4NXMF

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nxmF00
1IJFB 4DR4F 2UUAF 4DV7F 4B3SF 1HNWF 4JI7F 5LMNF 2UU9F 2RJZA 1CQMA 2VQFF 4AQYF 2B7BB 2VQEF 1G1XA 4DR3F 4JI3F 4LF4F 3T1YF 1N32F 4JI6F 1IBKF 1GH8A 1IJEB 3R3TA 4DV0F 2UXCF 4DUYF 1HNZF 4DV2F 4LFAF 2F4VF 4DV5F 4LFBF 4JYAF 4DR7F 1F60B 4DR6F 2B7CB 2UXDF 4LF8F 4X66F 4YHHF 4DUZF 4LFCF 1CQNA 1HR0F 3OTOF 2UUBF 4NXNF 4DR2F 1HNXF 4X64F 2UXBF 4K0KF 1G7CB 4OX9F 2KJWA 1FKAF 1XMQF 4GKKF 4GKJF 5LMUF 2UUCF 4YY3F 4LF5F 4DR5F 5AJ3F 2E5LF 4X65F 4JI5F 1RISA 1LOUA 5BR8F 4KHPF 1I94F 1VMBA 2HHHF 4DV6F 1N36F 4JI0F 4JI4F 4JI8F 1XNQF 1QJHA 4B3MF 1N34F 1IBLF 4DV3F 4LF7F 4LF9F 4JI2F 2ZM6F 4B3RF 2BVZA 2YY3A 4X62F 1FJGF 4NXMF 1N33F 1J5EF 4JI1F 1B64A 3T1HF 4B3TF 4JV5F 5IWAF 1XMOF 4DV1F 2KJVA 2J5AA 4DV4F 4LF6F 4DR1F 3ZZPA 2BXJA 1XNRF 1IBMF
chains in the Genus database with same CATH superfamily
3SZ2A 3OHBA 1CC8A 4R8UA 4OX7A 4B9MA 2APOA 1NK8A 1TV6B 4Y2IA 4IKAA 1RACB 4DWIA 1HL6A 1TK0A 2MMYA 2P6SA 4FKYA 4HH0A 4O44B 5KFLA 2MQOA 4QWCA 4RW4B 2ZE2B 2FD2A 1T9WA 1S0NA 4USMA 3TA1A 1NB2A 1HW8A 1Q78A 1YZ7A 3CJ5A 1S57A 3BQ0A 1X4DA 2OFHX 4NLSA 4XDCA 3SDEA 4QQBA 4F0KA 2ZJQQ 3W8GA 1R6YA 4NCBA 5B0EA 1IKVB 1S97A 3N28A 1NK0A 2QT7A 1FE4A 3UD5A 1C1BA 1FKOB 5K8MA 2ZDOA 4ZCLA 1UPMB 1F0XA 1SL2A 3MPDA 3JYTA 4NMLA 4YFUA 1YJRA 3RYLA 4G65A 3FEXB 5IFMA 3TEGA 1S6QB 1QD1A 2E66A 1S1VB 1UJ5A 2C2MB 1RT4B 2OLWA 2U2FA 4I6WA 3A1YG 3TO8A 2XMVA 3JSMB 3PTWA 1PILA 5J2QB 4ZCMA 3L4BC 1WORA 2NUHA 1W26A 2Y1RI 3J7AN 2WONB 1Q7YT 3V2UC 2DYAA 3KXDA 2UXDF 4LMZA 2KM8C 5J2MB 3FGVA 2MQQA 1JLQA 3DXSX 1T8EA 4ZVQB 1FHTA 2QO3A 3PX6A 3DXBA 3CF5Q 2VONA 3UN2A 1IWGA 2Z2YB 1OSDA 1BY9A 1PYSB 2EBGA 4B08A 1JWWA 2W7PA 3PYDA 2FJAB 3PVXA 3SEOA 2KG1A 4ER8A 1JK9B 2HHUA 2KRBA 3PJXA 4ES3A 1VK3A 5B08A 3NGRA 1JJCB 1LW2B 4O3OA 5HBMA 5GADU 3TANA 1N34J 1U1NA 3AXKA 2QGFB 1XMOF 1S76D 3HULA 3NS6A 2W9AA 3GG1A 1FRHA 2UUWA 3M8PA 1V5IB 3A3OB 4DV6J 5CA5A 3BM7A 5JVGQ 2J6SA 2W2OP 3GCXP 3R7NB 4W4MA 5IOLA 3SFGA 3MMCA 2E1AA 1LFWA 2CQ1A 2DRDA 2E29A 2DHAA 2ZITA 1RADB 4A8YA 5FD1A 1EB0A 3MOJB 2W2NP 3GJQB 4C3MA 4D3GA 1OJ4A 1N5SA 3DLEB 2WOMB 1IKWB 1XC9A 3HI9A 3OL7A 3JAMU 2LU1A 4TLQA 2FVPA 2VQEJ 1ZAXA 4ATNA 3ZTRA 5HLFB 2E9RX 1NCLA 4OI6A 4RKUC 5HVGA 1N4LA 4ED0A 3EJMA 2NSCA 4ZA1A 2CDQA 3F56A 3NOGA 1CSJA 3CCRS 3GV5B 4YR0A 4O3QA 2ZBQA 4DQRA 1S6PB 4ZP8A 2FLOA 