4NXKA

Crystal structure of abp-d197a, a catalytic mutant of a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 149
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nxkA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nxkA01
1DHKA 4IPJA 4PL1A 3MI2A 4DQWA 4FHAA 3O1NA 3PBYA 5D32A 2PWDA 2PWEA 3TROA 3WNLA 3HGRA 4RZ4A 5CZTA 1K8YA 3Q37A 4LRSA 2ZXBA 5LNWA 3LHYA 4JYEA 3M07A 4U33A 1G4TA 1UB3A 4N6EA 4NU7A 3W7PA 1FQ0A 3IIXA 4E2BA 5HULA 1HNYA 4DXVA 1CW2A 3A22A 1OK4A 5D30A 1BLIA 1IXOA 3BSGA 5F7UA 1F6PA 1G7UA 2WSPA 1M6JA 3D50A 3O07A 1AL7A 3MI3A 2O7QA 1KV8A 3PB2A 3FS2A 3BK0A 3NM3A 3BAXA 3UWYA 3KRSA 4A2RA 2GQ9A 2OSWA 2ZRUA 1AW1A 2TPSA 4O17A 1LYXA 4UTWA 3W2LA 2ATMA 3CB8A 3LBCA 3TE9A 1JD7A 5U7SA 3VE9A 4H2CA 3P7YA 4IOTA 3BAIA 5ABTA 2F2HA 3UPBA 1VLWA 4MJZA 3FA5A 1GVQA 3GXPA 4LUJA 4TIMA 5H2ZA 3QC3A 5G2IA 3MP5A 4PCFA 2ZFAA 1VYSX 1DVJA 1EWEA 1JXKA 4CN1A 3VMOA 4GUJA 1IZJA 5CGMA 1VFUA 3G1YA 5D04C 3NEVA 2QCLA 5EPDA 5DCBA 3TK7A 3T7VA 3HO8A 4O16A 1W5MA 1AVAA 3K1DA 3EDEA 2G5WA 4JTHA 1PAMA 1Z42A 2NSXA 3N2MA 2Y24A 1J0IA 3IRDA 4J3UA 4RZ5A 4NT0A 1B2YA 1JUEA 1K03A 2QCHA 3KVJA 3AO0A 1KTNA 1WPCA 2A5HA 2J24A 2Y89A 2J27A 4X9YA 3BGJA 1A5AA 1FBAA 2NX3A 2BY3A 1X1OA 1RZMA 4NXSA 2FTPA 4LOCA 2EQDA 4UQEA 3C2RA 4UFHA 1YTKA 5CGTA 1BF2A 4Z1BA 3CZNA 2ZUTA 5KZDA 5C2XA 4J28A 4I7UA 2QDHA 5BRBA 3DDGA 3LCFA 1ALDA 4WSJA 3RK8A 1FXQA 3I7QA 3VGGA 1TRDA 2EHHA 3CQ0A 4H4IA 4B9YA 1RQHA 2EAEA 1JCNA 2A7PA 4AHQA 3EX1A 2AAAA 3HBLA 1NSJA 4UNLA 3RNDA 4E38A 2NXIA 4GE8A 5I23A 2O7SA 1KW1A 5D2YA 3FLUA 2QCEA 1JRBA 3WK3A 2OYKA 2EACA 3QQ1A 1JFHA 3WFAA 3PSVA 3W75A 2C0AA 4EVZA 1VIWA 1Q6QA 3VFLA 2QMJA 4AXKA 1CGUA 2VNCA 4CCEA 1ONRA 3CEUA 4LC8A 1ZS2A 1QPKA 4ONVA 3BLFA 1JDCA 4XBSA 3VM7A 4BI7A 1TPWA 5A2AA 1YTEA 2V3DA 2Q3OA 3NPVA 3NVTA 4U31A 4UMBA 1LLWA 1JI1A 3M5VA 1K8ZA 1I4NA 1TPEA 2OJPA 4LVBA 3B0UX 1AMYA 1KXVA 1KGWA 2BWGA 3S2CA 2NV2A 3MHUA 5CLTA 4O18A 3GAKA 3TQVA 4FX7A 1KLYA 2J6XA 4WD0A 3S1XA 4BF9A 3WK2A 5EBUA 4LY8A 3SY5A 3PUDA 5D02A 3LOTA 1UASA 3KWXA 4LVDA 1WOAA 1KLZA 1WQ5A 2C14A 3EWXA 1VZWA 2VRQA 4PEKA 4GNJA 4AHPA 1V7YA 1BEUA 1LRTA 1SSGA 3GIYA 1KCKA 3LXCA 1VPXA 1TRIA 1ML1A 1OB0A 2FH6A 5AHFA 3BLPX 4BR1A 3BW2A 2ABBA 3MHFA 1BTMA 1Z48A 2J9ZA 4NJGA 4NNAA 1KFBA 3V1PA 4J3WA 4OKDA 1UKTA 3ZS4A 5FF7A 5EMYA 1BG9A 3L5AA 1UD6A 3GR7A 3W38A 1H7PA 5CZ0A 3L68A 4J27A 1YYAA 3DFSA 1IXQA 2V82A 1TV8A 3BG9A 3KLLA 4NUWA 3VM5A 3WENA 3DHDA 4FMVA 3SIZA 5J5RA 3G1AA 3SGUA 3P8IA 2Z2UA 5HR7A 1BVNP 2Z1KA 4GUGA 2DZUA 3IJ9A 2OX1A 3TJLA 2E8YA 1B4EA 3HGOA 1I2PA 1T0OA 1X8FA 2C19A 1TQXA 4UTKA 3I7RA 5KSWA 4UQDA 3SGZA 4IX0A 2PCQA 2WNZA 2VEIA 3CM4A 1GJWA 3WY3A 4H6KA 1XDMA 3ZWTA 3BC9A 3CIWA 3EJPA 1SW7A 3S1WA 3EWUA 3MJYA 3NZ1A 3HGJA 2QLYA 3DX4A 5HPOA 1GVOA 2CWNA 3O06A 4K6AA 1LTDA 2QF7A 1HUVA 3IGSA 1P6WA 3VMPA 1X6UA 3UWUA 3BUQA 1SO4A 3W85A 5GVJA 1L6SA 3KRZA 3ZT6A 1DJNA 2NT1A 2ZX9A 3QRHA 1OT2A 3GZ3A 1H63A 3PULA 3TA6A 2OYMA 1DQXA 2DJLA 2QUVA 1ZJIA 4HP5A 1IIGA 2Z6IA 3LI0A 4WX2A 5TIMA 3ZWSA 3LPPA 1EPXA 3P74A 3W7JA 5E6ZA 1G7VA 3PB0A 3PG9A 3CGTA 3BLIA 1CYGA 1FY6A 5EA9A 4DBEA 4UQCA 1K7EA 4PFMA 1M5WA 3FAXA 4A2SA 2JKEA 4AWTA 4IMFA 4O19A 2NZLA 4FIRA 4BZYA 3LCLA 3O6CA 3FEMA 2X2HA 2FJKA 2WO5A 4M6PA 2EAWA 1VR6A 2GVGA 1FWWA 4A29A 4HHPA 5HNRA 4I7VA 2Y88A 3BG3A 3NL6A 4R53A 4IMCA 4QITA 4BI6A 1QO2A 3HJEA 4KMQA 3ZR6A 3WEOA 2B7QA 3R2GA 3QJAA 2NUWA 4NNCA 3W73A 3G8EA 4FXSA 3KRUA 2NWSA 3W86A 3P5ZA 3WEMA 2QAFA 4LUIA 5BW6A 3LCGA 4ORIA 3W2NA 2HS6A 5CSSA 1MW2A 3LLFA 3QYQA 5K9CA 3M7WA 1JRCA 1A53A 1EO7A 1AQMA 1VHNA 1XL9A 3VI2A 5KZMA 1RPKA 3UY7A 1UD3A 3RIKA 1H62A 1MXGA 1YPIA 1QPRA 1KB3A 3W9ZA 5LKYA 1B57A 4O14A 1JUKA 2GPTA 3ATZA 4HOZA 2YYTA 2RDTA 1QPNA 2HTMA 1JIBA 3NQ6A 3WY1A 2H3DA 3GKAA 1JUBA 4GI8A 4GXMA 2ZWYA 3R89A 3CEPA 5I3KA 3KE0A 4K8HA 3STFA 3TUUA 1PZ2A 2ZCGA 4FLOA 5TBOA 2G97A 3BVVA 1GJPA 3OLDA 3BPWA 3D4ZA 2XWEA 1ZAIA 1WYIA 1TCDA 1SFJA 1KXHA 1VYPX 2WKJA 4IPIA 4HN4A 3A47A 1XBVA 3GXFA 5A5WA 1K7FA 2X1SA 5I3FA 3W1RA 3B8DA 2E6AA 4Q4KA 4NZJA 5I24A 4FX8A 3W71A 1Y7VA 1NOFA 4KWUA 2KZHA 3KVMA 4G1KA 4JFWA 3VGBA 1KCLA 3PG8A 4ZZ9A 3RF9A 2ZUUA 3FYPA 2YW4A 3LM7A 1DBTA 2BY0A 2FGZA 4Z1CA 4UTJA 2A21A 4FNTA 3TXZA 3M9YA 1WV2A 3G1HA 4UXDA 3LHTA 3TTSA 3THAA 5F2LA 4RZ6A 1UUMA 5CZSA 2Q3RA 9CGTA 2RH9A 1WDWA 1LBFA 3G0XA 2PRHA 1LM1A 3NPXA 3GX9A 2YPIA 3AXIA 4QAIA 2QCDA 3HG2A 2FYVA 5BRPA 3W74A 3G1VA 5A8GA 3LV5A 1UD8A 1XXXA 1SO6A 4FIQA 2Z1BA 3AMLA 2X30A 2ZZ7A 1I2OA 5K4XA 2C15A 3B04A 2ZTJA 5H91A 4XKYB 1G5AA 3UWWA 2VFGA 5LNRA 1QW8A 3RLVA 2TYSA 3N9RA 1H5YA 2WSKA 3H53A 4UTIA 4WOQA 3OHIA 2GJRA 3UCQA 3L2IA 5U4NA 3EWWA 1K8XA 4O28A 2C1HA 4FLQA 3R5EA 4PSRA 3PR2A 3DU0A 2VFDA 4NVTA 3GXMA 1QNVA 3EB2A 1OABA 3G24A 4FB7A 4HSOA 3QZEA 3NZRA 1Z32X 3Q94A 3CZEA 3UWZA 1XV8A 4UR7A 2ZE0A 5G5IA 1KXQA 3W70A 4UMCA 2V2DA 4TO8A 1XCXA 1YXCA 2WC7A 4H8VA 4GI9A 1YLVA 3DX1A 1VFOA 4BWLC 1SR9A 3UXAA 1YDOA 2QCNA 5F2IA 1RR2A 4QM1A 3CZLA 1IF2A 4CQAA 3UG5A 1E43A 1B4KA 1GZGA 4PCSA 2ALDA 2RDWA 2J25A 3II1A 3VSVA 3QSTA 1GVIA 3S8HA 3A24A 5K4ZA 1OHLA 5A6LA 3NOEA 2VFEA 3F4NA 3O15A 4FNPA 2ZQ0A 4RX0A 1I8JA 5FESA 