4NXKA

Crystal structure of abp-d197a, a catalytic mutant of a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
431
structure length
431
Chain Sequence
b'ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
molecule tags Hydrolase
source organism Geobacillus stearothermophilus
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
total genus 149
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nxkA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nxkA01
3UEQA 4O54A 4WX2A 3MP5A 1F6PA 4CQAA 2Z1KA 1P4CA 4B9YA 1BWKA 2CZFA 3WJZA 1LRNA 4H8UA 3OLDA 4OBTA 2BHUA 1E3XA 3GXTA 4JTHA 2X1UA 4AHPA 3W74A 3BLPX 1SUXA 4B9ZA 1KFCA 3OVQA 1TTQA 4JX5A 3LRMA 2B7NA 1YTKA 5L6UA 1XV8A 4J9JA 4S2BA 1WZKA 3DHDA 3LBCA 4HPJA 1FWTA 5HXMA 1O5XA 5AHFA 1JD9A 3ANYA 2ZDRA 5CZTA 1XFBA 1KXQA 3IGXA 1JIBA 1G94A 3VGGA 2OX1A 3TONA 3R2GA 5HNRA 3C2EA 2ZX6A 4H3DA 4JFUA 1FDYA 3Q2DA 5F2LA 1C29A 3VSUA 1O5KA 2DJLA 4OWGA 5T26A 4LT9A 3SECA 3LCGA 2ZX9A 1BSIA 1UCWA 3TSMA 1FBAA 1JI1A 2CZEA 1IXQA 3WELA 1KXTA 4UTWC 2WOQA 4GUFA 1WQ5A 3C61A 3EX4A 2YCEA 1BVNP 5KSWA 1WZMA 5BRQA 3M1ZA 1JD7A 1L2UA 3N9SA 4N9DA 1QI4A 3KRZA 3IV3A 3V1PA 5J5DA 2VRKA 4MFDA 4UQDA 2W79A 2A0NA 3IEBA 3IIXA 1NSJA 4BK9A 6TAAA 3NM1A 4LQ1A 3DX1A 2E6AA 2V82A 2WNWA 4TVUA 3PG9A 1TQJA 1UKQA 2AAMA 1MO0A 4XBKA 3L5LA 4PH6A 3VNYA 1QW9A 1YDVA 1W0MA 4JTFA 3P62A 2A7RA 1KM4A 3GDKA 3PSVA 4RV8A 1Z32X 3O16A 4LOCA 3I68A 1UOKA 1ZALA 2C3ZA 2X2IA 4KMQA 3LTYA 1MW0A 3BUIA 4UUIA 3KOFA 2FB2A 3O6CA 3UWYA 1OFAA 1DJNA 4PFMA 3RF9A 3QW4B 5CXPA 4CQ9A 2ZRZA 4XBSA 2Y7DA 5AYXA 2VEPA 5D37A 4MKNA 2C1HA 1FCQA 2VFEA 2ZZ1A 2NXHA 1N8FA 2O7QA 1WA3A 4BI5A 2J25A 2YW4A 3T4CA 1XUZA 3CZGA 3LPPA 5AC8A 2PWHA 1U33A 3P5ZA 2GJPA 2ZX8A 2XFWA 4JX4A 4HNTA 2WVSA 4AF0A 1BKSA 3LGEA 1KGXA 4ZQRA 3UWQA 1BVZA 4MIMA 4I7VA 3OA3A 5F4WA 1SO6A 3FOKA 3TQKA 1TQTA 1D3CA 4XKYA 1OSEA 1SR9A 2A6LA 1EP2A 2QV4A 3W76A 1ZAJA 2NUYA 3WK1A 3HJEA 4A22A 1W5QA 5E6ZA 3M5YA 3N2MA 3TXVA 5L9FA 1H60A 1GVIA 3N2XA 1JRBA 3ABSA 4Q4KA 3UWUA 3FKRA 3L0KA 3W72A 2D3LA 4N9CA 1P5BA 3LHWA 4TU1A 3G1YA 2ZUTA 3BSGA 1QO2A 1LWJA 1KM0A 1JDCA 4MLRA 1VLWA 3BCFA 4J27A 4O0KA 1ZY9A 3W07A 5FESA 3ABQA 1DJQA 4M7SA 3L67A 1RQEA 1LORA 5FEXA 4CLMA 1RP8A 3A5FA 3UWVA 3WK2A 1MW3A 1YXDA 2VFFA 2Y70A 5AHIA 3WNPA 3PVFA 4K37A 5DCEA 4A21A 1CX9A 4AW7A 3MHUA 2WSKA 4UR8A 1VPXA 1R47A 2QMKA 1X8FA 4ICNA 3LERA 5G1TA 3NNTA 3DAQA 4DF1A 3DFTA 3S8HA 1KM6A 3ZR6A 2Q3RA 2WVUA 2A7PA 3QPYA 4DO4A 3QMSA 3W1QA 1IXPA 3DFNA 1CYGA 3MUXA 3S9YA 4ONVA 4JFWA 3LHUA 3A5VA 3FYPA 4UTLA 1GWJA 2WO5A 1W3IA 1UH2A 1H62A 2UV8G 1I4NA 1M53A 3IVTA 3BW3A 3VM5A 1LDCA 3RLVA 2QCHA 3O8AA 4AEEA 3LCXA 3QPZA 4IMCA 3WK0A 3ZSTA 2Z2UA 2Y6ZA 1HWWA 3NZ1A 2V9DA 2WJZA 3IVUA 2DIEA 4JTIA 2C15A 5EL1A 4WY0F 1T99A 1XKYA 3EX3A 4M6QA 2X1RA 4R7JA 1WAUA 1XDLA 1TREA 1G4EA 4IPIA 2QCGA 1KGWA 3B04A 2YZRA 3EJQA 3S2CA 1ZENA 1BPLB 4OU1A 1QOQA 1EO5A 3DI0A 2VKZG 2J88A 4EWND 1PCKA 5BRBA 1XXXA 3W7CA 3UZJA 4CCCA 5LGXA 3I7QA 2C6QA 3AMLA 4NNCA 4UNLA 2WVVA 3W1LA 4BWLA 1OX6A 3CZKA 1GJPA 1MXSA 3SZ8A 1GVQA 2J9YA 4UQBA 3BVJA 1DV7A 2GJRA 1KWGA 1R30A 4EIVA 1KM2A 1C9DA 1ZHAA 4UR7A 5AN7A 3U6WA 1X6UA 3W7GA 1A5CA 2YGYA 5K4XA 1J0IA 2XVKA 2HS6A 3UY7A 4UQCA 3BG5A 1E51A 1AL8A 1TYGA 4WZHA 1QPKA 4J3VA 2F7PA 3ATZA 3I7SA 1KXHA 1XCWA 4DELA 5HJLA 3K8LA 3ZWTA 1O4UA 2YOCA 1OF6A 3MI3A 3W71A 4XQ6A 4AVFA 1QPNA 1GVRA 4X9SA 3VFLA 5A2AA 4EF9A 4O1DA 3QMRA 1H63A 1WBHA 3M43A 2XN0A 3LB0A 4O17A 1MEWA 3L4WA 3SI9A 4GNJA 1K8ZA 1H50A 1LLWA 3VMOA 4U2YA 4IMDA 2WCSA 3CT7A 1Q6QA 1LM1A 2FTPA 3ZWSA 1JCXA 1F5ZA 1TMHA 4UFHA 3EJTA 1LOQA 1E43A 1YTEA 4Z0JA 2GQ8A 3BGGA 3OEXA 3T44A 2VT0A 2D2OA 4LV4A 3UYCA 1JUEA 3W7MA 4E2OA 1SFLA 2BTMA 4CCDA 2B7PA 1JVNA 1GJWA 3ZT7A 1AK5A 5A5WA 4X22A 1LROA 3L5AA 3A4AA 2DZSA 4AAJA 1BTMA 1VCVA 4DBDA 1TTPA 3TSBA 1KBIA 1ZCOA 3N14A 2Q8ZA 2V0TA 1A5SA 3HO8A 3MI6A 3W7RA 4AEOA 1TJPA 4JNMA 2CLKA 4NJHA 1DQXA 3QW3A 3PUDA 1LOSA 1UD3A 2QUTA 2QDHA 3UD6A 5BW6A 3PBYA 1DBTA 2A4AA 3BAJA 1R75A 2QDGA 3L66A 3ZT5A 4CNOA 3QF0A 4YLWA 3PB0A 3W7QA 4HNVA 5EPDA 2VXNA 1SZGA 2YFNA 3N9RA 3CEUA 1ME8A 3CZSA 3W6YA 4UTIA 1GPWA 3MHGA 3BAYA 4GBUA 1XBXA 1HFBA 4IXXA 1QDSA 4UTMA 4NX0A 4AEFA 1HO1A 3GKFA 4XUGA 3TSDA 5EY5A 1RD5A 4JTGA 4YL2A 1FWNA 1TPEA 2AMGA 5K9XA 3NQ6A 3UG3A 1V3MA 4DO6A 1H7XA 2Y61A 5TIMA 3BG3A 4MY8A 3QM3A 3KLLA 2WSRA 3IVSA 4ATWA 3UWWA 4O8RA 4Z1BA 3UPBA 1TCDA 5H2ZA 3WJXA 4H8VA 5DFAA 2NXGA 3P82A 2ZXAA 1R2TA 2PWDA 3WEOA 4MLJA 4WY0B 4E38A 2TYSA 2WVTA 3ECQA 1P0NA 4ML9A 4JD4A 1K02A 4N4QA 3NEVA 4OHQA 2RH9A 1BG9A 3HGOA 4AF0B 2OSXA 3ZO9A 1KM3A 4O53A 4GI8A 3M7WA 1WO2A 2A5HA 2Y63A 4UQAA 4UFKA 4BFAA 3L2LA 2J27A 4GWEA 3LRKA 1CGTA 4AMAA 1K03A 4CNPA 2ZRXA 4BF9A 2G95A 2DJXA 3SW6A 4UMBA 4QAWA 3D0CA 3EX6A 3PM6A 1CGYA 1LTDA 1EHAA 1F74A 4LRSA 4HNNA 4K7VA 2LLEA 3GBEA 1WYIA 3DKJA 3GYEA 3OVPA 2QPUA 2NV2A 1AMKA 1FCUA 1JXKA 2D3NA 2V8ZA 4K8HA 4FNUA 4NXSA 1V5XA 4ZQMA 5H91A 3WK3A 1I2OA 1GTEA 2F84A 1KWKA 2QCDA 1KFBA 1TPVA 3W7PA 3ZS4A 2YA1A 3OLGA 2Z0IA 4FXSA 2ZRWA 4GFSA 4FNRA 3B8DA 3DENA 1CPUA 1YLVA 5E6YA 5EMYA 2ZRUA 5CZSA 4FIRA 1HO4A 1LRQA 2FE0A 1EUAA 3SFKA 1QR7A 3RILA 2EF9A 4H8HA 