3N0VA 2HNZA 2M3DA 5H9FJ 1Z4UA 5ETMA 4CTAA 2AT1B 3NGUA 3C6TA 4ZJOA 4TLRA 2B7BB 4PG5A 4GVBB 3MECA 2DNRA 5KFSA 3RBZA 4G1QA 4KRWA 2R8KA 2R4FA 1HNZF 3HF5A 4P7VA 1RXOB 4AXJA 5B0CA 4ECUA 4YOEA 4DL0C 1H0HB 1TU0B 1REVA 3WZ0A 4IOAQ 5HVFA 1S99A 2KXFA 4ICLB 2R2UA 3J7YU 5B0BA 4WKYA 1VQ6S 1MROB 2N3LA 5KFYA 4DX6A 2K1RA 4BBYA 2IM0A 2EFQA 3ZZOA 2GHWA 4BHQA 2B9YA 2Y1IA 4HEA9 5IM0B 1T05B 3D0IE 4ZVSB 1RT6A 4W92B 4IH6A 3NMAA 2BA9A 5DQHA 1Y0HA 3E01A 4U8YA 4YR2A 4X4NA 4ZPBA 5I3UB 2N4DA 4O0NA 4TXSA 4UY85 1RT7A 5F8LA 4PRFA 4FYVB 4UZCA 5DETA 4CZCA 2HHTA 4IYQA 1KTVA 1WHWA 3KLGA 4CP5A 5L46A 3K5MA 2HIQA 1HPZA 2KVIA 2V2ZA 3GMGA 1RZMA 4OI4A 3NGDA 3KLEB 3T1YF 3DU5A 1C4CA 1T9YA 1Z2LA 3Q8RB 2W8LA 2EK1A 4N47A 3KYLA 2CA9A 2L48A 2C42A 5KG2A 1ROFA 3TR5A 1KFDA 3MR2A 3CB4A 4EUVA 2UUBF 1N48A 3CDEA 3DRRA 3R5AA 2UXDJ 4O4RA 2B4PA 5EGYA 3OXGA 3N6NA 3RGIA 4KIAA 2DR7A 4LVOP 5BJRA 1BQNA 4OZNA 5G0RB 3NKYA 2ZZTA 2J8SA 2DEJA 3AHPA 2AJ2A 4NLPA 1FJCA 3TI0A 2JZ5A 3PIOQ 2HLUA 1EP4B 3JS9A 1UVJA 2CPDA 4WFXA 4DFPA 2DK2A 2HMIB 3X1LB 3CTRA 3L09A 4IFYB 2W2MP 4FN5A 2B43A 4ID8A 3B4DA 3R6LB 5KFNA 4NE9C 3FSYA 3O3LA 2FLLA 1RE1B 2FIUA 5KFGA 4J9RA 2V67A 1OWXA 3I96A 3SQGA 3QFWA 2BMBA 1XMOJ 3IAS9 4ED1A 2VBXA 3R5BA 3SCJE 4OHYA 3D1HA 3VGVA 1S0VA 1CJVB 3EVWA 4JB8B 2ZFHA 1Y10A 3ZXWA 1V6HA 3HCXA 3G86A 1PC4A 4LRFA 1OS5A 1GX6A 3KG4A 4MYTA 2HGLA 1FKAF 4IFVB 2QFIA 5RUBA 3H20A 4DDFA 4DUTA 3ILJA 2YWEA 4PYAA 1WUUA 2HIYA 3SV4A 2K3IA 2V4RA 3WIVA 4EK2A 3W62A 3EPIA 1QJHA 2J0SD 2V4QA 2BE9B 4M5DA 4I4BA 3KHHA 2LEBA 1SV5A 3OJSA 1UA1A 1VS3A 3VQSA 2ZH6A 3MM5A 2ZH8A 2IBKA 2ZKUA 2VB6A 4L75A 5LSRA 1TAUA 4KH1B 1WI8A 3M32A 1NSQA 2HZAA 1BXNA 2B8PA 2HFZA 2OPRB 2O67A 4DL4A 2ROEA 2XHCA 1LWFA 1X8DA 3U7JA 2MZSA 4ZS6A 2B4VA 3IAM9 4RW9B 3H5SA 3H40A 1O0PA 1O6XA 1HFEL 2JRSA 3EUNA 2W9CA 1RT1B 1HNZJ 1RAHB 3NL0A 3FBCA 2AQ4A 4C8ZA 2VDIA 3N9UC 1FEHA 5AXLA 3AD9C 1XMBA 3ZC4A 3BGOP 2RHSB 4DR5F 4LF5F 2WBMA 3GP9A 4OZJA 1NKEA 4E0DA 3W64A 4OYMA 3ICLA 1JIHA 3NNAA 1VHIA 3CJ4A 2C3MA 2DR8A 1DJ0A 4CNZA 3EVMA 3W9HA 3G9CA 2ZC4A 1HHTP 3R2DJ 3BSAA 4S0MA 3ENQA 3CCTA 4NX9A 1U47A 3HLUA 1NUEA 5IZHA 1QUPA 4KYZA 4A47A 3C16B 3BKTA 3QLHA 4I2PB 4MK7A 2EBEA 2V34A 1IBMF 2W9BB 4M63A 5J1EB 1HYSB 4ED7A 2CJKA 2HRYA 2CQ3A 5I4MA 1NDKA 2XS7A 4RR5A 4ECSA 4N5SA 3T1YJ 4DN9A 2W1BA 2JEIA 3G96A 4TU7A 3K5NA 2HEKA 3MD1A 5HMZA 2HWIA 4QPXA 