CH0A 4AZ7A 5GGSB 2OTPA 1B0GB 1PDZA 2OB3A 2WZEA 1FIGL 4JHZA 4AXKA 5E9XA 1NBZB 3EMQA 3IKKA 4KZDL 3IPBA 3B9VA 2OSWA 3DRTA 5DQDH 4B5ZA 5I1DB 2EG8A 5I78A 4FQXB 4LKCA 1MIML 2B8OT 2VRAA 2RHEA 3GJEA 4KHXH 3ZX1A 3CQKA 4WI2A 4YN3A 4F7PA 5B1CA 5F7WC 5C0RL 4C6KA 3P0YH 3S6OA 2X09A 1V03A 2R2BA 2QSCL 1VFUA 1BZ7A 2JJUA 2OQLA 4GAGL 2BSBA 4HX1B 3TJEL 2K70A 5BZAA 4Q9QL 3E3QE 3EO1A 5T5NF 1RK1A 4LK4A 5AAMC 1S2TA 1XPGA 4M1CC 4JY9A 3TU9A 3Q44A 3CQHA 3P67A 4EE2A 5F0MB 3HN8A 1RUSA 4FTVE 1FGNH 1W1PA 1EAJA 4WEMB 3GTTA 5AZ2H 2YYUA 4PCFA 1LP9E 2PO6B 5J4MA 5IB5A 4XAWL 3WN5A 2XKNA 3W2JA 4MDIB 1T7WA 3PWAA 5IHLB 3SZ8A 3VI3E 4RX0A 3SDAA 4EN3A 2O56A 1KIPA 1T0NA 2Q8BL 4PJXE 3KRBA 4RDWA 2VXQA 3PB0A 1E4MM 3DHDA 1UMYA 3O6DA 5ICYA 1A65A 3RJQB 2Z6FA 3EGDA 4KI5D 5KVMC 4IISA 1S5HA 1Z9SA 1JPMA 2OMAA 4WSJA 1MH5A 2VFHA 4HKXB 5CJQH 3ARFD 5HYSB 2VSDA 1TEGA 4MMWA 1HNYA 5FWQA 4G9DB 5ANME 2IQAA 1I1AB 3QJXA 1HJBC 3PF2A 1LLOA 3DEQA 1A6AA 4MQXD 4Z7VA 1WUFA 1UQSB 3VKJA 3M46A 4OQ1A 4YDLC 2OCJA 1E6JL 3FTWA 3QEGH 4WNSA 1Z9PA 4YR6B 4LS2A 1NCUA 4N2KA 1QNZH 4V1DD 3EKLA 2N1KA 1DL7H 4M7JL 1TYGA 1BGAA 1ODZA 1S2CA 1IGJB 2WXOA 1QSZA 4FG6D 3ATYA 5AENA 1QNVA 3N2BA 2GVYA 3LKOB 4CGTA 2V8ZA 1AKJB 4IP4A 4WCJA 4DYEA 3I50H 3Q5OA 3DJSA 1RAMA 2LV4A 4DYJA 2GQHA 2RCSH 4KCTA 1JGIA 3QUHA 3RAOA 2V2XA 3NL6A 5FV1L 5CCGE 5CJ5A 3E74A 1NLBH 1OJXA 4GUQA 4KRPD 4P48A 3AFLA 1JYVA 2YK1L 4ICWA 3QVQA 5C08E 5LG1A 2X6CA 1EYWA 4GG9A 2WLMA 1V8HA 4FL4B 4XNUL 1G0CA 3T71A 4V28A 1G9NC 2WAHA 5LCVA 4L2LA 4NBYB 1JYNA 3QEQA 3PS6A 3LH8A 3LZLA 4P4KA 5AZEL 2CM5A 4XNYL 4DJFD 1OAXL 1HVQA 3M45A 2K7QA 1U41A 3T0XA 3A5VA 2F54D 3CZSA 2C7FA 1ZLUH 3GH4A 3TFBA 3HLAA 4BK4A 2GPZA 2PP9A 1PZCA 1WBJA 3V0VA 2HQAA 3M43A 3URNA 5F7BA 3ZKXB 3TO4C 5F9DC 4GXMA 3W9DB 5T3XE 5FJPA 1OSPH 4P59H 3MLXL 3QORA 1JYWA 4ZYKA 3N9SA 4S3DA 3SPIA 1O5XA 5CZXD 3SPVB 5KUKA 1BG1A 3RPKA 4C7DA 2IS7A 1OFDA 1DVQA 1KV7A 1EZLA 2E68A 3TYFB 5CLWA 5JDSB 4FDWA 2PDQA 5EFFA 4KVNH 4M5ZL 3HG4A 1LLWA 2R1PA 2PW2A 2KDGA 3FT1A 2WHJA 1LNUA 4XGZA 2Z7WA 2REQB 5T1LA 3IDGA 2UZXA 2ZKYA 3EYVA 5ADPL 1I2PA 