5KITA 5CLWA 2Q8LA 3TSMA 1B0IA 1F73A 3VGHA 1UCWA 1LROA 4OV9A 1AL8A 3S0CA 1D7FA 4YWIA 3WDJA 1L2UA 2ZUWA 1R30A 3TMQA 1GWJA 4LS0A 4GUIA 2UV8G 5AYXA 3W7QA 1T8XA 2V0TA 3W7NA 3M16A 1G9HA 2F7OA 4WLCA 3LRMA 2PRLA 3DFQA 3R13A 4B5NA 5HWNA 1LOQA 3UPWA 1BVZA 3SJ3A 3WK0A 1SZEA 3E96A 2I14A 4O4VA 1N55A 4EWND 4GQRA 4JR5A 3IVTA 1OGSA 5D2XA 4M8UA 2R94A 4R34A 3U2OA 1UUOA 3L4TA 4JTUA 3B0PA 1NFBA 4NJKA 2HMCA 2H8XA 1G4PA 3ATYA 1M7PA 3W7HA 3W1AA 4JYFA 2F7FA 3LHVA 4UMAA 3EX4A 3WY2A 1PIIA 1V3MA 2ISSA 4JN6A 1W8SA 3DDFA 4YLWA 1JDDA 5LNUA 2OW7A 3CTLA 3PSWA 2YDAA 5D2TA 2D3NA 1JCJA 2A85A 1LBMA 2FLIA 3NQ7A 3FFSA 1AG1O 1XUZA 4UFJA 4KFNA 3I6RA 2WPBA 5E6YA 3BUDA 4OIFA 1UD5A 3NQFA 2Z6JA 3EEGA 3FJ6A 1EA0A 1LOSA 1PCWA 1D3CA 3NYZA 2GUYA 3MO7A 3STGA 5C55A 1PEZA 3CLMA 3TC6A 1FUYA 4PSPA 5F4XA 4LVFA 2VT0A 3VSTA 1Y0EA 3B05A 5AHEA 2QV4A 1W5PA 2FPTA 4H7VA 4DF1A 3W1TA 3S1VA 1V5XA 3ABQA 3LX9A 1VCVA 3DAQA 2BXZA 4AB4A 3EWZA 4MZ1A 5AHLA 1QWGA 1IIHA 1Q3NA 3A6OA 4O50A 4YXGA 4Z0SA 3VX1A 3EX3A 3G3DA 4ZQPA 1XI3A 5D2WA 2CZDA 4UFKA 2X16A 2BXYA 4CVWA 1R2SA 2XWDA 3UY8A 2H8ZA 3UXDA 3GAYA 5D03A 3NL5A 1S5VA 4IX2A 4M6VA 3F4WA 3TQKA 3E49A 4JX6A 3L5MA 5DLCA 1IV8A 2PE4A 3STEA 4JFSA 1U83A 4J3VA 3NAVA 1TTJA 5HJLA 1P4CA 2Y7GA 4LVAA 2Y61A 1KWGA 3ZO9A 3W83A 3HGSA 4JTJA 4HNUA 3OVQA 4OE7A 2ZWZA 4O1DA 1RQEA 2FPYA 3L4VA 3P82A 2JBMA 3VGDA 1H51A 4JTFA 1NF7A 3LCIA 4OQVA 1RVGA 4GIAA 1OX4B 4WSKA 2BSLA 3PS7A 2YW3A 2F18A 1GQNA 3OVPA 3BSHA 1FDJA 4KFOA 2YFOA 1D9EA 3C2EA 1MXDA 4FNUA 1QOPA 4LV9A 1MW3A 7TAAA 3W23A 2CZEA 4IMEA 3TONA 5K9DA 1GYNA 3KX6A 3UWVA 5LHFA 1ICPA 3S9YA 3S5NA 5DO8A 4TX9A 4HT3A 2WV8A 3CHVA 5FF0A 2V81A 3A9IA 4FF7A 2VXNA 3N19B 2GVLA 2W79A 1QI5A 4JTGA 3K8LA 3LTYA 4AWUA 1O95A 3IIVA 4K37A 1OFPA 2NWRA 3SZ8A 1QPQA 2R8WA 4MUZA 1QR7A 2E6YA 4HNVA 2OSXA 1VYRA 1VAHA 4FLRA 1F76A 1TO3A 3W1XA 4C1KA 2WVVB 1JF6A 1S5WA 2G95A 2ISWA 3GB6A 3GDMA 3BV4A 2FB3A 4LS1A 1OYCA 2OYLA 3BCDA 3P61A 1IZKA 2TMDA 4PL2A 4S2BA 4AH7A 3BG5A 1CX9A 4PODA 3W07A 3W7LA 2B0MA 4JDBA 5A2BA 2VFFA 1KM2A 2IGTA 2J88A 3TDFA 1SQ7A 4LV4A 2R14A 1VS1A 1XSIA 3WY4A 1HO4A 1NVMA 3LGEA 1HL8A 1WP6A 5E70A 3EDKA 2GQ8A 2CLEA 3KEHA 4LT9A 3THQA 5F4SA 4JY9A 1AW5A 4HKPA 1TMQA 1O4UA 2AGKA 2A4AA 2CFFA 2DZVA 3HMJG 4UUIA 3MBDA 5E0FA 1AMKA 4POCA 3BMVA 1JD9A 3G0UA 1W31A 1TV7A 4O8RA 2A7NA 1TYGA 3W2KA 1QOQA 3W7EA 1VC4A 1V3LA 1G4EA 3P81A 1EWDA 3R8RA 2XN2A 1DHPA 4O10A 1QW9A 2F7QA 3L2LA 3KXQA 1JVNA 2Y7EA 1KM6A 3L0KA 4XWUA 1G4SA 3EJQA 5G2HA 4WQ6A 3EWBX 1DL3A 1DKWA 1HL2A 4HA1A 3WNKA 4OHQA 4JXCA 4HPXA 4A22A 3G22A 4TVUA 4R33A 2V30A 3L4YA 3BAWA 2WNWA 4U28A 2V2HA 2WNNA 2RHGA 3GDRA 6ALDA 5FEZA 1DOSA 2A2IA 4FNRA 1R75A 4O1AA 3IGXA 4ZQNA 1QHPA 3EDJA 3EJRA 1KGUA 2X2IA 1CIUA 1JQVA 5K7JA 1VCGA 4Y6GA 3WNNA 4WXYA 8CGTA 4Y9AA 3WNOA 1UBSA 1BAGA 3S6DA 1A50A 3S5ZA 4CCDA 4MKNA 1CXIA 3I68A 2C18A 3QPYA 3BMWA 1NF0A 3CWNA 3G0SA 1RP9A 1TPVA 2FB2A 2FE0A 4GFSA 4JTTA 5HMSA 3UNDA 1W3IA 4AEFA 4UOQA 3KVLA 1PZ3A 2XN1A 3L4XA 3JS3A 5AC6A 2QJHA 4O1BA 2GVYA 4RKAA 4ALDA 3MYOA 2YJQA 4WZHA 2FIQA 1ZJAA 5K2ZA 3A21A 2QCGA 5LNVA 2AAMA 3QMTA 1F5ZA 1CGXA 1MZHA 1ZY9A 2OW6A 1UH2A 1ZENA 1W56A 4UOZA 1JAEA 3EJUA 2FPVA 5D33A 1OSEA 3WNMA 3MHGA 3INPA 2EJ1A 5CXPA 1I2RA 3CZSA 1AQHA 5CZJA 2WQPA 1TPB1 1TQUA 3AJ7A 2OMAA 3E0IA 4IQLA 2EO7A 1SO3A 4NX0A 3UYCA 2BTMA 3U6WA 4MY8A 1XH1A 4NJJA 6CGTA 1KXTA 1BWLA 4N6FA 3F03K 1XH0A 4OBTA 3D52A 4NI3A 1EUAA 4AF0A 5EYWA 2QUUA 2GQAA 5AB3A 2JKPA 3ZOAA 3W7GA 2VFHA 3N9SA 2X2GA 5SWUA 1MFVA 4QAWA 1TPUA 2B4GA 1E3ZA 4HPJA 4ADSA 5K3VA 3BVUA 1KBBA 4UIOA 3BVJA 3GYEA 4H8UA 3VNDA 4TR9A 1HXKA 3C8FA 4ZL1A 3IEBA 5G1TA 2YCEA 3ANYA 3P60A 3EX6A 1JCXA 3N3MA 2NX9A 1WXJA 3W7RA 1R33A 4C1LA 3DFOA 1RP8A 3LV6A 1G67A 4AF0B 1KBKA 3QH2A 5D09A 3BCFA 5DCDA 1GG1A 2FDSA 5G4EA 2F1BA 2VR5A 3NQVA 1OYBA 1I2NA 2ZX7A 4GKLA 1L9WA 3DX0A 4AIOA 1HWWA 1CXFA 4M56A 2E77A 1I75A 1SW3A 3P62A 1JF5A 4UFLA 2YR1A 1K3UA 2YOCA 2QJIA 3H55A 2BLEA 1DQWA 3H54A 2DORA 3BLKA 1EHAA 1H7NA 4XZ9A 1KFJA 1N8FA 3SECA 2AMGA 3QW3A 3W7IA 5LSMA 3VCRA 1PCKA 5AHIA 4GO8A 3NGJA 4ZVJA 1WZKA 3RU6A 4J3TA 3BVXA 3UZ5A 3RFAA 2QKFA 1XUUA 5AC8A 1YTDA 3W7KA 1I2QA 3ZFHA 5CPLA 4UNIA 4RJEA 2DH2A 2V5BA 4YMZA 3MWAA 3ZQ9A 3BGGA 3TH6A 4DBDA 1EEPA 4M5PA 4U2YA 3W72A 3DH7A 1C8QA 1ZAHA 3W7MA 3DFTA 1DEDA 1KGXA 3MYPA 3IGUA 1LRNA 2TSYA 1XBYA 2CLLA 2V3EA 4XTIA 5DN1A 1MW0A 3B0VC 2QDGA 2X2JA 1PVNA 2VFIA 3M1ZA 1PHWA 4JYDA 4MY9A 3C0JA 1OFDA 1QI3A 2PWGA 3G8RA 1QX1A 1TV5A 3KFTA 1KV5A 1HT6A 3ZSTA 3EWYA 4UQ9A 1U2YA 2ZUVA 1CXKA 1A5CA 1C9DA 4K39A 1LDCA 3FKRA 3R12A 4IXXA 3W3OA 2D73A 3FIGA 2CZ5A 4CGTA 4O0KA 2PRMA 3PBVA 1VLIA 4ORMA 4IMGA 4MAZA 2CW6A 1ICQA 3M43A 3BAJA 2JK2A 3S1UA 5J5DA 1PS9A 4M19A 1LZOA 3VSUA 3C52A 4JGDA 4M6QA 4IJBA 4UC5A 4BA0A 1X7FA 4CN4A 1TTQA 1UA3A 3D0CA 1U33A 3HIJA 3L4UA 1FXPA 3QMRA 4CCCA 5I3IA 3FYOA 3WDHA 3DBPA 4GJ1A 1YDNA 3DI0A 4JY8A 1G1YA 3C6CA 1JGIA 3B03A 1FCVA 1LCOA 2GJNA 4UTTC 4HNNA 2Y63A 4GUHA 1CPUA 2ZXQA 2VC6A 1TTIA 1YADA 1F2JA 1GG0A 3P5YA 2PC4A 3DHUA 3TSDA 3DFPA 2YGYA 4MLRA 1WX0A 2XVKA 4XKYA 1PHQA 3A23A 1FCQA 3M5XA 4N9EA 1RV8A 2ZZ2A 5CPOA 3CWOX 4LW7A 