1IR1A 4IH7A 4XIUA 4HT7A 2Y8WA 1OPIA 3BN4A 5C42B 2UUBJ 2OMLA 5DO2A 4FYDA 2D7SA 2MZ1A 2YNFA 4UOHA 4DF8A 1K47A 3V81A 4DLEA 4WP3A 4ZITA 1EQMA 2MY7A 2KVQE 1F2HA 4X62F 2V68A 4Y34A 2EK6A 2FVRA 1XR7A 1TK8A 1R6VA 1RHKB 4WFAQ 4O44A 1KVJA 4C11B 4RW4A 2UUAF 2ZE2A 1CULA 1CS4B 5H9EJ 1N32F 5KFQA 2IRXA 2ACYA 1EETB 2QLXA 2QL5B 1IKVA 2DJWA 2BE7D 4OYPA 1FKOA 4PZVA 3IM9A 2GO9A 2P9CA 1P9YA 3KJNB 5E2QA 3DLKB 3GIRA 2N82B 1FWKA 2R7SA 2KT2A 4DQIA 3O2IA 1AXQA 1S6QA 2BJ9A 1KHWA 1RT4A 3KK2B 4I6YA 1TKDA 1VOMA 3JSMA 4PWUA 5J2QA 2BE2A 4YP3A 2HVZA 3KG1A 5GAEI 1FJGF 5D4NA 1R8AA 1ZM2A 1T02A 4MIAA 3QWPA 2WONA 4ECRA 2MB0B 3R7SB 2CG4A 1UJ4A 1DLOB 1P1TA 1YBAA 4IUFA 3BF4A 4ZCKA 2I2YA 2KG0A 4DUYF 5EWEA 1VRQC 2MJNA 2HW3A 3PEHA 1VIXA 3GR1A 4Z2XA 2XYHB 3RBEA 3I6PA 1RJJA 1RLCL 4U7UK 1KOOA 4BC7A 4U6PA 1LW2A 2D41A 5AT1B 4C8KA 3NS5A 2G2ZA 1FFSB 3MEEB 3T1AA 4DR5J 3OVBA 1JJ2R 2FDNA 3AOBA 3QFHA 1S77D 3BBCA 6FD1A 3AJ2A 3VF0B 2DY1A 4EBDA 1MMNA 4WK1A 4F4YA 1FRMA 4J9OA 1VQKS 1VJQA 3QJLA 2YKAA 3MM6A 3TJ9A 2KXNB 3TX8A 4DI6A 2KYZA 1RHJB 1VJWA 4CLLA 3OFGA 3OQ2A 2M9KA 2RB7A 3ISNC 4F3QA 3NNCA 3IO1A 2DH9A 4WIQA 1WKKA 2ZH7A 4ZP6A 2KRRA 2WOMA 1Y4ZB 4O0IA 1IBMJ 5FLXY 3RAXA 3THTA 5GAGU 4UUXA 1KLMB 1ICEB 4QU7A 3G4SS 1HQUB 1QTMA 4CO5A 4UUWA 1TQLA 1CQNA 5BYSA 4TY8B 3P5TL 4EO8A 2ZWPA 3RB0A 4G1IA 1N0VC 4YY3F 2B6AA 1E6YA 1IXKA 1U09A 3K8WA 3RG6A 3KUHA 1VMBA 1S6PA 4ANCA 4Q2MA 3JSBA 1NJYA 2JDJA 4I7FA 4C8MA 1I5OB 2NREA 3BKFA 5A6PA 1YJWS 3TAPA 3M2VB 4FBTA 5M2UA 4I1TA 4GVBA 2E5IA 2DGTA 2HHPA 1FT8A 3BEGB 3BO3A 3NEKA 4NYPA 5CD4A 3D2WA 5M2PA 2IJNA 4USVA 2XCPA 1SC1B 4OHXA 1U0SA 1DRZA 3HHLB 4X4QA 4DL5A 4ICLA 4E2FB 3QSIA 2Z30B 1OQ6A 4B3SF 4MFBA 2VQFF 1D9DA 5C24B 5CQGA 3AODA 2DY9A 4F02A 2MYFA 4P75A 3I31A 4ANDA 2UUAJ 4LRBA 1VLYA 1H7WA 2KHCA 2XY5A 5IM0A 3BQ1A 2Z2ZA 2B7CB 2R7RA 1T05A 1YWXA 2N7CA 2AJ0A 1RWPB 3MR5A 3GG0A 3VV2B 2DHHA 3T19A 4RUCA 3SCLE 1T03B 2YQ1A 5LOQA 2DISA 4KHRA 1BMQB 1VIOA 2DPIA 2Q1LA 3CDUA 5K8NA 2OEKA 3DGVA 3W61A 5E3CA 5B0AA 2HHWA 1JNZB 1KEKA 3EM1A 1QVGR 1XNQF 1PG5B 2HNDB 2ATCB 3KLVA 2O1PA 2AYEA 4L3KA 3PKYA 3Q2SC 3MDFA 4JI2F 2FZKB 3B6BA 3KLEA 2PN6A 3H25A 5CCMA 3U1LA 4QWAA 3PHTA 2F1FA 1VC5A 1FJGJ 2R3VA 4X84A 2VPXB 3IR5B 5LXYA 2OAUA 1NSAA 2MZQA 3D6HB 3KOAA 5MLCV 2IYGA 2KDOA 1TAQA 2J0WA 5G0RA 1RAEB 1KQFB 2B5JB 1YVFA 1YJNS 5B0DA 2BBEA 3D6MB 2YNHB 4DUYJ 2H5EA 