2AI0H 4JY4B 3F12A 1NF0A 2ATSA 4XNAA 1ETA1 5FACA 1RPKA 3VM7A 2NX5E 2B9AA 3MC0A 4HPYL 3FT3A 1TLKA 4V2CB 4GMEA 3DHPA 2B7PA 5HUOA 2J5LC 5DURD 3HNVH 1H6FA 1JGDB 1X4ZA 2E1WA 2Q09A 3QNYA 3H7RA 4GB9A 1XAKA 1PY0A 4ALAL 4S1SL 2W80C 1M7DA 2WWDA 3SJ3A 1E8YA 1RULH 4HLEA 4CMMA 1FRBA 5IBTH 1W16A 1WOBA 1KV5A 5I5JA 1HZHL 2XVBA 3HZMB 1NTDA 3PQYE 5JR1L 1MXSA 3QORD 1YVLA 3IM1A 1YMMA 1A6TA 2FL5B 1G69A 3TNNA 3TNOA 3AREC 5CZ0A 1FOBA 4IJ3C 2AGTA 4RNIA 2PEVA 1ED3A 2Z93B 4UMAA 3MLZL 3PABA 2NT0A 4WDUA 3S3SA 3GSQB 2UXGA 1EX1A 2ZVIA 2F5AL 5KYWA 2CETA 2QKSA 3WL9A 4KROC 5KSBB 4HGWA 1VACA 1XL6A 4S1QL 4CN4A 3X11B 2GDQA 5BQDA 3QV8A 1GYNA 3BQVA 4PJXB 3C8KB 4XMKL 4HPHA 1KM4A 4JTSA 2M8XA 3CH8A 1T3FA 3ISYA 4NFBA 1YG9A 3BW9A 1M3JA 4JZJC 5CPSA 4G70B 2IVFC 1M5WA 1OFAA 3U2JA 1E5UI 1DIOA 2GZXA 1G6VK 2UX6A 4QT5B 4D2NA 3P4LA 4ZPTA 3RFZA 2VVNA 4HK5A 1ZVNA 3TR2A 3WU1A 2XINA 4MJ4A 1Z3GL 3P30H 4HISA 1HGWA 2RHGA 2IH8A 1FVEA 1I85C 2C1GA 1B0WA 3VC5A 3DIFB 1KR1A 2EDHA 4IBZA 4Q4KA 1QR7A 4QHLA 1NCTA 2F9BT 3P3UA 3PWJB 5DHYB 5FGRA 2FDMA 3BLPX 3DX3A 2NW3A 1EHXA 1NCDL 1SO6A 2J8UB 4X2RA 1GW0A 2VQUA 1F6FB 4JBSA 5EA0H 5BRBA 3QEUA 2YXGA 3SPJA 3TBVA 2BP0A 2B20A 1AD4A 4PTTA 3KWVA 4J1UA 4OV5A 1IBHA 1A47A 5EBLB 1UP0A 1TJXA 5CSZB 5C8JB 4J1OA 5D72H 3VXGA 1GSMA 4P23B 3T0AA 1Z2KA 2EH7L 1NQ6A 1Z5YD 2KZHA 4OF6A 2V0TA 1H11A 4PQXA 2QPXA 2FJHB 2VD9A 2OMVB 2QZ5A 3ARDD 4KKAD 3VIFA 3VXUD 3ABXA 1KPUA 3A6CH 4X83A 4E2VA 1GXEA 3LAFA 2VDNB 4ODVL 3FQYA 1DPMA 2HRLA 4Y19A 5D4YA 3IU4L 5I0ZA 1BX2B 5F8RC 3ISRA 1Q4WA 5DS1A 2AEQL 5DQ9B 4FNQA 5IB1A 2EDDA 1U4FA 5DMIH 3DX0A 3OKMB 1UZDA 1RZMA 4AUJA 4ANKA 3A6BL 2H3KA 4S3CA 4H20L 4R97C 7TIMA 1F02I 1UWXK 4LARL 2EO9A 1LDSA 4YYFA 5IBUB 3B56A 3FRPG 3C2FA 1WC7A 4HJ0C 4JG1L 4LYKA 4KJWC 3LG3A 2G5WA 3NYZA 4E9WA 4IGNA 1E8XA 1OE1A 2O6CA 3EFDH 4XMWA 1ZEAH 2LT9A 4IGBD 3XIMA 3V35A 4ETQB 5B38A 3ULVD 3WUFA 3GRIA 1AZZC 1IM9B 4DGWC 1LL7A 1VFOA 5AVUB 4JNYA 2NSQA 4X9HA 4XVDA 2GJ6D 3TN0C 1N7MH 4PN6A 1MFNA 5F1KC 1V6TA 4XD5A 2VDHA 5KG9B 1XSJA 4AW7A 3INUH 1L6FA 4JGMA 3HC2A 4OLVH 5F9JA 1TKKA 4XRCB 