3M0ZA 2V5LA 2WOQA 1LOLA 1V3JA 2CZFA 1TCMA 4IGHA 6TAAA 3WJYA 2ZZ4A 4JTIA 4OGZA 2VUYA 3W2JA 2ZRZA 1Q6RA 4XTDA 3UG3A 3VMNA 1S5TA 1F6KA 3CT7A 2CU0A 2ZX5A 3GR8A 3L0GA 4B9ZA 4DELA 2QUTA 1G94A 2E6DA 2VEPA 4JS3A 3A5FA 1OT1A 3DX2A 2ISVA 2DJXA 3RILA 1MEWA 4QISA 2BX7A 5CPMA 3HPZA 5HQEA 4YL2A 2ZA1A 3GLCA 5DBUA 4HIBA 5C54A 2C6QA 3VE7A 1QI4A 3HB9A 2XIBA 1LP6A 5T26A 3O6DA 3G1DA 1J0HA 1BKSA 2ZTKA 2ZYFA 1WA3A 4LPCA 1ODUA 1T99A 1GYLA 4KFPA 4WY0B 1CDGA 3LB0A 5F4WA 5D2VA 1GVFA 4UFMA 3NQGA 2F1AA 2WCGA 3HZ3A 1BPLB 4JFVA 2VEKA 4LVGA 3ZR4A 4RR4A 3SI9A 4QSHA 4Z1AA 2ZX6A 3CPUA 4FEZA 5D38A 2I9EA 4A3UA 2NUXA 3RLUA 3OA3A 1MW1A 2TAAA 5D37A 2VRKA 5E1QA 5HUPA 4DO6A 3QFEA 1VB9A 4JX5A 5I3JA 1OYAA 3QGVA 5A6MA 1QDSA 4ZQRA 3UQNA 2YA2A 4HPHA 5FF3A 1UD4A 3BUBA 1P0NA 1OK6A 1E40A 5IBXC 1FWTA 2R91A 2ZBTA 5AYYA 1XFBA 1SU5A 5LNSA 3PWAA 3SW6A 5EKYA 3Q2DA 1R47A 1S46A 2Y7DA 1VHCA 5I3HA 1VCFA 2CLOA 2NXHA 2X1TA 2E5DA 1XDLA 5BOOA 4AWSA 1JULA 1CGVA 2DIJA 2DZWA 3T55A 5F1UA 1UD2A 1MWOA 1B3OA 1XSJA 2Y6ZA 2A7RA 4GUFA 1KBJA 4JIQA 3WJSA 3KLKA 1J4EA 1TQVA 4IMDA 1G69A 3NDOA 3NG3A 1U5JA 4RK8A 4JL1A 1VFMA 4QNWA 1A5BA 3VGFA 2JKAA 4E2DA 3ABRA 3OLGA 3ZR5A 3M5ZA 2ZZ1A 4AIEA 2BY1A 1EA9C 5G2WA 1Q6LA 1LRQA 1UH4A 5I3GA 5EY5A 2I1OA 3KVKA 3ZT5A 2ZZ6A 5CG7A 3ELFA 3M6YA 4WXZA 4CKQA 2YA0A 5E9AA 4PA8A 3TAKA 3TR2A 4BWLA 2WVTA 1XCFA 4WOZA 1VJSA 4DO5A 2DZTA 3QM3A 4O53A 2Y62A 1FWSA 1VH7A 4YCOA 1J0JA 2EKCA 4LWWA 4Y96A 3UWQA 1FCBA 2ZXAA 4TMBA 4ZQCA 3T44A 1QPOA 3K8MA 1LLZA 1E51A 3GDTA 1XC4A 1UKSA 4I9AA 3GDKA 4RCXA 4XQ6A 1LBLA 4AW7A 5AN7A 4MB1A 3M47A 3NM1A 2XFWA 5DY2A 3TU9A 1YXDA 4O12A 1CXLA 3QPZA 3GKFA 2XIIA 3M5YA 2C16A 1LORA 4UTWC 1JDAA 2ZUSA 1QWUA 3W22A 1L0PA 3TMLA 2GJPA 2QEZA 3SSJA 2WSRA 3PM6A 5LGXA 3AJXA 3WELA 4MLJA 4LNYA 3OEXA 4LU0A 4K8EA 2NV1A 2TRSA 1XBXA 3G3MA 3L4ZA 3TX9A 3JRKA 4M7TA 3DGRA 4UTLA 5MHBA 1L6WA 3TV8A 2Z0IA 1KBIA 1SFLA 4NJIA 1FCUA 5FEXA 2ZIDA 1J5TA 3GBEA 3L9CA 3P8JA 3N2XA 1UJPA 3OVRA 4NJHA 1OX4A 3OBKA 1K7XA 3CZKA 3NL2A 3TSBA 4BK9A 3GTNA 1GPWA 2EABA 2DZPA 3SFKA 3PUEA 3BW3A 1IXPA 1EP2A 1TJRA 3DHFA 4QQ3A 4FO4A 3QW4B 1HTYA 1EB3A 1G6CA 3L66A 1ZFJA 3B06A 5BRQA 1DJQA 4UCGA 2C13A 3OLEA 2EEXA 3TFCA 4OWGA 2ATSA 2FHFA 4XBKA 1J0KA 3LBMA 3LERA 1GTHA 3TIMA 2NT0A 3CC1A 3HG3A 3W1UA 4ATWA 1WZLA 1ZJBA 1H60A 2WVVA 3W6YA 1R2TA 1EX5A 3IIOA 2E1DA 1PJ9A 2YSWA 3W2MA 3PBUA 5AOUA 4WF7A 1RD5A 5AYZA 5F1VA 3KOFA 3ZSSA 1ME9A 3IVSA 2VOMA 2C7FA 3GNDA 3WJXA 1SSDA 3FJLA 2BZNA 4PEEA 1O7DC 2QAPA 1KWKA 1TPC1 1W9XA 1GJUA 3DENA 5FF4A 4JDYA 2XVLA 1PE1A 3ZT7A 3IK2A 2XN0A 2W0UA 3V75A 4O15A 2F61A 3C56A 3NQ2A 1JCLA 3ABSA 2C3ZA 4D2JA 4LRTA 2V3FA 3A4AA 1SMDA 3KL0A 2QPSA 2Y7FA 3TAOA 4EOUA 3AXHA 2CLMA 2WKGA 3U8GA 2OCZA 2GUUA 1GVSA 3W2UA 1HVXA 5KEZA 1YDVA 3UERA 2YFNA 4U2ZA 2QR6A 2DIEA 4FX6M 4Q32A 2G96A 1A5SA 1H7XA 1ZALA 2G3NA 4NXKA 4AMXA 2VEMA 3OG3A 1UH3A 3C4UA 2QCMA 2A0NA 5KMYA 3GDLA 4S2CA 4DF0A 3LHZA 4U3CA 4N4PA 1CGYA 4UQAA 4YCPA 3NL3A 1TQJA 2QPUA 2NLIA 3WK1A 1M53A 3WFZA 5E0KA 1EP1A 5LHEA 1FWRA 4K7VA 3D4YA 1THFD 3BH4A 4X9SA 4N02A 4N2YA 4U4MA 1YXYA 1OFOA 3KL5A 4DO4A 2D0HA 3IIZA 2W6RA 5C6MA 1W5QA 3M44A 4NNBA 3I7SA 3TFXA 3TTYA 1ICSA 1ZAJA 1OFRA 3MUXA 3O63A 4MYAA 3T40A 4JTSA 1T96A 4O52A 2WANA 1X1ZA 1O5XA 1GTEA 1QO5A 3JR2A 1HG3A 1XD0A 2E4TA 5AHNA 5HR6A 3N34A 3BAYA 1HL9A 2CLKA 4OU1A 3BLEA 1O94A 1WBJA 2CXGA 1VQTA 1IXNA 1EP3A 1RQBA 4UTUA 3UG4A 2E09A 2DH3A 3C3NA 4L4MA 3L0NA 4JX4A 3GXIA 4Y8FA 3WJWA 1PS3A 1Q45A 1GT8A 3AMKA 3L5LA 4AAJA 4K36A 5CGQA 1KM4A 3E02A 1XCWA 1OFAA 1S3HA 3FOKA 4H3DA 4H8HA 2V2CA 1W3NA 3PUOA 2D0FA 2ALWA 3L67A 3C2VA 2WPGA 2CLHA 1N7KA 4XB3A 1FX6A 3CLWA 3QSRA 3DFNA 2BHUA 4FNQA 1ZCOA 4Z1DA 1XH2A 5KTLA 1Q4NX 3NQDA 1CXEA 1JJKA 4AYGA 4Z08A 3VO0A 4QJ1A 2E6FA 3MP4A 2NXGA 1MVYA 4RXFA 1ADOA 4MIMA 3TC7A 1TQWA 1Q6OA 3O8AA 5AFDA 3L4WA 3G1FA 1FDZA 3I65A 8TIMA 3LCWA 3N73A 2D3LA 1TPFA 1GCYA 4N9DA 1E3XA 4J3XA 3TOPA 4LTSA 2H90A 3HF3A 2FFCA 3E9AA 3NQ8A 3LRLA 2FHCA 1KA9F 4JFUA 3WMSA 3WJZA 3QEZA 1QAPA 5KZEA 1TB3A 3TW7A 3DI1A 1CXHA 4OJYA 1WZMA 4GWEA 3OLIA 4X2RA 2J9YA 3USBA 2OT1A 3BARA 1W1ZA 1OG0A 1NEYA 4M7SA 5FEWA 1JL8A 3GK0A 3W1QA 1QCWA 3DZ1A 1JCYA 4AEOA 5EMUA 5IM51 1ZHAA 4JEQA 4E2OA 4MY1A 5KINA 4HOXA 2LLEA 2QJGA 2FH8A 1W5NA 4HOWA 1GEQA 3LI1A 5LZLA 1EIXA 5DXYA 1A47A 4MYXA 3C2FA 4MVAA 3LTSA 4O4WA 4OT7A 5DXXA 2BHYA 2YZRA 4CNPA 1TQTA 4K38A 2G3MA 3L2MA 1WZAA 3NQCA 2WJZA 3TNOA 3VGEA 4GINA 1OFQA 4OV4A 3NNTA 1DORA 1F05A 1C8VA 3VNZA 4P61A 3TJXA 1TSIA 3DKJA 4Q33A 4MPQA 4JTEA 3DKLA 3MBFA 4KKXA 4LXFA 3LPOA 3IJ7A 3S5YA 2OSYA 3E12A 5DY3A 1W3TA 2ZA3A 4O0ZA 4AMAA 3MMTA 4RXGA 1GOXA 3P67A 3GBDA 3LCHA 1WOBA 4AYSA 1PIGA 3D51A 5DBTA 3B4UA 2C8NA 2RDUA 2J9XA 1SZFA 1LWHA 3IJ8A 1H7OA 2WVSA 3W1NA 3WDIA 2E9BA 2ZRYA 4N9CA 5DFAA 1R2RA 2PURA 1JI2A 3VNYA 4AEEA 1UKQA 6TIMA 3EXTA 4I7WA 5BMXA 1XBZA 4P2VA 1JG9A 4GC4A 3EX2A 1PPIA 1PV8A 1AK5A 3W76A 1P0KA 1P5BA 3GXTA 5BMWA 4ML9A 1KM5A 4AVFA 1PL9A 3P84A 4O54A 3PF3A 2F7PA 3OIXA 2NX1A 1J2WA 1KTCA 3BO9A 4WY0F 4LS2A 4JIPA 1SO5A 2BXVA 3UZJA 3PBWA 3S42A 4JICA 3BUIA 2ZXDA 2CLIA 3O6YX 4BI5A 4A21A 3WN6A 4J3SA 1K02A 