5SUHA 1M0SA 4DS5A 3L7PA 1QAIA 1EP4A 2RU3A 5F0WA 4A8WA 4GKJF 4IFYA 2E5LF 2E9ZA 2G0CA 1N52B 1W25A 4EMDA 3KK1B 3TJ8A 3I87A 3CD0A 1RHRB 4YN3B 2JFKA 2VBZA 4P73A 4DFKA 3TWZA 2BVZA 2GIQA 2FVSA 5CYQA 3PRDA 4ZLLA 2BOAA 2I1RA 5AXNA 1FRKA 3H7HB 3IG1B 1FRLA 1T3OA 4GO7X 2B0GA 4RNFA 2CIMA 2F8MA 5CAAA 5FDLB 3DYAB 3MR7A 4WU2A 3BGFA 5HP1A 3DKDA 2ZKTA 1TL4A 2J0XA 2JNJA 4RNHA 1BQMA 4WU3A 4NRTA 3OTOF 2WSEC 3F41A 5DG7A 4X64F 3IP0A 5F8IA 3MFIA 2DT9A 1Q5VA 2BACA 1VISA 2PO4A 2VIHA 5AJ3F 4UQTA 3H2UB 3Q23A 4JI5F 3GJSB 1G6BA 2L9NA 3G6VA 5JUMA 4NLVA 2W7OA 2LP4A 4YY3J 2OPPB 2MKSA 3OXFA 2CPXA 4MKYA 4FKXA 3M05A 5ETQA 4LIWA 3LALA 4NLOA 1U6ZA 2HWTA 3T6JA 5F41A 1RT3A 2BQUA 2CZ4A 3IC1A 4PXDA 5C7PA 2GC8A 1SUQB 1WD6A 5KFOA 1IJFB 1SIZA 5ETSA 3L9ZA 4ZVRB 4ZOSA 1RT1A 4HACB 1X31C 4O3PA 1RYSA 2D3ZA 2YWWA 1ZS6A 2O5DA 1WG5A 4CYUB 3OSPA 3EWGA 3LP2B 1UEUA 3HD2A 3EYZA 3R9LA 5I42B 2VQFJ 3TQ1A 3GSIA 1N0UA 5E3PA 2HNYB 3M7VA 2VG7B 3ENVA 1Y5IB 3GFYA 2QA1A 2IY5B 2L9DA 2OJ3A 3TP2A 5ETKA 3CCES 1EJ7L 2HGMA 4BDPA 2QX0A 5F3ZA 3MZIA 5CH7B 1D09B 2RDJA 4ZVOB 4Y00A 3P6YC 3T9ZA 4OYBA 1YTYA 3C16A 3H90A 1WC6A 2ALZA 1SKRA 3PRBA 1N36F 5C2CA 2CPJA 3S1TA 2GJIA 4ELUA 4PG4A 3VHQA 4H4MB 3J7YI 5DGBA 1HWJA 4IO9Q 4LQ9A 5HVHA 2LMIA 1U4BA 2P5VA 1LNQA 3GFHA 2J9EA 3CCWA 1YK9A 4JI2J 5L8RC 4J9QA 4IR1A 4J91A 4EWTA 5LMNF 4OL8A 4RUHA 3MM8B 4CLYA 4NLRA 1CPZA 2UXCF 2EG2A 5F8GA 1NHUA 3MR6A 5C42A 1Q16B 1K0VA 2JSXA 3IGNA 2C2EA 1IKYB 2Y1JA 3FVYA 3W2VA 2ZJRQ 1RAFB 2R2SA 4ECXA 3TYTA 4YB1P 2VBWA 2UXBF 1QAYA 4IH5A 4OV6A 3EXCX 2FQQB 2HGNA 1RDRA 3FEZA 2KU7A 1TFYA 2E5LJ 4C11A 2AMCB 3DGPB 1BD6A 3ULHA 4BCAA 5EUHA 2MEWA 1CS4A 1FDBA 4DF4A 3SIPB 1Y9OA 5KFZA 1IM6A 5CYMA 4C4WA 4F4XA 1RBOB 1EETA 4KKOB 1WI6A 4FXDA 1EX8A 5F8HA 1EHWA 2FZGB 1T94A 3RAMA 3UO0A 2VFSA 3GYGA 1G1XA 3BSCA 2YH1A 1XIQA 2DITA 3A13A 3TJAA 2DRBA 3DLKA 1WHVA 5IQQA 4ILMA 2XB2D 1X9WA 1UFKA 4QR0A 3MWBA 1WOSA 3NAIA 4K4WA 3CVKA 3D1OA 2QLFB 4X4UA 1O8BA 2HKEA 2IYIA 3DOMB 1ZM9A 1HNXF 2IMWP 3V6HA 2NSBA 4RU2A 3QGPA 1RU1A 4J5OA 3AT1B 2HS0A 2GGPB 3R7BB 3ENAA 3GJRB 3OTOJ 1VQLS 1GAOA 2OO4A 1FTCA 4X64J 2GS8A 4AXIA 4C3KA 4NLQA 3UCGA 4DEZA 2FJEB 3CC2S 1FX4A 1SJ4P 4PUOA 1DLOA 4M95A 2CPHA 4C0HA 1OY6A 3DI6A 2EVZA 4YDDB 1HBNB 4FF2A 1EARA 4ANEA 3MD3A 4PYDA 4JV5F 4Q8EA 1LFPA 4MIWA 1UZHA 4DPYA 4PXEA 4OX8A 4DV7F 2MHNA 4CRJA 3P8BB 1FXDA 2GQQA 4USKA 