4NXKA

Crystal structure of abp-d197a, a catalytic mutant of a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
431
structure length
431
Chain Sequence
b'ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 149
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nxkA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nxkA01
1JF6A 3G3DA 3G1VA 3DX2A 2WKLA 1M7OA 1N55A 3FJ6A 3S9YA 3VGFA 3O1NA 5HWNA 3BLFA 4JTFA 4DF0A 1NOFA 1L6SA 1KW1A 1QOPA 2Z6JA 2FH8A 3AXHA 3W9ZA 3GX9A 4UXDA 4UOQA 1UKTA 1NSJA 3F4NA 3R89A 4UCGA 3THQA 1PJ9A 1KFJA 1WX0A 1VJIA 4KFNA 1HO1A 4JFSA 4K39A 4O52A 1G9HA 4K36A 1GQNA 1KM5A 4FXRA 1DORA 4M56A 1F74A 4BK9A 2VELA 9CGTA 5LHFA 4M6PA 4UQ9A 5T26A 4DBDA 3W1TA 1Q4NX 1F76A 1X7FA 1XUZA 3CEPA 1DEDA 3KWXA 3LRLA 3HB9A 3SR7A 1XKYA 4AW7A 1GG1A 1VPXA 1R33A 3SGUA 3W37A 1VZWA 2FH6A 3H53A 5LNSA 1R34A 3BGJA 4MKNA 2Y4SA 3LTYA 5LGXA 4XWUA 4DXVA 3EWWA 1JUKA 3LHZA 5DO8A 1LM1A 2FHBA 1ZJIA 3SGZA 4ADSA 4LVGA 3DDFA 2PWFA 1SO4A 3C56A 1CGUA 3SZ8A 1AW2A 3BUQA 3NVTA 2E0PA 3DHPA 1S5WA 2PCQA 5FEZA 2D3LA 3GR8A 3UPWA 3RFAA 4PEEA 5FI8A 1MW1A 3T40A 3NPXA 3HBLA 1T96A 1QWUA 1H1ZA 5HINA 3A9IA 4BF9A 2YFOA 1R2RA 3NYZA 2ZUVA 3ECQA 3AO0A 3PBUA 3D4YA 1FDZA 5BMXA 3TW6A 5CGTA 1BVZA 2EABA 4XTDA 1MZHA 3GVGA 4MZ8A 3QYQA 3PVFA 3TR2A 3KLKA 3QJAA 1F05A 3NQ6A 3ZWSA 1K8XA 4I7UA 5KSWA 1G7UA 1ZJAA 3QSRA 3DFOA 1CXHA 3TJLA 3I7QA 5HR6A 1OFBA 3LCHA 4GXMA 1TTPA 1BPLB 1KTBA 1K7XA 2WVVA 4NXSA 1VAHA 1H61A 3M5YA 3KRUA 3P67A 3WDHA 2D2OA 1M5WA 3UWWA 1VYSX 2Z0IA 4NU7A 2VT0A 3OLIA 1VYPX 1G5AA 2Z1KA 1ZALA 3GKAA 1VFOA 1IGSA 4GO9A 3BG5A 4H7VA 5LSMA 2P1FA 1P1XA 1YDNA 3O07A 3NQDA 4O17A 4HNTA 3EWYA 1FQ0A 4UFLA 2OZ0A 4KKXA 1SU5A 3BK0A 3ZSSA 5CSSA 3ZQ9A 1CXEA 4MPQA 5E0KA 1SW0A 2NX3A 2A4AA 4HSNA 3IGXA 3T7VA 1OB0A 2YYTA 1TQUA 1WXJA 5A6LA 1D7FA 3EX2A 5DBUA 3QEZA 4JY9A 4DO4A 4ICNA 3ZR6A 1JCXA 1S5VA 4JIPA 2OW6A 3K8LA 1KWKA 4Z1DA 3NL2A 3KE0A 2YIHA 1R30A 4EWND 4G1KA 3STCA 3UWVA 3EB2A 3BUIA 1OX6A 2Y7EA 4JGDA 3ZOAA 1ZAJA 2YW3A 5L9FA 1W9XA 1E43A 1VFMA 1JD9A 1GCYA 5K2ZA 4IMDA 5TIMA 1UA3A 4O1CA 3CGTA 2ZRWA 1SSGA 1TRDA 1EUAA 2E09A 3P82A 4JXCA 3NO5A 3VM5A 1B4EA 2OT1A 3NGJA 8TIMA 5IBXC 3L65A 3GZ3A 5AHNA 1PCWA 5E1QA 1DTUA 3T55A 3S0CA 2FIQA 5EL1A 5EA9A 1CLVA 1QW9A 2WCGA 5TQLA 3DX0A 4XQ6A 2F7QA 4QISA 3HG5A 3NQGA 5DN1A 3S2CA 1GVQA 5HWJA 4AWTA 4J3WA 3QSTA 1IXPA 1EIXA 1UA7A 1GPWA 2H8XA 3W86A 3GLCA 3W2KA 3MHUA 3QGVA 2OJPA 4JICA 2CW6A 3E02A 5FEWA 2E6FA 4N9CA 1EO7A 3LXCA 4RR4A 1MW0A 1F7BA 1KBJA 3EKLA 3PSWA 4GE8A 4O4WA 3NM3A 1KBKA 3F4WA 3P7YA 3R13A 4MFEA 4M19A 3O06A 5AOUA 4FNRA 4WSKA 2R94A 3LB0A 4IMFA 3W2LA 3BVWA 3F03K 4DPPA 4NJKA 2XVKA 4IOTA 4Z1AA 2ABAA 4FNSA 4JYFA 4M5PA 1BTMA 1A50A 3W7RA 1CDGA 1HNYA 3D4ZA 2ZUUA 1SR9A 2G5WA 1QR7A 2OMAA 3BV4A 4XBKA 2G3NA 5CG7A 3THAA 3WN6A 5K9DA 3W07A 1F5ZA 4K7YA 2E5CA 1FDJA 3LPPA 3TIMA 4LPCA 1IXQA 2B7QA 4OWGA 1KM4A 4JTTA 1ZENA 1GOXA 2BWGA 2TSYA 3HF3A 3M5VA 4J3UA 4BI6A 4J3SA 3DHUA 2PRLA 5CZSA 3QMRA 1QDSA 1CGTA 1LORA 1RQBA 5D03A 4JTHA 5D30A 4AHOA 1PZ2A 1EP3A 1LRTA 3EWBX 3RLUA 4DO5A 4J28A 1JCMP 1Q3NA 1JQXA 2QEZA 3MYOA 1CXIA 3M0ZA 3W7QA 3HGRA 3QQ0A 5AHFA 2QAPA 3B0PA 4N4QA 2XN0A 2QPSA 6TIMA 2D73A 1TREA 3WDJA 2NUWA 2YPIA 1PL9A 2BX7A 4JL1A 1H50A 1KBBA 3NPVA 5AHLA 4DEFA 1TPUA 1QHOA 2PRMA 1CGXA 2I14A 1KTCA 5A6MA 2QJIA 4ADTA 1YXYA 3B0UX 5TD4A 2ZBTA 4RX0A 4BWLC 2ZRVA 3MWAA 1OT2A 1H1YA 4YXGA 1UD8A 3MBDA 3L4UA 1KLYA 2NUYA 3WY1A 1B2YA 4WF7A 2V2HA 3C0JA 3Q37A 5D2TA 1H3GA 3WJYA 4MFDA 2FYVA 2ZWZA 1VS1A 5FESA 3FS2A 4POCA 4CVWA 3STEA 1XH0A 3BAWA 2W0UA 3VNYA 2ZA1A 4BI5A 3SIZA 1UH2A 2CU0A 4IUOA 2ZRUA 1MSSA 4OU1A 3OEXA 4WSJA 3IJ9A 4X0NA 3CM4A 1PIFA 1QNVA 3DENA 3GR7A 4MY8A 3FKKA 1VLWA 4OT7A 4PCTA 4O8RA 2BY0A 3LI1A 3S8HA 3W87A 3GYEA 5H91A 1SO5A 3WJSA 3WK0A 1YXDA 3OLGA 3HPXA 5F2MA 1KM1A 1TPC1 3MI6A 1UB3A 1P0NA 2ZIDA 1HL2A 4NJJA 4PSPA 1P0KA 4FIRA 2VNCA 1I8JA 1T99A 4AYSA 3KL3A 3LCIA 1HG3A 5HJLA 4WZHA 1I2QA 4AEEA 1B3OA 1W5MA 3CPRA 1V3MA 3NL5A 1ME7A 3C2OA 4HT3A 3K30A 4H8UA 1NF0A 5SWUA 3BVTA 1QPNA 1A53A 4LC6A 4CCDA 2RDTA 5AYZA 4FLOA 2OYMA 3S5YA 3WELA 2X16A 1JXKA 3GDKA 5EPDA 2VEIA 1JJKA 2OT0A 1U5JA 1TMHA 2QAFA 5FF3A 3EDDA 1MW2A 1S3HA 1LLWA 3TNOA 2ATSA 2ZRZA 3HG4A 3LXAA 4EIVA 5J5RA 1E3ZA 1EX5A 1TCMA 2YJQA 1UH4A 1XBYA 4HOWA 3OLDA 3W2NA 3HQ1A 3WMSA 5E6YA 4ZL1A 3PC0A 2VFGA 2C8NA 3GXNA 1XGZA 1WZKA 1PAMA 1XH2A 2GVJA 4CLMA 1GG0A 3W84A 3LHTA 2FDSA 2GJPA 4DO6A 2VFHA 3Q58A 1QPKA 1UKQA 3N14A 4S2CA 4LNYA 3G24A 2Z6IA 2ZRYA 4N2YA 3BUPA 3IRDA 3WNLA 1M6JA 3EWZA 3HJEA 1FWTA 4X9SA 4UNIA 3C2RA 2FPYA 4NT0A 4PSRA 4AEOA 4RKAA 3NDOA 4AAJA 3LI0A 3EWXA 3O8AA 4I7VA 4M6QA 4S1FA 3I7SA 4HNNA 4IMGA 1XSKA 4XBSA 2HS8A 3W72A 1FX6A 4UFJA 5KITA 1W37A 1EP1A 2ZRXA 1VRDA 1PHWA 4O50A 4RV8A 2Y6ZA 4OV4A 3LRMA 1K02A 4U2YA 3TXVA 4YLWA 3GXIA 1R46A 2Y70A 4BFAA 4NNAA 3NL6A 1KM0A 3DU0A 3STGA 2ZE0A 4LU0A 1ICQA 2WNQA 3PB2A 1D9EA 3VM7A 1QI5A 1THFD 3AXIA 4E2OA 3DX4A 3KVJA 3BCDA 3GIYA 4ZQRA 2O7QA 3P74A 3P8IA 3W70A 4Y96A 2BY1A 2H90A 2EPHA 1WE5A 3VE7A 3BW3A 5KZDA 4PH6A 3AMKA 3VGBA 4WUIA 3GDTA 1D3GA 3FW6A 2BXVA 3INPA 1TO3A 2E6DA 4QIUA 4EVZA 4UQDA 