4G5ZL 4H9MA 3WFEH 3KBFA 3V9EA 3EA1A 2R1MA 1TCRA 2VJ0A 2J66A 2FMNA 3R6IA 4J3OH 3LCWA 4PJGB 3J27A 3C5ZB 1C16A 1HHGA 3HEIB 5KSWA 3TN0A 1BECA 2DZXA 1XF3B 2Z7YA 4ZB5A 4QAIA 2COVD 4JRYA 3OG4B 1G7IB 2QLYA 3KXFE 4PSRA 1QOXA 5KSVB 3MUXA 2C9QA 3CFDA 4P3CL 5DJXB 1O94A 3PQYB 4HAKA 3NXFA 1A5SA 3TPUA 3EX1A 4RXGA 2ADGA 3OPUA 4NHUA 5DF0A 3P77B 4I5RA 4MS6A 5IG7B 1GKRA 2R0KH 4HJTA 2K6ZA 2IALB 1N7KA 2NV2A 1GKEA 3HS0A 2GUOB 3ML9A 3T4YA 2NLYA 4K7YA 4O1AA 4BF7A 4AZBA 1A0CA 1XRFA 5HTSA 4XBMA 3PZQA 3QUYD 1X39A 3AXXA 4LAKA 4PS4H 1WUEA 5B38G 5GSRA 2YC1A 1QNPA 2Y1AA 5FUCE 3F03K 4I9TA 1TYRA 2X89D 4ADIA 1DVUA 1K8YA 1UZ6F 1GW9A 5EZLA 3DI2B 5EEZA 2GSJA 3MRIB 2ZOWA 2WNNA 1Q9OB 2PF6A 2D3NA 2NX1A 1G7QA 5F1NA 2OLDA 2O6EA 3UO1L 1VLWA 1FG2A 3UTSA 1JV5A 1OTUD 4OZHF 1I8IA 3UEQA 4BQBA 2NX5D 3CUPA 4UAOB 1GC1C 2JB6A 1UBPC 4IOTA 5HDBE 1FFTB 3RTQC 4EMZA 3QR2A 4YXLL 5BUAA 4E0CA 3TONA 1G4SA 3EG9A 2ZYHA 3QULB 3CMOH 1SMAA 1Z1WA 1FNSL 1FZKA 1KV3A 4XP5H 2DUZA 3VFWA 3W2MA 5HMFA 1NSNH 3ZTCC 1ZALA 3WIFA 3CSPA 1GOXA 2WYTA 4MZ1A 4PRBA 1FSKB 5CJBA 4MA7L 4TSAH 4F24A 3G77A 3P4MA 4MNHB 2XQ0A 4UT6L 4XAYA 5IM51 1FCCA 2YUZA 4KWWA 4KWSA 2XVGA 4M1GL 4A35A 2KLTA 1KJVB 1XQLA 2YEQA 5JO5B 1U8PA 2FH8A 2VR9A 2Y1ZA 1IC4H 5I1KL 1QFEA 3M0JA 1INDL 5CPQA 1D3CA 3BFOA 4QHPA 4FB7A 1CQKA 1JCMP 3KOYA 3KVDD 2PS2A 2CBPA 4PUDA 5D1QA 1W6TA 4MYPA 3V1HA 5AB9A 5I3FA 4KTDH 4W8LA 4FXJA 5E1IA 1RSFA 2E9GA 2WC3A 1JYXA 2IC2A 2OKTA 5CZSA 4DP0X 1B54A 2Y8KA 4PVLA 4XN4A 5AYQA 1EEQA 4S0SD 4BWTA 2AL2A 3IEBA 3WJYA 1UXSA 3T6WA 1MHEB 2J5WA 4Q4EA 2BW4A 2J7HA 1PPIA 3CS2A 5E5UB 2GKIA 3QXBA 3ILPB 2UXTA 5KBNC 4HWBA 4HIIA 2AL1A 2Q8ZA 3SUSA 1T66C 1QYGH 4IMEA 4MVAA 1TTIA 1EEPA 5I1AB 5HR7A 2P5WB 1PS9A 4FRWA 3RILA 5KZEA 3CH9A 2A73A 4PRHB 2R1KA 4Y6GA 1RVGA 2V5MA 4AE1A 4DBWA 3IVKA 1T5XB 5AWNL 2YD7A 1FYTD 2OBGA 4G9FB 2FIKB 1D9KA 4JHUA 3L95A 2RDWA 5ECVA 1TCRB 4V1YA 3O2VH 3C2EA 4M8QA 3MVTA 5CQ1A 4LF2A 1JNDA 5DZJA 2YFOA 3AHXA 5CMAB 3RGVD 2E5CA 5IQMA 1P4UA 1QPPA 1X5AA 5AOZA 2YSWA 1KLYA 1QOKA 1JK8B 4QG9A 4X9SA 1IFHL 2Q2EB 5G2WA 1I7ZB 4W1TA 4OZGB 4HFWB 