2YVSA 2DB1A 2W01A 2G4BA 3PNIA 3I0SB 2XLJA 4YEAA 2BKNA 4NLWA 3M30A 3SBMA 2ZZNA 3MEEA 3TA0A 4M5JA 3O44A 5EN1A 4LFCF 3C8YA 1J5OB 3BDEA 3U27A 3BQ2A 2YQ0A 4CNYA 2BQ3A 2B8QA 3EX7B 3IN5A 4RBTA 1T11A 1APSA 2HQIA 4HHUA 2XGQA 4LF4J 1WNEA 1S48A 4CH1A 3QSYB 1SKWA 3H5YA 4ELTA 2RDDA 4KY3A 2LEPA 5EHHA 2A1BA 4WBFA 1RI7A 1N36J 1FXLA 3MPVA 3GJTB 2WK4A 3T1HF 1TFWA 1BQXA 2WW8A 1JLEB 1MU2B 1KLMA 4WFNQ 3CCVS 2HQGA 3M8SA 3VAMA 2LA4A 3T41A 4TY8A 1EAYC 5KFRA 3BKUA 1GH8A 4PG8A 4IO1A 3R3TA 2CZVC 4HDGA 1Y00A 1LKZA 5LMNJ 3IBCB 3DRYA 3N6MA 1B99A 4AL6A 5T41A 1Q8IA 2ACMA 2VPYB 2UXCJ 2QL9B 4Y65A 1X5SA 3POTB 4MMOA 4A8XA 2OEMA 2X3GA 4J7CA 2AEJA 1S0MA 3M2VA 5LMUF 4LBHA 1EKRA 3D0GE 3H5UA 3ILOA 1X4BA 3UCZP 2BW7A 5D8HB 2UXBJ 2A6MA 2Z56B 3G8SA 2ZBCA 3CDBA 1DHMA 1RTJB 3K17A 3OTDA 2BJDA 4B9LA 1JLAB 4LF9F 2EKYA 5C24A 1AT1B 1UVLA 4F7VA 1N33F 1IKXA 3BSOA 1FE0A 3BBBA 1KBRA 1EIYB 5KT5A 3M8QA 4C98A 3M2RA 4K2XA 3ITHB 2R8GA 2VDHA 5KFFA 3OR1A 2HURA 4LJMA 3M6WA 1T03A 4CLZA 3J80Y 4R8UB 1IJEB 1TMJA 4C0BA 1SB6A 2EEYA 1H38A 1LWEB 2AKWB 1VHFA 2K3KA 5DM6Q 4DZ6A 1SBRA 2M5YA 2D3OR 1IUJA 2F65A 3IWNC 2HNDA 5IQ6A 4HI1A 4WCEQ 1QUVA 4XK8C 5GMEA 5HJXA 1TKTA 1NKBA 3NS7B 4DSFA 1HNXJ 1KD1T 2NS1B 1EQ0A 1K9MT 1S4EA 3UDEA 3BPDA 2XY6A 1WWHA 1JLBB 3KDNA 4M8LA 3JYTB 5JMNA 4ZP9A 3VVTA 3W66A 1JLGB 1VDHA 3CD7A 4B3TF 1VQPS 1S72S 1PJ5A 4Z37A 1S1XA 1CJKB 1F3VA 3W2WA 3AD8C 1WOOA 1K44A 5DDQC 1R43A 1KOHA 4LQ3A 4FNHA 4JV5J 1U6FA 4EYHB 1UW4A 4DV7J 4TNOA 5LJ5Y 2V5HG 4I6AA 4ZIVA 3KJQB 1TK5A 2KL8A 4Y6IA 2AZ1A 3KK1A 2QIFA 1RT2A 3D54A 1ZTTA 4HR2A 2FC9A 2GQCA 2VZ9A 5AE3A 2DR6A 5KFMA 7FDRA 3G82B 1UVNA 3UN5A 4B17A 3AH6A 3PR5B 5CCLA 1NJZA 4LFCJ 2AGPA 5E0OA 2HQCA 3M4XA 1PJ7A 1UWBA 1PJ6A 4FS1A 2XYPB 3HD1A 4F2SA 3A8KA 3GR0A 4ED6A 5KFCA 5IXUA 2JC1A 2NYIA 1SPBP 1PC5A 3SYZA 4O3SA 2HFUA 1HA1A 1U0HA 3EZ5A 5HBMB 3DYAA 3DCAA 1HBOA 4U9RA 4FYXB 5DM7Q 2DGSA 2LYVA 2E7WA 4DSEA 3VAHA 2GX8A 2CJBA 2OMOA 3MTJA 3T1HJ 3LW5C 3M1VB 3C6UB 2ZD1B 3CO0P 1FK9B 4EFAC 1R0AA 1EZZB 1VQ4S 4U67Q 2LFVA 3K8VA 1C4AA 2G1HA 2F7VA 4DR6F 3HX9A 3AA9A 4R5PB 4URGA 1OYDA 3PX0A 2NPIA 4C7QA 1Y5LB 2DEIA 2E5GA 4NASA 3KLIB 2XG8A 1F3FA 1RTIB 1M1HA 4ECVA 2DBBA 2GFFA 3EXYA 4CI0B 4WXWA 5E41A 1OIAA 5GAGI 4NMXA 5KFPA 3OUYB 3WDOA 2AYBA 4JI8F 1SUQA 5LMUJ 1ZOTA 1F9EB 1GQEA 1SQGA 4QZVB 4LF7F 4N77A 4HACA 1MW7A 5D0RA 2VJVA 2OEJA 2CQ4A 2B3TB 