1EH9A 3TUUA 3L66A 4QNEA 4PCSA 3DI0A 1QO2A 1UASA 2ZFAA 3CWNA 4RCXA 3IIXA 2TAAA 3LX9A 1SZGA 1KXTA 3BCFA 1FWSA 3CQ0A 4E2BA 2A7RA 2ZDRA 1OK4A 3QZEA 2FFCA 4Z1CA 2GVGA 4FNQA 1NM9A 5K3VA 3HGOA 1JULA 1O4UA 5CLWA 4GFSA 3LHUA 4OE7A 1YADA 4ORIA 1EUNA 5D32A 1B4KA 3S42A 2GQAA 1N8FA 1V7YA 3ZT7A 3CZKA 2AMGA 2YA0A 1TB3A 2Y63A 2XIBA 3M16A 1FXPA 1G4PA 4I7WA 2EKCA 2CLIA 3EXSA 4LVAA 5CSRA 4LRTA 4UTKA 2BHUA 2WVUA 2C14A 3W1MA 3L4WA 4O15A 4CNNA 4FEZA 4QNWA 3G0UA 4OHQA 1MXSA 2CFFA 1C8QA 4LXFA 4UFKA 2GJNA 1V3KA 3W38A 3BO9A 2ZYFA 3BPWA 3DZ1A 1CPUA 1ONRA 3I6RA 4HPXA 1ZFJA 2F7OA 2GJLA 4MAZA 4UZSA 3LGEA 2Q8ZA 3WNMA 2OYKA 5DCBA 4IJBA 4RZ6A 1GJPA 1J4EA 4NJIA 1QPOA 5E70A 5G4WA 4JTSA 3TW7A 1W5NA 2VKZG 3B06A 2Y5EA 4ADUA 3NA8A 1GVOA 5LNUA 1YLVA 2C6QA 3W2JA 1OJXA 1WZMA 2A2IA 3TTSA 1YYAA 4UIOA 1JCNA 1H51A 4DBEA 4JTIA 3UWUA 1ICPA 3SECA 3LM7A 4OQVA 4OV9A 2WANA 5I3GA 2CLMA 3A47A 2QCEA 3K8MA 3NQMA 1QPRA 3LCXA 4YMZA 4CQ9A 2Y89A 1R47A 4IXHA 4NQ1A 4B9YA 4XB3A 5K7JA 3QPYA 4OKDA 1GYNA 2VFEA 1ICSA 3B8DA 1OFQA 3YPIA 1LZOA 1V5XA 4NNCA 2BSLA 2W79A 3PG8A 4LUJA 1F6KA 1RP9A 2Q3OA 3WNKA 1XD1A 1TTJA 3TX9A 4IPJA 5CLTA 2YYUA 4J9JA 3L4TA 4XTIA 3OVRA 2J27A 5G2IA 1RPXA 1QPQA 1H7RA 3E12A 1EO5A 5MHBA 1GYLA 5HDRA 3WNNA 1NF7A 4ZQPA 5J5DA 4NXKA 4D2JA 5D2WA 1CIUA 4DQWA 1X1ZA 3HO8A 3L5MA 3WJXA 4BA0A 2DZVA 1DKWA 1MFVA 4UMBA 2E1DA 5K4XA 5AHMA 5CZJA 1O60A 3A6OA 2V2DA 2PWEA 1X6UA 5D2VA 1HX0A 5E6ZA 3BVVA 4J3XA 1FDYA 2OSXA 1SQ7A 1TPH1 1BG9A 1DQWA 3DX3A 1SPQA 1TQJA 3E49A 3MW7A 5BMWA 1PS9A 4AHPA 1G7VA 3FEMA 4NX0A 1W0MA 3G1XA 3I65A 3M1ZA 3OVQA 3W1UA 5G1TA 5HULA 2AAAA 2P10A 1CX9A 1H62A 3E96A 3UY8A 1TMQA 2WSKA 3W1PA 1ME9A 4E2DA 1Z44A 3PUOA 3RK8A 3ZR4A 2I1OA 1FWRA 2QDGA 3BAXA 3W1LA 4JCLA 4AB4A 4DF2A 5LKYA 3LCFA 5C5YA 4XZ9A 3HPSA 3L21A 3L4ZA 1PV8A 5HUOA 4Z08A 3F1QA 1VYRA 4AEFA 3T44A 1EWEA 3DFPA 1K3UA 4GKLA 2NT1A 1JI2A 3IGUA 3AJ7A 2QUUA 4UTTA 1OHLA 2VEKA 3ELFA 2FQIA 2DIEA 3IVSA 3SW6A 1KXQA 4FHAA 3UD6A 2XWEA 4MOZA 2BY2A 3LCGA 3DFNA 4MZYA 1A47A 4Q32A 3D50A 1Q45A 1U33A 3WNPA 2QKFA 2QMKA 3C2VA 3TH6A 1QX1A 2Y7FA 3FYPA 3HZ3A 4LRSA 1JDDA 5HMSA 1HVXA 3P5YA 1MFUA 1PIGA 4I9AA 1OYCA 3CTTA 4LVBA 4N9EA 3LXBA 5FF4A 3QQ1A 3VKJA 3HJZA 5D37A 2ZICA 1KGWA 2V3EA 1SW3A 3BW2A 2CLFA 2KZHA 3VCRA 3C61A 4X22A 3WEMA 3PULA 1SFJA 1VCGA 1C8VA 3NXFA 3NQ2A 4A3UA 2V5LA 2C3ZA 1OGSA 1SMAA 3L9CA 4JTKA 3W7NA 2B7PA 2H6RA 1OK6A 1G94A 1G4TA 3B4UA 3TROA 3LBMA 3WY3A 3DKLA 2F61A 4NX5A 3SY5A 3H54A 5LNRA 1JG9A 3S5NA 2UV8G 5I3IA 3MJYA 3EKZA 3TU9A 4UQEA 3BG9A 4HN4A 2Y7DA 3MYPA 3DFSA 1XBVA 3W7HA 1KFLA 3IVTA 2EGZA 3Q94A 1JIBA 1WBHA 2ZQ0A 4NZFA 2DZXA 4Q4KA 2EADA 2I9EA 5CKSA 5FF2A 1PVNA 5LHEA 5CGQA 1XH1A 3CT7A 4IWWA 1V3LA 3GKFA 5D33A 3PBYA 3TFXA 4B9ZA 1VCVA 3A5VA 3BG3A 4KMQA 3ZT5A 3RMJA 1AW1A 4CKQA 3FYOA 3OLEA 3L0KA 1SO6A 1XFBA 1I2NA 3VX0A 2DZWA 4RXGA 1FCBA 5U7SA 3CLWA 2YCEA 3TV8A 4MY9A 1MW3A 1TCDA 2YXGA 4M6VA 3TFCA 4JIQA 3LTPA 4Y8FA 4NJGA 3UEQA 1PCKA 5AC6A 1EP2A 2J24A 3UCQA 3G0SA 4LS0A 3C6CA 1BAGA 2ZUWA 2GVLA 1CGWA 2J88A 4WX2A 2D0FA 4UTTC 3WK3A 1IF2A 1H7XA 4JFWA 4PL1A 4M7SA 1EB3A 1OX4B 5F2IA 1O5KA 3TQ0A 3W71A 1TPFA 4NZJA 1YTDA 3VO0A 1TQTA 3M7WA 4ZQCA 3ZO9A 1YPFA 3G22A 1YXCA 2E68A 1AL8A 1W8SA 5LNWA 4LVDA 1J0IA 4LV4A 4GI6A 3NZ1A 4JX4A 1OSEA 1Q6OA 1WV2A 2QMJA 2W6RA 5FEXA 4R7JA 4RJEA 2A6NA 2BXZA 2E5BA 3CU2A 3EXRA 3LHYA 2JKPA 1YDOA 3E9AA 1JL8A 1W56A 3I7RA 1AG1O 2DORA 1M7PA 3EJPA 1S5TA 3EWUA 4S2BA 3KRZA 3OG3A 2AQWA 1QWGA 3Q2DA 3M43A 4E0CA 3P61A 2A0NA 3BUDA 4WY0B 1R2TA 1A5AA 4OJYA 4JNMA 1VHCA 3A5FA 4UQBA 4H2CA 5G2WA 3W1QA 2BY3A 3G3MA 2ZUTA 1L9WA 4UQCA 4WQ6A 1TJPA 1DJNA 4CNPA 1DHKA 4WY0F 1AMKA 4MYAA 3LV5A 2WOQA 3EXTA 4U28A 2FLIA 3KLLA 4CQAA 1TPVA 3DGRA 4UMAA 2WJZA 5CZTA 1XV8A 4QQ3A 5DY2A 2NZLA 3A4AA 1AVAA 3KVMA 2G3MA 3EDFA 4AXKA 5AHEA 1I2PA 1IZJA 3N3MA 1M53A 2ZZ6A 1CXLA 2X2IA 1TV7A 2V3DA 2WO5A 2CZ5A 3WENA 1I75A 1XCFA 3DXIA 1OABA 3GDRA 1UUOA 3C2FA 1OFRA 1N7KA 4PC8A 1XCWA 3IIOA 4JCMA 2EEXA 3CLMA 3CWOX 2DIJA 1JF5A 2B7NA 3KOFA 1WOAA 3TMQA 3TK7A 2Y7GA 3O6YX 1UD3A 4GO8A 4K8EA 5G4EA 3W1AA 1HT6A 4ONVA 2A21A 1GJWA 3GB6A 2X1TA 2CLEA 2QCDB 4ZQMA 3QPZA 1BLIA 3IIVA 4NUWA 4O18A 1MVYA 1WAUA 4JTLA 4O14A 3NQFA 3N9SA 4WOQA 3PSVA 1IIHA 1XI3A 2JGYA 4A2SA 2YR1A 1KA9F 3II1A 3GXFA 2G97A 2R14A 2E5DA 1XSJA 3NQCA 1JFHA 2AAMA 2V82A 3W3OA 3CC1A 1GWJA 2AGKA 1FWWA 1KCKA 3FKRA 3L4YA 4TU1A 3R12A 3G0XA 5HNRA 1MWOA 3NL3A 4JTUA 3B03A 3C4UA 1ZHAA 1DOSA 4ML9A 2TYSA 3USBA 3S1XA 2BTMA 1RP8A 3W7DA 3ZSTA 3ATYA 1WYIA 3FJLA 3D0CA 4LS2A 3W7LA 3VGHA 5C6MA 1AQMA 3MHGA 2EHHA 3NOEA 2B4GA 4A2RA 3UG3A 1HTIA 1JRCA 2C18A 4CCEA 5EMYA 4C1KA 5CGMA 3NQAA 1QI3A 2F84A 3DH7A 1TSIA 1RQEA 2WKJA 3BVXA 5CPNA 5A2CA 3O6CA 2QF7A 1W31A 3W22A 3BLKA 3VE9A 5LZLA 4GIAA 4GBUA 4JD4A 4HOXA 2F2HA 1T0OA 1OFAA 2FJKA 1B9BA 2TMDA 1JDCA 1QMLA 3RF9A 1OX4A 5KTLA 5D02A 1G1YA 4PCFA 5HWMA 3QW4B 4JYDA 4IX2A 3TONA 1Z48A 1EPXA 4ORMA 3GBDA 1BWKA 4WXYA 4J3VA 1EA0A 3W7OA 4IPIA 4O13A 2WVSA 1S46A 1CXKA 2ZTJA 5EYWA 3WJZA 1WZAA 1TQXA 2WNWA 2BXYA 4FX8A 5AYXA 3GAKA 4ZZ9A 3VSVA 1OT1A 2QCGA 1XBXA 1DBTA 3B05A 4PEKA 4FXSA 1JVNA 2QCNA 3P81A 1DL3A 