4GQQA 3VKJA 2X1UA 2YIHA 3W1LA 1SZNA 2WNQA 1QFEA 4JTKA 5HWJA 1M7XA 3BUPA 1MSSA 4ICNA 4CLMA 2D0GA 2YYUA 2P0OA 1HTIA 5HINA 3QF0A 2GVJA 1H50A 1HFBA 3YPIA 3K30A 3TXVA 2RFGA 1XSKA 3C2OA 3KHJA 2DZSA 3TCEA 4Z0JA 1QMLA 3LHWA 4ZQOA 3W84A 3DX3A 3FW6A 2A1YA 1U30A 2DU2A 1O5KA 4K7YA 3MP3A 2ZICA 1H1YA 1H1ZA 4KWWA 3HG4A 2VKZG 2V8ZA 5EL1A 3UEQA 1RPXA 4HNTA 3O16A 5BNKA 1VJIA 2NUYA 1OFEA 3NO5A 5TD4A 4JTLA 1EH9A 3GXDA 4WUIA 1MO0A 1V3KA 2Y85A 3W1MA 1NAL1 3EJSA 1C29A 3Q58A 4JFTA 3L65A 1CGTA 1O60A 2EADA 4ADTA 2ZZ3A 1JQXA 3NQAA 3NR0A 4W9TA 1KFCA 5DELA 3EKLA 1BWKA 2Q8ZA 4DF2A 3T78A 1CI1A 1KFKA 1TJPA 1DTUA 1TQSA 1XGZA 4GRSA 5FI8A 2AQWA 2YA1A 5HUOA 2BHZA 5C5YA 2EGZA 1W0MA 4PH6A 1LWJA 3EDFA 1H7WA 2ZZ5A 2B7PA 4NX5A 3WNPA 1Z41A 5K9XA 5FEPA 1KFEA 2OT0A 3EDDA 2VELA 3HPXA 4MFDA 5D05A 5CSRA 1FDYA 3BLBA 4CN6A 2EF9A 3SR7A 3LXBA 3GXNA 1BSIA 3FAWA 5FF2A 5CKSA 1H3GA 1AW2A 3F1QA 5LGZA 5HWMA 4UTMA 1OFBA 4IWWA 1KFLA 3G18A 2BY2A 2IQTA 2ZA2A 4EF9A 3W7DA 1SZGA 2P10A 1D3HA 3DHPA 3NPWA 2X1RA 3PY2A 3UD6A 3CU2A 4WY0A 3W7CA 3S5OA 3ABOA 3HG5A 3QMSA 3LHUA 2E5CA 3STCA 2E0PA 4IXHA 2FHBA 1SPQA 3MW7A 4L4LA 3T4CA 3BAKA 3GNNA 1MXSA 5HXMA 3TW6A 2A6LA 2Y4SA 3C61A 3EXRA 3IV3A 3PC0A 3N14A 3W1PA 4NZFA 3W87A 4FLSA 4E0CA 3NA8A 3EJTA 3HQ1A 2ABAA 1MEIA 4S1FA 4O13A 3NQMA 3M41A 1EUNA 4RV8A 5AC7A 1XM3A 4N9BA 2F84A 2QCDB 1TIMA 3FKKA 4AHOA 4CNNA 4TMCA 4J9JA 1HX0A 4ZQMA 2E5BA 4AMWA 2B7OA 4X22A 3CTTA 1VGAA 4MFEA 3HJZA 1P1XA 1QHOA 1H7RA 2FQIA 4UTTA 5DCEA 1F7BA 3NQEA 2YKKA 1W54A 1SMAA 4ZMGA 3BW4A 1OJXA 3LCXA 2RKXA 2F7RA 2JGQA 4GI6A 1B9BA 4HSNA 4GO9A 1ZNNA 2HS8A 2GJLA 4O11A 2ZX8A 1TREA 2VENA 3CV5A 5I0DA 2OZ0A 2D2OA 2QMKA 4XUGA 2WKLA 1VRDA 4UZSA 4MZYA 1JCMP 4X3ZA 3CZGA 4MZ8A 3L21A 2CHNA 3NXFA 2ZRXA 1TTPA 3EKZA 1KTBA 2PWHA 2E8ZA 5G4WA 2QCCA 7CGTA 4CQ8A 3TKFA 4JL2A 1H61A 4DPPA 4UNKA 3LLDA 3IVUA 2WSQA 3P80A 3KL3A 1OX5A 2JGYA 4UZUA 1FWNA 2Y70A 4EIVA 3GVGA 4PC8A 1XKYA 4IUOA 3W7OA 3KAOA 3PAJA 5G1YA 1W37A 3G1SA 4NQ1A 1UOKA 1TPH1 1YPFA 5F2GA 2Y5EA 1F74A 3MI6A 4LC6A 4WJEA 3HPSA 1D3GA 2WVUA 3TQ0A 1KM0A 4PTNA 1JXJA 1L6YA 4UCFA 2ZRWA 5E93A 4DEFA 1PIFA 1ME7A 2B7NA 1EO5A 2HSAA 1UA7A 2P1FA 4QIUA 4LQ1A 4PCTA 4JD4A 4UTHA 2Y2WA 1OX6A 2WCSA 3O05A 1M7OA 1ME8A 2PWFA 4J7RA 3NPUA 1R34A 2H3BA 5L9FA 5IBXA 3A5VA 3DXIA 1OVDA 3VU2A 5CPNA 5HDRA 5TQLA 3LDVA 3EXSA 4ADUA 4DPQA 4JCLA 1MFUA 2EPHA 2DP3A 4N4QA 1JR1A 2A6NA 1W5OA 4CQ9A 3DC0A 4RLIA 4UR8A 1CLVA 1WE5A 2H6RA 2YX0A 3RMJA 4BFAA 1OF8A 1TPDA 4O57A 1SW0A 3VX0A 7TIMA 1TMHA 1WO2A 3BVTA 3IIPA 4TU1A 1OF6A 1DV7A 4JNMA 4UQBA 1SUXA 4MOZA 4QNEA 1IGSA 4GBUA 2XVGA 3BVWA 5I5RA 2WSYA 2QCFA 1I45A 3PVFA 2V9DA 2ZDRA 2E68A 3ECQA 4KWVA 5F2MA 1WBHA 3G1XA 1KM1A 4MJMA 1QWNA 4Y90A 4CNOA 2GOUA 3W88A 2CLFA 4UFIA 2YXGA 1XD1A 2CPUA 4FNSA 3LTPA 3CPRA 3LRKA 4JCMA 4W93A 4FXRA 1MEHA 1HO1A 1GVRA 4X0NA 2ZRVA 3CIXA 5AHMA 4O1CA 4R7JA 4EF8A 1R46A 5A2CA 2DZXA 1NM9A 1Z44A 3HOJA 1WAUA 5L6UA 1CGWA 3W37A 3QQ0A 1KM3A 3K8KA 3LXAA
chains in the Genus database with same CATH superfamily
3MRFB 4EXBA 2PO6D 4YDIH 8RUCA 5CAKA 3L3GB 3SAZA 1IUZA 3DSNA 4FHAA 5HHPB 1IQWH 4AK2A 4LEFA 1G4TA 4NU7A 2K8MA 2ROYA 4YAQB 3V6OA 3IIXA 3Q1SL 4X7TA 4NKDB 4WDIA 4C5ZA 3D50A 3LMJL 4AZCB 4N1CA 1PWLA 3XIMA 1FH7A 3BAXA 2NNXA 5HI5C 4F57H 4HU4A 3AMGA 2BSCA 1BX2B 3TO4A 2IC2A 1VLWA 5AENA 3MJ9A 3FA5A 3VFVB 1GVQA 3FZUC 3VUPA 3NK3A 2P46B 2F54D 2QQLH 2DI7A 2YC1A 4KAQH 3TK7A 3HO8A 3GZKA 3IJQA 1HH9A 4X9YA 1OCCB 2G0WA 4P7RA 3FJTA 4KKQA 1Q9LA 3DO7A 5I1HH 2HE8A 1RK6A 3S88L 4Z1BA 4I3GA 3QUZA 1ZSHA 1MCSA 4YR6A 3RK8A 3ATEA 3DWTA 4B9FA 3BWWA 1A3WA 4IGBA 1BD2E 4AHQA 2Q10A 3H12A 4KI5E 3NN8A 2H2SD 4PRRA 2CGYA 4M7LT 4X5XA 1S7VB 5F9JB 3UDWC 4W87A 2UZIL 1IBDA 2EDQA 1DJZA 3WLNA 4RMWA 3D0VB 5AAMC 4XBSA 3DBSA 3LV3A 1D9KA 3MQTA 3MV8B 4UMBA 1I4NA 2OJPA 3GLAA 2R2EA 1RHHB 3MHUA 1E71M 2J6XA 2V5SA 1X5FA 2OAAA 4KQNA 4I3RL 3OJDB 2J8GA 1JYNA 2EDOA 3D9AL 1A6TA 1OSPL 3NZ8B 3PTQA 4P99A 4PGJA 4I3SH 3U6XA 3TNMB 1TV8A 3ZE2F 1U1UA 2X4NA 3SIZA 1E6OH 3VI3B 5EF3A 3BOVA 4L7ZA 4PMJA 3DTXA 4GUGA 3U5YA 4CVZB 1UT9A 1TO5A 3ULVF 2VEIA 4DGVH 4U6HA 3G5ZB 3T9PA 3NIYA 4E9WA 4QAMB 5GSRB 1RZGA 2QLYA 1OCOB 2X0WA 5D7IA 3M1BB 3VA2C 4F9PC 4OZIA 4BSJA 1U8NB 4WY7H 1W1VA 4MXQD 3QYSA 3LI0A 3GU2A 3ALWA 2CCLA 5GRUL 1HSBA 3R94A 5IVXE 3P02A 2FJHA 1DQVA 4YE0A 2A7BA 4F93B 4BZYA 3QG6A 3N11A 1D6EB 3HC4H 4JG1L 4LRIC 4H20L 4RAVA 4MS8C 4ZB5A 5L2KA 3BG3A 4QITA 4UAOB 1E42A 1RZKC 1FYTE 2WUBL 4LB3A 3G5EA 1BIIB 5LIWX 3W2NA 2HS6A 4WKZA 3P3SA 4XNZB 4PB4A 4LPTA 4Z7OF 2F7IA 1CFTB 1JERA 4JM2A 3GMRA 2GPTA 4MTMA 3STFA 4WWKA 4JFHE 3QV8A 5I3KA 1WFMA 2ZCGA 4XP4L 4OCSH 3D4ZA 4XD5A 3ULVL 2QQKH 1YEDA 1VYPX 4JQ2A 1I82A 5EEVA 4QRUA 4JUSA 3CHOA 2E6AA 5MERA 4WO4B 2K6YA 5ECVA 1KEGL 4XKMA 1KYFA 2NSMA 2FDBP 5KVDE 2A21A 3THAA 3T0EB 2QGCA 2IKIA 1GH7A 2HFEA 3ABZA 2L04A 4NN5B 3H7UA 5DJ8B 5B1JA 2Z1BA 3AMLA 3KBNA 2P7TA 3F6IA 3VXRA 1W15A 3UWWA 4XPBH 4U3AA 5HGBA 3L5WB 4J3OG 2DQCL 3CFBB 4M1DL 1JMZA 1J05A 4RX4A 2EPKX 3NP4A 3W0KA 2ADIA 1IIKA 4NZ4A 3MYJA 4UR7A 1YLVA 1Z7JA 1SR9A 2FT7A 3LSOB 5F2IA 3LPGA 5DRXA 3DFHA 1E4WL 5BZAA 4HUUA 5BOEA 