2Z1BA 1TCMA 2YW3A 1TQVA 2E5CA 4LUIA 6CGTA 3LTSA 1WV2A 1GOXA 5BNKA 4P61A 2VC6A 2AQWA 3TTYA 2R8WA 5DBTA 3W7HA 2C0AA 3W83A 4OV4A 3GBDA 3G1HA 3KL3A 1J5TA 1IXOA 1VFUA 2E8ZA 2DU2A 2NX1A 2C14A 1TTIA 4PEEA 4UTJA 3L2MA 3L21A 1Q6LA 1EX5A 2Q3OA 2BY3A 1MWOA 5C55A 2P0OA 4XTIA 4JYEA 2ZZ7A 3MBDA 1K8YA 1PE1A 2OJPA 4XWUA 3R5EA 1OFDA 1SFJA 3EWZA 5K9DA 1K3UA 3USBA 3NQ2A 3NQEA 2PURA 2FYVA 2ZZ4A 2IGTA 1SSDA 2TRSA 4IUOA 5CPOA 4LVFA 3WFAA 4UZUA 2J24A 3NGJA 4O1BA 5CPNA 1V7YA 4NZFA 3BLIA 3UWZA 4J28A 2PCQA 3VO0A 1SU5A 1SO3A 4KFNA 3DZ1A 1G67A 2ZZ5A 3GNNA 4NUWA 2DH2A 1QWUA 2FLIA 1A47A 3CTTA 2O7SA 2EEXA 2OW6A 4QM1A 1FX6A 1I2PA 3DBPA 1XBVA 1SSGA 2EO7A 4JTJA 3BVXA 3TXZA 3WEMA 4KFPA 4LS1A 5CSSA 4LC8A 3W75A 2QCFA 3TU9A 2PWEA 2ZE0A 1WXJA 1XL9A 8TIMA 1QW8A 3OG3A 3TCEA 1HXKA 3I65A 1C8QA 1FQ0A 3NQ7A 2VENA 3HG5A 4JEQA 5DY2A 5CGQA 4UTUA 2EACA 2JK2A 2A1YA 3HPSA 4JTUA 4MB1A 1BLIA 3T78A 3V75A 1NVMA 1VFMA 1QMLA 2VUYA 2E5BA 5BMWA 3GAYA 4KKXA 4TO8A 2QJIA 4A2SA 2V3EA 4OJYA 2JKAA 2G5WA 1XCXA 2VOMA 4EOUA 4UCGA 2CFFA 3NQMA 4ORMA 1A53A 4E2DA 3M0ZA 2J9XA 2C18A 1XD1A 3B0UX 2PE4A 5U4NA 3P84A 3UXDA 1OF8A 2OYMA 1TRDA 2C16A 5HULA 4D2JA 1XGZA 3UG4A 3P81A 1TQUA 4UFJA 4AYSA 5C5YA 2QUUA 1V3LA 2BLEA 3CGTA 1IV8A 3P5YA 1B9BA 4O4WA 5I3HA 3B06A 4AMWA 5F4XA 5IBXA 4J3WA 5FI8A 4Y8FA 2BY1A 3NQGA 3QFEA 5AHEA 3W7IA 1AG1O 2F7RA 3I7RA 1JG9A 1AW2A 1IF2A 4WSKA 3MO7A 3G3MA 1G4PA 4AH7A 2A2IA 4MJMA 1KBKA 3NPXA 1VCFA 3WDHA 2H90A 3PY2A 3T7VA 1EO7A 2FGZA 4FNPA 1QCWA 4M6VA 1JDDA 2OW7A 1JFHA 1EPXA 1HG3A 2E09A 4E0CA 3KVMA 2JGYA 2HS8A 2QCMA 3LHTA 1VYSX 2VFIA 2WKGA 1T0OA 3W85A 5HWMA 1XH1A 2WKJA 5HR7A 4ZQCA 3LXCA 3LXBA 4WLCA 1ZS2A 1OX5A 1OFEA 3H55A 5CSRA 1KV5A 3MJYA 5IM51 3VMNA 3RMJA 5I5RA 3UNDA 4LS0A 1ADOA 4BWLC 3DGRA 1NOFA 1J0HA 1GVOA 3DX3A 2VFHA 1QX1A 3BUQA 4GO8A 5SWUA 2QAPA 4NJGA 3KFTA 1CI1A 1RZMA 1SZEA 2BWGA 2X2JA 2DIJA 3NM3A 4LPCA 3G3DA 2DZVA 2FH8A 1U83A 2F7OA 2DORA 4ADTA 4H7VA 1TPB1 4NVTA 4UTWA 2OYLA 4DXVA 3N73A 3G22A 3VGEA 1UJPA 2WPBA 1R46A 4JR5A 1ZAIA 1SMDA 4QITA 5DBUA 1GYNA 3W84A 4KWWA 1CIUA 2WCGA 3EJRA 2YYTA 4AHOA 3HBLA 4FX8A 5EYWA 2ATSA 1M7XA 1VR6A 3GX9A 4LXFA 2YKKA 1ICPA 5D2VA 4OE7A 3KX6A 1TO3A 2AGKA 1KFLA 3Q58A 4O50A 4OQVA 3HG3A 2F7FA 2PWFA 3TIMA 1R34A 1I45A 3QRHA 3TMQA 2ZTKA 5ABTA 1KM1A 3C2VA 3A21A 1GYLA 3BLEA 3F4WA 4AXKA 3BW4A 1B0IA 3W2LA 4HNUA 1J0KA 3WNNA 3HGJA 3NAVA 2FB3A 2ABAA 4JTKA 3H54A 2NX9A 1PS3A 3NPWA 3C3NA 3E0IA 3EKLA 3NG3A 4NXKA 2ZZ6A 1OFOA 4RX0A 2A21A 1KBJA 3DX2A 2ZBTA 3ZT6A 4IOTA 4GUGA 2I1OA 1FWRA 3VE7A 3PF3A 1GG1A 3GNDA 4O4VA 1ML1A 3VGDA 3VGHA 1DHPA 4HOZA 3YPIA 3AO0A 2ABBA 1D7FA 1THFD 2NX3A 1WZLA 3MHFA 1G9HA 4JDYA 2ZZ2A 1Q45A 3BMVA 4QIUA 1VHCA 1Z44A 3NQAA 1QOPA 5HMSA 2RFGA 2ZZ3A 4W9TA 3BUDA 1D9EA 1VAHA 4GC4A 1EB3A 1OABA 1HVXA 4HHPA 1HNYA 3M5VA 4M19A 4UMCA 3LCLA 3ZFHA 1LYXA 4UNKA 3NQFA 3FJ6A 4RXFA 3TTSA 1F6KA 2FFCA 4GI6A 1KV8A 3W7KA 2BXVA 3QSTA 4C1LA 1W1ZA 1JCMP 1CW2A 3KVLA 4O13A 5FEWA 2FIQA 2D0FA 2E5DA 1PIIA 1QHOA 2ZIDA 1KA9F 2ALWA 1OYAA 2I14A 2CZDA 3O05A 1CXHA 5D04C 3O63A 4HIBA 2YA0A 2QCDB 4MYAA 1XC4A 4NZJA 4FLSA 5TBOA 2QR6A 3TE9A 1QHPA 2JKPA 3PBWA 3TX9A 2QKFA 3OBKA 4UTTC 5CG7A 1VZWA 4JN6A 2GVLA 4K36A 4X9YA 3UCQA 3TMLA 1QPOA 1XDMA 3EJSA 2PRLA 3W9ZA 4PSRA 2EKCA 2VR5A 5E1QA 1FWWA 3LI1A 2F1AA 2GUYA 1JJKA 2ZA3A 4O1CA 3LM7A 3LPOA 1KFKA 1HL9A 3NL3A 3BC9A 3ZSSA 3FYOA 1AL7A 1TPDA 2G97A 4ADSA 4UIOA 3RFAA 1JQVA 5FF0A 5LKYA 3STEA 1N7KA 3S1VA 2JBMA 1OK6A 1T96A 2GVGA 5DCBA 1ONRA 1S5TA 4FNTA 1GZGA 4LV9A 5LGZA 4CN1A 1SW7A 4N6FA 1H7OA 3OLIA 1QFEA 1B57A 5K7JA 1LBMA 1JCNA 1W56A 1Z48A 5HDRA 3IGUA 1E40A 2ZWZA 1CDGA 3BCDA 3HGRA 4O28A 3W7OA 4IPJA 2Y4SA 3G1DA 4CN6A 3EWUA 3TNOA 4B5NA 3MI2A 5AB3A 3LV5A 5AC6A 3QC3A 2TMDA 1GG0A 6TIMA 4QNWA 1QWNA 1WE5A 1VB9A 2WNZA 1A50A 3OIXA 4HKPA 4CKQA 3A22A 2X2HA 3G1FA 5U7SA 4C1KA 1H3GA 4Q32A 3S5NA 4I7UA 3EB2A 4RXGA 2X1TA 1G4SA 1PHQA 2BY0A 4XZ9A 4S1FA 2FH6A 3P8IA 3TC7A 5K2ZA 3G8RA 2GVJA 4O19A 2ISVA 4K38A 1CXKA 4X3ZA 1A5BA 2RHGA 4MVAA 5I0DA 2IQTA 1L9WA 2FPVA 2GUUA 5LNWA 1ZAHA 2RDUA 5LHEA 2FQIA 3BLFA 4LVDA 3BO9A 1DHKA 4JFVA 2B4GA 4PTNA 2CW6A 5G5IA 3ABRA 2ALDA 4TMCA 2XVLA 4O10A 4ZZ9A 3HG2A 2RKXA 3CEPA 5CZ0A 3CIXA 2R91A 4N9BA 2V2DA 1VGAA 3STCA 1SZNA 3DFPA 5CPMA 1JXJA 1DKWA 1TPFA 1VJIA 3HG4A 1YXYA 3QEZA 3LXAA 3LLDA 5F2MA 3BAWA 5KINA 3M16A 4PCSA 1RPKA 3EDFA 3WJWA 4JTLA 2D0HA 4IMFA 4PSPA 1RR2A 4MY1A 1O95A 4O14A 1ODUA 1OFPA 2A6NA 4Y6GA 4ZQPA 1LZOA 4PC8A 1HL2A 2DH3A 2F2HA 1PIFA 4AIOA 3WFZA 4N6EA 3U8GA 1Z42A 1QAPA 3OVRA 3EWWA 1BF2A 4JGDA 4TX9A 3E12A 1PIGA 3KEHA 4IX0A 2Y89A 1PPIA 4K7YA 1RV8A 2CWNA 2DZTA 2VEKA 2H8XA 5E9AA 4A2RA 1ME9A 2J6XA 2PWGA 3G8EA 4MZYA 4LNYA 3W1AA 1YPFA 4UQEA 3GB6A 2ISWA 1ICSA 1UUMA 1TV5A 3EDJA 4NJKA 4XKYB 1OYCA 4CN4A 4JX6A 5D02A 4AB4A 2ZXQA 5A2CA 2NUWA 4JL1A 3AJXA 2VRQA 4DF0A 5KMYA 3CPUA 3HMJG 4FHAA 5C2XA 1CXIA 3RLUA 4PA8A 3LCWA 1KW1A 2YSWA 4M8UA 1DTUA 1X1OA 2Y88A 2GPTA 4IMEA 4O1AA 3TA6A 3DXIA 1QI5A 4YCOA 4MZ8A 4TMBA 1MW1A 1FUYA 4RCXA 5LNRA 1I75A 3CU2A 3M5XA 3TQ0A 2BY2A 1W5NA 5DO8A 4PEKA 4GXMA 4WY0A 1H7NA 1Y7VA 3IIPA 4U2ZA 2AAAA 3W1UA 3C56A 3SIZA 3QH2A 1UUOA 4QISA 