1DV7A 3PR2A 4BR1A 2NLIA 4M7TA 1U83A 3L2LA 4IMEA 4WY0A 1MEIA 5FF7A 3UWZA 2RH9A 1QCWA 1T8XA 4AMWA 2Z2UA 8CGTA 3HIJA 1CGVA 4O1BA 2CZFA 3GXPA 1JI1A 4J3TA 3BLBA 2FB2A 4AWSA 1QI4A 2ZZ1A 5I3KA 1MXDA 4Q33A 1HO4A 2GPTA 2F1BA 1PZ3A 1ZAHA 5D05A 2DH2A 3T4CA 2FGZA 2F7RA 1TQWA 5E93A 1HFBA 4MVAA 6CGTA 2DZUA 4FLQA 5AC8A 3BLIA 3SFKA 5FF0A 3GXMA 3U6WA 2RFGA 3MI3A 1XUUA 4AMAA 3TKFA 3MP5A 2VR5A 4H8VA 1TPWA 1W3TA 3UERA 3CZSA 1PPIA 3BAIA 1OF8A 1X1OA 5D2XA 1L0PA 4O0KA 3NQEA 2IQTA 5K4ZA 3IGSA 4UC5A 3JR2A 3MI2A 1BVNP 5GVJA 3BAJA 3G1YA 3RIKA 3BUBA 3M5ZA 1LLZA 3EDJA 1WA3A 1MEWA 2OX1A 1LRNA 4GUHA 4AHQA 2EO7A 3TOPA 4PODA 5I23A 2NV2A 4J7RA 1H7NA 1TJRA 2DJLA 2QCDA 1O7DC 2C1HA 1I45A 4RLIA 1JR1A 3TQVA 3BMWA 1KFEA 4JX6A 3ZR5A 3QFEA 1YTKA 2NSXA 1GEQA 4O10A 1PHQA 4Z1BA 3G8RA 3O05A 1KFCA 1XC4A 3VFLA 2ISVA 2ZX5A 1KLZA 3UG5A 3O16A 4PL2A 1Z32X 3TSBA 3EJUA 2QUTA 3MUXA 5D09A 4P61A 2XVLA 2WPGA 4A29A 2E6AA 2X1UA 3L5AA 3W88A 1GVRA 1GTEA 4EF8A 2D3NA 3ABRA 4K38A 2J25A 3ZWTA 1VCFA 1UH3A 1G67A 1EEPA 3L0NA 1BSIA 2ZCGA 3IV3A 2YZRA 3W7IA 2FB3A 1TQSA 1RPKA 1VB9A 1VGAA 3G1SA 4FB7A 2NX1A 4GUIA 5I3FA 4UTIA 5EY5A 1UOKA 4ZVJA 4NNBA 2C19A 3LERA 2WQPA 4EF9A 5DFAA 2VXNA 2WSYA 4H6KA 2RDWA 5AYYA 2XN2A 2ZXBA 1H5YA 2TRSA 4LVFA 2E4TA 2ISWA 2Y61A 5DY3A 3WDIA 3LOTA 1LOQA 4KWWA 5U4NA 3UWYA 2ISSA 4H3DA 1SZNA 3VX1A 4LC8A 2CZDA 5G1YA 5BNKA 3KAOA 1P5BA 2J9XA 2NXHA 4AMXA 1O94A 3D52A 3FAWA 1JDAA 1K7FA 3NNTA 5E0FA 1ZNNA 2V5BA 4X3ZA 3R5EA 4L4LA 1R2SA 3N73A 1ADOA 1A5BA 1EA9C 1XSIA 1JAEA 1LBMA 3QMSA 3LHVA 2Y2WA 2ZUSA 4AIEA 2CLHA 3L0GA 1WO2A 3W73A 2XFWA 3BMVA 3EJSA 1KV8A 2H8ZA 2EF9A 3CEUA 1D3CA 1X8FA 3LV6A 1LWHA 1QAPA 2E8YA 5LGZA 3UZJA 5DXYA 1U2YA 4RK8A 1OVDA 2X30A 3R2GA 3MP3A 2YKKA 2GQ8A 2ATMA 4Z0SA 3IVUA 3UYCA 2NT0A 4IX0A 3O6DA 1AL7A 2ZZ5A 2A5HA 3W76A 6TAAA 4JY8A 2FHCA 3HGJA 3N2MA 3W1NA 4UTWA 3ZT6A 3S1WA 1JXJA 4UTLA 2P0OA 4KWUA 4O12A 2LLEA 3GXTA 3M44A 2CPUA 2PWGA 1L2UA 1XL9A 3KVKA 3KXQA 4FNTA 2B7OA 4K8HA 1VFUA 4LQ1A 3JRKA 3L4VA 4O16A 5I3JA 1G4EA 3VI2A 2VC6A 4ZMGA 2Z1BA 2HS6A 3B04A 1J0HA 4GINA 1FXQA 1TV8A 1H7WA 3RLVA 2NXIA 1KXHA 5HXMA 2JK2A 4FMVA 1P6WA 3BW4A 2OSWA 3MHFA 2NV1A 3K1DA 4JN6A 1E40A 2WNZA 1OYAA 2V0TA 4JTJA 3VU2A 1LDCA 3W7KA 1DHPA 5HR7A 3V1PA 1ZCOA 3WJWA 2OW7A 2BLEA 3ABSA 2Y85A 2PRHA 5C54A 1JUBA 3M07A 2HSAA 1LCOA 1I2RA 4HKPA 4UNKA 5BW6A 4YL2A 4AF0B 3VGDA 1W54A 4U31A 2J9ZA 3PBWA 1LROA 1I4NA 1WQ5A 5L6UA 3GBEA 2V30A 3P8JA 3WK1A 5F7UA 2ALWA 3GAYA 2NX9A 7TAAA 4TR9A 2BZNA 3K8KA 4UQAA 5DELA 3HMJG 3G1FA 4IMCA 3BVJA 2DJXA 5AN7A 3BSGA 3RILA 1NAL1 3TSMA 5CZ0A 1F2JA 3IIPA 4Y90A 3W7MA 5CPMA 4Y6GA 2A85A 4UFHA 5IBXA 2VFIA 5D38A 1JUEA 3BLEA 4PTNA 2JKAA 3WY4A 4DF1A 4MJZA 3CHVA 1KTNA 3BLPX 2OCZA 1U30A 3L4XA 4GRSA 4XKYB 3SSJA 3OVPA 1IZKA 3BAKA 4GUJA 3P84A 1W5PA 1XBZA 4LS1A 4WOZA 4N9BA 4E38A 4YWIA 3EX4A 4UTWC 1VH7A 4R53A 1AK5A 3M47A 5D2YA 3M9YA 1FCUA 3EEGA 2X2JA 2ZA2A 3EJQA 1FUYA 1KFKA 3IIZA 1UKSA 5F2LA 1CI1A 2NWRA 4MYXA 3UXDA 5LNVA 2R8WA 3M41A 3TMLA 1VQTA 3PAJA 3VNDA 3N9RA 1D3HA 1OFDA 1HXKA 4FIQA 2QLYA 1LOLA 3ABQA 2ZZ7A 4MB1A 3WFZA 2VENA 5AFDA 4TMBA 2NXGA 3NR0A 3FA5A 4O1DA 1UCWA 4O0ZA 4DPQA 3GNNA 2JKEA 3KFTA 2PWHA 1FBAA 1LTDA 2X1SA 4GNJA 4HIBA 4IQLA 3EDKA 4RZ4A 3TXZA 1HUVA 1XXXA 5EMUA 2FPVA 4N9DA 3I68A 2DP3A 1K7EA 1ZJBA 1NVMA 1OYBA 2CLLA 3HOJA 3W7EA 3L67A 2VRKA 2PWDA 4PFMA 3UG4A 4U2ZA 4Y9AA 5DXXA 5F1VA 2YW4A 1KB3A 3S5ZA 3W75A 2ZTKA 1FCQA 3C2EA 2QCLA 1J2WA 1FY6A 4NVTA 4GI9A 4LV9A 2WCSA 3LDVA 3DFTA 1J5TA 1CW2A 2V2CA 4MY1A 2YA1A 3V75A 4GJ1A 1PEZA 2YGYA 4JEQA 2C15A 2QUVA 3HGSA 4CQ8A 1O5XA 2JBMA 3L2MA 3W2MA 3L2IA 1OX5A 3LTSA 3PB0A 2VUYA 5IM51 4FO4A 5BRPA 1DQXA 2IGTA 4N6FA 1ZAIA 1KFBA 1XDMA 3IJ7A 1LBLA 1LP6A 2ABBA 1E51A 2F18A 3LRKA 3FAXA 2GVYA 1GTHA 4JL2A 1JD7A 4ALDA 4BWLA 1QO5A 2XWDA 3OA3A 3TAOA 2XIIA 2ZZ4A 5F1UA 3EX6A 2A6LA 3CZLA 1JRBA 1G4SA 3PWAA 2GUYA 1G69A 2A1YA 3QH2A 1C29A 1KM6A 5K9CA 3O63A 1K8YA 3FOKA 2WNNA 4ZQNA 2A7PA 4P2VA 4JTEA 2J9YA 5C55A 5D04C 5A5WA 2ZWYA 3L68A 1FCVA 2GOUA 5EBUA 2C7FA 3QC3A 4WJEA 3KHJA 4IGHA 2CZEA 3MMTA 2HTMA 4O54A 4RZ5A 3ZFHA 4CNOA 4DELA 4OIFA 2VOMA 1RZMA 1K03A 3KVLA 4X2RA 4O11A 4FLSA 4JR5A 3DC0A 5HPOA 1SSDA 4A22A 1TPDA 4GUFA 4JFVA 5EKYA 4AF0A 1OF6A 1O95A 4QAWA 2G95A 3FLUA 4CGTA 3G18A 2GQ9A 1Z42A 4JFTA 3SJ3A 4HPHA 2VEPA 1WZLA 1J0KA 5AB3A 4NI3A 1VC4A 3RU6A 1GT8A 3GNDA 2D0GA 2QCCA 3FFSA 2RHGA 1UD5A 1SZFA 3C8FA 2YDAA 4TIMA 4LTSA 2WKGA 1Y7VA 5AHIA 1GJUA 3NQVA 5G5IA 4QJ1A 2WSRA 4OGZA 2G96A 4HSOA 1KV5A 3DX1A 2ZX6A 1JCJA 4LY8A 1TV5A 3QMTA 1LYXA 3DFQA 1W5OA 1F73A 1QW8A 2A7NA 3KX6A 3VMNA 2PURA 4ATWA 2E6YA 1KGXA 1CGYA 4FX6M 1BF2A 1Z41A 4MIMA 4XKYA 3PUDA 1PS3A 4MLRA 1B57A 3NG3A 3W23A 4UFMA 5I24A 3UQNA 2Y62A 3VGEA 5F4SA 2BHZA 1WPCA 2DZTA 4U4MA 1IIGA 1PE1A 3KRSA 4N02A 1LRQA 1ML1A 4GWEA 4O28A 1L6WA 1W3IA 5CPOA 1RQHA 3LLDA 4MZ1A 3TJXA 3PF3A 3W7JA 4TO8A 5A2BA 2QR6A 1TIMA 3EDEA 7TIMA 3C52A 3DDGA 3T78A 6ALDA 3WEOA 1BKSA 1XCXA 2EAWA 5AC7A 3W85A 1W1ZA 3L5LA 2NWSA 1I2OA 1TTIA 3CTLA 3UZ5A 3W1RA 1NEYA 3EX3A 1SFLA 3CZGA 3QW3A 2WVTA 3E0IA 4EOUA 3GK0A 3DBPA 2EACA 1UJPA 3TAKA 2ZXAA 4UOZA 4UFIA 4HNUA 