4PCSA 4R5VA 4YL9A 3DUSB 1GVIA 4LKXA 4BF7A 4Q4SA 1P1VA 3CNKA 3QIUC 5E5LA 2B08A 4J1OA 3HLKA 1NQBA 3NJNA 5JPMA 5M1TA 1B0IA 2YXVA 3N29A 3TZVA 5C07B 1L2UA 1NJ9A 5JIMA 3W7QA 3ZDXE 3DFQA 2BCMA 3NEOA 4HZ1A 3RL2B 1M6UA 1BVZA 2R4RH 4Q8QA 4OLWH 4FXGB 2J8UF 2BCKA 2VEGA 2PWUA 3D25B 3C5QA 2RA1A 1DWHM 4JTUA 4NJKA 1G4PA 5DJ0A 2CERA 4JZOA 1TU2B 4LYRA 4JN6A 1JDDA 2CDEA 5C9XA 4PJEE 1AG0A 2Y8KA 1XMWA 4AUUA 3LNFA 3MO7A 5C55A 4N0FB 5F4XA 2OL3H 2A0LD 4DJMA 4UUJA 4H7VA 1V5XA 3E8VA 1HJBC 4AB4A 2ZCLH 2MQCA 5F9OL 4WTZG 4BUGA 1I8MB 2AQNA 1OZUA 1L6GA 1XI3A 2HT2D 5IUSA 4JMNA 4Z78B 3GAYA 4AK1A 4MCYB 2OJEA 1A1OA 4D94A 5B3JE 4ZUVB 4OM0H 1U83A 5ICYB 3WTWA 3TVMB 4LVAA 3RUGE 3ZE1E 5IDIA 4HNUA 2FPYA 1BSLA 1TYRA 3LEVH 5EB9A 4QXGL 3I9IA 4M5ZL 2XSAA 1HI6A 4BZ2A 3D7PA 4Q7BA 3NCWA 1CL7I 2HUEA 4JTGA 4RE4A 1OFPA 3OVGA 2Y6TE 3LB6C 2KDYA 2OMYB 1IZKA 4S2BA 4XMPH 1INDL 4L4TB 1G7LB 3SD5A 4ALAC 2CIIA 2Z34A 3LGEA 5GS0D 5GIRA 1JRHH 1Z9MA 1AW5A 4R7WA 4Z7WE 2VLMD 4Y19A 3K2MC 3KJ6H 4MNLA 1MCQA 4N86A 5LWYL 3DHMA 3TF4A 3BN9C 5BUAA 1BYNA 5IKCA 1UR0A 2J8TA 3ZTJG 1C5DB 2GWNA 5IHZB 4HHWA 4L80A 1DKWA 2Z6FA 2FATH 2ZVRA 4W4NA 2RHGA 3UGUA 3MLVH 4WUUE 1XGPA 1P0SE 4YHOL 5BOZG 1WDPA 2LTQC 2H7WA 3FOMB 4P2YA 4ANKA 4FQPA 4AVIA 5AZUA 5GJTL 2WWDA 2JKSA 5JQ9A 2GVYA 2KLRA 5IEHB 1OP4A 3VXOB 5LNVA 3V0FA 3PV6A 1JAEA 3IMTA 3VC5A 2XVBA 1UA6H 4YPGA 2WQPA 1TQUA 3AJ7A 3NCYS 3E0IA 4KJPD 4CNIA 5HHMD 1U8MB 4KMLB 4OGYL 2DSUA 1XIMA 4HNOA 3QPEA 3OKEB 4P9ML 3FX4A 3ZOAA 1FZKB 2X2GA 4M62H 1VFHA 5HJBA 3DVGB 1TPUA 3WUEA 3DSFL 1CD0A 5I17B 4AIZA 1W0WA 3VB9A 2JELH 3N3MA 2BLFA 3BHBA 1N0LB 3H2PA 1NDGA 4JMXA 5ECUA 3G6JB 5IROA 2Y5QA 5H1WA 2BOCB 2E77A 4KQ3L 3HZMA 4KCUA 1Z3GH 5I8CB 2DQJL 4HKJB 1E70M 2DORA 1XZ0A 2UY7A 4UWQB 4ZVJA 2BGQA 4MCZB 2QKFA 3CAVA 4RFEB 4FJYA 3R10A 3TT1H 2Q71A 1LO2L 5DD3L 3IRSA 1TNMA 4HWBA 3AWOA 2TSYA 1JNLH 3DVNB 3S9IA 3RL1A 3I74A 2J8FA 4NUJA 5DUBA 3D2UB 3ZSTA 2ICWJ 4NC1C 3GRWH 2PR4H 3NJGA 2XXMB 4FP8H 1VPOH 1RL1A 4OD3H 5TK4A 1WC7A 4JGDA 1MHCB 3IU3B 1E9LA 3KZ8A 3D0CA 4LHUB 1X6NA 3ITVA 4PY8I 3HIJA 1MIMH 2C3GA 2PTWA 3EKGA 1IE4A 1F5WA 3OZ9H 1HN1A 1YCSA 2PPCA 4PGEA 4AVOA 1I3GH 2Y63A 2ORBH 1YADA 2VR4A 5BVJA 2DDQH 4LCCA 5K1VA 3QI9D 4PJAA 5BCAA 3V0EA 1IBFA 4L4JA 1L8NA 4OI7A 1E9OA 3DGBA 4DAIA 2QULA 4JTIA 5AUMB 4DKTA 2MNUA 3LKQA 2ZX5A 4DW2H 1GOWA 4AMCA 5MEPB 4Q89A 4RZCA 2ZKHL 3RILA 1MEWA 5T26A 3P93A 1J0HA 2G9HB 5KSBB 2OLAA 5LCVH 3V1HA 1L9MA 5D2VA 1WKFA 1SOQA 3CVHH 4DXKA 2WCGA 3DUHA 1U92A 1J11A 3N50A 4CKVX 2AV1B 4WW1A 4A3UA 2EDJA 1A4LA 2VRKA 5FR3A 1F3RB 2CDGB 3VZYA 1UWGH 1BXBA 3CX2A 5DUMH 3AICA 5IWLA 5D96C 1UTDA 2E7DA 2X1TA 4ODUB 1MAMH 1CGVA 1ISZA 2V0AA 4JPIB 5DDHA 1YNTA 4GUFA 5FX3A 4WNJA 4LCUA 3QR1A 5KVEL 3UFIA 2BY1A 5IM7B 4F0MA 1YNLL 5EY5A 5I2IA 3WXWH 2CO6A 2DD8H 3UJTL 2JCCA 3WXVH 4O5LH 5A6BA 4BWLA 1TUFA 1FWSA 1GZHA 1Z9SA 2R4SL 4GG9A 5DT7A 3C87A 1LLZA 5IY5B 4CC1A 4KMTL 2XFWA 4E5TA 2W63A 1B6UA 5HDQL 4O12A 4L3CB 5IVOA 4HEME 3LVEA 4XZMX 3V4UL 2ZUSA 3W22A 1IC7L 2A79A 4UV7H 2UYLB 2EH8H 4XZWA 1U2HA 1DQML 4I0PC 5IMOB 1FCUA 3EOTH 3GBEA 3WUBA 3QIWA 3QWRD 4KQ4H 1UJPA 5IQ9A 4DH2A 4NJHA 4MCMA 1QEWA 4BXVA 2OQJA 3M0XA 4FOKA 1AIZA 2HK1A 3MRQA 3SFKA 3QJHB 4G43B 1A3QA 5DHYB 3BKCL 4FCAA 4R0LB 2EDEA 4G7EA 2GGJA 4X9IA 4DNLA 1AGFB 2YB1A 2WHLA 1ND0A 3ZL2A 1PTGA 4WF7A 5F1VA 3KOFA 2F53D 4I18B 4BFJA 5JPNB 4HCDA 1K2DA 3HCVA 4PM1A 3QR0A 3O2DH 4OQTL 5T1KA 3U9PL 1M2OA 4ZG1A 4XBGB 5JHDB 2Y7FA 5GGTH 3GSWA 5CP7B 2XQYK 5IFTA 4HUVB 1PG7W 4B91A 1JTOA 2FJSA 4NXKA 2UZXB 4HVBA 4D0CA 4NO3A 1WNOA 4G7FA 1E5CA 5I75B 3QIBB 4X9SA 1S5IL 2YXOA 3KL5A 4JRLA 5GS0H 5C6MA 3TCLB 5E03A 3T71A 3SCSA 3WMBA 5T3XE 3ARBB 4PB0L 1T96A 5T9BG 2PO6B 5TE6H 2GJXB 5E1IA 4EIUA 1IXNA 4NUGH 4R5EA 2E09A 2CKBH 3O7UA 3WJWA 4XH2A 2XACC 3WTVA 4AAJA 3I75B 2PLTA 3Q5YA 2P76A 3ZUNC 3NCXA 4C56E 3ZVHA 5CIPA 1MFMA 1RBAA 4FNQA 1F4WL 1Q4NX 2DSZA 2HG0A 1JNDA 4MIMA 1TQWA 1IGTA 3G1FA 1FDZA 2Y7LA 2FDMA 5D1ZI 2ODIA 4NASA 3V0VB 1PDKA 3RVVD 2F54B 2F68X 3KCJA 3N15A 2WM0A 4OZGE 3GMOA 5LBSH 5L8LB 2H90A 1KA9F 3STLB 1RY0A 3WMSA 2EE0A 3SIKA 4PMQA 1S2TA 1KCSH 3DI1A 2CLPA 3VH8G 1HHKA 1NAKL 2HPOA 1QHZA 4ERSL 4NI8A 3CSPA 5EMUA 4YHZH 4WI5A 1ZHLB 5INCB 3LI1A 2PTDA 4P0DA 1W9BM 2Q2LA 4D9PA 1EO8H 4CNPA 1V0KA 3NIDE 3NNTA 5JIPA 4HGMA 2FEDC 5G4HC 1E8XA 2H1LM 4MAYC 3D51A 4A6GA 5TGBA 3B2UD 1SZFA 2ZRYA 1WAAE 1PX8A 5HVGB 4QP0A 3H3KA 3HI6H 3EX2A 1AK5A 4QR6A 4FFZA 4GEIA 4F8OA 3PF3A 3E38A 1UB5B 1S2AA 3WF0A 4FXJA 8A3HA 3IDUA 3ES6A 1OARH 3KW3A 2V33A 4U3SA 2ZXDA 5C0EB 5I1LB 2ADAA 1Y6NR 3EBAA 2F8IA 3VKJA 2X1UA 5DZAA 2BIIA 4WGHA 2WNQA 2VDLL 5C08A 1ZLWH 3B1UA 3RGVA 2BK8A 2HTLD 1VKXA 4JO5A 3O6FD 4ZQOA 3W84A 2HCZX 5DC2A 1NMBL 3U9UA 4F2TA 2WBJB 2WLZA 4KWWA 2VKZG 1YBQA 4IP4A 2IOOA 3HZKA 4B5WA 4HFWB 1EH9A 3VNLA 1NAL1 3O0LA 1F3TA 4H4NA 1CGTA 6REQB 2FWUA 2J47A 3H0TB 1NCJA 2X4UA 1HEZA 2V5JA 3NAAL 3O0KA 4GRSA 5HUOA 2KZ1B 4NSBA 1LWJA 2JJTC 5A8QA 4QWWC 4PMFA 1S8DB 2AS5M 3TJIA 3EXJA 2I5IA 3SR7A 1WTLA 4OZHE 3QUKB 4LL4A 5FF2A 4FQ1L 3KP0A 4IWWA 4LEXH 3DC8A 1KFLA 2BY2A 4IRJD 3NDZA 3LAFA 1HHIB 1RALA 4IFRA 3STCA 4HDIA 1TZHB 