2VEMA 2EAWA 5A6LA 3M47A 1M7OA 2WC7A 4TIMA 4YMZA 3OHIA 1WOAA 1TV8A 5D03A 1VIWA 2PRHA 2CLLA 1Q4NX 2XN1A 3CC1A 4MY9A 4FNSA 3L4YA 2Y2WA 4NJJA 5I3GA 1RPXA 4OKDA 4JY8A 3NOEA 2BHZA 1SPQA 4WF7A 1U5JA 3GR8A 3E02A 5LSMA 2QJHA 1PAMA 3A9IA 5G1YA 5AC7A 1L0PA 2VNCA 4HA1A 3QQ0A 4MPQA 3VU2A 2ZQ0A 2QLYA 3S1XA 2TAAA 4NT0A 2FHCA 3M44A 3UZ5A 3WY2A 4JY9A 3NQCA 3D4YA 1W3TA 4FIQA 4POCA 3U2OA 5I3JA 3FW6A 2A7NA 3G1VA 2VFDA 1I2QA 2WKLA 5AHLA 4WD0A 4ZVJA 1OHLA 2HMCA 2NZLA 1FCVA 2NWSA 1IZKA 4H2CA 4RLIA 3MWAA 1KTBA 4LC6A 1AMYA 1F2JA 3KL5A 3MW7A 7TAAA 1B4KA 4LRTA 2B7QA 1UD8A 5LNSA 3HOJA 3CB8A 1EA0A 1MFVA 3THQA 3L9CA 3P8JA 3VNZA 3DFSA 2EPHA 3O06A 3DX4A 2FJKA 5EMUA 1AQHA 1BEUA 1M6JA 2XIIA 2D73A 2ZA2A 5K3VA 2ZUVA 1R33A 3W1NA 3LLFA 2WNNA 3ZR4A 2OMAA 4HP5A 1JULA 1RQBA 3EWYA 4Z1DA 1SO5A 2BXZA 2E1DA 4RJEA 3LCHA 2QAFA 2X2GA 3N34A 4UOQA 1M7PA 3K1DA 3C6CA 2G3NA 3P67A 4MUZA 3TUUA 3KHJA 4N9EA 2HSAA 1NAL1 3W22A 2PC4A 2WNQA 1V3JA 3S5ZA 1W31A 3DHPA 4IXHA 3BV4A 2YXGA 1N55A 5KTLA 3VKJA 1TPUA 1D3HA 3P60A 3WDJA 3TKFA 3EXRA 1WX0A 3BPWA 4U4MA 4H6KA 1MFUA 1KCKA 1JCJA 1TPWA 1VS1A 4I7WA 3S5OA 1PL9A 3CLWA 3BUBA 2V81A 1XI3A 3W23A 3LHYA 1JCYA 2YDAA 3PUEA 4W93A 4QQ3A 3TR2A 5CGTA 3ABOA 2C19A 4JDBA 3NXFA 5D2YA 1W5MA 5E0KA 3W7EA 1TRIA 4WJEA 3DDGA 3I6RA 4LWWA 1F73A 3GXPA 3K30A 2QPSA 2CLHA 3WDIA 1C8VA 3RK8A 4UTTA 1TPC1 4JTTA 5EA9A 5LHFA 3M07A 1XSJA 1BAGA 2YX0A 3GTNA 2ZXDA 1GTHA 1WBJA 4AYGA 4RZ5A 3TOPA 4FLQA 1IGSA 3UQNA 2VFGA 1UD2A 3QMTA 3BLKA 1JUKA 3O15A 2OCZA 4UFLA 1MEHA 3KRSA 2WSQA 4WOZA 3AJ7A 1OX4B 2G3MA 3PG8A 3TFCA 3C2OA 1K7XA 1ZJBA 4NI3A 3L4ZA 1O60A 3HJZA 3P80A 4UCFA 3B4UA 3WMSA 5F2IA 3Q37A 2Z6IA 4PCFA 2ZUWA 1TTJA 5EKYA 2FHBA 1EWDA 3MBFA 3BVUA 1TSIA 3VNDA 1TJRA 3W2NA 2GJLA 4M5PA 3FS2A 4A3UA 1XD0A 1UASA 3IIVA 4BR1A 5F7UA 5K9CA 3DDFA 1YDOA 2CHNA 3L4UA 3LCFA 1ZJIA 4K8EA 3A23A 4Z0SA 1UD6A 4JCLA 1X7FA 3W1MA 5FEZA 3UPWA 4YXGA 5AHMA 4EVZA 4GQRA 2V3DA 4GIAA 2E8YA 4UTHA 1P6WA 1XBYA 1CGXA 3TQVA 1UKSA 2JKEA 3D4ZA 3E9AA 1AVAA 1S5VA 3W1RA 3PSWA 3L68A 3CZLA 3IIOA 1Q6OA 1GEQA 3W2KA 2ZCGA 4O15A 2WVVB 5TD4A 1IIGA 2ZRVA 3HF3A 4L4LA 1GVSA 3L0GA 4DQWA 1H5YA 1ZFJA 3THAA 3CV5A 3OLEA 2W0UA 4UC5A 1F05A 2ISSA 2XWEA 5CLWA 3VX1A 3QZEA 2J9ZA 3IRDA 1W8SA 5D09A 1HUVA 3EDKA 2I9EA 3ZOAA 3M9YA 1XSKA 4RZ6A 4AMXA 1G7VA 4QAIA 4M56A 2R14A 3NPUA 2H3BA 1TB3A 3BVWA 3BAXA 4NQ1A 4JL2A 2H6RA 1KFEA 3DU0A 3C52A 5HUOA 3DC0A 3HQ1A 4JTEA 5D05A 4WQ6A 3DKLA 3EDDA 2XN2A 4CGTA 2V2CA 7TIMA 2P1FA 3HZ3A 4YWIA 3EEGA 2E6FA 5E93A 1JQXA 3ATYA 1G6CA 2ATMA 3BH4A 1XH0A 2HTMA 3P74A 4RR4A 3DHFA 2XIBA 3MYOA 4WXZA 5DLCA 1KLYA 2ZICA 2NSXA 3W2MA 3FLUA 5KZDA 1G5AA 2KZHA 1WP6A 1WDWA 2BX7A 1H7PA 3VI2A 2OT1A 1AW5A 3GXDA 1I8JA 1SW3A 3PULA 4MJZA 3EXTA 3W7DA 3CQ0A 4BZYA 5DN1A 1TQWA 1QO5A 1Z41A 3NR0A 2EADA 1KGUA 2NT0A 1OFQA 3WNKA 1J4EA 1VHNA 3NVTA 4IQLA 4Y90A 4CCEA 4P2VA 4OV9A 2Y5EA 3SJ3A 1PEZA 3B0VC 4FMVA 1JF5A 1Q6RA 3HB9A 5I3KA 3CZNA 3R13A 3TDFA 1NM9A 3VGBA 1H1ZA 2Y7EA 3W1TA 3TH6A 1OYBA 1KBBA 4E2BA 3TC6A 2F18A 1WOBA 1JR1A 1I2NA 4UOZA 3GDTA 4N02A 5MHBA 1F7BA 2NV1A 3BARA 2TPSA 5F2GA 1KM5A 5D33A 2C13A 2A85A 3WY1A 3GK0A 2B7OA 4YCPA 3TAKA 3A6OA 1KXVA 4WUIA 3VSTA 3DI1A 3P61A 4LUJA 1XBZA 3ELFA 5CGMA 5D30A 4HPHA 3K8KA 1NF7A 5DCDA 3SGUA 1W9XA 1PJ9A 2WV8A 4ZQOA 2BHYA 5D2TA 3F03K 4FB7A 3FAXA 5I3IA 3W2UA 1OK4A 2OSYA 1QPRA 3GDRA 1K8XA 4GKLA 5IBXC 1LBFA 1YDNA 3BUPA 3GVGA 3SY5A 2YJQA 5FF4A 3BG9A 1QNVA 3GXMA 4WXYA 3S42A 3CLMA 3G0SA 4JYFA 4FLOA 3NL5A 4O18A 2E6DA 2F61A 4GI9A 1A5AA 1YPIA 3EXSA 3D51A 2E68A 5EBUA 4MFEA 5G4EA 4DF2A 4JICA 3LHVA 3FIGA 4X2RA 4R53A 5DXXA 3C4UA 3UXAA 2QJGA 3II1A 1KTNA 3S5YA 2CZ5A 2Y85A 1DORA 4Z1AA 5HUPA 3B05A 3MP4A 4UNIA 3GAKA 2GQAA 5LNUA 3C2FA 3MMTA 2TSYA 1EP1A 2GOUA 4DPPA 1GJUA 5BOOA 1FXPA 3SSJA 3PAJA 5E0FA 5A8GA 1P0KA 3INPA 2ZX5A 3W1XA 3LDVA 4UQ9A 3M6YA 1LCOA 2VEIA 4Y9AA 5CKSA 2NT1A 3TAOA 4JIPA 4GUJA 3G1AA 4U3CA 3QJAA 5CLTA 3W7LA 3NA8A 1O7DC 3LOTA 4A29A 1OT1A 4MZ1A 5J5RA 3AXHA 2DP3A 3BK0A 3L4VA 1FWSA 1FY6A 3ZQ9A 1UBSA 3EWXA 2NUXA 3T40A 3CTLA 3CPRA 5KEZA 2ZYFA 4HSNA 1QPQA 3W88A 3LV6A 5G2IA 1U2YA 2YFOA 3DH7A 5G2HA 4J3XA 4U28A 1G1YA 3S6DA 3CWNA 3VX0A 4CQ8A 2WPGA 2YA2A 3K8MA 1SQ7A 4PL1A 2RDTA 1UA7A 4U33A 2DZXA 1HL8A 1IZJA 1VYRA 1X1ZA 3JS3A 4ZL1A 1LRTA 5GVJA 5FF2A 2W6RA 2F1BA 1ME7A 4JFSA 1SZFA 1YXCA 2WSPA 1VFOA 1NFBA 3R89A 3O07A 1UH3A 5AYYA 5CZJA 5BMXA 1TV7A 4FEZA 5FF3A 4O57A 2ZTJA 3FKKA 3O6DA 4JTSA 3TW7A 1IXNA 3WJSA 3WN6A 1SO4A 4J3TA 4FO4A 3VSVA 3JR2A 3AMKA 4CVWA 3KAOA 1KTCA 4OGZA 7CGTA 3N3MA 2XVGA 1MXDA 1F76A 3IGSA 3HGSA 4O12A 3G18A 3LTPA 2E6YA 3IK2A 2G96A 2BSLA 1TQXA 3PB2A 1L6YA 4J3UA 4IGHA 3EWBX 5D32A 4LVAA 5CPLA 4LU0A 3NO5A 3PC0A 4FX6M 4Q33A 3F1QA 2OYKA 3G24A 2WQPA 4GUIA 2BXYA 3E49A 4UXDA 3G0XA 2FHFA 1ZJAA 4KWUA 4K6AA 3E96A 4U31A 3STGA 3WNOA 2B0MA 3FEMA 4MOZA 2CLFA 2EHHA 3GZ3A 3RU6A 1MVYA 3GDLA 1DOSA 1IIHA 4DPQA 4ADUA 4Y96A 3IJ7A 3QQ1A 1PCWA 1FXQA 1UA3A 2R94A 3N19B 3S1UA 4GE8A 1EEPA 1VYPX 2V5LA 3GXFA 1K7FA 2CLOA 1LBLA 1DEDA 5F1UA 3L4TA 2ZA1A 4AWSA 3LI0A 3IJ9A 2EQDA 3M5ZA 1XSIA 2RDWA 2YPIA 2OSWA 1J2WA 3TV8A 1O94A 3C0JA 3NQDA 3HPXA 5F4SA 3A24A 1MXGA 