4H01A 1SPDA 4QE1A 3IETA 4AV5A 1AC6A 4ZUSA 3G18A 3O6CA 5EC1A 4A04A 1TJ1A 4YTUA 5FYKD 3QQDA 4N0CD 6PAZA 3KJ4B 2YPVH 4Q6JA 4MRBA 3VX0A 3MMWA 1RUQL 1EF2A 1S5VA 5JHAA 4YDLB 5K9OA 1NVMA 3BC9A 3AIVA 2DM3A 4YPGB 4YWGH 4LSQL 4R7DB 1G9NL 5IJCC 5ABEA 4NI6A 1JXGA 3N44B 1IGIH 3WIHA 1SPQA 4X2PA 1D9KB 4DXVA 4MXVE 5MEQB 2XUCA 4JTUA 3CN3A 5SWSE 3HQOA 1B3YA 2YPLB 4JREC 1XLBA 2VR4A 1ALDA 7A3HA 3QIUB 3L1FA 3P4OA 4Q33A 2WZPD 1WCBA 2DMBA 1CGSL 2WGXA 2LU4A 2PWVA 3LZ3A 1WAAA 1ZHBA 1HCVA 2XN9D 4G5AA 5E9DA 1KR0A 2QJIA 4ZQRA 2VGLM 1DLHA 4JTCA 3WE6B 1EH9A 1G1KA 2QUMA 3T2NH 1VPOL 3IT8D 1MHEA 1AGCA 1D5BA 2B14A 5EC2A 1IWPA 1N0XH 3KZ8A 2F61A 4LVDA 4GI8A 3ONCA 1G94A 3U1PA 2F54A 4G9PA 2Z7UA 3BOVA 2D7MA 2HFEB 2C7UA 1HTYA 4PWGA 3FB7B 1H7OA 1ZK9A 4PTTB 1BYBA 5F4SA 2BP0B 2TMDA 1N55A 4U1MA 5LGJA 1CB4A 1LWIA 1EEZA 1KGYE 4HBCL 4OD3L 4DVRL 2CESA 5H2BB 5LQBH 4AWJC 3K2UH 4AG0A 1FZOB 2NW3B 3ZKXC 1DYSA 4EBQL 4ERSH 1P6CA 3CBWA 2LOEA 3LN9A 2YOAA 3D3AA 4QBXA 1L4IA 1FHGA 1V0NA 1P5UB 3KPPA 1W9UA 3OO2A 4KRTA 4LFHG 1V4YA 2BNQD 3NIFB 3NIGF 4R5VA 4FPSA 1AG6A 2IANA 4A37A 5IW6A 2H8ZA 4JTRA 5E08H 5PTDA 5F8QC 1AH1A 4YL2A 5A6KA 1T7YA 3CXDH 3RNQB 2MNJB 3TZVC 2INEA 4M1RA 4NT0A 3ML8A 2PO6D 1ECEA 2OWCA 4KJYB 3W7RA 3JT0A 2AP2A 5HYQA 1X5JA 1FA4A 3ARDB 4X80L 2ED7A 3R8QA 3TTQA 3T07A 1I1XA 3F2BA 4BS0A 4YL4A 3L3JA 4YS4A 5A16A 4JM2A 2H32A 4ZO8A 1GGTA 1I8IB 2RGSA 3ZL4H 2PF0A 4JBRA 1JHTA 3ESPA 4UT7H 3L5XH 5I3DA 1YQ2A 3H9SE 1JUEA 5L6UA 1LP9B 1S7VA 4K7PY 4XO9A 3NIDF 1JR1A 3AHYA 3FEQA 3GHBL 3B03A 2BNRB 4O13A 2WVVB 1BQSA 2R59A 4WKZA 2VDPH 3K5RA 1N82A 4MWAB 2WIIB 1WE5A 1WIPA 1QWKA 1CLYL 5KYNA 2XWXA 3RPTA 3MXWL 1UEYA 1Z9AA 1YNKL 1UYQA 4JGJA 1C93A 2QDGA 1GVOA 5LGKA 4YN5A 4GW4A 4ZNCD 1A3ZA 3QFEA 5DD1H 1L9MA 3B8YA 1WX0A 2P80D 3BVUA 4IIHA 3TTSA 4ATTA 2MTAA 3DGRA 1YNTA 4AQLA 1IZKA 1JHKH 1IAKB 3RIAF 3IMBA 4NHUB 3RWIB 3U46A 3GZKA 4JY4A 3UCRA 1MVUB 1SJHA 5E6RB 1FL3B 4A2DA 2KQNA 5F21B 4XPFL 5I71C 2V37A 3CUXA 4HA4A 2EYTA 1ZMYA 3CFDB 3N1QC 4M80A 4L18A 2X4OB 5F3FA 4J35A 2JK5A 4UNIA 4O10A 5I06A 1TEFA 4PY7B 3WTTA 3MV01 