1Q7ZA 3TW6A 1WBXB 2FRGP 2H0JA 5SV4A 2Z7GA 1N2VA 2MNJB 1OAKL 1DCEA 2LV4A 4XHJD 1TVHA 2ZPKH 4CNNA 3IDXL 3A6CH 4YXLH 4R6UA 2BJMH 5I5IA 4ACZA 3A4EA 2YKKA 4M29A 3QULB 5D7SH 1W1TA 3MZ2A 5CGYC 2WMIB 4RDYA 2DOCA 4BKLB 4HU2A 3B2XA 5I0DA 5AW8B 1RERA 1BRLA 4QHNB 3CZFA 5DD6A 3EKZA 2Z92B 4PJEA 1E0UA 2Q7YB 3ZDYF 3D39A 1GYAA 5HGAA 5ANHA 2NLYA 5EDSA 3GVGA 4PC8A 2JQXA 3QEQE 2YLLA 4BGDA 1AO7D 4IBSA 1IHIA 5IFHL 4MAUH 2H41A 1IYXA 1QVOA 1KQYA 5F2GA 3RWHA 5H2BB 4QROA 4PRTA 2PEVA 2XQ0A 1XFPA 4UNUA 1ME7A 4JGNA 3L7FA 4LANA 4PRNA 1UZ8A 5HD8C 3CVHB 4ZS6D 1J0YA 1DLFH 4AM0Q 2PWFA 1NWTA 4JPWL 2H3BA 5L9FA 2Z1SA 5HHQA 2UY3A 5CPNA 2ON3A 2F6KA 1TQCC 3UMTA 5DQ9A 3MRIA 3SGDH 1JCTA 1WE5A 4I88A 7FABH 2ZG2A 4Q4IA 1YEFH 3QFJA 3TA4D 4JNMA 4APQD 1HZLA 4O02B 1I45A 1NGPH 3LEXA 4NGHL 4KWVA 5LBGA 3CMFA 4UFIA 3CQQA 1Q0XL 2DSWA 2ZRVA 5D2LE 4R7JA 1J87A 5A2CA 1MCFA 1L7TH 2WOYA 1WZ1L 4K5MA 2WMPA 1EUUA 1D2KA 1DWGM 2CBUA 4P2RE 4WDXA 1KJ2B 4RZ4A 1BBDL 1QWKA 3W7PA 3PHQB 2MPAH 4NZUH 1V02E 3OKLA 1M71A 1SEBA 2Z7UA 4WFGE 5F7UA 1WEJL 3ECBB 2Q86B 5DMGD 3SQLA 4DIXA 4I48B 2REQA 5CZRA 3UWYA 4A2RA 1Q9OA 3ULUF 3DX8B 1I3UA 3CFDB 3QPQD 4AXWA 3CNYA 4O58L 3EMCA 1HHHB 3V0TA 4TIMA 5H2ZA 2ZYRA 1S7SB 3HQOA 4ONGH 4KJQC 4EANA 2OMWB 1L9RA 2PWVA 3CAFA 2JK5A 2FGBA 1QHQA 3V6OE 1RJRA 1OD7A 1RZMA 4PJFB 3C2RA 1ILSA 5KZDA 1RZFH 5HJ3A 4NHVA 1SMOA 3B2VH 5IBLD 3HZYB 4JG9A 5IR1A 2BFVL 2YK1L 3TEUA 1KPVB 1QATA 5ETUA 2E27H 2B9AA 2ZZUT 1XCQB 2E9WA 1AZCA 4DLFA 4M93B 1N8ZA 3CB3A 1HQRB 3IKCB 3QDGD 3T2QA 1E5AA 4MMYB 3ULUL 3KBWA 4HK0A 3AS0A 1MFBL 1ACCA 3GAKA 4H8NA 2HVOA 1B0RA 3LKSB 5BOJA 3PZVA 1V7NH 1BVLA 3E9TA 3O6AA 3BW2A 1PZAA 4P23D 3V1PA 1FI8C 5LKNA 5HYFA 4OKDA 4HGWA 5EMYA 4Y4KD 2XKNB 5CINL 5MHSE 5EUKA 4PUBH 3VA8A 3BG9A 1EEUA 4F9LA 2NQHA 4Y5VA 1HP5A 1BVNP 1M7UA 4GBXC 1V6YA 2C19A 4A8NA 3DIVA 2BIQA 4KUZL 3GMQB 2H8PA 2C71A 4F0KA 1MCEA 1AE6H 1A21A 3IXAB 4UU9A 1HXJA 1EGMA 4C6LA 1KENL 4IU3A 4LCVA 2A74A 3CH9A 1OAYH 1KNOA 3IBEA 1XL6A 2GI0A 1Q6CA 2PYEA 3R25A 4MS6A 3GHEH 4HP5A 4Z2LA 3LPPA 4AD4A 1ZVYA 4M7ZC 1P2CA 3WN5B 5I30L 2V68A 3ML9A 5HHMB 3KPRD 2BVEA 3DLQR 5I0VA 4GQGA 1U8HA 4N87A 3NL6A 1UPMB 2BNJA 3ZR6A 5TE4L 3W73A 2HT3C 2FZ9A 2Y0SA 4ZFQA 3P5ZA 2FGLA 3MNMA 2V7NB 5TK2A 4YDZA 2NY3C 1UD3A 5EUOA 3RIKA 1G4MA 5D7IE 1KJVA 3SKNA 5C0DA 1NTDA 1IAIH 2RDTA 4OZIE 1AZRA 3ILEA 4PJGA 1EV2E 4U1NB 4S3AA 3IBOA 4RZKA 1PZ2A 4MX7A 5D72L 5BW7A 4BEIA 5CBIA 1TVDA 3W1RA 4B50A 1A8JH 5I24A 2GZXA 4N2FA 2KZHA 1AD0A 4ZZ9A 3US1A 5L2KE 1ZDQA 3O6LH 1U21A 4LAQL 1MNUH 3IJHA 2X42A 1UUMA 3MUGB 3VCLB 5ANMB 4DFIA 1R3RA 1CICC 4LF3B 4M3KB 4AL8C 4LL9A 2UY2A 3UYIA 5LNRA 2SFPA 4GVFA 1L6ZA 3EAKA 3F12A 4FA7B 2ARWA 3NACH 1E9YB 2C1GA 2P53A 3EMQA 4FB7A 3QZEA 1Z32X 2FEEI 5FYJE 2X53A 4J3OF 5LUMA 3CPLA 1EHKB 4NQSB 4PP2B 3KM2A 4PB9H 1DLHA 4FI7A 3QOKA 3QSTA 4HZ7A 3V10A 4UZGA 4CEUC 4FG6D 1INEL 1NWUA 5I1JH 4U1LA 1V51A 4N9GA 2JH2A 1XIWD 2ZUWA 3VXRE 4PAZA 1YY9D 4LQFL 4JZNA 3W9DB 3SJ3A 3K6OA 5EIIG 2KS0A 1A7OL 4L65A 4JR5A 4NERA 3VRLE 2XQYA 4TQPA 2G4EA 3KYNB 4M4RA 5DVLA 2HMCA 4JYFA 4ONFH 3LHVA 1PIIA 4KDTC 3KJ4B 4KRPC 1KBLA 2A85A 4G9PA 1JVLA 3MA9L 1BZ9B 4D0BA 2DZBA 4HV8B 2Q3AA 4FERA 3VKBA 2QV4A 3B2PA 1ENUA 3ABQA 5REQA 5FA4A 4FL4B 1Q3NA 1UACL 3C8HA 2NLJB 2VLKA 5FLVA 2OLSA 4MDIB 2X16A 1XR9A 4P4RA 3LM3A 3L5MA 3L9EA 3U0TA 8FABB 2OTWB 3ASOB 3RUBL 1P4CA 4W1TA 4WHTB 5IJVB 3TFKC 3OVQA 2NYKA 2CC0A 2GCYA 1N6QL 5EOCH 4HZMA 1P5UC 4N8VA 5IQLA 2UX6A 5D8JH 4UDTB 5K9QI 1E9QA 2DQIL 3W1XA 2RMNA 2WVVB 1KRBC 4EN3C 2OYLA 2HV5A 3BZJA 5J11B 3W07A 5LAXA 1FV1A 3MVIA 3TDFA 1ZBKA 3O3AA 4LV4A 1NDZA 1HKJA 5J56B 2HJKB 2O61A 1OY3B 5JHMA 1NL0L 1QTPA 1F41A 3FT2A 1V3LA 4XXCA 4AWJC 2DVTA 5F3HA 1PD6A 2KUTA 3EJQA 2X0YA 4A68A 2V6AA 4OHQA 5I3DA 4YWSA 4HIIB 1BYDA 1Y07A 3D69B 4DN4L 1V54B 2VC7A 4BFIB 1MCLA 4UIKL 4WXYA 5EIVA 3S6DA 2XWBB 1OOAA 2FO4B 4HSQA 1JVOA 3SE8L 4Y19E 4RKAA 1R4XA 4ALDA 1A4BA 4MDPA 3UJEA 3M45A 1UH2A 4R8WL 2ZOLA 1HH6B 3DV6B 3O3UN 4GRLC 3INPA 4GSQA 1MAJA 5FKPB 1LG1A 4FI6A 4GMEA 5DJCA 4JO8A 2OO0A 3MLZL 5DUPH 3X13A 1U8QA 4X60A 5KJRH 2EEDA 4OBTA 4NI3A 5E24E 2WLHA 3VXUD 4CD5A 1RJLA 3USZA 3DXAD 2GQAA 1P43A 3U7WL 2Y7NA 1IWAA 5JU6A 2WZAA 5I06A 5HHXL 5ID1B 4NFDA 3DIFB 4UIOA 3NTYA 3L5XH 1EEZA 3MACL 1R33A 3LYRA 2NR6D 5JO5A 2HRPL 4AIOA 3VNJA 1GGUA 1PZ5A 2PS2A 3FO2B 4IGMA 2BLEA 5EHFA 1YE4A 1M7DA 3VIMA 2G2RA 1WXZA 2FJUB 1GMIA 1GPFA 3SOTA 3FQUA 3TR9A 1PLCA 2IFFL 4C6OA 1I3VA 4TULH 3ESPA 3MWAA 4LSUH 1RULH 3STZA 5E0QA 2E86A 4U2YA 3PWGA 1JPFB 4RW5A 2IKJA 5CC7A 4GLEA 2HBVA 2IDFA 3G8RA 3U2CA 4OVUA 2QV2A 1OT4A 3RWIB 5F7MC 5E94A 3PL6A 3DYMA 1KGYE 3CJJA 4ESKA 1E4NA 5CMAB 2A1WL 1MCBA 1ZEAL 2HWZL 2UWEB 2PDKA 3SSGA 4HX1A 3GI8L 4AGPA 2Q3XA 4KRMB 5BXSA 3UIYA 3FT3B 2AJ3A 2WYZA 4QE4A 3CCHB 3QNZB 3WJLA 1EJSC 2JKRM 4GB9A 4HEPA 2OJZH 2PC4A 2I9TA 2H45A 3I2CL 1KCWA 2WMGA 3ITYA 5E1HB 3L3IA 1RV8A 1EVTC 2IADB 1QZNA 3MRCB 4IGHA 4ZFZB 6TAAA 1R3WA 4PRID 4N0UA 3RAOA 3GBNL 1ML0A 3VXGA 3QB7C 1F90H 2WMHA 4HUNB 1SJEB 1VKFA 1EDYA 2XDFA 3O6FB 3UBPC 1O5PA 5CPMA 2XIBA 2G30A 4DP2X 5LLIC 1QBLL 1WA3A 5GGVL 2RGSA 4K3DH 4KO6A 1GYLA 4JFDA 