4UZSA 2ZX7A 3EJUA 1B4EA 1AW1A 5HWNA 1NF0A 3W70A 3WY3A 3BGJA 1JCLA 4IJBA 3W86A 1MEIA 1QWGA 3NL2A 1LLZA 4DEFA 4GJ1A 3GLCA 3MP3A 1W37A 3GXIA 2CLMA 3TJXA 3W7NA 1VRDA 1ZNNA 1FDJA 2XWDA 2E77A 1XCFA 1JRCA 1VCGA 4UMAA 3BW2A 3HPZA 2YR1A 5A2BA 2FPTA 4KWVA 5AOUA 1DVJA 1S5WA 2OT0A 1OGSA 3TROA 4IWWA 1UD4A 1B2YA 1MSSA 5AHNA 3Q94A 3TK7A 5AFDA 5DY3A 1OFRA 1MZHA 4LTSA 1U30A 4ALDA 4FNQA 1FDZA 2Y62A 3L0NA 4LVGA 5HQEA 2E0PA 3KE0A 1T8XA 4HPXA 2OZ0A 4GUHA 1AQMA 2YIHA 5D2WA 5F1VA 1KB3A 3KVJA 4LY8A 4AWTA 5I23A 2EGZA 1JDAA 2PRMA 5I24A 2NWRA 2ZWYA 3A47A 1H51A 3L5MA 3PWAA 1BWLA 3FAWA 1YTDA 1JGIA 2VELA 3RNDA 1OG0A 4ZMGA 4NNBA 4K39A 2CLEA 4GINA 1WPCA 3NYZA 1TIMA 1JAEA 3D52A 1OJXA 4J3SA 5BRPA 4NX5A 1G4TA 2NLIA 5DELA 3GXNA 2D0GA 3R12A 2P10A 3L4XA 4G1KA 4R34A 3GDMA 3WY4A 4N2YA 4NU7A 3MYPA 4QNEA 3BLBA 2F7QA 3EDEA 5G2WA 1JI2A 2H3DA 3WNLA 4HT3A 3W1PA 4AWUA 4J7RA 3CM4A 2X16A 3UG5A 2E9BA 3DFOA 2GVYA 1W5OA 1L6SA 5KZMA 3QGVA 3GKAA 4WOQA 3W87A 2X30A 1OB0A 4O11A 4O0ZA 4RKAA 4JS3A 3IJ8A 6ALDA 1JL8A 3CZEA 3BAIA 1W54A 1LOLA 3BVTA 4AIEA 1G69A 1M5WA 1PVNA 5HINA 4FF7A 3BMWA 1ICQA 2Z6JA 3PS7A 1P1XA 4EF8A 5AYZA 1R2RA 2ZFAA 3D50A 2V3FA 3PUOA 3PR2A 1H1YA 2C8NA 4OIFA 3W7JA 1TMQA 3IIZA 3JRKA 3EKZA 2CU0A 1VQTA 3LBMA 2EABA 4FXRA 2EAEA 3G0UA 1CLVA 3LHZA 1VH7A 2QCEA 4X0NA 3KXQA 1W5PA 4H4IA 3TJLA 2BZNA 4JCMA 1H7WA 1DQWA 4LS2A 4MAZA 3KVKA 1RP9A 5HR6A 1RQHA 3SGZA 1QI3A 3BAKA 4GO9A 1VC4A 2V30A 1HX0A 4HSOA 1D3GA 8CGTA 2CXGA 3KL0A 3GR7A 4JIQA 5D2XA 3DX0A 2QCCA 3STFA 3M41A 5KITA 4XB3A 4FLRA 4HN4A 4WSJA 1EP3A 3GIYA 4QJ1A 3W38A 3W73A 4BI7A 3S0CA 5C6MA 1OX4A 1GVFA 1KLZA 1PS9A 5FEPA 3AXIA 1Q3NA 4LW7A 1PZ3A 1LWHA 3KWXA 1SMAA 1XH2A 4CNNA 2GQ9A 1RVGA 1CXEA 2Y7GA 1JUBA 2QF7A 4DBEA 1KFJA 3RIKA 3G1SA 4MYXA 2QMJA 4R33A 1UH4A 4FX7A 3CIWA 1CXLA 2NXIA 1W3NA 1YADA 2V2HA 5LZLA 1KCLA 3LCIA 3BSHA 3P7YA 3H53A 3FFSA 3LRLA 1DL3A 3B03A 1EH9A 3VM7A 3PBUA 2ZXBA 2Y24A 1Y0EA 2FPYA 3NL6A 3FA5A 1LP6A 1WZAA 1FCBA 2DZPA 4JYDA 3W2JA 3VMPA 4HOWA 1EIXA 1L6WA 4UFIA 1VJSA 1R2SA 2ZUUA 2FDSA 3VCRA 3HIJA 2ZRYA 5HPOA 4IX2A 3L65A 4I9AA 1H7RA 2ZUSA 4O52A 4UFMA 5C54A 2QCLA 4M7TA 3KLKA 5I3FA 1NEYA 5HWJA 1CGUA 2CLIA 5A6MA 3NPVA 1HTYA 3C2RA 5G4WA 4UTKA 3W37A 2JGQA 3B0PA 1GCYA 1PV8A 1JF6A 4XTDA 5DXYA 3S1WA 1TQSA 3KRUA 1OVDA 3UERA 1CGWA 1XUUA 1J0JA 1MW2A 2WANA 2DZWA 1B3OA 5K4ZA 4PL2A 2CPUA 5TQLA 2QUVA 3T55A 1E3ZA 2DZUA 3LX9A 4Z1CA 1EA9C 4IMGA 1XM3A 4BI6A 3WJYA 1VLIA 4BA0A 4HOXA 4PCTA 1SW0A 3F4NA 1EUNA 4RK8A 1PZ2A 4JFTA 1UB3A 4Z08A 3C8FA 3EJPA 3ZR5A 2X1SA 3CHVA 3DFQA 3NQ8A 4N4PA 1H61A 3R8RA 1OFBA 1HTIA 4AHQA 3L2IA 1ALDA 3EX2A 1YYAA 4O16A 3BVVA 3O1NA 2Q8LA 3NZRA 2QEZA 4LVBA 4QSHA 1TPH1 5D38A 3QYQA 2YYUA 1HT6A 2EJ1A 4L4MA 4KFOA 2QCNA 4DO5A 2H8ZA 1EWEA 2Y7FA 4JXCA 2WSYA 1G7UA 2E4TA 9CGTA 3PBVA 1S46A 3TW6A 5E70A 3VGFA 2GJNA 1GQNA 1V3KA 3WENA 3G1XA 1UKTA 4S2CA 1OT2A 4NJIA 3VE9A 4GRSA 3TFXA 5FF7A 4RZ4A 3NDOA 4OT7A 1CGVA 2C7FA 5KZEA 2V5BA 4PODA 1I2RA 3CWOX 4ZQNA 1S3HA 3WNMA 4NNAA 3SR7A 1PHWA 3NQVA 4TR9A 3W3OA 1GT8A 4ORIA 1CXFA 1UD5A 1K7EA 3EX1A 5LNVA 3O6YX 4M6PA 3UY8A 4GQQA 3QSRA 3FJLA 3DHUA
chains in the Genus database with same CATH superfamily
2O30A 3MODH 1KJ3L 4U4BA 2CALA 3LN4A 2IV8A 4WW2A 1MCOL 4J5NA 3MP5A 5I1DB 2Z1KA 1P4CA 1NCUA 3WL9A 1HH9B 1NLDL 3CE1A 2CZFA 3K2UH 1LRNA 3C8NA 4XAPA 2B2XL 2BHFA 1EQWA 3OLDA 2W60A 5D7IA 5IDZA 4QRNA 4GLEA 4BUGA 3ENEA 3EMZA 3SQOH 3PZTA 1ZP4A 4HWNA 1KXTB 1HXMB 4QKTA 3L6FA 3KPSA 2JEPA 3EH3B 2KPWA 2ED6A 2VN6A 1KCVH 2IAMD 3O6MH 1SUXA 4XNXH 4Z7NB 1TTQA 2YLAA 2F2KA 1MAML 4RCAA 2P0IA 3LRMA 1XV8A 1TFPA 3ARVA 2GGGA 2IPGA 3QNYA 4X7CC 3L4CA 4B9CA 3V0SA 4PWGA 5BOZG 2NZ1A 2PF0A 3V4LA 3HZVB 3E5PA 4TV5A 4ODHL 1FWTA 4LCRA 2YGPA 1A7QL 3LQLA 3TN0C 1KELH 2VDOB 3HRZA 4BQ6A 1CT5A 3BKYL 2C0HA 3GKWL 3HAEH 5DFVD 5TE6L 5AW9B 1XFBA 4IRSC 4LP8A 1O7AA 2QYGA 2CHOA 3SGKC 1WD8A 3ARGC 3HRZB 5LWYH 1OTSD 3UTTA 5CP3H 1A3LL 3B2VH 3WL1A 3IRSA 2OX1A 2VUNA 1SDAB 3TONA 1CFVL 4A68A 1F8TH 2WLNA 4AK1A 4FXJA 3C2EA 2ZX6A 3T0EE 2CK2A 1E5YA 1C29A 3CXFA 1O5KA 2LW3A 2WWOA 4ZUSB 3OKMA 3LBOA 4OWGA 5D8ZA 3BUVA 5CSUA 5IBTL 2VEFA 5T26A 3LCGA 3BANA 3OU8A 3OAZK 5FW8A 1BSIA 1UCWA 5FIEA 4DJED 1FBAA 1MCKA 1A7OL 4NUJA 1IXQA 5BOEA 3WD3A 2YXVA 2CHWA 3WELA 3H4FA 1KXTA 3PNWB 2GDVA 1K9TA 4UTWC 1I9EA 2H4EA 1DANT 4YXHL 1F6FB 2FYYB 5DQPA 1OGAD 3DVFA 3SDCD 3QHFH 2OELA 1D2OA 1MFEH 3EX4A 3U2SA 1BVNP 3FONA 4WFFE 3LNPA 3FSTA 3MXVL 2HCVA 3M1ZA 5DVOA 1JD7A 2FWUA 1XX9C 5DMYA 5LIUX 1QI4A 4DETA 4MFDA 4UQDA 2VLRB 4BZ2L 5JQ6L 1H3PL 2W0KA 4EP8C 1X4YA 4NAFB 2LTQB 3T0BA 6TAAA 1RK5A 3DYPA 1OP3H 3T3MB 4LSTL 2G3IA 4PBFA 3WF1A 3PG9A 3WUFA 1TQJA 4XBKA 3IPBA 4PH6A 4MWFA 3QXWA 4NQDB 4F7PB 1ZT4A 2O5YL 2F15A 3VNYA 4GW5A 4LX4A 1QW9A 1Z9LA 4JFEE 4LCWD 3PWNA 2GBVA 4OD2B 4H9ZA 1YUHA 2A7RA 2ARWA 2GSIA 3WO8A 3GDKA 5C9WA 3QI9C 4E9SA 2WYIA 2FYMA 2LGNA 3I68A 1UOKA 2E56A 2C34A 2BM3A 3DXAB 4KV5F 4M93B 5DUPL 2C3ZA 5I26A 4EDXB 4HJWA 1MW0A 1TCRB 3BUIA 3FQUA 5F0MB 4RNJA 3MRCB 1T66D 4AUJA 1OFAA 1BJMA 1YDYA 3RF9A 5CXPA 4IL2A 3ES7A 2PS2A 4QHNB 2WKOA 4XVSH 2V9TA 4PMFA 1GGIH 5EZJB 2X1IA 2Z7GA 2B9BA 2EXOA 2V2TB 3OQEA 1AJ7L 