1XD0A 2YA2A 2NUXA 2V8ZA 5I5RA 3IK2A 3NQ8A 3W2UA 3QRHA 3W1XA 1QWNA 1IXNA 2C0AA 3GDMA 1K8ZA 5KZMA 4GQRA 5KINA 2TPSA 4FF7A 4JX5A 3A21A 3S5OA 2EJ1A 1JQVA 1WDWA 3P5ZA 3QF0A 4K6AA 2B0MA 4K37A 1UBSA 2XN1A 4BZYA 2DZSA 3ABOA 4H4IA 1AW5A 4NJHA 4UTMA 1VIWA 1KCLA 4UZUA 1LBFA 2CWNA 1TRIA 3EJTA 4O53A 2V9DA 3VSTA 1W3NA 2Y88A 3CZNA 3TQKA 2D0HA 3VNZA 3BH4A 4UMCA 4JDYA 3LCWA 1SO3A 4UNLA 1XM3A 1UD4A 5A8GA 3UNDA 3NZRA 1AMYA 2JGQA 1CYGA 1HWWA 3H55A 4R34A 1SUXA 2OSYA 4XUGA 5I3HA 1YTEA 5TBOA 5ABTA 3EJRA 1MO0A 4GUGA 3OIXA 4UTUA 3D51A 1SMDA 2QJHA 3STFA 2WC7A 1Q6QA 1C9DA 4UCFA 1H63A 1EWDA 3BGGA 3EX1A 5C2XA 2ZA3A 5H2ZA 2R91A 2YSWA 2ZXDA 3TCEA 5KZEA 4M8UA 1TPB1 2ALDA 3DKJA 2E9BA 4J27A 2EQDA 1KGUA 3S1UA 4O57A 3UY7A 5DCDA 3A22A 2ZX9A 2GUUA 3P60A 1GZGA 3WK2A 4LW7A 3PBVA 3N34A 4A21A 1HL9A 4FX7A 5F4XA 1OFEA 1Q6LA 1AQHA 4QM1A 4C1LA 3TE9A 1H7OA 1VJSA 4O4VA 5BRBA 3LHWA 4CN1A 2C16A 1OG0A 4WXZA 2Q3RA 1GVIA 2F7PA 2V3FA 1R75A 4HPJA 3U8GA 4N6EA 3W6YA 3G1AA 4CN4A 4U3CA 2QCHA 3A24A 1Q6RA 3TC6A 3UXAA 1FWNA 3CV5A 4AYGA 3WFAA 3MO7A 2H3BA 3GXDA 3NM1A 2FPTA 4AVFA 4ZQOA 4MLJA 2ZX8A 3VMOA 4UR7A 2WV8A 3PS7A 3TTYA 3QM3A 1IXOA 4Z0JA 1ZY9A 4O19A 2Q8LA 3TDFA 5A2AA 1OFOA 1H60A 4LT9A 3LLFA 2QPUA 1CXFA 1E3XA 3BC9A 1ODUA 1HTYA 1BEUA 3P80A 1GVSA 4AIOA 1SW7A 3TSDA 2F1AA 3AMLA 4KFOA 1LWJA 3W83A 3NQ7A 2PC4A 2RDUA 1LOSA 4K7VA 2WSQA 4WD0A 4JTGA 3PY2A 2QCMA 1UD6A 4JDBA 2VEMA 3IJ8A 2HMCA 2ZZ2A 2DU2A 4X9YA 1KM2A 3BARA 3NAVA 1M7XA 3WNOA 3C3NA 3P62A 3PM6A 2CLOA 3W7GA 4TMCA 5DBTA 1W5QA 1HL8A 3N2XA 1UUMA 4GI8A 5DLCA 3W7PA 3LPOA 2X2HA 4HP5A 1VR6A 3GDLA 2XVGA 2F7FA 5K9XA 1B0IA 4FLRA 3M6YA 4QITA 1F6PA 3G8EA 1P4CA 3S6DA 7CGTA 4UUIA 1MEHA 1KWGA 1DJQA 4IXXA 2GJRA 4H8HA 3VSUA 3WY2A 2V81A 1WP6A 3TA6A 4HHPA 3HPZA 5G2HA 2YOCA 1TQVA 1YPIA 2Y24A 4HOZA 2O7SA 2X1RA 1NFBA 3FIGA 2RKXA 3BVUA 3RNDA 3OBKA 3B0VC 4W9TA 2VFFA 3UWQA 3R8RA 1ALDA 4PA8A 3KL0A 4JYEA 2E77A 2YX0A 4UR8A 5F2GA 4LUIA 2ZZ3A 2FHFA 3DAQA 3CZEA 2E8ZA 5KMYA 1UD2A 4CN6A 3KEHA 4N4PA 3M5XA 3ATZA 3NEVA 3S1VA 5FEPA 1XDLA 2CXGA 1A5CA 5BRQA 2X2GA 3PUEA 2QJGA 2FE0A 3VMPA 3CPUA 1SZEA 1KBIA 4B5NA 4FNUA 4JFUA 3ZS4A 1KM3A 4CCCA 1TYGA 1RVGA 3BAYA 4TX9A 3UPBA 3HG2A 4QAIA 4RXFA 4UTJA 2DH3A 2PE4A 1RR2A 3PG9A 1JCLA 1H7PA 2ZX7A 2WVVB 3GTNA 3DHFA 3NPUA 1L6YA 1DVJA 4L4MA 3ANYA 4UTHA 3G1HA 5BOOA 2H3DA 1TPEA 5HUPA 1TTQA 4W93A 1GVFA 3O15A 1KXVA 4JS3A 1PIIA 1Y0EA 1WOBA 1J0JA 3AJXA 1RD5A 4GQQA 5I0DA 3SI9A 3DI1A 1RV8A 4GC4A 4OBTA 3VGGA 2CLKA 3CB8A 2FTPA 3HG3A 1WBJA 2QDHA 2BHYA 1QHPA 3BSHA 1BWLA 4O1AA 1G6CA 2QV4A 3TC7A 4KWVA 5DCEA 1QFEA 3W74A 4BI7A 3KL5A 3LCLA 4HNVA 4KFPA 2C13A 4AWUA 1JGIA 5HQEA 1IV8A 5KEZA 1QOQA 4YCPA 3DHDA 4HA1A 4MUZA 2WSPA 4AH7A 3G1DA 3W7CA 1EHAA 4U33A 3OHIA 3JS3A 1VHNA 5F4WA 3CIWA 1ZS2A 3N19B 1VLIA 3NPWA 3IEBA 4TVUA 4R33A 3U2OA 3MP4A 2VFDA 2OYLA 4LOCA 3CIXA 3MBFA 1OFPA 5CXPA 1MXGA 1A5SA 2QCFA 3LBCA 2EAEA 4MJMA 2WPBA 1ME8A 2VRQA 1V3JA 2CHNA 5E9AA 3A23A 4LWWA 2ZXQA 1JCYA 5CPLA 4QSHA 4FNPA 2DZPA 4YCOA 1YDVA 2YFNA 4WLCA 2J6XA
chains in the Genus database with same CATH superfamily
1N8IA 3D06A 1WFIA 4CEXC 1DBMH 5EU4B 3PXHA 3NZPA 4F7EB 3D34A 8FABA 3AMCA 5FDWA 4K39A 4ACTA 3BH8B 3TCSA 2JJUA 3MZTA 3UZZA 1DEDA 3SR7A 3RI5F 1A22B 4J1UA 1WS7A 4IIDA 4P49A 3OR7A 2DPKA 4M3JA 5JQ6H 4PUKA 1AP2A 3DHPA 1S5WA 3T3PB 4BK5A 4UM8A 4XCCH 5LLIC 3KAAA 4HSAC 4ATLA 1WF5A 2OX5B 3FL7A 1LE5B 1M6OA 4N0UB 4P7QA 2PDHA 3PBUA 2BERA 1KMGA 3INOA 1PL3A 3PRZA 1K8XA 4KRUA 1FE8L 4Y2DC 2ID5A 1TTPA 4NN5B 1FNGA 3RPIB 1ZOXA 1ZALA 5H37A 3B9KD 4GO9A 1IGIL 4OCMC 3BW9A 3VH8G 4XHJC 4O17A 1Y18B 4TVPH 1Q0YH 1FNEB 2JKLA 4DZHA 4CAGA 5E0KA 4C6QA 2B14A 5FF6A 4NDMA 5A6LA 2APSA 4ZT1A 3I50H 2F58H 1DJXA 3T5WA 4DO4A 3GSUA 5A3ID 4YYCA 3F12B 4EWND 5E9NA 3BUIA 4GUPB 1CYXA 1MHPH 1QBMH 3L1FA 2H32H 3NN8B 4P23C 2ZRWA 2NYYC 2P52A 3SDXF 2IH3B 3MRMA 3I9GH 4HDIB 2F7QA 2VDOL 1H1NA 4X6CE 1R3KB 3T6WA 4FQXD 1VFBA 4U1JA 1W1YA 5KSVB 3DSFH 5BVJA 1OP4A 3N40P 5DGRA 2FVKA 3QQ3B 1DBML 4M43H 4XUYA 2BS71 15C8H 4NJKA 1UGNA 2AGTA 4FYRA 4EN3D 5IMMB 2BNRB 5JO5A 3MV11 3CUIA 1FGVH 1TTGA 3UGUA 3IJSB 5AAPA 4F15C 4DN3H 3BXWA 2XX1A 3IWPA 3NFPA 2HJLB 2XZ9A 5JQ6L 4MQTB 1KYUA 3B9DA 1KRCC 2IBGA 2BJMH 5AHFA 4XCCL 3OWEA 4XMVA 4B50A 3G1RA 2CBVA 2FIKA 5A6MA 3ZGHA 4AQOA 3BO8B 3WIAA 3VWKD 5JW3H 3UDWC 4PMYA 1HAWA 3O0KA 4HWBL 2FYVA 4DJED 3QQNA 3D0LB 3CFBA 1XYBA 4IUOA 1YEFH 3SBWC 3CM4A 1VFSA 4TVPL 3D2TA 1Q0YL 5C07B 5FB8A 4RGMB 3EPMA 1LLOA 4PWHA 3TO2A 5C09E 1QVOB 1HL2A 4NJJA 2VNCA 1T99A 5BQ7B 3A4JA 3K6SB 3I50L 2F58L 4C47A 5T3ZD 5EU6B 2XPKA 1NMCC 2O5ZH 5C9WA 1JK9B 4MA3B 3BVNA 1QBML 4U1KA 1S4IA 1SFHA 3NCYS 2NTFA 5DI8B 3LXAA 1TCMA 2YJQA 3O41B 1KNOB 2OULB 4NGHL 1JAKA 3MB9A 3FV9A 4L2YA 2QF8A 3I9GL 1USZA 1JGVH 3MUAA 3KDMA 3ITOA 2P5EE 4YC2C 5LG1A 3IRDA 2I9LB 2OL3H 2JKWA 3UYOD 3DSFL 3THUA 3QWQB 4XP9L 4PW9A 2Z35A 1DBJH 4I7VA 5IB3A 4M43L 2FEEI 2K4AA 4XN4A 2CLZB 15C8L 5KVDH 3SCQA 3QIBA 1U41A 2JJTA 4NAEA 1X4XA 4U2YA 1MZZA 3ULUE 4HJGB 4IBQA 2NX5D 4BFAA 1FGVL 3BZEB 2ZONA 3FFCE 3E9TA 5F0PB 4DN3L 1IEVA 2AC0A 5HJYA 1V7NH 2WYIA 1DVXA 1DDHA 2BJML 1O12A 3BSZH 2WWMC 1J8KA 