1X5MA 1HHGB 1NTHA 1REQB 1HNFA 4LCWB 4Y9CA 2OQHA 3AZSA 4O5LH 1BQLL 1HGYA 2C18A 2FFIA 3FHEA 2ZKWA 4FFYA 1GG0A 4KTGA 3G5ZB 5AYBA 4ODWA 5FSDC 4QRRB 3ZE0F 1D8CA 2ILLA 2QUNA 4Z5RA 1C08B 4L4MA 1EXGA 3UR8A 3PV6A 1D6EB 3VIMA 2FQIA 2BOEX 3M1CA 4KDVA 2HVKA 2X5PA 5T5FL 2B7DT 2J6XA 2JELH 2JI3A 4WQOA 3OZYA 4C6BA 1HYRC 3VUAA 3DO3A 2ZP0T 5F6IC 3QG6B 1DWIM 2V5CA 2XWRA 4B5TA 2ZKXA 4HPOL 4S3FA 2B4CC 2QVIA 2X1QA 3P4NB 2P80A 3EYFB 1FCGA 1JV2B 2AXWA 4P4KB 3FZUC 5I1CL 1UJ3C 2WZMA 3MCNA 1N3NA 2ZAHA 3AADB 3MGOA 2FJUB 4JRYE 4JN7A 3S5OA 3TA3A 4Q3MA 1WGVA 2H2SC 3EPOA 2ZRZA 2XZCH 3WX7A 4D9PA 1OAZL 2ODOA 4PW9A 4ICCX 3H8NA 2YGQA 3CQIA 3BZ5A 4KX7A 4JIRA 3X1FA 5I76A 3AAMA 1V3JA 3FHAA 3O6KH 3PHOB 2V33A 3CUIA 1VPYA 3LYEA 1JWMA 4G7VH 3L0NA 3NZHH 4UB9A 1Z42A 3R19A 4G8AC 1J4EA 2O0TA 5GJTL 2A85A 4ZNEE 1U42A 4QCEA 1YNTF 3E2QA 1SLVA 5KJ4A 3KBSA 5CR8A 3K6SB 1HOCB 3TPKA 3GRWL 3PP3K 4Q8PA 1FHLA 4MWAC 4J5NA 3VCLB 4NQ1A 1UQSA 3LNMA 3KLSA 1M2OA 4RRPA 1FWRA 3KXFB 4B5SA 4XVUD 2AZUA 1UKSA 5CSZA 5C8JA 2BNQE 1EGVA 1ZLUK 3NAVA 3RMJA 4NKIL 4GGHA 2GBTA 1FIEA 1O7DE 2E59A 5E09A 4CD6A 3WCYA 3NOEA 1T89A 4R26L 5AKQA 4JO3L 4DF0A 3GG8A 1NFPA 4YE4H 1E9YB 2X7LA 1OCNA 5K9QG 5J12C 3V6FA 3SJVE 1V51A 3WDRA 2FEDD 3QYSA 2ZPKL 4HJ1A 3WV0A 2WMKA 3LKRA 4PRHD 5CEZL 4GG8A 5CU9A 3CLEL 4HB7A 3U4FA 2XKNB 3QUZC 4FQXD 3NA4A 4ZFOA 4A66A 3N17A 3JV4A 2KPNA 1RZIB 1UD2A 4Z7QB 2NZ9C 3IDIA 1JXFA 5IBXA 4NG3A 3QLLA 3B4YA 1EXPA 4XVTL 1ZU8A 3NVTA 4X9YA 2WOYA 2P5NA 2V7NB 4QAWA 1NICA 4JLRB 3RB7A 4NWUL 3IFPA 4S39A 1XZ0B 5CAKA 1QPXA 3JVGA 2Y63A 3C8KA 5MEOA 1FYTB 1E4XL 2YLHA 3FO9B 1YN6B 4UOQA 4LSUH 1MEIA 3RX2A 3QHMA 4OI7A 3SD2A 3UROR 3ULAB 2EEAA 4UV7L 5L2JA 5KYWB 2HMIC 3CL8A 3V4PA 1MZYA 3C2AH 3HRZA 1O6VA 4XWUA 1ADQL 2W95A 4R2GC 3N29A 1JUKA 3OPZH 2F1EA 1LT8A 2R69H 3BLEA 5GZNA 3W0WE 2ZUVA 5GRYA 3NSXA 3W5NA 1PZUB 1BKHA 1ZTXE 2HFTA 2CLLA 2Z6JA 3DERA 3UG8A 1KGIA 2F6UA 4XVSH 3B7YA 1YW1A 3PNUA 4X9BA 4HIQA 1WZ1H 3LH2L 4NI3A 2G75A 1H8NA 1B2YA 3Q8AA 1UM6L 4JRLA 3OKOB 2ZOOA 4MXWH 4W68A 1X7IA 3QCTL 1DQQA 1E28B 5L4MA 2XACC 1U4EA 1KQYA 