3MU3A 2GAZA 3O6ML 4ZX4A 1F8MA 1FCQA 1I4FB 3I6TA 3W24A 3MLTB 3KVQA 3TZVB 1II4E 1FKXA 1CICD 5J8OA 2DQIL 3IXTB 3TYGH 3T4CA 2VITB 3GO1H 4RFEA 5C0EB 2GFBB 1UYWL 4IBLT 4FFWD 4MXQC 2RD0A 4BWTA 4EI6A 5C0IA 5HGGS 2C1PA 4GXUN 3UPAA 1XSOA 2J88L 5AD0B 1BKSA 1EQCA 2FB4L 1VFTA 5HYJE 1WITA 5E94B 3HB3D 3CWHA 1ZHLA 4Y4KC 3UWQA 2G60H 1PF3A 3K3QA 4XMXA 4JN1H 1BVZA 1JV5A 4X6FA 4DEWA 4MAYC 4AZCB 3ZJ8A 5B8CB 1D3CA 4YHNB 3ATAA 4GP8B 1ZLSH 3ID7A 4Z7UA 3CQQA 3NIGF 3F05A 3O3RA 4ZXOA 2P0OA 3TXVA 4EF3A 2OQLA 1UM5L 2A9BA 3QPKA 1H60A 4HZAA 1WKFA 1GVIA 2CJUH 2B1HL 3G08B 4JZ5A 5J6GA 2ODIA 1UOLA 1F3XA 5F7NC 3NSCA 2YPIA 3W72A 4D9RE 3CVCA 5CLYA 2K1MA 2OCJA 3PWPE 4TU1A 1BAFH 2DQ6A 4KK6D 1TQCB 2BW5A 2BLFA 3BSGA 4I3RH 4K3HA 4F7CB 1QO2A 3UZZA 5EU9A 2YDRA 4N2IA 2OAAA 4MNQE 3HB3C 1JDCA 1M3IA 4KQ3H 5I00A 3CLFH 4G1MA 5IROD 3RM9A 1RJLA 3EYQD 4J27A 4UB0H 4BD4A 3LN5B 4GY0A 2MKLC 2CITA 4EAEA 4D9LL 1OSZA 5I76B 4G9DA 3L67A 4GX8A 4NRZA 1LORA 1EJXC 3A5FA 4Q0XH 4W70A 4EI5B 3ME0A 3BYYA 5EOQL 4XAZA 1WQVT 2J8UF 2YC1B 3WK2A 2JKLA 3WEBA 1IQDB 1LNUB 2O5YH 4YNYA 3WNPA 4PY7B 4PJ5A 1O9ZA 3V5DA 3PVFA 1QFWL 2VDNL 2IDFA 4ZFQA 5F3BB 4U5IA 2Q7YA 5EZOH 4Y4HB 4JM2C 4V11A 1CYWA 1RZQA 4YFEA 5EU7C 3RRXA 2WSKA 5EZLA 2XHYA 4UR8A 3USZA 1R47A 4P2RD 4EI5D 1I6NA 3NJGA 5IB4A 3K72B 3DO3A 5JHDE 3S35X 3UO1L 1GQIA 1KRAC 4BK4A 3DAQA 4LRNL 2HT4C 4XP4H 4LEQA 1AGBA 3MX0A 3QS3A 4JLRB 2WAGA 2AJUH 2ZP8A 2GTQA 1FNAA 4LSRH 5K9KA 3OGCA 3QJRB 2A7PA 3TGXA 4LKXA 4IBZA 3OV6A 4LSPL 4QEHA 4TTDC 1IRAY 3DFNA 4HPYH 4ONVA 4XP5H 5LN8A 2HV5A 2J55A 2CJSA 4HCDA 5I1AA 4UTLA 1GWJA 2WO5A 1EEZA 1NLBL 2F8IA 3UZXA 2HG5A 1AP2B 2WXHA 2W0PA 5HMEA 3GY1A 4HGMA 1U3HC 1MRQA 4L3EE 4FA6A 5C7XH 1A6UH 1KLGB 3RLVA 4DBWA 4IU2B 2Y6SC 4JFXA 5ANHA 2AJZA 1CDBA 1ZD6A 4CU6A 3QPZA 3MREA 3DVIA 4M3HA 2DW7A 1HWWA 5H8UA 1Z9PA 2DIEA 3B2MA 4JTIA 1FV1A 5FJJA 1T99A 1XKYA 2J8TA 2IXVA 1EGMA 3VG0L 1WAUA 2D7QA 3RG6A 2EG8A 1MCQA 3GZOA 5GXBB 3BRDA 4H40A 2H3NB 4GYJA 1YN7A 3I9PA 4XXDA 3X11A 1ZENA 4JLRA 2DYPD 1M9SA 4L4VA 5AZ2L 1TITA 1EO5A 1SJHA 3DI0A 1SVDA 4LSPH 4ZNCD 2BVOA 2ODHA 3HFML 3GWJA 5HDLA 3W3BA 2VKZG 1TETH 5F72S 5F6IB 5IB4B 5CC5A 2ZOWA 1PCKA 2VLJA 3UZJA 3KS0J 1RLDA 2HVOA 3T05A 3ZJKA 4B0MB 4KNSA 2C6QA 4O5LH 1R3RA 1G0XA 3GIVA 2FGBA 3X3FH 3NIDB 5J1AA 1OX6A 1GYUA 3GJFB 4CCEA 2HKAA 1W1B1 3MLUL 4B96A 3CZKA 1BECA 4Q9QL 5ENLA 4TSBL 5EO0A 1MXSA 2EDXA 3SZ8A 5ABAA 2DQDL 4NZRH 2GJRA 3RJDA 4N3TA 5D1QC 1UIOA 1R30A 4EIVA 4EI5A 3H21A 2Z3FA 3QE5A 4Z1PA 1ONEA 1ZHAA 4LSUL 2Z2AA 5JW3L 4MKMA 4DJDA 2QDVA 4GMSH 3VIKA 4CSZA 2XSBA 2G3XA 2XYCA 1KYOJ 3W7GA 5DMMA 4CEUC 3PTMA 1J0IA 3HV8A 2HN7B 1M2VA 1Q1PA 2HLAB 3IRZA 1GKQA 4DP2X 2PU1A 4HJFA 3T0ED 1XIWA 4JPKH 2Y7QA 2J4GA 5HJBA 2XTLA 1QPKA 5JW5B 3TN0A 1FP8A 4ZFFB 3K8LA 3ZWTA 3ZKMC 1BYBA 4JRXB 2F6AA 2L8AA 4IICA 2RTTA 2ZCKL 1QPNA 1VFSA 3NBNA 5A2AA 5BV7H 3AXMA 1KCBA 4OZHF 4EE2A 1WBHA 3M43A 1K6QH 3JUYA 5TQ2H 1XGQA 4WUUB 2OULB 2W9DH 3LB0A 4ENLA 3CXDL 2WB7A 3SI9A 1GOOA 5IBLD 1XGEA 1LLWA 4XP6L 3VMOA 4U2YA 1PX3A 4FYTA 4IMDA 4QTIL 2WCSA 4NT6A 3IAQA 4QRFA 3ML8A 4TL5A 2MCAA 4N4YB 1Q6QA 1T4WA 1EFXB 1QJWA 1LM1A 1JCXA 2IXUA 5FHAH 1F5ZA 3MRMA 1D5IL 4EO5A 1TMHA 3EJTA 2DT3A 3MA9H 1AI1L 4H13C 5CD5C 3MT1A 4IMKA 3KW3A 3JTTB 1HGWA 4G8EA 3I6LD 4YHPA 4IS6A 4PTDA 3T07A 4I0CC 3QUMH 4OZHE 3VFRA 5JW3H 4OCXL 2C79A 4ORGB 2VT0A 3T44A 2WZMA 2D2OA 3I6KB 3W7MA 4X5QA 4IDJL 1SDYA 1YNTF 4PTVA 2IF7A 4WW2C 3B8TA 1HSAB 1N59B 1FFQA 2VC2L 4EI6B 3WN5A 1S7VA 4HG4J 1OQOA 3N6YA 4AUUA 3L5AA 3DMMA 2VQ1A 4HK0A 1VGEH 2FEJA 3R19A 4O02L 4Y5VA 1W8GA 1T2QH 2EDQA 1VCVA 5MHSE 5CU9A 1I4FA 2R29H 3S0PA 1TTPA 1IGJA 4ADGA 1ZCOA 5FCUL 1DBML 2C3HA 5E7BA 3N14A 2OK0H 5I17B 4LLYA 2RQEA 3MI6A 3OAUL 5I1GH 1A5SA 1JPMA 5FYJH 2OEMA 3KTCA 4I9JA 4IL0A 3G22A 3W7RA 4JNMA 1OVZA 3D87B 4NJHA 1S9XB 1DQXA 3QW3A 3PUDA 1LOSA 1UD3A 2RMNA 3I84A 4QHMB 1UZ1A 3KPPB 4GT7A 3WEAA 2QDHA 2NV9A 5BW6A 4YDKH 5EOCL 1P2CB 3SJVB 1VACB 5TQ0L 2XRAL 3OHMB 3ZGHA 5AZ0A 4O5LL 3HUJA 3RVVC 4X83A 2HNHA 2QDGA 3SB3A 1GZPB 2R1XA 5DWPA 1OTUC 3ZT5A 4KTYA 4KX9A 3RCMA 1PYWB 1RA0A 3ARQA 3MNDA 2YD3A 1F4XL 4FFVC 2YFNA 5D70L 3SGKA 3U7YL 4GKTA 4B2DD 3QBUA 3TOYA 1GY1A 3N9RA 1SXNA 3ZVHA 4F79A 2I07B 4AYFA 3EFFB 3TZFA 4MCZB 1QU4A 4GBUA 1YNYA 1LP9A 1HFBA 4XN2A 1WJ3A 3E3QE 1HEJC 4N8UA 4GMSL 3B9OA 5CBIA 3Q5OA 4DEPC 4UTMA 1IC5H 1QLEH 4IOSD 4CMMA 2AMGA 1F1DA 2I69A 4L4TE 3RFZB 1Q0YH 3MLVH 1DBMH 4APXB 5EEUA 1D6EB 2EZ0D 2VDOH 1E8ZA 3C0SA 3PP7A 2NVDA 4GRMB 4DO6A 3UYRL 3BG3A 5CPTA 2QADD 1FWHC 3KLLA 1GKEA 4W6WB 4WHYG 3BW9B 5J6SA 5IFAL 6PCYA 1P1MA 3IVSA 3GMMB 3PZGA 4UIMB 3UPBA 5HYSB 3Q8EA 5HHNA 1A7RH 3SCMB 4S3GA 4ZAKD 4DQOL 4J39A 2RCSL 2Z34A 3GPEA 1TQCC 2H45A 2JKWA 2W94A 4NKDB 1AZNA 2BOBA 5DFAA 5CBBA 1FHLA 1WBZB 1G7IB 3BZEB 4WY0B 3PZIA 4QTIH 2WVTA 5L8KB 1XG3A 3L7EA 2HJPA 1J8SA 1P0NA 4DY1A 2HWZL 2MQCA 1D5ZB 1ZT7A 3AT8A 3CXHJ 3NEVA 2H2PC 4DP5X 1NCCL 4YX2L 2EDWA 1OCBA 1LUCB 3MV8A 2VDQL 1M1XA 4AF0B 3O4LE 1EZ2A 1NGXA 2YD4A 4C59B 1QTWA 1RZKC 1S5HB 4GI8A 1TSHA 2J5LC 5I6MA 1VZHA 3C60A 4YFDB 2A5HA 2Y63A 5JO5B 4UV4H 1WFIA 1ZTMA 2V7NB 1DBAL 2ZYRA 3LZNA 4JQVA 4ODVL 4GMTL 3VXSD 2P88A 1A3XA 