4Q2ZB 1VFAB 3FU5A 1JPSH 1IL1A 1SEQL 3GKWL 1QPXA 5EU6D 1MEXL 4Q8MA 3UBXB 4OJFL 4PJAE 4C6CA 1U8LA 4Y2DC 1F42A 3FQNA 2FJGB 3L3DA 2XZ9A 3QO0B 2E5DA 4PBEA 3BW9B 4LUSA 4BSVB 3L17A 4YNYB 4IRJB 3PREA 5AOKA 1IKNC 2HFGL 2AFNA 5CFAA 4LOFA 4JK0D 4JFXB 2DSVA 3KH4A 2EDBA 3NDOA 4RK8A 2JKAA 4LCSA 4R90L 3ZR5A 5B8CB 4OZ4B 1E0XA 3FQ1A 4HKBA 4PG2C 4PJCB 3VU1A 3M0LA 3E5BA 3O2WL 4DJDC 2IAAC 3F7VB 3FO1A 4RDWA 3QM3A 1Z5HA 1E4XL 4J4PD 1YN6B 4BKNA 4M61A 1TKWA 1IKOP 1F45A 4XQ6A 1EZVX 4ZCWA 3FB5B 1UIPA 3UPRA 1XF2A 2Z2BA 3OXRA 5C6TH 4FYQA 4PJXB 3HPJB 5HHOD 4F7EB 4XCEB 5I19L 4GW5B 2ASHA 2JMRA 4K8EA 3GVWA 2TRSA 1W72H 4U1KB 2WLIB 2CLRB 2OPCA 4Y9PA 5GJSL 1MREL 1SFLA 5I66B 2ZIDA 3KHDA 3TT3L 2E74C 1MUWA 1ZTXE 4FQCH 1O75A 1DUYA 3GTNA 4OLUH 2JCCE 4W84A 1AO7B 3GJEA 3L9RA 1NCNA 4QQ3A 4YSCA 4FTVD 5C7XH 4ADIA 1UPPA 2X88A 1J0KA 3BDYH 4Q74A 4AEIH 1X98A 4ZMOA 4GY1A 3LPFA 3IDYB 1BMGA 4M8RA 4CMMA 3DRQA 1VGEL 1X39A 2XUCA 4NRXB 3IVSA 4U7SA 2AJYH 1QPPA 1O5QA 2J1WA 4H8PA 4NM4L 3W2DL 3ARQA 5C0CA 5FO9A 3KPOB 1MCJA 1JCLA 4D2JA 1SVZA 3DVFA 4H8WC 3FU9A 5DT5A 5GZOC 4WHYH 3L2NA 3PAOA 1NFDB 5HI3D 4ZXOA 4XZUB 4L9DA 1JHTA 4PD4K 3DG6A 3UAAA 3OG3A 3T6XA 2A0NA 4EI6A 4YXHH 4PV9B 2BINA 4W7WA 1KV7A 1NARA 3WK1A 4RNHA 2PF8A 5AKSA 3WBWA 5GHWH 3S3DB 2WXOA 4L2YA 2D8KA 3M44A 3LTVA 4XZNX 2WANA 2EYSA 2PP0A 1QO5A 2E59A 5JZ7D 4OD2B 5JYMA 1WBJA 1EP3A 4XMKH 3NSFA 2VX7A 15C8L 4XOCA 3Q5TA 2VHLA 1PZCA 2NQDA 4PVNA 4KO5A 3KLHD 4D8LA 2JNZA 1O7AA 3VO0A 2AXFA 5CPSA 2XVNA 4KFMA 3MP4A 1MVYA 5AFDA 3LSCA 4DP1X 1J7VR 4WDTA 1FAIL 4OCXL 1OM3H 4MJ5B 2EKSB 3T8QA 1U3ZA 1SHMA 1HSAB 3OKKB 1DL7H 2QIIA 1Q4WA 1EXHA 1OV8A 4OF0A 1WWCA 2OWXA 3FC8A 1SFSA 4JZJC 3BARA 4PW9A 1QSVA 1LILA 2N3JA 4X4XA 3BL3A 2FH8A 5EC1B 3KCPB 1GGYA 4Z0XA 5F0PB 1JPDX 1DEEA 1IT0A 1F4YL 2J44A 2KHAA 1JK8B 5D2NB 1G7PB 3WIIH 4Q6YA 4MPQA 5JDJA 1DQTA 5DJYA 5M3WA 3SUTA 1GOXA 3VXMD 1B3IA 1WAPA 1CS6A 5FUZH 3QDGB 4FALA 2XBZA 3HR5A 4GYKA 5KS9A 2WVSA 4N9CA 5DFAA 2YCJA 4G56A 3AXXA 3EXTA 3QFGA 2J7GA 3IVKB 1PV8A 2O6FA 2BASA 4Y8AA 2H9GA 1NGXB 2QDEA 3SDYH 2R1WA 2NX1A 3BO9A 2AABL 1QTSA 3BUIA 1VCBC 4GS7C 1RPUA 1C08B 1XIGA 3FEQA 3C8DA 4UWMA 4MA1C 3TWCH 5F3BB 4PS8A 2VRAA 4Y4KB 1QLEB 3CYJA 1ORQB 1JV2B 2OXHA 1HFBA 4IP7A 2P47B 3GF8A 3C2OA 2DZSA 4KK9D 4B90A 1W17A 5K1JA 3ZX1A 5CFHA 3OJMB 3MP3A 1EFZA 4Z6AT 1A4KA 2GJZA 4JFED 1MHPH 1RPXA 4AZHA 2I32A 4HC1A 1O60A 4KITB 3NR0A 5GGRA 1INQB 4CW1A 1H09A 3KDPB 1QP1A 3ZE0E 3LXUX 1Q94A 5CLYA 4U1MB 3GXUB 5JHLL 4LARL 5T1LB 5C08E 2C3HA 1QQDB 2AVFA 2EF9A 4XOAA 1BDYA 5BZZA 3ARVA 3F1QA 1CBVH 3H6AA 3T4YA 4R26L 3KPRB 1FORL 5CUSH 3UBHA 3NPWA 1J10A 1BFOB 4Y16B 1QK2A 1NSNH 4UDUB 3BAKA 1MXSA 3EXRA 2Q09A 3ARGB 3IDNB 2Z1PA 4GY0A 2Y22A 1AR2A 3O2VL 4XNQA 2F84A 4LSVH 3EHBD 3WMLA 5D1ZC 1NBZA 4ZQMA 2B7OA 5AL8A 4UMGA 4NO0A 5H6HA 4PMYA 4TUOB 2H26B 2W5FA 4HKZB 3BH8B 1R6WA 3NDZE 3NGBB 2VENA 4X4YA 1DIOA 4NQCB 4DOHB 4OLVL 4XUGA 1ZA6B 4X3ZA 3BZ4A 2WWKT 3L21A 4R4NC 1ACYL 3LD5A 2B59B 1JHLL 1Z66A 2NX5D 2WOBA 5G5DA 4UNKA 3QPXH 4XO6A 5DRNA 2Y70A 3FONA 4C1NA 2WGXA 1ORSA 4AG4L 5F1IA 3ELAT 1RLWA 3D06A 3JV6B 1TPH1 4W6WB 2ENYA 1ELSA 4AMKL 3MJGX 3P0GB 4REQB 3IN0A 3CQFA 2OR7A 1O5RA 1CE1L 4TL5A 4N85A 3O0RH 2B7NA 3JUZA 5FGCE 2B16A 3L3OB 3FCTB 2B15A 4PCTA 3D09A 3R6IA 4M5YH 1V0LA 4TSCH 1R34A 4OV5A 5HDBE 4GY4A 3ARDD 3Q8CA 4RLIA 3D39E 1IEAB 1TPDA 1F58L 3A6BL 3OGOE 4NKOB 2DQFB 1MPAH 3OZPA 4X83A 2WIMA 3RBSA 3HC3L 2F15A 1B30A 1XIWB 3LD8B 1S7UB 4M80A 3WLRA 5AC5A 3LRKA 1P7KB 4GG6E 4XNMA 1UR8A 4F0HA 4ZDHB 1M05A 4EF8A 1R46A 1GJIA 5L6UA 4MSWB 3EYOA 1Q6EA 5FHAL 2BWQA 2J88H 4KJWC 2PWDA 3AFBA 1JFQL 1GKEA 5DEZA 1UB3A 5DURD 4WEUD 3UGEA 3BQUD 1OK4A 1IXOA 3U30B 1BBJB 4K7PX 2HG5A 1AL7A 3FS2A 3BK0A 3QFJE 3KRSA 4TVCA 3FH5A 1XGUA 1AW1A 4Q8PA 4FABH 2CCVA 1XVSA 5JXED 2ATMA 3H7VA 3CB8A 3LBCA 1LO0H 4FHKA 5L88L 4PWIA 2ATKA 3WX7A 2DWDA 1W3LA 5G2IA 3FPYA 2WXHA 3QVQA 1QUMA 4FC3E 4B3LA 1TCRA 3T7VA 2AMUA 3H2WA 4I9JA 4A2HA 3S2NA 4ODTH 5D9SB 3I02B 1K03A 2J27A 3NVQA 5DANA 1FBAA 1E2ZA 2G37A 2NUPB 5IJCC 4AV5A 1ZLPA 4R3SA 4P3CH 1N7ML 1B6DA 2CHDA 1GYWA 4JIEA 4JFFE 2NNAA 4CQBA 2YL8A 4K9JA 1S7RA 1I7RA 1Y0LA 4H4IA 4Q7DA 4YSDA 4UNLA 2VXUH 1UM4H 4N6RB 4E9VA 1TVNA 3PRZA 4JREB 3GSVA 3AABA 1J9TA 4AXKA 2R29H 1V6WA 3O11A 4M5TA 2W80C 3LZNA 4HHGA 4BI7A 3RZCB 3RWJA 3SCMD 1WKEA 3H42L 3L23A 4EACA 2V8MA 1P4BL 2Z7ZA 3BVDB 1Q6FA 4IUGA 2XA8H 4XC1H 1IC0A 2CK2A 2BOEX 2VLRA 5MEND 4NQXB 1UASA 3QDAA 4PEKA 2QSTA 4J2MA 4HNLA 1VPXA 4L29B 3BLPX 4BR1A 2R9HD 1RZ8B 3WO8A 4UAOC 3T6QC 1Q65A 1Z9PA 3SKOB 4WU5A 1ZVHA 1A4JA 1KB5A 5E2JA 4NKIL 3RRQA 4XNZC 5FGSA 3VM5A 1JP5A 3WENA 1G0YR 5D71H 3ENLA 4A4AA 1B4EA 4E3TA 2WQXA 4JQIA 4ISVA 1HDMA 4FQJL 2HNEA 3H24A 2PCQA 2ZCZA 1FNGA 5EZIL 3S1WA 3MJYA 2FCBA 1RK7A 2ICCA 3EYPA 1OAQH 3UJIL 3T77A 1IARB 4WO4C 4QDGA 2VLJA 3UPMA 3OQ8A 1VP5A 2Y1YA 3KRZA 5AAWA 3H56A 3T0EC 5IK3B 3SY0B 5E08H 4WX2A 1FGNH 4ZYKA 4NN5C 1GS6X 2BS9A 4POZD 3ZWSA 3CUPA 4PBVC 1Q1PA 2Z25A 4FIRA 1X5MA 3N9GL 3IE4A 5DWUL 1ZLSL 5CBJA 2FK9A 2UY6B 3VXUB 4LSSL 2A38A 3DXAB 3HJEA 4KMQA 2V67A 3BOLA 1FZOA 1TE6A 4XCYA 2BDQA 1ZRQA 1HU8A 5AW6B 5DHVH 