2P46B 3FB5A 5DTFB 3WUWG 5ERWA 1PHWA 1KCBA 4GE8A 4NKCA 3VKDA 4QRSB 3NJHA 1OAUH 5C0BA 4PB0H 1PYMA 5FWRA 3H7VA 2G37A 1WWAX 2UZXB 2YA2A 1A5OC 4ROQA 2CK2A 3ARGB 5CCKL 2EVGA 1WIUA 2AGJL 3RTQA 2WKGA 1W17A 2PI6A 4RSVA 4WO4A 3HPSA 4JXCA 3ZLQC 3G5VB 2XHYA 3RU8H 1ZB5A 4TUJB 4CU7A 5LXEA 2ADJB 1M68A 4MQ7B 4AEOA 2P3ZA 3QORB 4JPVL 3N41B 2ZOKB 3APCA 1PE1A 3C2RA 4D72A 3SSZA 4MJ6A 4IS6A 5DUPL 4EAEA 3BN9D 1JZ6A 4TVPD 1L9RA 1OP3K 1P9MA 2MSPA 4XPBL 3HMWL 1ZRQA 1FWCC 4LPYA 4NO0A 3GU2A 1W9BM 2X4NB 2WY3B 1H5BA 2Q76A 3GB7A 4FFVC 4U3XA 3DHFA 2QV4A 1V6VA 3BDXA 4DRSA 5I1CH 2X3BA 2QUUA 1BJ1J 2VZTA 4M9OA 4NJ9H 2VYRE 3IGXA 4OGQC 4F7MA 1NCIA 1T80A 4FP8L 4F79A 3TQ0A 4TQIA 5MP6L 3M9YA 5K59F 4J6RL 2HZGA 4DF1A 2WQVA 3H4FA 2G2NA 4LNRB 5D9MA 1PCKA 4O57A 3KLHD 2PYEB 1IT7A 2HPMA 5SX4I 4O4VA 2FK9A 2ZD0A 3EJZD 2VDGA 4EQ3A 1U8QA 2J73A 3O6ML 1JN6B 2NUYA 5LBVA 2AJVL 1N2RA 2F7OA 2WXIA 4HHAA 3VB9A 2CIPA 3D47A 4HLJA 4YHZL 1DWFM 1NBVL 2FCBA 3EOAA 3MA7B 1AXIB 2Z28A 3GK8H 4DY1A 2EIMB 2PDBA 4GQRA 1AP2A 1BOGA 4ZMVA 2VR7A 5EF1A 1VBJA 1KFJA 2VWSA 4YDVA 2HLAA 1W72B 3QWOA 5E0FA 4CBZA 3IDNA 5B39B 4WNQA 2O55A 3R4IA 1IYXA 4ML4A 2VDRB 4W88A 3Q2NA 1M9WA 4E0RB 4IBWA 1NCWH 2ZOLA 3RGVB 4NVTA 2GIYA 1V02A 3PAUA 4NNCA 3MODL 2AJUL 4D8PB 5IF0B 1R3JA 2M83A 3PP3H 3OF6D 3GIVB 4NC2B 1TTQA 1YEJH 4JX4A 4UDUB 3VRJA 3M5YA 4FG0A 1IARB 1S5HB 1Z9SB 1S46A 3T3MB 3THMH 3QPXL 3AIQA 4ZUUB 3DN5A 4HK7A 1WISA 3HUJA 1NBCA 1RLBA 1K8DB 3JV6A 4JE4B 1T0NB 5FYJD 3PL6A 5T1MA 3T8XA 1IM9D 4RRPM 5KVFH 5INCB 3WF0A 1VFBB 4YFDB 4CJ0A 5JXEA 2NUTA 4DP8X 2Z3FA 3GHBH 1FN4A 1J87A 1D9KC 5DJAA 3Q6FA 3ZKND 3GUGA 5E6YA 5KSAC 4NY2A 3QI9B 3TIMA 1TO4A 3I2CL 1ZY9A 2NNAB 3CZFB 5TE7H 4DK5A 2EC9T 3B8VA 1IVTA 3P3SA 2Z31C 3QXAA 1F5WA 3HE6C 1KFWA 3CFMA 3NCBB 3BVXA 3X12B 4A29A 3WD3A 4WUUA 1JQXA 2X16A 1KV8A 1OGAD 3SKOA 3WKZA 1IAMA 1VGKB 3INPA 3AALA 1TPVA 1RP9A 3II2A 5F9WC 5D1ZA 3EO1B 3ASOB 1HKMA 1CDJA 2YXWA 2ICWJ 3MREA 2CO7A 3OXRA 1DR9A 3R43A 1KM1A 4U4IA 3HUJE 4Y4KD 3RWDB 1XBYA 3SGGA 4DJDC 4P8UA 3CGTA 4K2SA 3KWUA 4EI5C 1U8LA 3CYJA 4X6FA 4HS6B 2Z4QA 3H2CA 