4P5TB 4GWEA 1W6LA 3BP5B 4OZGB 3L3IA 4CNPA 4LZKA 5FKYA 3FU0A 5BROA 5LIWX 1XHGA 1WCQA 1P4UA 4TNEA 3V0WH 4Q4PA 4OZFG 5DHEA 1P0BA 3SW6A 4QAWA 3BAEH 2NRDA 1D5BB 3M46A 4RMBA 4TL4A 3EX6A 1CGYA 3JV0A 3TVAA 1LTDA 4LRSA 3H42H 4LCWB 3THMH 3GBEA 1VRSA 35C8L 3GYEA 3TV3L 4C56D 2QGHA 3I3DA 3OVPA 3N6QA 1WYJA 4ACTA 3ZKQD 1KC7A 2NV2A 1E15A 3EF7A 1FCUA 4K8HA 1P0DA 3LA4A 5H91A 4JDEA 4O1FA 4ACPA 1NFGA 4JGNA 1V0NA 3MKCA 4I1PA 3TLLA 3W7PA 4V27A 2ZAHA 3ZS4A 4NF7A 1L9TA 2YA1A 3QGAC 2KDGA 5LBSA 3V9FA 2P7TB 4HH9B 1FFNB 1J86A 2A3EA 5BVJB 1YE4A 3MZNA 3BPOC 2CBJA 3B8DA 1CLZL 2JEQA 2Z7WA 2W81C 1JPEA 5IB3B 5JHLH 4JN8A 3N40P 5FGBA 4JHZA 3PWUA 4WCYL 4DM2A 4X8XA 3LEYH 2FE0A 5E23A 4JFZH 2PP9A 4Y8AA 3RNQB 1HYSD 4Q8QA 4XZMX 2K9UA 3SFKA 3ARDB 1RY0A 2UXTA 5C9UA 4NRXA 3IJLA 4O9HL 1TCMA 3VDAA 1WCGA 4X7FC 1YHTA 4HCRH 4X5RA 2LAAA 1WDPA 3X13B 3OPSA 3JYBA 1OCQA 4ABQA 2OMNA 3GSWA 1XYCA 4P61A 4H6RA 1AJ2A 1QACA 2J7BA 3T04D 2R8WA 3W7HA 5EU7E 4NFDA 2BODX 2DWSA 3SJNA 4RX4D 3P3UA 3AADB 4Y7MA 1XF3A 4OV4A 4NUPA 1A7RL 1R3LB 5DRXB 3VJ6B 4WDWA 5CQ1A 5C0BB 2H32H 5B1KA 5C0QA 3B34A 2MQGA 3F58H 5DD6B 1XGUA 1MLBB 4ERSH 1P4BL 1NGWB 3FQ4A 1S2AA 4ZDHA 4TV6A 1RL1A 1AUSL 1IKNA 1BXXA 2RAGA 2OXNA 4UTJA 4DNLA 2EEFA 2KI6A 2VMEA 1EX5A 2QGEA 3L3OC 4PYHA 5KBLA 1Q6LA 3VA2C 5JHLL 2A79A 1V7MH 3BICA 5FW6A 3I4KA 3N29A 2B1AL 4F4RA 5E4EB 3OZ9H 4LESA 1CU4H 4CW1B 3I6EA 4M8QA 2PYFB 2P43B 4PRAB 3KYMA 1FIGL 4QEGA 4AC2A 4WV1A 3HG1B 4DAFA 1ID5I 1K8YA 2VXTL 3QIUD 4H9TA 4F9LC 4Y2WA 4TVSa 3ESNA 5E5RB 1OFDA 1K3UA 2QADC 4EXAA 1DZ0A 2X6AA 1Y6KR 3B3IA 3N2TA 3DOSA 2AXJA 2V7HB 1THCA 5F3HB 3DJTA 3K0WA 2GKIA 2FEDC 4LCSA 4Y7EA 4KAQH 1HE8A 2IGTA 4YBLB 1Q13A 4R88A 3WFAA 4LVFA 5E8EB 4UZUA 1LO5A 2NYZA 2PYEA 5D1QA 2J24A 4O02B 4DP8X 1R9ZA 1PX4A 3EOAB 5CPNA 4ZAKB 4J28A 1NIBA 4FZEL 1A6VL 4OV6F 3ZDZB 3NZHH 3VD1A 1G67A 4HNLA 2ZC8A 2DH2A 4LL9A 1QWUA 4GAYB 2E7FA 2TODA 1WICA 2O7SA 3TR9A 5D7JD 5CJQH 4S0SD 3M6DA 5CKAA 4GG9A 2XQBH 3FQRB 5FM5O 3CV1A 1UJQA 2YBRB 2P8CA 1UC6A 2X9ZA 4LU5H 2SEBB 3L3GB 5EC1A 4BFGA 5CF3A 1XBVA 2NOYA 3V7AG 4LS1A 3TU9A 3APMA 1NU5A 4MMXB 2QCFA 2AJSL 2YD1A 2XM2A 4TX8A 2PWEA 2UY7A 4P5RA 5DR5L 4I3RL 5K9OB 8TIMA 3DK2A 5SWSD 4BSJA 4TUKL 2QPEB 5D1ZI 3DV6A 4P9HC 3TCEA 5CHNA 3D30A 1D6VL 1CFTA 4HYRA 1FVCA 2WQVA 4WU7B 3T6ZA 1SLWA 4B9FA 1FYTA 1TVLA 3HG5A 5DZOA 2BSED 2PYEE 3V10A 4JEQA 1T4KB 5IQ7H 2OCFD 1WDDA 4K71C 2JK2A 3FGCB 5CGQA 4XP9H 4NZ4A 5J89A 1S4IA 3U57A 3PLYA 3V75A 4X9BA 4HAFA 2KERA 3V16A 4ZUTB 4MNGB 1VFMA 4IKNA 2VUYA 3LKRA 5BMWA 1ZANH 3GAYA 3O3DB 2C3GA 4LLDA 4TO8A 3IDGB 2QJIA 2V3EA 2MTPA 2V5SA 3SO3C 1C1EH 4PJDE 4N2OA 3CN3A 3S8GB 1A9BB 4ZUWB 4HUVB 1XEDA 3NQMA 4NO3B 3WJMA 1A53A 1TYJA 3M0ZA 2J9XA 2C18A 2A4EA 3QW9A 2ADFH 4UDUB 4LAOA 4YVVA 5U4NA 4LF3B 3X2QB 1M6OB 2OYMA 4P23D 3UO1H 1AZBA 1E3FA 4JG1L 3R8BB 2C16A 1I9IL 2CXEA 3LMYA 1J5CA 1RVKA 2WMKA 4M0XA 1HQRA 3UG4A 1G9ML 4AZ8B 5BO0D 5GZOC 1LEGA 2JIEA 1TQUA 1LP9E 3IDXH 4FQLH 1PFCA 3RIAK 1HXJA 5I09A 3VACA 1NINA 2BLEA 9XIAA 2XTSA 2IWGA 4E0RA 1OY3B 2J8UB 3QZOA 5C6TH 5J12B 4XP5L 4D9RD 5JZ7D 2ZOXA 3STZA 1H6EA 2AQSA 2UBPC 3LRSA 1FYTB 2B1AH 4AMWA 1VENA 5IBXA 3NSJA 5HHPB 5FI8A 1RA5A 3NQGA 3D4GA 5DVKA 2VVSA 3UJIL 3QFEA 4XD5A 2JMRA 3VFWB 4GAGL 4H1LH 1DDHB 2F7RA 3GF8A 4OUEA 4JRWA 1JG9A 4Y2LA 5CO1A 4B60A 1AW2A 2UY7B 3D1MC 2XM1A 4AXNA 3L7RA 4U6VL 4KOBA 3MO7A 1AH0A 4CBPA 3ITCA 1MFAL 3G5XA 1B90A 2Y5JA 1PYMA 3PY2A 4BZ2A 4EN3B 1BGAA 4JQ3A 2FGZA 3BPOB 4YSAA 5KJ7E 2OW7A 1UPPA 2IUZA 4Z7WB 4MG4A 3T3MF 1JFHA 2R2BB 1F2QA 2BNRA 4UILH 2E09A 2YBTA 5BJTB 3S6TA 1SZRA 3KVMA 3LHTA 2QCMA 5EN2B 3VNKA 3NPZB 3TBYA 3L17A 3GMOA 4M80A 5HWMA 2W9EH 3QR3A 1MUMA 2V5MA 4W9CC 4JFOA 2WKJA 3B9KA 3BFQG 1H0GA 3GSUA 4PJAA 3T4AC 5CJ8A 5FSEC 3URNA 5DR5H 3S3DB 3K4WA 4ZQCA 1OSPL 4I6KA 1IGIH 3REWA 1XLCA 5CSRA 2OA9A 1E5UI 4NDMB 4GAGH 1ORSA 2K0RA 1E71M 4BKNA 1E4JA 4S11A 2MHAA 4PWFA 4JY6A 5TPWH 4BWLC 4AX3A 4U1NA 5GS3A 2E40A 2QQ6A 4YSCA 4JPWH 1YY8A 1M2OA 3DGRA 1JZ6A 1P43A 3TBWA 2GIYA 3ZQXA 4US5A 3DX3A 3WLPA 1QX1A 3FB7A 5DD6A 4GO8A 4X6CB 4ZS6C 4LCCB 3PK7A 4ZTXA 5SWUA 3W9EA 1G0CA 1ZK9A 3GZQA 4IQEA 3ARZA 3KUMA 4JPKL 3KFTA 1IYXA 1FRGH 3PL6B 5ITBL 1CI1A 3CMFA 3LH9A 3B8YA 2DIJA 4HQQH 2NDGA 3U0HA 2QADB 9XIMA 1INQB 2BDNH 4R5XA 2V9QA 1XB6A 3UROR 1WKDA 2DLEA 3GHTA 3RTLA 1EXPA 3C9NA 4PJIF 3AS0A 1YMMA 4IOIB 2K9FB 5E1AA 4MMWA 4UTWA 4QRTB 4MYWB 4OQ1A 1KTLB 4ZZKA 4JG0L 4MMZB 4PJ5D 4JG1H 3LUTA 1EJ8A 3D18A 1UJPA 3KMDA 2YCKX 3QIWB 1OGTB 1SMDA 3T6XA 3EOTL 4XKMA 1FZJB 1PKMA 2F9BT 2WCGA 2Q6ZA 5FCSH 1GGOA 1F3RB 3KAAA 5FYKD 5CEZE 3DECA 2FTYA 5L4MA 5HMFA 2R7EA 2AHIA 4X4MA 1QVOA 4L1TA 1AO7D 3OKDA 3UTTE 5IB3A 4TTGA 2R1NA 3SGGA 1ICPA 1I82A 1CK0L 3S1GA 1HQ4A 5CNHA 2WLLA 3MOAL 2FX7L 5CS7A 2B9AA 2FR4B 3O6FC 3HG3A 5B1JC 5K59F 2KS0A 3Q6GH 4PREA 1UP3A 3MTXA 1W2PA 5F44A 5HGBB 2W5FA 5ABFA 1I45A 3TMQA 2VZTA 1E27A 3GSXA 1G1OA 3SQOL 4ENZA 4AD1A 4BQ4A 5ABTA 2ACSA 4PGLA 5BRZB 2CR3A 3A21A 1GYLA 4JRYD 1AHKA 4AXKA 3BW4A 3ALFA 1B0IA 1HKKA 1QNZH 3R06A 4HNUA 3MGTB 1WDSA 4APQD 2D1ZA 2EEAA 3HGJA 1FP9A 2H6PB 3BD4A 3KGSA 1CCZA 4YXKL 2XFGB 3OSKA 3WXVH 4C8XA 3MUAA 3GIZL 3H54A 2VC5A 2C9RA 