3SKOB 3J27A 4PCSA 4LYRA 2OCJA 1SJCA 3QRBA 5JIPA 3MLVH 1RZJC 4WEUD 1JCKA 1RJZA 2ZDRA 4E2BA 2FFCA 2GVGA 4FNQA 3RHGA 1QLRB 1RJPA 2OMXA 4P3CH 5EB9A 5JW3L 3FO2A 2XXMB 4LK4A 4UILH 3M16A 4CU8A 5GJPA 3EXSA 1ZHNA 2QJDA 2BHUA 3ARGA 2C14A 5ICYA 2NR6A 3GSQB 1MXSA 1XLGA 1VENA 4PRHE 3I6RA 5GS1C 1YEFL 4NP9A 5KBDA 4XVSH 5B38B 3D48R 3JV0A 1AQDB 3HBQA 1LF1A 2DDXA 5I19L 1MUMA 4XNBA 4ZJ9A 4YWGH 2DI7A 2WTRA 4U1IA 1INDH 3TTSA 3S0PA 3P4NA 2YQGA 2O5ZL 3AVEA 1TENA 3PZQA 1QPRA 3RVWC 4JG5A 4MTMA 2YD2A 4IXHA 4CADB 5F89A 1IFGA 3GSWA 4NAMA 4OKDA 3TOYA 5I6LA 3EBIA 1RP9A 2CMRH 4FXGB 1U3NA 3P2BA 1JGVL 3U6XS 3BLLA 5CJXC 1A6ZA 4NYYA 2OL3L 2EYSA 1DLFH 2PDWA 4L9DA 4B3VA 2HFFA 3GG8A 4W4OA 3N6HA 1DBJL 4ILSA 5F72S 1A7QH 5KVDL 3QFJA 4FFVD 2E9IA 4DXXA 1PZAA 4G6AD 4AHPA 2A74B 5AW4B 1LILA 5CBEA 4XO4A 2P24A 4NENB 2IXUA 1JZEA 1H62A 3E96A 5AKQA 3NPSB 2OV0A 4D8LA 1FQ9C 3ZR4A 4ZX6A 1C08B 2VDQB 5E9XA 1V7NL 1INEH 3GZOA 1SY6A 4PLOB 3BSZL 3RNKB 4A2FA 4F2MB 4AL8H 4NM4H 4UDTA 3MLXH 4FHAA 4R7DB 5BZXA 2ODOA 4ELMA 1T83A 3MLVL 4M7ZB 4WW1A 5BJTA 1SVBA 2TRHA 3MV8A 2QMKA 3N18A 5IB5A 3TH6A 3L1OH 4PBFA 4LRSA 4P3CL 4AZCA 1ZWIB 3FULA 3QDJE 3QAZB 4UILL 1J5OH 4N9EA 2ZICA 1GQKA 3OQEA 1WCBB 2PCFB 2IANB 1C8VA 4XVSL 3L9CA 4JTKA 2V2WB 4Z23A 3MSRA 3GG0A 4U1GB 1HH6B 3MRQB 5GRZA 3DETC 5LIWX 3W26A 1FL5A 3DFSA 3U82B 2NW2B 3MJ8B 4N0FA 3IVTA 2EGZA 3GC4A 2WMIA 3ILDA 4YWGL 4RMRA 1INDL 2CESA 3SY6A 5D33A 1M9WA 2A9BA 3LEXB 4KMQA 4ZBCA 1FCBA 2BNRD 3OJVC 4JMNA 3OXRA 2P26A 1MUCA 1HXYA 1TQBC 1NIFA 4DBWA 1REIA 2CMRL 2WHKA 4NO5A 1TPFA 1TQTA 1MDAA 3WAJA 2Z0BA 5LNWA 4LCYB 1DLFL 2W6RA 4RJEA 1MFCH 2WQ8A 4Y4KC 4XP1H 1XFCA 4ZW3A 2X10A 1U8HB 1A7QL 1P84J 1KBWA 4UTFA 3V5HB 4JNMA 1FLRH 4ZMVA 3QY8A 5G2WA 4YDMA 4O02B 2RQEA 1GGIH 3OSVA 1BIHA 3RKDD 4KJWC 3K2UH 4LOFA 3KYOA 4CQAA 1S78D 3Q7JA 1XV8A 4H9ZA 3CFDB 3VD4A 1CZ8H 4PP1D 1INEL 3WEAA 1IZJA 5C07D 2X2IA 1QTPA 4G42B 4KTEH 4AL8L 3MLXL 4ZGYA 4ROPA 3JTTA 2WAGA 3WX7A 2ADAA 2B7NA 1R8LA 5GNZA 5C3TA 3L1OL 2ED9A 2CLEA 1UWYA 2I7SA 4ZFZB 1J5OL 1GCFA 4N2CA 3ITVA 1XI3A 4GLRI 4S39A 2B0SH 1E8ZA 4A2SA 2E5DA 1XSJA 4IKKA 2JB6B 1LNUB 4NN6B 1XLJA 3FKRA 3ZKNC 1V4YA 4HCGA 1IGTA 1M1SA 1ZHAA 1R24A 4QS5A 2ICEB 2AEOA 3VZYA 3ZSTA 2MSPA 3VGHA 4D9QD 3KPLA 1RSYA 5DZLA 5EMYA 4KKAC 2DLHA 4FQ1H 3BQVA 5D2NE 3AWGA 4IOFD 1OTUC 1G1YA 1NIBA 1QNOA 2WQAA 2DQ6A 3E2SA 4Y16B 3QW4B 4Z1YA 3TLQA 5FJTA 4PGLA 3WJZA 3EKCA 4AV4A 3I75A 5FKAB 4NZCA 3B05A 1JVNA 4RFNB 1DL3A 5C6PB 1U83A 2VVSA 3TBSB 1WT5C 1MFCL 4XP1L 4OGXH 4X2UA 5K59E 4X5RA 4C83A 4HA0A 3VCLA 1G0CA 4EBQH 5MENA 4L1LA 1U3JA 1JUFA 1M71B 3W00A 1FLRL 3LKPB 4DOHB 1XUUA 3QNXA 2YPLB 3QEHB 5AVUB 5HVHB 1GGIL 5AQ0A 3K2UL 1FH9A 1UWUA 3PWUA 4JFDE 5I16A 1BVNP 1F6AA 1CZ8L 1E70M 4B5XA 4G1EB 1ZBCA 4J7RA 2BIMA 2CIKA 4PS8A 1XR2A 4KTEL 2NZIA 3BN9D 1I0DA 5F1NA 1PHQA 4PUUA 2QVTA 2Q1EA 3TNMB 4PGCA 2J44A 2XA3A 1J8HE 3TT1H 3O16A 1Z32X 4G1NA 2I9TB 2PTVA 3SPIA 4TLSA 1T04A 2G5RA 3GIPA 4HK0B 2B0SL 4HV8A 3HI1B 3L0NA 4S11A 3KBMA 4RCAA 3USZA 1TQSA 3VD3A 2W66A 2IGFH 1E0XA 2EKSB 1GQLA 1XYMA 5BRZB 4JIHA 1G4RA 3K46A 3VX1A 1TJ1A 3FB5B 2D7NA 5C9JA 2R9HD 3K4AA 3R5EA 4KO7A 4AIEA 2X5PA 5FJOA 5CBBA 1NBVH 4OGAD 1TFVA 4RE0A 1B3VA 1XYFA 1X8FA 5T5NF 1JHTA 3UZJA 1DXEA 2CRIA 4E0RB 3RO6A 1HKLH 2NQ9A 1IAMA 4MKMA 3LKSB 1GYUA 3SN1A 3CQFA 5EZIH 2BVOB 4TS6A 3AZTA 4LCWE 4G43A 5LAPA 1K5NB 3QJRB 3DIFA 4OGXL 1DQTA 4UM9A 1IM9B 4OD3H 1YA5A 4EBQL 2ZT9C 5JHDE 5FDYA 1J0HA 3LY0A 3B4NA 3EO1B 3QDMB 4MJ4A 4P8UA 4PIRF 1ZMYA 4W9JC 1OYAA 2XU2A 3PDOA 1ZCOA 1EWHA 1HDMA 1P9MA 4NSKB 1R38A 3A4FA 4GIRA 4LSSH 3VGDA 2YC1A 4F2BA 3SURA 1TZGH 2DJXA 1QHQA 1RZGB 5KYYA 1NAL1 3TFBA 1ZT4A 1XS2A 4IPNB 4U1NB 1ZPTA 3TT1L 5TFSH 3SSJA 2ICWJ 5D6CB 1ZLSH 3WXVH 4S23A 2ATPA 1D5BA 3M0XA 4PJAE 3X1NA 4L4TE 3NSJA 3DV4B 3EJQA 2MCG1 2IGFL 1AZNA 4XZHA 5LNVA 3RAJH 3TMLA 4C54A 4IMLB 3CXHJ 4Z3EA 3FT2B 3QIWD 2YL9A 5EMUA 3HOJA 1RUPH 3VIGA 1AIFB 5T3XD 3UG4A 3LXUX 3S5ZA 2ZTKA 2IO5A 3LDVA 1XMWA 2DEPA 2XWRA 4AK2A 2YGYA 2QUVA 1XPGA 1WDPA 4D6DA 2W0FA 1NBVL 5KVEE 4MB4A 4YN3A 1XDMA 3ANUA 1HKLL 1FJ1B 2GVYA 5IQOA 3VFWB 4ALDA 5EZIL 4K3EH 5DMLA 2ZSVA 1G4SA 1TG7A 2AZAA 3QFDB 4DRSA 1YNTB 3L68A 2EXTA 3F6LA 5EBUA 4OD3L 3MMTA 1LE9B 3R8GA 4OKVA 4F24A 5CEWA 4FLSA 1C93A 5GS0D 4A22A 2ICWA 3W5MA 1CVSC 2V2XB 1RUKH 3MCOA 3PP7A 2GK1B 2G0LA 3C8FA 5F0JB 1AANA 2YDAA 2Q86A 4LSSL 2AJYH 1CFQB 3S98A 1UB5B 3H2AA 3BE1H 1TZGL 1I7TB 3RQ3A 4QS6A 1NDYA 2JF6A 2Z27A 4LKCB 3BWAA 2BHZA 3L7EB 3R18A 1LRQA 3WQ8A 4YJZL 4P5RA 3VIPA 3QJFA 3X3GH 5DMKB 5F7DB 5TFSL 5FK9B 3C52A 3DDGA 3T78A 1ZLSL 5CN2A 2CLVA 4HKJB 4OZIE 2OMZB 4Y16D 3WXVL 1IT8A 4DAFA 3VRIA 3KOYA 2BP1A 3NK4A 3EZ8A 4K55A 1K4DB 1KUMA 1G84A 3RAJL 3S2NA 3C5ZA 3N1FC 4LO9A 3GU2A 4U10A 1I85C 2J8GA 3C5JA 3D1MC 3THDA 3OZPA 2CHZA 1RUPL 2VISB 3T0EA 3OKLB 4KKBC 3V2AR 4P2RA 4IPLA 2NZ1A 5ABTA 4GUGA 2YPLD 1EWDA 3BGGA 1LJYA 1CICB 1P7KB 2QKIA 3MRLA 3C2YA 2X7VA 5AVZB 3DKJA 3MV7B 2B4CC 4K3EL 2X7LB 3P60A 4PRAA 4W7VA 4FX7A 4QM1A 2Y1AA 4G5DA 3H4XA 2C16A 4WXZA 1OG0A 1YY9D 1IT7A 1MNSA 2R0ZH 3S6OA 4EQ3A 3HS9A 1FVEA 1LP9B 1T5KA 3TH3T 1ODUA 1HTYA 2Y3AA 1BEUA 3ULAB 4D6EA 