3VZZA 4NPJA 1Q94B 4BKNA 1E4KC 4ACYA 3CAKA 1BREA 2DQCL 3ARRA 2GVJA 3VRLF 2PDGA 1R86A 2N0KA 4PODA 3WO8A 1ZVSB 3P7YA 1TZZA 1GSKA 1HESA 4UBDC 4FXKA 4LO9A 3W9ZA 4Y5VC 4NM4L 4KXZI 2FPVA 5EBUA 2GAZB 4P2QB 5DD5H 3WEOA 2FATL 1ZOXA 2YGPA 2V2TA 4DPQA 5I2IB 1EFXB 3KL5A 3AITA 2QF8A 2VLKA 4XCFH 2FDBP 3CV2A 3ARYA 2MCMA 3QEHB 3KG5A 4B27A 3QDHA 4WIQA 3VCCA 3MZTA 4UYPA 3EXLA 5GJSL 3U7AA 2FO4A 4TVPE 4W9IC 3O3AA 4V27A 3S5NA 4P9HC 4Y4KA 3C0QA 4HSNA 4PFEA 2Z91B 3MGAA 4KQ3H 1NQKA 1RK0A 5ILTL 3MNVB 3QRGL 4ODHL 3I6RA 5IFPA 1FLTX 3TIEA 2OMYB 4S3AA 3TIDA 3BD3A 1V6UA 2ACQA 2UY3A 5CEYA 3PTMA 1TNNA 3BPNB 1J1OL 1TVHB 2A6JB 1L3NA 4ODHH 3W56A 1F6YA 2C34A 3KDPB 3IJIA 1EEUA 1G5GA 3I75A 4NQUA 3P62A 3RYSA 1W3NA 3V4VH 4MADA 4PGEB 2V7HA 1HSBA 1D6VL 2VAJA 2NCMA 3DBXB 3O4LB 4HWZA 2VM8A 2YO3A 4OCRH 1BRLA 3BPLC 1XF5A 5BU6A 2EECA 2V17H 4G8TA 1JIBA 4JG0L 3MJ9H 1NGZB 3R1GL 3ZE1F 4MMXA 4LSQH 3SDCC 4E42A 1TQSA 3ENLA 2FX9H 4QDPA 5DX7A 2VLKD 3AWFA 4HV8A 1FXPA 5G2NA 2HS8A 1RUQH 3I4KA 3LRMA 1DE6A 2AQ2A 2QR0A 2VC2H 4YC2B 4DEUA 2CBIA 2HJKA 2JF1A 3NL2A 4F7TB 4DXKA 4ZFZA 3GMOA 5INDB 1J5IA 3GMLB 2UWEF 4Q14A 2F7FA 4KMQA 4W6XB 3BT0A 3M0YA 3TROA 1YECH 4RA0C 1XL4A 2NY1B 3MUHL 5DEGB 4AJVA 1S3HA 2WWCA 4R7NA 5HPMB 3FT2B 2RIKA 1XH3B 1GZPA 1VLXA 4TTGA 1QRND 4GAYB 3L5IA 1G01A 4JANB 4LAQL 4DNMA 1DJGA 1WGOA 5E94B 2J4WL 4J27A 3MBFA 1GPOH 2PRMA 2WTPA 5ISZA 5DJ8A 2BOCA 1IGCH 5AW7B 3TO4A 1E43A 3HCVA 4ZUWB 2PRLA 3Q94A 1VEMA 4UNVA 5E5MA 4ZW7A 1VYSX 4GKSB 5DZNA 1MLCA 2J8UF 2ZUNA 3GVGA 3MU7A 3CIXA 4YVVA 1U92A 3RITA 4PI0A 2WQPA 1WWWX 4NOFA 3S4SG 4PLNC 3O3DA 5TD4A 1CNVA 3EOSA 5D2NE 4N6RA 1YEIL 2XOTA 1CDBA 4JM0A 3T2OA 5MEPA 3VACA 5FECB 3SGDH 4W9EC 4HPYH 3L08A 1WZMA 3VWKA 2I9TB 1OBAA 2HRGA 3NSMA 3FXIC 3EIFA 4HQQH 2AK4D 4LOVA 1XRSA 4B4HA 3LEVH 3SKNB 1EC9A 1GUVA 4ABVA 4K2UL 2E5BA 4M7KL 5HYFA 4DZAA 1E2ZA 1WDQA 4AC4A 3ZTJG 5HHQA 5I1JL 5D2LA 4WGVB 2BSRA 2XFGB 3PDGA 4PCTA 3UGXA 4NSBA 1YEJL 2FJGB 1NCBH 2XV0A 2W60A 1PCSA 5FYKL 1JXKA 2BP3A 2Y1YA 2F2KA 3CK0L 2IKJA 1MCKA 3V6OE 4MA3A 3THQA 3AIUA 5A6BD 3EW3B 3ZHKA 2OPCA 