4AKQA 3QDAA 1MREL 3QJSB 3C3NA 2ZZ6A 4F0KA 4G6JL 2QVNA 2JB5H 1GW9A 1SLXA 1OFOA 4QRPD 1J8RA 1LO3L 1FNSH 4NQEB 4OZGA 2GJZA 5LNGA 3GFXA 4E9RA 1BOYA 5LWYL 2XYBA 5TF1H 3VE7A 3GYRA 3MRRB 2OXHA 4L64A 1YYCA 2ZSWA 5E9DB 4X63A 3FUJA 5T33L 4CJ1A 2O61B 1QEXA 4NM8H 4HOZA 4HIJA 3LV3A 4G5ZH 1I7RB 2EUWA 4AIUA 4XPFH 4MX7B 5AEAA 1D5ZA 1ZT7B 5JIPA 4M1GL 4R2GB 3TW9A 5LA0A 2A6DB 3VD5A 1U58B 1QAWA 2WXFA 4WW2F 1GQKA 4M7LT 5I1KH 4WU5A 3RJXA 1KLFA 3ZE2B 3WLMA 3TX4A 1S9WA 4G1NA 3T9WA 4YXKH 4QXGH 5D71H 5EC2B 2VZUA 3K0YA 3LH2L 4FQCL 3LRHA 4A1RA 4BKLB 1QOPA 3N1AA 3NQAA 4BSWA 2RFGA 4W9TA 5HMSA 2VWSA 2NDFA 1D9EA 5MERB 2Y2YA 4O2EA 1MLCA 4DJDD 3GI8L 1OCZB 4AX7A 3ARYA 4KCWA 2OGJA 4GSDH 4UT7H 1LYXA 4PU2A 2W5PA 5B7MA 1GKRA 1TIWA 1TLMA 1AD9A 1UOZA 4YDJA 3TTSA 1F6KA 3NSNA 1LE5B 2OMXB 3GMQA 2FFCA 2O4MA 1KIRA 1E0WA 1KV8A 3D3FA 2HRPH 4KNTA 3S3BB 3W7KA 3SIKA 3MCMA 4KKCD 3ANUA 5HATA 1MCDA 4ES9A 5D7HA 1CW2A 4AVIA 3KVLA 4R5VA 4G7FA 1CTNA 5GRJL 5KANG 1O6VA 1PIIA 5GGSA 5FJPA 2D23A 5HNUA 4OFYD 2VZOA 1PZ1A 2JI2A 4UTFA 3O05A 4LAUA 5C92A 3O63A 2DOCA 4DVRH 1NKRA 3B7SA 3FFCB 2QCDB 3AMCA 1UCBH 4NZJA 1FBIH 3DG3A 1JV2B 1S5IL 3GC2A 3FFOA 1PQZA 2QR6A 3SPJA 3BO8A 4E9XA 4EBQL 1W72H 2DV6A 4WWNA 4Y4KD 4IFOA 2R27A 5KVEE 4HKXA 1NFDF 3O6LL 4AQEA 1VJZA 2YZ5A 3RWDA 3W5MA 5CCHE 4MD5B 5ETUB 4ZYKB 1RUSA 2GVLA 5REQA 1E73M 3L5HA 1GGIL 4HEPA 2J6EH 4X9YA 5J1TC 2GFTA 3KLAA 4R7NB 3P0GB 4YN5A 1ZLWK 3TMLA 2YSSA 3O4LD 2P44B 3ZE2F 1BZ9A 1HSBB 2B77A 2DQTL 3FO0L 1ERNA 4FI8A 5EU3B 3VWJB 1IAKA 2EKCA 1BD2A 1L7TL 2F19L 2X40A 4MXVE 3OR6A 1ODAA 4WK0B 4BY3A 4QMEA 2HJFB 3VH8G 4Q74A 2P52A 1GGUA 2ZA3A 1A5FL 4L1HA 5MEOA 2P8LA 4HLZH 1HL9A 2QSVA 3BC9A 4H8QA 3VRJB 3BMXA 5D1XA 1XL4A 2QQKL 3QUKA 1CBGA 3NEEA 1I0DA 2VZSA 3ZTJG 2DVXA 4NUQA 3CYJA 1VESA 1AL7A 3L3JA 4Z7AA 3PXLA 4UIOA 2WMHA 4MJ4A 5FF0A 1N59A 2MCG1 4P9HL 1V7NH 1FRBA 1CB4A 2BDQA 3S1VA 3C6EA 1Z1WA 2JELL 4F27A 1Q38A 2CDGA 4HJGB 3MV9A 4L0YA 1QKZH 3OJVC 4FNTA 1W72L 2CJTA 1V6XA 2PDJA 3OA5A 1U93B 3WMPA 1GZGA 4LV9A 1SW7A 3JVGA 3QYCA 3MRMB 3VW3H 4KU1A 4DNHA 4QE1A 4DKEH 1IAMA 1MH5B 2JK5A 3OLIA 4P2RA 3O3EB 4UINH 3QV8A 4XPHH 2B1HH 4YPGA 1JCNA 3C8HA 4V1DA 1LBMA 1W56A 2J12B 5DHMC 2EPOA 3V5CA 3ARBD 1E8YA 5ADOH 5I6KA 3WF4A 3W7OA 3PJSB 2D31B 2I60H 3G1DA 5JXAL 1OWWA 1CDHA 4O9HH 2XWBB 4CN6A 3EWUA 5EUKA 2OMVB 1GAFH 3BKML 4B5NA 3SCRA 2R0LL 3GD6A 3NJNA 2A6JA 5ECUA 2R39A 1OZMA 5CZVL 1LD9A 1WE5A 4ZB2A 4KQ3L 2P80A 3O0LA 4CC1A 4WIQA 3FO1B 1QLRB 3T8QA 3C09B 1AS6A 4CKQA 4YHYC 5U7SA 4AQOA 4GSDL 4UT7L 1M42A 1O1HA 1XIWB 2EICA 3KBFA 4I7UA 5I30H 3EB2A 1GPOL 5E09A 1HXYB 1M2VB 2AQ2A 4YSRA 2XX1A 4R97B 1BG1A 2FZNA 2OPCA 3RDTA 5DJ8A 4S1FA 4KMTH 3WIHL 5C2UB 1TG7A 5D9OA 5K2ZA 4QHPA 1KSRA 3NN8B 2A73A 3B7UX 5FWQA 4O19A 4OF5A 1FN4A 1BM3H 3QRGH 5TGBA 4DFIA 3GVQA 3CT2A 3TJPA 2RGLA 3PV7A 3A12A 4HS6B 5MEQB 3MBXH 1NWSA 3ZLHA 2Q3XA 1SLUA 2WV3A 5KSAA 1FCCA 3BLFA 1J9CT 1RQ5A 5AW3B 1TKWB 3BO9A 4AD5A 5C8BB 3A13A 5DD3H 5HK4A 1EANA 3BOLA 8RUCA 2DEXX 5G5IA 3L9RB 4OJEH 2ALDA 1ZT1A 5EFFA 3W6MA 2YAEA 3EYFB 1DL7H 4I9MA 2VDLH 5CZ0A 4GLRH 2P42B 4ODTL 1I7TB 4Y4FA 4YSEA 5HBBA 5FO7B 3VOJA 3LKQA 3JWDC 3STCA 5IFTA 1N10A 1A1OA 3GU2A 5CPMA 4I3SL 2V38A 1CLYH 3RWCA 5AB9A 2XICA 3K2KA 3ML9A 4ZUVB 1EJUC 4KS0A 1XF5B 1HWGB 3IFNH 1YJDC 5JPMC 2J7CA 2C3VB 1XCTB 1Y18A 4YN3A 3F7YA 5T1DH 2VDML 3SQBA 5KINA 4KVCH 3WJWA 7REQB 4QNPF 4JTLA 4ACZA 1WAAA 4MY1A 5ILTH 3RUGE 1JHLL 2ITFA 4ALAH 2B5IC 2AJZB 3O3BB 4GAAA 4C58B 3MRKB 4O14A 4LGPB 2OM5A 3EYUH 3V6BR 4J5VA 4KXCA 4P9ML 2PMZA 4H00A 1LZOA 4ZQPA 2F2HA 2L3BA 3S4SA 3GI9H 3H2WA 4HULB 3MGOB 3DGGB 3FL7A 3WFZA 2PAJA 3K6SA 1H41A 1Z42A 1I8KB 4JGDA 4I77H 4WO4C 5HPCA 4IX0A 2VSDA 4X4YA 3VIHA 4AIZA 4MWAA 3AT9A 3FPXA 1AJZA 4K7PY 5CUSH 1E4XH 3N9GH 1UWEH 3S2NA 2OKOA 2KT6A 3IFLH 2PWGA 3QGKC 2JIXD 2DLIA 5EUOE 2XIMA 1D9KB 3X14A 4AGQA 4D94A 1ICSA 4RZCB 4D8ZA 2Z31B 2VDRB 3EDJA 3FN9A 5JR1H 2C3XA 5KW9L 2VW7A 1OYCA 2P1YA 4P3DA 4AH2B 1NIUA 3WUWA 4Q4MA 2QEZA 1KTDB 4MRBA 4TS6A 3X1NA 4AB4A 2NUWA 5A2CA 2AXGB 2ZE3A 5KMYA 3WBDA 2INFA 3PWJA 2AEPH 2Z31D 1N26A 1N2RA 1CXIA 1V6UA 5LQBH 1C3FA 4ZPTA 1DUZB 1DTUA 1IL1B 3KR3L 1JFQL 1H5BA 2PDPA 3RAOA 5HHQA 1ZVSB 3RX2A 3SADA 1HILB 5F8QC 5T1JA 1MRDH 4QXVA 1FUYA 4IHOB 2ZOTA 5I02A 2UWEA 1YN6A 1U3NA 4JFYB 4GW4B 1HZHL 4KEUA 1QQDB 3KHQA 3C5QA 3U0TA 4H8NA 4INFA 2YRZA 1XR2A 4PEKA 1EMTH 2UXFA 3WQDA 2HVKB 4N7QA 1Y7VA 1YEHH 2EH8L 1I1AC 1AXIB 3NQKA 3VXOB 3LG3A 3ZDXE 2AAAA 4GY4A 5DYFA 2CWRA 3OG4B 5TQ2L 5EU5B 3C56A 3V5OA 2BVTA 3SBQA 5DRZB 1NIAA 1Y07A 5DMGD 2IKGA 4WKHA 4PGDA 4TLKA 4K07A 3MLRL 2VEMA 5J6GB 3OGOE 5A6LA 3A3WA 4PGBA 4YHLH 1D7CA 5JQHC 5E08H 4P3WA 3EO1B 3AW5A 3WDQA 4C56A 2CBMA 2VAAA 3UDWA 3BWAB 2FVKA 1TV8A 1PKQE 3GVVA 1IFRA 3PP3K 4TLUA 3VRLE 2PDGA 3G6AA 4PUEA 2XN1A 3CC1A 4HLZG 2ZONA 3CDZB 3L4YA 4OI7A 3FYIB 4WFHE 4RISH 4HIEA 1EC7A 4AZCA 3W0WE 1TJ1A 1JV5B 4M7JL 2BHZA 4M8VA 2OJEA 3ZHLA 3IMTA 4WF7A 4Z7QF 1SPQA 3E02A 5BU6A 4IQJA 2EDRA 5TE6H 3RAJH 3URAA 3J27A 4QNPE 1OP9A 3VU2A 1LL7A 5F0PB 4RNRB 4Z2JA 3A6BH 4P9MH 1KCXA 2QLYA 5FACA 4XD6A 2TAAA 2FHCA 3ZKSD 4JFDE 5D5MF 3M44A 5JOPE 1NJ9A 3KNBA 4PP2B 5IR1B 2EUVA 