1EJ7L 1SW7A 4JRYE 4GACA 1RUKL 4BFIB 4KFOA 2PC4A 5HHOE 1DBAH 2ZJSH 3HUJA 4X7TB 3N0PB 1UBPC 2DU2A 1J5SA 2AJYL 1M7XA 3PM6A 2CLOA 1VERA 4HZ8A 4GI8A 3BE1L 3KWWB 2PTTB 1XGPA 4W6XB 4QITA 1C8PA 2EDHA 3DHJA 2QL1A 3D2UB 2DM2A 4HHPA 3X3GL 1MFAH 2DQUH 4W9TA 3NIDE 1VF5C 2ZG3A 4HWEH 1MNUH 3VDGA 4PRTA 2F53A 4XC3H 4EANA 2WWCA 3L3KA 5D5MB 1ADWA 1X6LA 5DVLA 5AKVA 1PF3A 1A5CA 4F3FB 1HILB 4GP4B 3BJLA 4FNUA 4NQCA 4HK6A 4TX9A 3U46A 1FNHA 3BD5A 4IRJB 3S83A 4MBRA 2WQRA 2ZX7A 4LLVB 4HHGA 3O15A 4D0BB 4EMZA 5E2UH 4QEHA 2YSSA 2C1PA 4L37B 3FT9A 4PJGF 1AE6H 3QDMD 2DWDB 3VUPA 3DJ9A 5ENWB 2C13A 4AWUA 4DYJA 2ITCA 4QRPB 4MUZA 4B2DD 1EHAA 2YGQA 3WGVB 5H8PA 4G8GB 5J6GB 5I76A 2IMRA 3PWGA 1Y1UA 4Y2OB 5JOPD 4LWWA 3QUZB 2OMTB 1UEMA 4WHTA 4Y2LA 4XKMA 7ODCA 5AW7B 2R0ZL 1M7OA 3BWUF 5HWNA 2GY5A 2XV0A 2DSZA 4JHVA 4N0RA 4I87A 2F6AA 4IBUA 3W3BA 5BV7H 4LCCB 2E7MA 5CSBA 1DBAL 1Z8AA 3QKZA 4M56A 1L0XA 2ZJSL 4BIKA 1Q4NX 1F76A 3ZKMD 1E55A 1RXLA 3LRLA 5SWZA 4XBGB 4FMFA 4L9LC 3AIRA 5LGXA 1ROCA 3LHZA 1LM1A 5DUBB 3RG6A 4KCWA 2VO5A 3GR8A 3SUTA 1P5VA 2WMPB 4OCXH 4YYFA 1E9QA 1T96A 5HPMA 4R90H 1MFAL 2DQUL 4DGWC 4YAQB 2LAAA 8XIAA 1FDZA 1A6TB 1SXCA 1WBZB 4HWEL 4DVRH 2GT9A 4XC3L 1XJBA 2APXA 4X98B 4NRXB 1O7SA 3RGBA 1YN6A 2HRLA 6PAZA 4FN0A 1JZHA 3OLIA 1VYPX 1EJWC 4NP7A 1W3JA 4Y1TA 3F04A 5EU3B 3FONA 5DRNB 2V5KA 2EE0A 1X98A 4LCRA 3GPSA 5E2UL 2A4AA 1DUYA 3IGXA 3ZLQC 4JJHA 4F5CE 2Z65C 4PFEA 2R51A 4A7QA 5DBUA 2HK1A 1AE6L 5AC4A 2PPDA 3VUAA 1OZMA 1OX6A 2Y7EA 3RRXA 1SF5A 5AVYB 5A2KH 1GYAA 5CIPH 2FJHB 2WQXA 3VM5A 4GKSA 4AJYV 3D85B 5G2NA 1PDYA 3E2VA 1BBJB 5D2LB 4WV1A 1YHPA 3AS0A 2OTWA 4NO3A 1QRNE 2DQJH 2EIZB 4E3VA 1HYSD 4YR6B 3CIQA 2HXTA 4GE8A 2X9YA 5CZKA 1J01A 1UA6L 4TNGA 3QWRD 1HL4A 3DX6B 1HJVA 3LKQA 2JJSA 3VFMB 4FNSA 5LDSA 5BV7L 4ZSOE 3PP3K 2J2ZA 2PCEA 2G5WA 1QA9B 2WLJA 4XAWH 1GZJA 3V36A 3SRKA 2KDGA 4JZJA 4RISH 2PRLA 4C56A 2EBNA 5D30A 3UOAB 1DQQA 3D3VB 3IACA 3K2IA 3WHE0 4LAOA 1OPGH 4OCXL 1K6WA 4R96A 4R90L 2I14A 2P46B 3P4LA 3ZZ1A 2ZOLA 4TVSa 2V7HB 5M1TA 4DVRL 1KULA 3X1BA 1V02E 2GPZA 3AQZA 1UWFA 1CICD 4JVWA 1JNEA 2Z91B 3MV7D 3FU5A 3VNYA 1FRGH 3TYAA 1CN4A 5BO0D 1R3YA 1KTKE 1DANT 1VPOL 4MHHI 1UXMA 1V6VA 4ZTYA 1YXDA 3HPXA 5E2VH 4QRFA 5TQ2H 4FIRA 3PLYA 1JE6A 5A8NA 5DHEA 2DJUA 1JXKA 1EAJA 4B91A 2OT0A 4JO1H 4BE5A 1QNIA 1LLWA 2W07B 4JQVC 2GQ3A 4AQZA 1SYVB 2C8NA 2JK5A 5DMYA 4Z7QE 4K68A 1E4XH 1ZGDA 5BU9A 4BKSC 2DQJL 4JO4H 4N8VG 4AM0A 2R1YA 4RKAA 1YMYA 3LI0A 3D2UD 2YLHA 4Q8MA 4ONOA 4MYWB 2R1NA 5EEWA 4EPEC 3EUUA 3PNRB 4YLWA 1T6MA 4NT6A 3MBEA 3FOMB 4RGNC 4IBSA 4XAWL 4UDUA 2WNQA 3ZM8A 3L08A 4RISL 3MREA 3LSCA 3SKNA 4N42A 3P77B 3S4SA 2BY1A 4ASTA 2KMWA 2XYCA 2FEDD 3GH4A 4IRJD 1RHHB 4XAPA 4D1IA 4DFIA 1OPGL 3E74A 4UQ2B 3I6TA 4NILA 2XG4A 3DRTA 1NM9A 1J9TA 3S6TA 4XZ4A 3AWOA 4F33A 3L9RA 1E30A 2QUNA 1O0VA 4YWSA 3AYTA 4QRPD 1KTLB 4TVPE 2J73A 2VABB 3NCCB 1XRFA 1RK5A 3BD3A 1A9VA 1Q6DA 2ZXGA 2GOKA 4G8GD 1FRGL 4NQVA 4IL2A 3LUTA 4J1OA 3QUZD 4DNLA 1GJPA 5E2VL 5TQ2L 3CIAA 4Z7VA 1CLCA 2VLKA 5T1JA 3UBXA 4APXB 2A2IA 4Q8UA 5F3HA 1XW8A 3U83A 3TBVA 2X4QB 1DTNA 2ADFH 5I1GL 2R2EA 4HWZB 1GJIA 3O6FC 3G6AA 4UWQB 1IRAY 2YMTA 4JO1L 1AZ2A 2X6MA 4JAWA 4D8PB 2H9AB 1F6KA 3SCSA 2FX8H 5CLTA 3OVRA 1E4XL 1OK0A 4GCXA 1OAZH 4JO4L 2QQNH 4NYLB 3F00A 1K3ZA 4LVHC 2N59A 2R4RH 3HFTA 3LK6A 5BZZA 2V2DA 4W9DC 1X6UA 4OTKA 4NNXB 3QEQE 5K9JH 5IJVB 1T22B 2O9PA 1MHCA 1ED3B 2HG5A 5KSBA 3LH9A 3DKHA 4F48A 3FUEA 3QR1A 5IROD 1WH0A 1YY8A 4BE6A 3V0AC 4IGBB 1EZ2A 5CZVH 2Y0SA 3CNKA 4UTTA 2V63A 2NX5A 4YSQA 5T1KA 5FA4A 3BJ91 3IDNA 4WI6A 5D93C 1BD2D 2VN5A 5EUOB 4BWWA 3HKZA 4P3DB 4L5FH 3ZE0F 1I1CA 1DWIM 3M88A 3O2DH 2F74A 2VN4A 1BREA 4WU7B 4L3EB 4WI3A 4GVIA 4Q6IA 4WKZB 2HBXA 3S3DB 1NDMB 4ODXA 1JRHH 4JFHD 4J3OD 3F5WB 1DVFC 3NXFA 4H8WC 2H6PA 1WLHA 2PDBA 4MLIA 3D85D 2FJGB 1IU1A 1OK6A 4AD5A 3TPUA 3DKLA 4Z7WF 3EOYG 3WBDA 1LDPH 3TU9A 3BXNB 4XXDB 1ZT1B 3MYPA 4MVBD 1G7HB 2OJEB 3Q45A 4XTRC 2DZXA 4NQXA 4JPQA 1HH9A 5KG9A 3MR9B 4IWWA 1V3LA 2NNFA 5G5DB 1VCVA 2ADFL 1A6AB 2PO6B 2HLEB 4GBXA 3Q48A 4MY9A 4Y8FA 4NJGA 1D9KD 1ISVA 3U2EA 3NIFF 1NGXA 4OFIA 1MZRA 1BAGA 3T8VA 1CGWA 2R56H 2FX8L 2XBTA 1RCQA 1H7XA 3ZZQA 4W9CC 3HG1A 2IBZY 3D3VD 3ZO9A 5KVDE 4A2GA 1AA1B 2E68A 1AL8A 3HB3C 4D9PA 4R4BB 1OAZL 1Q38A 5D96B 2QQNL 3K72B 4YXHH 5I2UA 2R4RL 1A2YB 2YD0A 4N2IA 1M7PA 2Z4QA 2F0CA 2BB0A 4OZFG 4YJ5A 2O5YL 1UYQA 3OG3A 4ODBD 3P11H 1E0UA 3PZ9A 4OJYA 1RHFA 5K9JL 1CQKA 1WIUA 4DX3A 4WO4C 2APTA 4UQCA 3T0AA 2IEPA 1DJNA 4CNPA 1U6AH 2BG5A 1U8JA 2WOQA 4IK7A 1CWYA 3P40A 1BFNA 1BP3B 1BVLA 2YO3A 4PMJA 3HAEA 1AD0B 4DEPB 4D0CB 1GNXA 4JJ5A 5AHEA 3IDGA 1CXLA 4LEBA 5CZVL 3QEUB 1N59A 3RUGA 2PNDA 1LD9A 4Q8OA 4P7LA 3ESMA 3F7KA 2WWDA 2D03H 1GKEA 4LGSB 4KKNA 3HIZA 1UD3A 5JXED 4L5FL 4ERGA 3Q2CA 3O2DL 4JFEE 4WRLA 1XIHA 3QGKC 4OI7A 3FQTA 3N9SA 1AGFA 1XG3A 1K1DA 2R14A 1KY6A 4GG6F 1FZOA 3APGA 1JRHL 3SGJC 1TJMA 4JFXB 4IIHA 3ESNA 3SO3B 4RNRB 5IFHH 1VDGA 3VFSA 1WYIA 4PRWA 2ADJB 4YHOH 4MB5A 1LDPL 2DSVA 5TTRA 3CZ8A 4FI8A 1HTIA 1T1WA 4YTQA 2WZ0A 5F93C 3SYCA 3AB0C 3PBMA 3O6CA 4DZ8A 2MH4A 1B9BA 4L4JA 4AC2A 5CCHE 4ETQA 4X0VA 4ORMA 