5B21A 2NNRA 1TUXA 2ATPA 1KFEA 4K3DH 3OODA 3MP4A 3B7RL 1A2YA 2GJRA 2QVHA 1U8JB 1H62A 3FSOA 1A5FL 3M8OL 1J12A 2H6RA 5DYFA 1SM3H 3AS2A 1DVFC 1A3QA 1N8OE 2MKWA 4YZWA 3D0AA 1T96A 2OSLB 1QA9B 3MRNB 4WTZA 3F5KA 5DHVH 1I53A 3PTDA 4KFNA 4XD6A 5J12B 3GYCA 1TWSA 1DQDL 4GW5A 4MBOA 4OBRA 3LERA 3ARQA 4NZRL 4DELA 4EWND 3TSMA 4QCFA 2UY6A 3GINA 3C3NA 5BRQA 2XY1A 4R96B 4JRXA 1C5CH 2DWEB 1HJCA 2P88A 4L0PB 5C9JB 4NCC2 1RFDL 2H2PD 3QUZB 2YDSA 2F38A 4IMLB 1QYGL 2XN9B 4QYOA 4IRSA 1KJ2H 5MHSD 1FFNA 4DP1X 3C5SB 3NCOA 3MBWA 3PAVA 5LGYA 1W8GA 3O8XD 4H19A 2Z92A 4U1NA 1TTPA 4AU0A 5KSUA 4D8LA 1A3HA 2ZXCA 1R3KB 3PDOB 2Q86A 1T1WB 5I8KL 3WKYA 3GG1A 1UZ8B 3MJ8B 5EUOF 4M19A 1M6UA 4X9FA 5IT2H 1KYFA 3PTKA 3GSNL 1E5ZA 4LIQH 2GC4C 4XAPA 4PP1C 4O2FA 4APQA 3APGA 3DX8A 2HPIA 3MACH 2IQTA 2P48B 4FA6A 3VH8A 4FX6M 3QNXB 3FQWB 4PJHE 4XE0A 2YEVB 3D07A 4Q4QA 3BKJL 2F53D 4TPRH 1TWWA 5CJQL 2OV0A 5EUKA 4WWKB 4KGJA 5DWUL 3VTAA 3PBWA 1F58H 3RU6A 4RZCA 1NCNA 2A5HA 1J1PL 4QY8B 3MANA 3FJ4A 2Y62A 4U1GC 1I8MA 1E5AA 2C9VA 5B3JE 2FBJH 4FQLL 5IHRA 5LBSL 1EO8L 5EN2B 4F5CA 4X5QA 4UT6A 5F0PB 4ABQA 2JJVA 3PREA 3EFDL 1IEXA 5AZEH 1LL4A 1LT7A 3HG1E 3ZT7A 2B3RA 3IVTA 5FCZA 3B04A 3MHGA 1XGRA 3F7KA 4ZQKA 4NNXB 5DJZB 4ELKB 4ZXBA 3CV7A 4HNNA 2XN9A 3GT6A 1O66A 1IXPA 1OZTG 1EP1A 5HHOA 4X6BA 4DI9A 2ESVE 3VG9B 4AC2A 4AZ8B 1TQCC 3ESOA 1XIEA 1Y65A 2QZQA 2DFAA 3MCOA 1FFOB 3MCMA 4FO4A 2AEWA 1JI1A 4IIQA 4JFPB 4UQ2B 1ADOA 1EWDA 3BVVA 3QI9D 3R1GH 2QAFA 2BS8A 4CC1A 1W3HA 2GGGA 3HB3B 3OAWA 4HXAL 1VBGA 4M62L 1U93B 1SBSL 3HR5B 5DVMA 4AYMC 2J74A 3L4UA 1AQHA 2VLMD 4XVJL 2DI8A 3WJLA 3MRJB 1NMAH 3UBXA 2FJKA 2VEIA 1W0YT 3DUSA 3NESA 4TV3A 3VH8G 3APNA 3U79A 3WIIL 3A4DA 4Q4OA 4FQIL 5LAXA 1G67A 1A3XA 3O81A 1ZSHA 4I8DA 1HCZA 3D33A 2N7AA 3S96B 1ZXKA 2VERA 4PJDA 3HPXA 1SJEA 2CJUL 3VCRA 2H9GB 5FW7A 1Z6KA 2XSBA 3G1DA 1VCFA 4WGXA 5E8DL 4I1PA 1QNRA 2PTTB 5IK3B 1UP3A 4KITB 2QBWA 2OR9L 1KOAA 4N2BA 5E1AA 5C6PB 4Y4FD 3BZEB 3Q8FA 1F3TA 1HSAA 4NU7A 4I89A 1Q6RA 1FAIL 2ZP8A 4JHWH 3VSQA 4D8OA 1U5VA 4K3EH 1W9PA 3T3ME 4RK8A 4ILSA 4F92B 1QLEL 1OF6A