1RAIB 3J80U 3FMBA 1HQEB 3LP2A 1I3OB 3TZZA 4LF9J 3UE2A 5I42A 2FJVA 1F5BA 4DPXA 2HNYA 1Q1KA 1XNRF 2CAJA 2DGXA 1X5OA 4FPRA 2F4FA 4CTAB 3C6TB 2R7OA 1EKSA 3IXQA 1ZZNA 2U1AA 2BJ8A 4IRKA 3MECB 2LXIA 1ELOA 2ZOMA 5DQIA 2ZZMA 2Z0GA 4G1QB 5JJBA 2OPSA 2YWGA 4DZDA 4QU6A 1REVB 1HBMA 1Q79A 2KFZA 3R5CA 3OLAA 4H4MA 2GCFA 4J9KA 1P1LA 2P9GA 2I9SA 2K1RB 4Q43A 2WCXA 2Q6BA 4RPFA 3NCRA 1DFDA 2FHJD 1IR2A 4HHHA 3L3CA 1PYOB 1M1KT 4P72A 1RT6B 1ZA1B 3W8PA 4B9UA 3NMRA 3K5LA 3E01B 1YBUA 4DG1B 2KZZA 1QE1B 2VC0A 3GYXB 1IR0A 3MPUB 2AYMA 1WDDA 1GMVA 2V8VA 1PBUA 5JXSA 1TVRA 1GK8A 2KXHA 1QM9A 3PEJA 1XK8A 4B3TJ 3KLGB 3CULA 3K5PA 1P6TA 3MMBA 1S0OA 4JBCA 1R27B 3R1LA 1GMUA 3W3SA 3IA0A 4F04B 2YKQA 3HT3A 3HVRA 4PG6A 2JL9A 4L74A 3LANA 2KO1A 2ZNYA 4X66F 1YLXA 4DSLA 1MSWD 1OMSA 5ETRA 5K14A 4KFBA 4PG7A 1YRTA 1OYEA 1WTBA 2RE1A 3W65A 3Q86A 1VQ9S 1BQNB 2R7WA 1NB7A 4KKOA 4OZLA 2A2CA 3O8WA 2CDRB 4WTOB 1Q53A 3EPGA 2HHVA 3SMZA 3NBPA 2OPQB 3HKWA 2LLZA 3DRSA 2R9LA 4YB6A 3C15A 4CH7A 4OX6A 4HH1A 5IC4B 4XAKA 4P74A 1UKUA 2XTJP 1HHQA 1U26A 4J9LA 2IJRA 5GAEU 1HI1A 2YKOA 4EYIB 2XWYA 2XY7A 3NGTA 3CCMS 1KTQA 1S59A 3FC9A 4AT1B 3MAAB 4PQUB 4LSLB 4ZKAA 2CQDA 5F8JA 5DDOC 2Z58B 3CEDA 2X51A 4MYUA 4OJGA 4NYOA 2F8HA 1SQEA 1KQKA 3EVOA 1TZ0A 1HBNA 1NLKL 3R5JB 3V6JA 1VR6A 1V3ZA 3LQVA 3DC2A 3T5KA 1I6JA 3HVTB 2D9OA 1XBWA 2EC0A 1LWXA 3NY0A 4B3RF 1UWAA 3BGLA 2YWHA 4JI8J 3QT5A 3LP0B 2FJDB 4A4JA 3QWUA 1SV5B 1WSVA 4LF7J 1X9MA 2DH7A 3HP6A 2FVCA 4CO3A 4KGXB 3BJYA 3NWGA 2JEFA 2DR5A 2CQGA 2ZVIA 3NLCA 1FTRA 5D3GA 1XNRJ 1S49A 3L7UA 2IAJB 1F9HA 4QYRA 2AP6A 2XMJA 1FKPA 1LWFB 3CDWA 2HFOA 2P9EA 2CPZA 3G8QA 2DNQA 4A48A 1TKZB 4WZMA 4DL3A 1RP5A 4FF1A 2DXEA 4KGZB 3K57A 5KG1A 1SJ1A 5CABA 3JB9k 1U1RA 3I5BA 5CZVA 1JLEA 4DV6F 3PFEA 3NP5A 1MU2A 4P2XA 1SQFA 3R97A 4E8UA 2BR0A 1N6QA 3FZ2A 3HVWA 3JTOA 2ZWOA 2GO8A 2HSEB 1JXVA 2DIUA 4OQJA 3B8HA 2COLA 4NEYA 4USIA 4ENOA 3LH2S 3UR0A 5KFAA 3BN7A 1WACA 3CC7S 3SCIE 3ISZA 2W24A 5L1LA 4C8LA 4ID5A 1NHKL 4QBUA 2QLWA 1NPKA 5AE1A 4HTIA 2MZJA 2NLWA 3POTA 3OL9A 5EX0A 2VQEF 4V1Ak 2M8HA 1KVIA 5KFDA 1Y3KA 4QIGA 3CXCR 2IVFB 2ASYA 3S6EA 4H4KC 1QSYA 4X4PA 2R7QA 1RTJA 1JLAA 3KTQA 3OVSA 4G6VB 5L39A 4X66J 4AYBD 2RKIA 5T14A 5BR8F 5LSOA 2CJQA 1W2IA 4J9UE 3IM8A 3HMJG 4EEYA 4AFFA 3GONA 1JXEA 3E8OA 1WEXA 3MAHA 1LW0B 2YNFB 2PEHA 1A0OB 3BV8A 1RHUB 3TVYA 3UW1A 4KT0C 2C22A 2OH2A 