5KSVA 2YAOA 3W7OA 2R56L 3FDWA 1LEGB 3ESUF 5IY5B 3ETBJ 1ZP3A 2PCPB 4MMWA 5ERWA 5E94A 1IEIA 2Z2UA 3A3YB 1XZWA 3QDHA 5DUPH 4YXHL 2PW1B 1U8IB 4E5XB 2REQB 2WN2A 2MTPA 3P11L 1HO4A 1W16A 3O0FA 1ND0B 1HF6A 4KKCD 2C3XA 5AC8A 3SFKA 5FF0A 3FPXA 3M1BB 2Q2EB 2ITDB 2JCWA 1U6AL 3HPJA 4S1DD 1NA8A 3FQ1A 4KI1A 5GZOC 2GWNA 3HN3A 3FN9A 3ARSA 3QJHB 2OO0A 5L2JA 2HJFB 4WVRA 2EH7H 2ANUA 3STZA 5F9AC 4BQ6A 2QCDA 2E25A 3P93A 1N0XH 2D03L 2VZVA 1SJHB 2W1NA 4I1RA 2QHLA 3WN5A 4OZ4B 1ZV9A 3UWEA 2Z64C 2AXGB 1XHGA 1K72A 2KZ1B 3B2VH 4CEUC 1G6RH 2J25A 4PJ7B 4TTDC 3CYVA 2YZRA 5EEXA 1VB9A 5J3HD 2WO2B 4JN7A 1V6WA 5IFHL 4YHOL 5AYYA 2WYSA 2CALA 1S7QB 2BZ7A 2ISSA 1CECA 2C9AA 3I2CH 1M56B 4L0ZA 2J9XA 4X6DE 1JDAA 4PBGA 4NC0B 1GAFH 2BNQB 1XIGA 2IFFH 2Q87A 2DUZA 1DCEA 4R2GC 1S7RB 5D1QE 1Z3NA 3MRIB 2YMXH 3R2GA 4HBQA 4ORZC 2EEBA 4QLKA 3L5IA 1OM9A 2WBKA 4IGBD 4JGMA 4UTLA 4XWOD 1E5AA 1Q85A 3BZGA 5DUPL 3M44A 4AQEA 1YSOA 4HHWA 3O11B 1CDJA 4TMPA 2PP0A 5C0CE 2QGEA 2PYEA 5E9DB 2IWFA 1HQRA 4INFA 2DI8A 4FFYH 1EC8A 3DVGB 1SOKA 2XH0A 3ABSA 3ARDB 5LGHH 4YDVA 4AF0B 3S5SA 3FQ4A 4U31A 2EH7L 4JW3A 3CO8A 3B0XA 1NQ6A 5LAXB 4ANVA 5HDQH 3HZKB 3I3DA 4GGBA 3HMJG 1N0XL 3ULSB 1T1XB 5E5LA 1F2JA 3Q3GB 2CR0A 2XUWA 3GD1C 3GSOA 4B15A 4R7WA 5FA5A 5A6BD 2H0EA 1L9NA 1U9KA 3V35A 3B1UA 3NIGB 5E2JA 4L4VE 1X7TA 1DZBA 3OL2A 4XMUA 3ZRFC 3B2VL 3F7YB 1G6RL 1Z9AA 4FA6A 4R53A 3RZWA 3VXSB 1MCNA 3BUVA 4J8RB 5DJZA 3RGVA 1CNVA 1NGYB 1JPMA 1CI1A 2BSSB 1ACYH 5IW6B 1W1TA 3PAJA 5BZDA 1PO9A 1D3HA 2CBOA 2ZZ7A 4L6OA 3WQ6A 3TASA 2VDNB 3KFTA 1LTDA 4RZ4A 3I2CL 2D9CA 4A3YA 4YOKA 4PRPD 1EOKA 1FIEA 1QVBA 2YS4A 1WCGA 2IFFL 2I24N 3BGFB 1DQXA 2YMXL 2EDTA 1H3PH 5LG6A 4Y1AB 3TAOA 3BVDB 3CZLA 3SUUA 1G69A 2WINA 2WBXA 1SXAA 1K8YA 2P76A 3HNTH 4WJEA 5HYFA 2PP9A 1DVQA 3H7BB 4Z78B 4W68A 4RZ5A 3ZFHA 3QDGD 4CNOA 4M1DH 1RZMA 3TYUA 4JR5A 4IRSB 3ZDZE 5ISZE 5SX5K 4QF1B 2A6KB 4FFYL 2CG9X 1ES0B 3NZSA 1GGTA 1QSFE 1SZFA 1YVLA 5LGHL 3WQ4A 2Z4GA 3ARBC 1HI6A 4F8LA 3ECBA 4QJ1A 3DX1A 4TUJB 5EU7E 3MJGX 1ZLWK 3DFQA 5HDQL 1QW8A 3VMNA 1KGXA 4YE4H 1NC4B 3ZN6A 1WCBA 1S5IH 1Z9LA 1ML1A 2PDCA 4GWEA 3NH7H 1F11A 2HWGA 2G0KA 3S35X 2VXUH 5IREA 5A2BA 3OMIB 5D1ZD 1HH6A 2E7HA 1MHEA 4P2QB 2BNJA 1DJWA 3CZGA 4QDMA 3NK3A 4B41A 2P8MB 1TTBA 4RFEA 1R5WA 1M7DA 3RX8A 2UZIH 5DMGD 4AZUA 4HC1A 4LBAA 1ACYL 3B5HA 4JM4H 5L88H 3UNTA 3G6DH 4A6YH 5ETUB 3TLRA 5GZNC 4FF7A 3KYKH 1E71M 3TN5A 3SSGA 4HHHA 3IPBA 4QO1A 2IQAA 2V9DA 3S2MA 3KPTA 3KJ4B 2HTLD 4WFGD 3N25A 1NGWB 1ZSXA 4IF2A 1UD4A 3FO9B 1SUXA 1YTEA 1WA1X 3FYEB 3OIXA 3DK0A 5FYLD 1SMDA 4AYID 2H5UA 1KLFA 2KZBA 3QIWA 2YSWA 3KD4A 2XG9A 1H3PL 1MHPL 3U0HA 2E9BA 4OZGF 1U8HA 4RAHA 3N34A 2QADB 2GITB 2X6VA 3TS8A 4HPJA 3DO3A 3HNTL 2DWTA 4PJ6A 5I2IB 1FWNA 4WIQA 3WFAA 5B22A 2CKBH 4LVOB 3PGDA 3AQUA 4M1DL 3UPMA 1U2CA 5HGDB 5DVNA 2JSFA 3DIPA 4HFWA 2WJEA 2YZ5A 5EF2A 3P80A 4JQ1A 3W83A 1TPXC 5FR3A 1Q9WB 4JTGA 3J7HA 2VEMA 2WXLA 1QFWM 3C3NA 2VRAA 3QEGH 2XZCH 1QASA 2WBJB 3N2XA 2WQUA 4A38A 3K74B 1ITUA 4HP5A 1LQSR 4YE4L 5D6DA 4ODTH 5M95B 3KCLA 3VXGA 3GBLA 3N6QA 2YJLA 4H8HA 3NH7L 3WY2A 4PJEB 1PZ0A 2VXUL 3ISYA 1YPIA 4XX5A 4LEFA 3UWQA 3GSVB 3MJWA 2FTWA 4UR8A 4LUIA 1CD1A 1BQCA 3S3GA 5I1JH 1SHMA 2UZIL 1JZ3A 4DK5A 3PUEA 3OMAB 4JM4L 5L88L 3G6DL 1E9PB 4A6YL 3GI9H 4CCCA 3KYKL 1IZCA 1RMFH 2ESVB 4FG2A 3KLQA 4ZENA 3VB9A 2YEQA 4R97B 2F68X 5HUPA 3VNKA 1RSFA 4JS3A 4F9PA 2XHNA 1E4NA 3ZMEA 5E9DD 3LNGA 2FQDA 2H0PA 5C0BE 5FWQA 5IBLC 1RVKA 4CMHC 1BWMA 3TC7A 4FA7B 4KFPA 5F6HI 1JGIA 1T2XA 3P73B 1AGCA 1Q8JA 1QOQA 3URNA 5D1XB 4OFCA 3LCYA 4YK4B 3MRNB 3ARDD 5J1SC 5JPNB 1E1CB 3MRPB 1C5DB 4E36A 2QCFA 1YAZA 4RSYA 2FZ9A 3X1EA 2UWEE 2UVFA 2CKBL 3W6MA 3L3OB 1K8IB 2AVFA 4P5UA 2WK2A 4XXWA 1XB8A 1GQJA 4HIEA 3CO4A 4JIEA 2YAHA 5SWSB 2KPNA 4PTUA 3CV6A 2LFEA 4G8EA 2GTWA 2K9UA 1L3NA 4PV9A 1WX0A 3BX7C 4K36A 1ZLUK 1XQLA 1I8IB 3VXSD 3CDYA 3QEGL 4JKKA 2XZCL 3C6LC 2FH6A 5AAMC 4DI8A 3OJMB 4DXVA 3H42H 4GNVA 4LVGA 1CGUA 3VXTA 4HK0A 1D8CA 3RFAA 1Q8MA 3EH1A 1H1ZA 3TYDA 3A9IA 5C08B 4EAMA 3BEWB 4KROB 4YXLH 3NGBC 4OJDH 1G1KA 5HD8D 4XTDA 1N18A 4ENZA 1RERA 4G6KH 4ONGH 4L3CB 5I1JL 1KLUB 2O9TA 2D2OA 4Y1AD 1HHJA 4LYQA 1G5AA 3GI9L 3CAWA 4LQFH 4H7VA 4EPBC 1RMFL 1S1RA 4OQTA 3I02B 1BRLA 5CSSA 4U6YB 3S97C 2QV5A 2DKUA 5SX4H 2IW0A 5IVXE 4MJIA 4ICNA 3OKKA 2D20A 4H1LB 3VI4B 1TEYA 1MCIA 1HXJA 1HGYA 2OZ8A 3Q2VA 3EFOB 4IRZH 3R7QA 5L9FA 3LJ3A 4LLMB 3PREA 3HZMB 4X8XA 5IRPA 3NO5A 3CMGA 4U6HB 4E9RA 4EI0A 2JXMA 2XWTB 1AXSA 3U0WH 4DVBA 2PF8A 1GXEA 1B4LA 1NC4D 2H8XA 3W86A 4GYPA 3V4VA 4XI5D 4JICA 4FFTA 3T9PA 3REWB 3LXCA 1MW0A 3S5LB 3HQOA 3UTSB 1XGQB 3U7VA 3SQBA 3J2PA 4KDWA 4P2QD 3JZEA 2QR0B 2LV4A 4Y2WA 3W7RA 2HPIA 3GKZA 2OMAA 1V93A 5AAWC 4LKXB 3THAA 1EX1A 4DP2X 1UWXH 3B8IA 1GOXA 3LIZA 1N4XH 1AFVH 3G6JE 4DO5A 3F7VB 3H42L 4FG0A 4G56A 2R0LH 2OR9H 3QQ0A 2R1PA 3DOSB 6TIMA 1S7VB 4NM4L 4F0SA 4WTZG 1JPFA 4TSAH 4GJIA 4F9JA 4HKBA 2ALAA 2P5WE 2X0HA 4B5VA 2JV6A 4RIRA 1H1YA 5EU6D 6A3HA 4OBSA 3MCG1 1B2YA 3KDOA 3PL6B 3Q37A 4G6KL 4ONGL 3DTXB 1JVOA 4OZHF 1D6EB 4WUKH 5D7IE 1FZJA 1KXTB 3BAWA 2OZNA 4IKJA 2QADD 4OU1A 4LQFL 1Q90A 4US5D 3BP5A 3ATDA 5CMAA 