4KNQA 4OD3L 3D4YA 1GUVA 1W3TA 3NQCA 5HNNA 25C8L 1URIA 3FW6A 2A7NA 1AGFA 2WSDA 3TJHD 1EZSA 1YA5A 3PXJA 2WKLA 2WGNB 1VBRA 2VFDA 4C7FA 2YLHA 1BLNA 4KK5C 5DO2D 3ZE0F 3SDOA 3CFEA 2NZLA 5DDHB 1VBUA 3QEHA 1BP3B 3CHQA 3QULA 4OZ4A 4PHZA 3V5KA 5HNTA 1IZKA 1UOWA 1ZOXA 2E9IA 4H2CA 5TH2B 4DO7A 2V5RA 4WJG3 4FQ1L 3RCNA 2GSGB 3V6FA 4U3SA 4Y9BA 2ZUNA 2W9LA 4MM1A 7TAAA 3W0WA 1B4KA 4IK6A 1DQJA 1FZMB 2WJEA 3VVWA 3THQA 1KY7A 1TCRA 3VNZA 3AWOA 4CNUA 1BZQK 1U3YA 5D70H 2VJXA 3SIMA 1JK8A 4HNTA 3RB5A 1AFVH 4FYRA 2ENPA 2I26N 5I2IB 3RR1A 2FJKA 1AQHA 4JFDA 4Z7VF 5SWSB 1PY9A 4N2BA 4P2RE 4OHQA 5C71A 5K3VA 2ZUVA 4DHLA 1BBJA 2DQXA 1ZGDA 4R8WH 2PPCA 1TJHH 1ACCA 3IM1A 2OMZA 3KW7A 2VLME 2ZKHL 3LIZA 1EAQA 2NX5E 2Q6WB 3ZUCA 4E41A 2OMAA 1TA3B 2VDMB 4OF7A 4PJCA 2OX5A 3NPSB 3TCSA 3B4YA 1A25A 5D1ZD 4XHJC 2A3CA 2E1DA 3LCHA 2VUKA 5H2BB 3K2MC 4Z0XA 3PWPA 3VUAA 3U1SL 4NQCB 3N34A 3N6HA 1M7PA 2O9RA 3K1DA 4GZIA 4LLQA 4XVTL 3VFOA 4GZJA 1WSST 3N40F 3K5RA 3SDXA 4LVNC 2XG5B 2ARJA 4W9EC 3WIAA 3QOKA 2EKSA 4P3CH 1X6LA 2QQLH 4PRHB 1GOGA 1NAL1 4K3JH 3VC6A 3QIWC 2FL5A 1W9DM 1B3VA 3ICJA 1KENH 5C0GA 3DHPA 3UZQB 2J8FA 4FQHB 3U0PA 3MV01 1X5YA 4OQTA 2DICA 4N2HA 1R3IL 4ONGL 5EOTB 2ADGB 1N55A 3ISIX 3UBXI 4FA7B 1D3HA 3VKJA 4A3HA 4G6JH 5EEZA 1GORA 3TKFA 1ZHNB 5GRVL 3QRLA 1YW1A 3WMCA 1V8HA 1KCKA 1KV3A 1VS1A 4QG9A 3ZM8A 5IMKA 4BQ9A 2VLKD 4IJTA 3S36L 4WI5A 3S5OA 4J2MA 3QORD 2VCOA 3AZRA 2N1KA 1JNHB 3RITA 3CLWA 5F4WA 5HI5D 3SE8L 1FH2A 3V0WL 2A6KB 5I1JH 3QC5X 5T33H 1R38A 2WXOA 3PUEA 1S7TA 1FFOB 4QGCA 3TR2A 2WLJA 5CGTA 5D2YA 1V79A 4JFDD 4MQ7A 3U1SH 3QNYB 2GK1B 1HP5A 1HI6B 3OKEA 4HJ0D 1JGUL 4RE4A 4URIA 1S3KH 5KVFE 4F8NA 3T0EC 5A6SA 1IT8A 2GSGA 1W3HA 2IBBA 3NWRA 1F73A 4YFLI 3RP1A 2XJKA 5FWRA 1Q72L 4L18A 3QUYA 1C8VA 3RK8A 1CE1L 1TPC1 3CFEB 4MCMA 2ZOKB 2EDDA 1D2PA 3GJFK 4WHYH 1KIPB 1T03H 5KANI 5IG7B 1DBBH 1XGTB 3IKCB 2ENYA 3P11H 4IRSA 1HE7A 4M6OH 5BMFL 4IFKB 1Z0MA 3TOPA 1IGSA 1AC6A 1IC0A 4BUHA 5A43C 1FTXA 2P5WA 3QWOA 1P6CA 3BOXA 2VFGA 2JQMA 5CZRA 4CNIA 1ETB1 1CECA 1UD2A 1W0YT 3RGVD 5KN5B 1JUKA 5FYLL 3FVDA 2DWEB 4R27A 3ES6A 2WQRA 1MEHA 1QPXA 2OG9A 4LT7A 3V0FA 1OX4B 1JGVL 1SXZA 2G3MA 1LO0L 5EU4B 3C2OA 4FI6A 1XGPB 4QRSA 3SE8H 3PG8A 4XC1L 3TYZA 5LA1A 1O60A 2AK4D 4H88H 2PDHA 3D7PA 1GOIA 2E9MA 2I5GA 2VXQL 3GW3A 4E8GA 3CDZA 1Z9SA 2IANA 4KKQA 3U83A 4PCFA 4OUOA 1T6BX 1XAKA 3C5XA 1J1OH 5EIIG 5C8JA 3S9IA 4C56B 1ACZA 1BF8A 3DIDA 1EWDA 3MBFA 1XT5A 1EXUA 3H26A 4IPLA 4YUEL 1JRHH 4JKWA 5FW7A 1TSIA 1BVKA 3K2UL 3QHTC 4WY7L 3UR5A 1MUJB 5ACZB 1A02N 5JYLA 5H2BA 1BZ7A 1QA9A 4A3UA 4XZLX 3UJSA 4I85A 4BR1A 3COTA 3VXOA 5D8WA 1ZEAH 2VDKB 3DDFA 3GNPA 2CKBH 1BGXH 3L4UA 3SKNA 3WTWA 1ZJIA 1FFPA 1EGJH 1UCTA 1USZA 4KXAA 3AITA 5FEZA 2XISA 1BBJB 4B6ZA 2VD8A 2VW4A 2QJJA 1F1GA 4GQRA 4HCFA 5GISL 2Y5TB 4HETA 3FY1A 2Q86A 2E8YA 3GRWA 2ZSVB 4Y1TA 3ZYIA 1BA9A 1FIGH 1NCJA 2Z65C 3GFUA 4CVXA 1NFPA 1UKSA 4FGMA 5FKPB 4YK4B 3NCYP 3IVKA 3E9AA 5SWZE 1A9EA 1AVAA 4L8CA 1R17A 2G8ZA 1ADDA 4EIGB 5A40E 5A16B 1WDRA 2OX4A 4BK5C 2OZ4H 3CZLA 1U95A 3ZTNL 1FZMA 3QJZA 4KAQL 2R0KH 1DQIA 4DP4X 3W2KA 1DQJB 2ZCGA 2DWTA 4O15A 5TD4A 4N5EC 3TFKC 3W9DB 3SRHA 3WD0A 1YBQB 4L4LA 3WIJA 4Q8UA 3APTA 2I9TA 3RHGA 4PY8I 2GIMA 1QKZL 3OKYA 4FTVE 1TOXA 4K71B 4U1JA 5GGVL 1H5YA 3M0KA 2NCMA 1ZFJA 3OLEA 3GTIA 2Z31A 2QUMA 2BC4B 2B4CC 2IADA 1F05A 4M5ZL 1TMCB 4FNLL 4WI9A 3T6QC 1NL0L 3CFDB 4FQXB 1E4IA 3DN5A 4Y16C 5ISZE 4X60A 3H6AA 1VPQA 4JTQA 5GIRB 3NGBB 5ADOL 1NCBL 3EDKA 1JZ4A 1EPVA 2I9EA 3Q5TA 3FF7A 3M9YA 4LUSA 2YO3A 3T65B 3IGKA 4MWAB 3WE1A 2XYLA 4GZ7A 2BFVL 1ECZA 3FTGB 3RA7H 3RBSA 2YUVA 3BAXA 1KJ2A 4P5MB 4PTUB 4JG9A 2KUTA 2PTYA 1N0LA 4HJJL 4RGOL 3VWKD 3FH8A 1L3WA 2H7WA 3PHOA 5JORB 5HUOA 4ZFMA 3WH9A 3CFIC 4HNOA 2D8KA 5FS5A 2HMIC 1JDEA 3RGBA 2GWGA 4F37K 3AU1B 1XMEB 4WQ6A 3DKLA 1NDMA 3T4AA 1WC7B 2OP4L 2XFRA 3HZ3A 3VB8A 43CAA 2GCYA 4JDZA 4CVZB 3H56A 4LVOB 4ACZB 5E93A 5GZNC 2DVTA 2DZBA 1G6CA 4QHKJ 3LIZL 2P48B 3DBSA 4LUTA 1C93A 2XVNA 2HTMA 2O0TA 4R9OA 4WHTB 1MF2H 3QA3A 4AKPA 3DHFA 4B91A 4G8GB 1AKJA 2OMBA 2D03L 4QXUH 3Q05A 1NC4A 2INEA 2PI6A 4PJHE 2WW5A 3RWIB 4H26A 2LQRA 1JZDC 4Q14A 3PQYB 4LO9A 4IIHA 4Q6XA 1G5AA 4WJXA 3U0WL 2R69L 3ESPA 4X4ME 1WDWA 3QV6A 1T1XA 4R6UA 1L6PA 2BIPA 4RAUB 5B4MC 4EOWL 4GPVA 4WGHA 4XZUA 3V0AC 1UR2A 4HIIB 3PULA 3NCMA 2KHAA 4MHHI 1F3WA 3X1GA 3RR4A 2UWEB 1OP5H 2NY2D 1P53A 1DVZA 2D3VA 2RBLA 3DVGA 1QLFB 3FT4A 3KPRD 3P2TA 4Y9EA 1I8MB 4KY1L 3NVTA 1AH1A 1J4EA 1AI1H 1JVLA 4OV9A 4QLWA 1C9SA 1LDPH 2Y5EA 3QNXA 1PEZA 2CDEB 3B0VC 3NN8A 1KBGL 2BS8A 3NOIA 4UT9H 4QAMB 4A2GA 1JF5A 2ZP9A 3ABKB 3PWJB 3JWNG 1Z2KA 3O45A 4Z3HA 3MRQB 1NM9A 5CSGA 5AFAA 2AXGA 5HI4C 4XNBA 2ATPB 4DM1A 2Y7EA 1Q9WA 4XPGH 3O9WC 2C7UB 2CNCA 1GYAA 2V69A 2DW6A 5MEPA 2X4RB 4QT5B 3L1OL 3VD2A 4E2BA 3W6LA 4LCYB 3TC6A 3VCLA 2FGLA 4ZEPA 1OALA 2AZAA 3V8CA 3AXXA 3HPFA 3GMLA 4N02A 1X97A 3MNVB 5F88A 6FABL 3VNLA 5MHBA 1F7BA 3WS6C 3U2IA 4BRJA 4UUJB 2CJUL 2LOEA 3OC5A 3QAZB 1X3DA 4MCYB 4MQTB 1KM5A 2HPIA 5D33A 1HAUA 1XBRA 3WY1A 3EOEA 3RWFB 4V1DB 2JLLA 2B59A 2W9EL 4GQZA 4Z7WE 2Q8AH 4DI9A 2CHRA 5ICZB 1ITQA 3DVNB 4YE4H 4YCPA 2ZVIA 2I5YL 3TAKA