2XJLA 4Z7VE 3SN1A 3ISWA 3VXQB 4HWEL 5FKAB 1JUKA 4CAGA 5SWZD 5JIQA 2PYEE 2ZG3A 4HK5A 3OKMA 1FG2A 1RHFA 3NURA 3VKDA 1TKKA 2WKJA 2NV9A 4MKVA 3VJ6A 1NOFA 1OAJA 3ZRCC 1MDLA 3SKJL 3RGHA 2J78A 2WCPA 1KBPA 4QGYA 1EEXA 4PLOB 2Z26A 1I7ZA 3C6LC 3KS0H 5IB1A 4FXGC 2A6IB 2AQPA 4DKFH 1AQKL 4KUCD 2ITCA 2RD0A 3JVGC 4H9YA 4G3YL 3FTVA 3QFWA 4YPJA 4W86A 5EUOE 4FIQA 3D4CA 3FTUA 1BZ7B 4GVIA 2UVFA 4NOFA 5EPMB 4PJGE 2IWFA 3OAYK 1DJYA 5LB1A 3OHIA 3QCUH 2GJRA 3UCQA 3GRBA 4FNLH 5EEWA 3L08A 3EGDA 4PRAA 3UYRL 5ICZB 1UR3M 1F8MA 3CZEA 4A8IA 3VIHA 5MEQA 1AHKA 1BVKB 1YXCA 3FBKA 1UURA 2XZQH 4Q8NA 3DX6A 4KGJA 4U5IA 1C9SA 3DFYA 1DQKA 1S5HB 2F19L 2WLKA 2RQEA 2R0ZL 1YEKH 3SRDA 4QOKA 3WS3B 4DWSA 2X89A 2J7DA 1UCWA 4AJWA 4OV9A 1MJ8H 1HHJB 2CKRA 4KZEL 1UG9A 4LS0A 3TVMC 3EZ8A 2V0TA 4XCFH 4ANWA 4M6NL 3QXUA 2OZ4A 4JG0L 3U7YH 3E96A 5D5MB 1CJYA 2AJVH 5IV2A 3IU4L 3SCQA 1AKJD 4OIIH 4QRTA 5DQJA 4M1CC 3SJVE 2C3VA 3RA7L 3WKZA 2AEPL 2Z4TA 3DDFA 5I76A 2BX5A 3C6SB 3IJLA 4KEMA 3ZKMC 3ITXA 1S2WA 2DIBA 1V4YA 2W9MA 1A6WH 3Q13A 4YIQA 3GDBA 1G7JB 4AKOA 4DF1A 1SJHB 1EJXC 3CE1A 2H32A 3PJSA 5FAAA 4PJBF 1PCXA 4Z3JA 4CVWA 3ZQXA 3WLBA 4IX2A 5DD5L 3E49A 4JX6A 3STEA 4F1SA 4LF2A 4KDWA 3VE0A 5J8LA 4G8EB 5EF2A 4JTJA 5DJ6B 1RQEA 1BQKA 2JBMA 1KCVL 4RGMB 1DVTA 3PS7A 3BWAA 4KVCH 4PGDA 4FNUA 1JHKH 4P8WA 1IAII 1A64A 4HPOL 2WXRA 4RSYA 2ZUNA 3O6MH 5CP3A 2R8WA 3UBXI 5HHOB 2VLKE 3S4SB 3W81A 1KBVA 5JLZA 3GDMA 3BV4A 4HA4A 5E8OA 1MIEH 2OL3B 2TMDA 5GGQL 3M8OL 2W65B 4O1FA 3VFOB 1VERA 3RX3A 1WP6A 2PGRA 2GQ8A 4P57A 1KBWA 5DEFA 2AC0A 2ZSWB 4HUKB 4FTVB 4FFWD 2Y5TA 1ZQ5A 1BEYH 1W9UA 4G80B 4PRHD 4O8RA 1G4EA 2PDJA 1EWDA 5E56A 4IBUA 1NCCH 3L2LA 4ODWB 3KPNA 2OV0A 2OMUA 3KBSA 4HA1A 3HE7A 4PTTB 3VFCA 3WH5A 5E7FA 5DFTA 2V2HA 1JCKA 1WBYA 1FH5L 3VIKA 3VG0L 2ZNWA 2BSBA 4Y6GA 8CGTA 4GSRA 3U9IA 1BAGA 1T1XA 2PPEA 3P0YH 3FK4A 4CCDA 1CXIA 3QNYA 3ZQWA 1BWWA 4QNPF 1Z5LA 3PDOA 1W3IA 2OOFA 4AEFA 1AR1D 1FN4A 4W4OC 4FXKA 1EFXA 1CLYH 1R3KA 4Y2LA 3I6TA 1YSOA 3FJNA 3H9YA 1I1AA 3WNMA 4YZFE 4HZ6A 2ODOA 1Y1DA 5CJOL 2EO7A 2MNWA 2CCRA 3QP3A 4NX0A 3U6WA 2GIXA 3V0AC 1IAKA 4D6FA 4XCCL 1SBSH 5E2VL 2QVKA 2G41A 4AGOA 1NFKA 5T8GA 2Y7MA 3SYAA 4FQXD 5I8OL 3MRMB 1G67A 1XJBA 3O9WA 4XZ4A 3DCPA 1JF1B 2AJSH 3G08A 1CF1A 3ZJ7A 1HWWA 4M56A 3FO9B 4P5UA 2QJIA 1UQSB 4MBRA 1H7NA 4DVRH 4JHWH 1XXFC 1CN4A 4TNVF 3AZTA 2PB1A 1R5WA 3GMLB 1V7AA 3BVXA 4K7PH 1ASPA 3GFZA 3PTDA 4L4PA 2QLVB 3T2LA 4L8CB 4C6MA 4RGOL 3Q01A 1EGJL 2OXNA 3RDTD 5IT2L 1EEPA 1YYCA 5IOPB 1IQDA 2Q8BH 5KYXB 2HT4D 4M48L 2YN5A 4X7SL 2JB5L 1DWAM 2UY4A 1PD0A 4P2OD 1A5CA 3LS4H 2KBGA 3URAA 2VXVH 2CBQA 2KYIA 1L9PA 4GAJL 1L0YA 1G6RH 3N43B 1U6AH 3VXMB 3H9HB 1HJWA 1JNEA 2NRDA 3PWJA 4H5SA 3T08A 4D1IA 2FECL 4LHQB 3VIIA 3DOPA 1MWAA 7XIMA 5FIEA 5GGSB 1FCVA 5I6KA 5FAJA 1RZIA 4UTTC 5DF0A 1MCDA 2WQUA 5CJ8A 1RZ7H 3PGCB 1V8HA 4Y7MA 4BEUA 3FUMA 3QPKA 1Q13A 3I6GB 4XKYA 2CGRH 4JFYA 2NY4D 3KTSA 4AOFA 1LOLA 4P59H 1NP0A 1U3NA 5C09D 2WMKA 2LU7A 4WEEA 3U4BH 1G7HA 3EA3A 2QSCL 4DELA 4NQDD 4JS3A 1OT1A 3Q44A 5EGRA 3LEYH 3A3HA 4GISA 3ULVE 4XUYA 5DBUA 4JFEB 3QW9A 3CN1A 4Y88A 5F4WA 2WZMA 3EIFA 4X4ZA 3L48A 2PTTA 1BPLB 3GZPA 4KTGA 1SY6L 3ALGA 4Y1AD 2O5YH 5KANI 4QSHA 1ZE3H 1FO0H 3QQ3B 4K23H 4W9EC 3FCGA 2VW7A 4JGJA 3TYZA 1TETL 4TNWF 4IHOA 4KKPA 1BQGA 1SU5A 1MLCA 2DAVA 3SW6A 4BUHA 2KAUC 4C6QA 3MRKB 4N0UE 5I3HA 3HNSH 4YFEA 1MUJB 1PY0A 4AV4A 3NQIA 1GZQB 3T04D 3IF1A 1ZV2A 1RQ5A 3QZAA 4R0LC 1N4XL 4N2GA 3AIBA 4P4KD 4JFDE 5T5NF 1N8WA 4B53A 5DHXB 4IBQA 5G2WA 1ADDA 4Z7OE 2PCFB 3MFFA 5EO1A 4I18C 5E9AA 5JPNC 4RESB 2LLLA 4GG6A 5DK0B 4CEXC 4KXBA 3P9LB 5DR5H 1GZJA 1KJ3L 1VJSA 3X11B 1D7KA 1KN2L 2QJJA 4LWWA 1P1ZB 4I5XA 5AB0A 4MB1A 5LN4A 1YEJH 5C0GB 3DIDA 4PFHA 1TJHH 3NH7L 3QRBA 2VX4A 4UQ2B 1D5XA 2LVCA 2WHVA 1IE5A 3SB3A 2PMZA 5I75C 3IPWA 3QIBC 4LNYA 4GT7A 3OJVC 1UC5A 5LGKA 5IESH 3G3MA 3L4ZA 2ZC1A 1GPOH 2X4RB 5MHBA 3TV8A 1E50A 5FEXA 4F2MA 3P8JA 2PO6C 3OVRA 1HYSC 2NX5B 1W3HA 1T04B 4NKMA 4C6KA 1ZFJA 9PCYA 4UCGA 3OLEA 5T3ZL 3QWQB 3B8YA 1DQQB 4TUJA 1WZLA 1ZJBA 1PJ9A 1RD5A 4YE4H 2NUTB 3SUVA 1HKFA 1EJFA 4JFFA 3B6SB 3ARDB 5LXGH 1FRBA 1EHLH 3KL0A 2QPSA 2WNGA 4Z7UF 1GGCL 4IRSD 1YNKL 4QLJA 2OELA 3T0WA 4TXVB 1I9EA 4QHKI 4H41A 3GYCA 3QZLA 1JGEB 3WIFA 5KVMC 3GTIA 3NL3A 2FR4B 4HHHA 4PGLA 2G5RA 4C6NA 3SBRA 1NC2D 3GSNA 1EJTC 4DO4A 4GXVH 2CJ3A 4AD0A 1W5QA 4NNBA 1W9DM 1OPGL 1X1ZA 5IMMB 2MKWA 4I13B 2H2SC 5DJXA 3VRJA 4OU1A 1U93B 4AG0A 1KV3A 3JWNC 3D5OF 4WTZA 5DURB 5C0CE 1K77A 3AMKA 3BQUB 4U5KA 1ZA3B 1XCWA 1KOAA 2GSGA 5C7ZA 3FOKA 5BRZD 3UZVA 1R0MA 2G5BA 5CEXA 2V9RA 3EFOA 3WTYA 3U2SA 1UQZA 4IRZH 2BHUA 4Z1DA 4YDJB 2MQGA 1Q6OA 4U4IA 2XG5B 4FQQB 3IANA 1OIMA 5HMDA 1YDPB 5HBFA 4O4YH 4M6UA 4OF3A 5KZEA 3UESA 2W27A 4DJFA 3OLIA 1XWYA 1I8IB 4ZJ9A 3KBPA 1CURA 4HQQL 3WMPA 4M6MH 1JCYA 5KYWB 4FFYH 4Z3TA 4F0RA 3IETA 5CILH 2WBJC 1PX3A 4NNYB 2O6EA 2N1KA 4R83A 2CKBB 4E42A 1GS8A 4OUOA 4QMEA 1CT5A 3L2MA 2CWXA 4N2OA 1X97A 5E4IA 1C5CH 5G2NA 3VNZA 3K1GA 1WKYA 2ZUYA 5J9PB 4BF5A 1WFIA 2OMVA 3LPOA 2OSYA 4AMAA 3VSQA 5AW2B 3GBDA 5LXVA 2X7LB 1WOBA 2BDNL 1BXNA 2APTA 4MXQC 4URTB 4W9GC