4JV1A 4NXMF 1KDNA 3EGVA 2CJAA 3G6XA 3AB4B 4PEOA 1FD2A 1B64A 3MM7A 2XLIA 1LWEA 2HBRB 4WYWA 3SSSA 4X4SA 1GXTA 3KNAA 3I55S 1YITS 4F8RA 2MLXA 4WP9A 2ZUGA 3CT9A 5HL7Q 2KM8B 3UFCX 1XR6A 2IRYA 3SQOP 3W9IA 4J9SA 3PACA 1ZA2B 1CULB 2HWHA 3OXLA 3T9NA 3ZNUA 4X4OA 3FUYA 1HMVB 1PGZA 3AQOA 1B7YB 5DLFA 4KO0A 4IG3B 1BUXA 2HRTA 2LXUA 2R8JA 1JLBA 2DVIA 3HSGA 5D15A 3WC2A 4JV0A 1SH3A 1WEZA 1B3TA 4K2JA 2HFNA 1JLGA 3RRGA 1RWKB 1CJKA 4FYWB 5KT4A 3DM2A 5H9FK 4LSNA 3PXGa 1X4EA 4F26A 2CKWA 2W2QP 3I32A 2FZCB 1TL1A 3Q0AA 1WKJA 4DCOB 4B3OA 2BE2B 1G2EA 2POKA 3K59A 3HT0A 3VZIA 3Q83A 2G0JA 4N41A 2GVZB 2MPUA 4B3RJ 1L3SA 1QAJA 2HK3A 5A2QY 3OTCA 3FQKA 3D5MA 3ET6A 1AUSL 3CC4S 1F6TA 3CPWR 5L1IA 3G87A 1SL0A 2R8IA 3G82A 5KFUA 2G2OA 1WG1A 3MEDB 3OHAA 5D0GA 3OFEA 3DHWC 2GW8A 4ZIWA 3KMQA 2CJXB 5K8OA 5HATA 5GAHU 1D8YA 2QSFA 3V6KA 3UQSA 2IRUA 4ZPVR 2DH8A 2AX0A 3UDLA 2BDPA 3MGJA 1G3OA 3DHXA 2V2VA 3QNWB 3HO1A 3GFXA 1AROP 1VQ7S 2PD1A 3RBXA 3DLJA 2AYGA 3LGMA 3KJFB 4OI0A 1VFJA 2VF3A 3U02A 3D9BA 2QEXS 3HK2A 1H2TZ 2GMLA 4YB7A 2IVYA 3M1VA 1LXJA 4NZ7A 3C6UA 1UJ6A 2ZD1A 3E3XA 1FK9A 3CIZA 1FDNA 2V8DA 1H2VZ 2PMZD 3MM6B 2HLTA 3AY0A 2Y1LB 2MXYA 3P4UB 2DCLA 3Q8UA 4F3OA 4CT9A 3M9MB 2W7AA 1R8CA 1RABB 4RW6A 4R5PA 3AFGA 3BR9A 4U7CA 1HQ2A 1YJ7A 2EXUA 2HK2A 3VGSA 2OTLS 1U1MA 3KLIA 4RX6A 1RTIA 2DIVA 1NPPA 1C1CA 5A8RA 2XCAA 3OUYA 2YXLA 3CJ0A 3QGGA 3DFEA 1GMWD 5KFVA 3MF5A 4MTPA 1C0UB 3ZZTA 4OLPA 4R25A 2VL1A 2VFRA 3RUBL 3AXMA 1HQEA 2B6AB 1E6YB 5ETVA 2JVRA 3DRXA 2VKRA 1O5JA 3IRWP 2XMAA 1SI9A 2WSCC 1SKUB 1VLOA 4EBCA 3IR7B 3B4MA 4LRAA 5BR8J 1CC7A 4I7FB 3KDOA 1JB0C 1RWVB 3MCNA 3DN9A 1Q82T 1AW0A 1ZBTA 2QFJA 2ZHAA 2BEFA 2BJ3A 1NDLA 2WBRA 1UPPA 5HI7A 3BO2A 4NXMJ 1YSJA 2Z2LA 3L95X 2DGOA 4CCHA 1HIYA 3ZO7A 2VD3A 2DO4A 4MFBB 4A8QA 4U95A 1UEVA 3H8YA 2C2NA 3CJ2A 1FO1A 2OELA 2RUSA 4MJKA 2YX7A 4K4ZA 4FP9A 1DQ8A 1UL3A 1KS2A 3JSRA 3LAMA 1MG7A 4F25A 1P8GA 3W5XA 1YJ9S 4WPAA 3MMJA 2PSZA 3FSXA 4GKKF 4DG1A 4KTQA 4CO4A 1QE1A 1ZM3A 3R5DA 4IOCQ 4F4KA 3Q89A 1CLFA 3J7A1 2QA2A 2P8IA 2FGOA 4I68A 1VBKA 2Z57B 4DFMA 2AF6A 5B0FA 3QATA 5A2QU 2KB2A 3E2EA 3T6BA 1RB0A 4N7TA 4K4UA 4Y2KA 4DLGA 2PDAA 4NLUA 4B9VA 3SI8A 5F9LA 3CGIA 2AZ3A 3BH6B 2M70A 2ATLA 4GRSA 2A3JA 1UFLA 3EGZA 5ETPA 2NYHA 4I64A 1FDDA 3KWMA 1CBKA 3ILIA 3FRYA 2VHGA 1WC5A 3QT6A 4ZK7M 5E33A 5ETNA 5ADZA 4Y0FA 1TL3B 2H54B 2IC3B 3SFUA 