4ZO8A 3ZLGA 2WZEA 4PCTA 2EINB 2BIPA 4C1NB 3ZGIA 2DQGH 5A7BA 2BVUA 1TPC1 1UB3A 1W6TA 3T71A 4UZGA 2O4EA 1FJ1A 1E56A 1HG3A 1V3MA 1IC5H 2BDNH 3FYYA 5A3HA 5D9SB 4R26H 2IMMA 5EPDA 4IRZL 1I8UA 1AZRA 4GA8A 5A8MA 2CLRA 2KERA 1XBYA 1NCWH 4HOWA 2DL2A 2ARJQ 1BVWA 2WBJD 1WZKA 5L6YH 1WRFA 2GVJA 3U0WL 2GJPA 1S3KH 1QPKA 3MJMA 1YEWA 1SDDA 3SQRA 3VOIA 3EWXA 2W60B 4IMGA 1MWAA 3FQNB 3W72A 1W37A 3PWNB 4YDJA 1I7TA 5GJMA 2R0KH 3TXVA 1NFDF 4YN5A 1M2VA 4NNAA 4KJYA 4LU0A 3FSUA 3LZRA 5FO8A 2BCKA 3CQPA 4P5TC 1J05B 1N4XL 1AFVL 4ZUTB 3QWRA 4QNPF 2OI9C 4I9WD 3INPA 4XAKD 1FC2D 4KBXA 2R0LL 2OR9L 4AKOA 3NOIA 3G5ZA 1UASA 1IIKA 5ELIA 4TSAL 2TAAA 1A4KB 2FX7H 4KI5D 3FCPA 4BGDA 3M0MA 1R4XA 3SGDH 3T09A 4HF5H 1J86A 2FSEB 3HLKA 4MNGA 2A5UA 4NY2A 4KKLD 4P5MB 1XIBA 5D1XD 3JU2A 4WUKL 4ECNA 4FKEA 2YXVA 5C7VA 5C0IA 2VISA 4Q9CA 3NESA 3KBEA 4FAAB 2E7CA 4ZUSA 1K77A 4KF1A 4NUPA 3SDDA 3MX0B 1RKRA 1HZKA 2C7UB 5D7JA 1J4EA 2PTZA 5EDSA 1NEZG 3LTVA 5FGSA 1OIMA 4NRYB 2C9SA 4YHKH 1OJXA 3VJ6A 1DWAM 3FSTA 1IC5L 4DBSA 2BDNL 3WUWG 3STLB 4YMPA 3UWUA 1ICPA 4G9FB 4TOQA 3LM7A 3LZFH 4FQ1L 4R26L 3A47A 5C9KA 1V6YA 3RX3A 1R47A 4NQ1A 4DJDD 2VFEA 1Q9KA 2QDVA 5I71B 1OFQA 1NCWL 4ODUB 1ECQA 1R3WA 5L6YL 2CDEA 3AUOA 4IPJA 4UYQA 3CV2A 2CO1A 4LP8A 3MBWA 1S3KL 2VLJB 4KDVA 1EO5A 3WNNA 1YE4A 1ID5I 3BZFB 4R88A 3WJXA 1QBAA 3TO4C 5C08D 3CH9A 4KROD 4YSEA 4I2XB 1SXZA 4QGYA 1BG9A 4HJJH 2PDLA 1TV3A 1OVZA 4XCYB 2R0KL 3MO1B 5CNHA 5AB2A 3W1UA 4QE4A 1D2KA 4QMEA 1CX9A 3UY8A 4QBXA 4KDTA 1KTRL 4OCSH 5F8QC 5K9OB 1H5BB 4JCLA 5EU5A 3UJFA 5FL0A 2IAND 5DU7A 1S7XB 1EO8H 1PV8A 2EYRB 1W0YT 3O3BA 5BU6A 2WZPA 4QLJA 3UCRA 2L8AA 2WQWA 4PJDF 2Y8VA 2PLCA 3LCGA 4NQUA 2FX7L 1A47A 1BX2B 4HF5L 3K4WA 1MI5E 3Q01A 5HMSA 1HVXA 1REQB 3P5YA 4X9IA 1LG2A 4WNQA 5I78A 4MA1C 4HNLA 3S48A 4BUHA 4G7SB 4GW5B 2MHAA 4KO9A 5BZAA 2QGCA 2J7CA 1OGSA 2QVNA 2DWDA 3RMEA 4XXCC 3NYDA 5I3IA 1JNNH 4Q3MA 5HYIA 4HN4A 4YHKL 3G9AB 3EBGA 1AS8A 1WWCA 1PAZA 3UTSD 2BP0A 1XH1A 3GKFA 3A6BH 3PTQA 5IG7B 2VTFA 1N70A 3WGUB 1KSRA 3HPLA 3L0KA 3EYOB 3RL1B 1JXFA 4AQ1B 3SDXB 2IF7A 1HCYA 1BPVA 3TV8A 4B5ZA 2P3ZA 3I6GA 3RRQA 1UP0A 3A3HA 3O0LA 4B4FA 4EQ2A 4M7SA 2LU7A 3VO0A 4O1FA 5ABFA 2APVA 1J0IA 2K8MA 5FEXA 1EEZA 4NKMB 2VDKB 3WG7B 4ZDHB 3H4HA 4P4KC 4HLZG 3H24A 1YNPA 4E41E 2CGYA 4HJJL 1EXHA 4WY0B 2ZSWA 4YX2H 4KXZH 1XWVA 2BY3A 3G3MA 3T4AC 4N2HA 1TJPA 4P48A 4UMAA 2VWEC 4YAQA 3S37X 5J12B 4O2CB 3RTQA 1BFOB 1EO8L 1U3HC 3DCPA 4CC4C 2CZ5A 1SQMA 1R0AH 1QNPA 3UXLA 3C2FA 1H15A 3WEXA 2EEXA 4QXIA 3BPNC 1DWJM 3IJYB 4LOUD 4UOW0 1GJWA 1NIDA 2Q71A 4B9JA 1XQ4A 2X0UA 4G9DB 4QLLA 2YR1A 5IW1A 3QZ6A 2FO4B 2YQ2A 1O6VA 4FULA 1BD2A 1UIPA 1CS6A 2CYGA 3WLIA 2FJUB 1HFUA 1LQ2A 4L3AA 3DG6A 3QFJE 1JNNL 2GZXA 4YLQT 1SMOA 1TSRA 2RJMA 2YPKB 5CBJA 1ZGLA 4Q9BA 3W22A 3BLKA 3MNWA 2N0MA 5KTLA 2X0VA 2OS7A 3HMXH 1NPJA 3VYOA 5JDSB 2VGFA 4LLYB 3QAQA 3IF1B 2ZKHH 2R83A 2WVSA 3GMRA 2WNWA 3W9EA 2PMZA 4ELME 3O9WB 1T66D 4WO0A 3MV8E 3DA0A 4HCHA 3OB8A 1D9KA 2CRYA 4ZAKB 3BLBA 4I18B 5EOQH 1QI4A 3TN0B 4LP4A 3APMA 3QUMA 2GYIA 4MVAA 3PJSA 1Z2KA 3U6WA 1NGZB 3TBYB 3KVDD 2X28A 3JV6B 4O0KA 3IGSA 4K2SA 3JR2A 5FGRA 3RIKA 3IBEA 4XOBA 4UAOC 5I00A 3B7RL 4QJ4B 2HFTA 1W9VA 3WO4B 2NV2A 3AU6A 4L5FE 4CRPA 5IIEA 1TJRA 3RBSA 1NOAA 5BRZD 1R0AL 3QO1B 2NY5H 2AS5M 4XBMA 1XAUA 1IT9H 1UOVA 5L0QB 1EUUA 1VIZA 3UA4A 4G9FD 1A3QA 1E7UA 1RUQH 5CEXB 1FOBA 4EF8A 3WBEA 3CVDA 3WUZA 4Q8PA 1E4HA 1XCTB 2ZCGA 1CBVH 3MMUA 5DK0A 4XMWA 4GUIA 5EY5A 2VLJD 3LNDA 2LU3A 3LNHA 3QGAC 2CHDA 2H2PC 2ICSA 4KXCA 4YU1A 1EFZA 5HDBB 1K7FA 1IM9D 3CH1A 1ZNNA 1GZHC 4S0TD 1N3NB 3QMSA 1YLBB 3HMXL 3W73A 5BROA 3AI0A 2OOFA 2ZKHL 4RNIA 5D4QA 3MP3A 5ANME 1FFPB 2ATMA 2NV9A 1RURH 3O6DA 3N2MA 3W1NA 4E42B 1R3HB 2X4UB 3P9MA 2RBLA 2J6EA 4BXSV 4A05A 1I7UA 5EOQL 1OHQA 1XHHA 3KBJA 3B04A 3EYQD 3EG9B 1FXQA 4IJCA 1BQRA 2VC5A 3UFYA 4S3EA 3T3ME 2CHOA 4QHLA 1JK8B 4JDZB 4YNYB 2FECL 2YAPA 1B4TA 4NRRA 3NFNB 4BQ3A 4NQEA 1B0WA 3EEZA 5JVLA 3ZJ7A 4DUVA 5HSFA 4E8GA 4UBDD 3AREC 5H37H 3KPSE 1C8YA 1DPMA 2NY5L 1A65A 3WLTA 4Y6GA 4B9CA 2JKAA 1LYQA 4DF1A 1BQKA 2QPEB 1RUQL 2Q02A 1YUHB 3PWVA 1S38A 3ES6B 2IV9A 3F01A 1MNUL 5HJDA 2JCCE 1DIKA 2B3IA 1CBVL 4DP6X 4PMFA 1ETB1 5MENE 2NXGA 1QFWI 4O0ZA 1O9ZA 4HIBA 3N11A 4X4KA 1IR2A 2YBUA 3L3DA 3TBTB 2E7FA 4D8PA 3MRDA 4PJBA 1Q63A 3KWTA 2Y7MA 2VJ0A 1TUXA 1CL7I 2QCLA 1CBGA 3QQ9C 5DRZA 1GZPA 5ITBH 1PCSA 3LV3B 4FP8H 1TZ7A 2V67A 3F2BA 4ACZB 3VFNB 4ZW5A 1ILUA 4HPYH 3MRGB 3T65A 3QV8A 5I0YA 2VR7A 1K8DA 1RURL 4BWLA 5AY7A 3ZUNC 2ZZ4A 5F1UA 7ENLA 4OAWB 3ITYA 5GSRB 3MMEB 2Q10A 2PWVA 5A5WA 1BQHB 2ZWYA 3S3SA 1SUJA 1MQPA 2EIDA 3DYOA 1F18A 5E6IC 4Y5VB 3CFKA 3D18A 4IGBA 2ED8A 4KK6C 2BGSA 3QQ4B 2CZNA 2YWYA 1SDAB 1EXPA 4D1JA 3FFSA 5EMMA 1HSBA 1PZ5B 2J72A 4F7MA 5G5IA 2WSRA 4IIQC 5EGRA 2B81A 3KPPB 4HC1H 4K8RH 4CVXB 2OTPA 4MLRA 3M1CA 1ORQB 4ENED 2R2HA 4U4MA 1WUFA 3UCCA 4Z2KA 4APQB 3EGDA 5HHMB 3FNDA 4O28A 5EO0A 4M93B 1RJRA 3EOOA 1S9YB 3FQXA 5EFFA 5CH9A 4JKLA 1O7AA 3W85A 4PGDA 3UO1H 4NUJB 3ZK0A 1I2OA 5EN2A 4FZ8H 3W1RA 1G7HA 2K8QA 4YH6A 1MY5A 2RALA 4EOUA 2ADGB 2EACA 2WM1A 5GRVK 2QPDB 4I48A 5JTWA 3LENA 5A6BA