2WRMA 1N8RT 2V8GA 4Q2LA 1XMQF 2HS3A 2QMWA 5C2GA 3FRZA 2ROPA 2OPQA 4C97A 3PJ9A 2V8PA 3IRXB 2V0NA 1RKJA 2AGQA 2I5JB 1WF2A 2XI3A 3ZFVA 4Q5VA 4QR2A 4CLSA 2WW4A 4ECYA 2ILYA 1NJWA 2DD8S 2JWNA 3QQCD 1VQMS 3A8IA 4LF2A 5CYQB 2I38A 3UVJA 1FRJA 3DDIA 3D4JA 5A8KB 1DTTB 2CQCA 2RILA 1Y5NB 2E1MC 3PO5A 5A0YB 3SSQA 2FGCA 3MAAA 4PQUA 4LSLA 2R7VA 1VC6A 4IQXA 2Y0BB 1PO6A 3TX0A 1VK8A 3I9V9 1IBLJ 2QA4S 2YX1A 6AT1B 3VAFA 2GA7A 4NZ6A 1XQIA 3BGUA 1JQGA 1S1TB 1NKCA 2HQFA 3R8YA 5HP1B 4OFZA 1NM2A 3QJJA 3FMWA 2BRLA 5LL6d 3HVTA 1BQMB 4O4GB 1G7CB 1HWIA 1T3NA 3LP0A 3V5RA 1MWYA 3Q8QB 3N01A 3MEKA 2H65B 3D1QA 2VOPA 1RAGB 4QR1A 1D1UA 4WFZA 4NCGA 2VC1A 4P9SA 1NDCA 5H9EK 1B4SA 3HSDA 2FJXA 2BOPA 1R8BA 2RD5C 3LPEA 2AW0A 4ZVEA 2OKQA 2PC6A 2RRBA 3RW6A 1RT3B 2IAJA 3GIMA 5CXTA 5AXKA 4CLWA 5I3PA 2R2RA 3HSJA 2FHOB 4AQYF 1TKZA 2GMHA 3GIJA 1ACMB 2FTRA 4M5KA 3OV7A 4NLGA 1D9AA 2PGCA 3ENWA 3H98A 5D4OA 1DARA 4NLYA 2X1BA 1TL5A 4PCQA 2DRAA 3ZTPA 2AEMA 2AU0A 3W1YC 2VODA 2YH0A 1K1QA 5F8MA 3KJVB 2ZOFA 3PW0A 1JKHA 4FXVA 2CNOB 1ZM4A 1BHNA 4OYWA 8ATCB 4NA1A 2Y3YA 4W90B 1HD1A 1RTDA 5JVHQ 3PKMA 4A8OA 4PPZA 2HS4A 2J8AA 3QIDA 4GKKJ 1RA6A 5HMXA 4LBPA 3T3FA 2JEGA 5EX3A 3LWLA 5KFBA 3Q8PB 1RKIA 3RB6A 4CLUA 4DS4A 3OPKA 3MXHP 4QYZK 3TRGA 2V8HA 4OZ0A 4EO6A 5C25A 4PKDB 3FSIA 1N5QA 4ZDNA 1KC8T 4CLTA 2Q3PA 4W98A 3T5HA 2WVDA 3HZGA 3ZTSA 4WJBA 2RQKA 4I0WA 4A8SA 3DOKB 1XTZA 2LEAA 2V9KA 1M5KC 3MI7X 2VICA 1MMLA 4C6AA 3QGIA 5LSLA 1NRKA 3HDSA 1Y7PA 4CT8A 3LP1B 3OFFA 2Y0SD 4OHZA 1X5PA 4RO0A 1HBUA 2CQ0A 1AB8A 2V4JA 1LW0A 4TN2A 3W2VB 4K59A 2DNOA 1H2UX 2QYGA 2I6WA 3PHEA 2X1FA 2G0IA 2VV5A 3N6LA 2UUCF 1F1BB 2ROGA 4CO0A 5I3QA 2IJFA 2WAQD 2F9DA 3AA8A 1T9VA 4DCJB 1IM4A 2B9EA 3ZZUA 1XMQJ 1TL7A 4I2QA 3ISND 3MOZA 2RRAA 1M5OC 1GX5A 1B70B 3IS9B 5KFJA 1U48A 2B9WA 1HMVA 5CYMB 2FY1A 2X3DA 2WVEA 2DNLA 4IG3A 3K7RA 4NOHA 5KT3A 5KFEA 1FNOA 1B0PA 3HFVA 2WB1D 5DLGA 4OZ3A 4DU8A 1HWKA 4ES1A 4KH0B 1F60B 2ZNZA 1WC3A 1U24A 5F8NA 2IMOA 3VR1A 4K4TA 4DV1J 4K8RA 2RQMA 2J9CA 3G6YA 4JI7J 3DLHA 1MNEA 3NAHA 2D69A 2XZTB 4Q7AA 2KZMA 1SL1A 3S01A 3CCQS 6FDRA 2GVZA 4NRUA 4PXBA 5HANA 2AJQA 2AJFE 2GAGC 1F2GA 2C2KB 4PUOB 2OHDA 2M2BA 1IWAA 2G2YA 1VBXA 2Z2MA 2GVDA 1PAEX 3DI6B 3MEDA 1KQSR 4L76A 2DHSA 5IS2A 1TELA 5KFWA 4U8VA 4Y28C 2XS5A 4HLBA 3MUVP 5J2NA 2VASA 4RW8B 3HFKA 1I1GA 4TVAB 4UOFA 4PWWA 1H3DA 3CJKB 2E7XA 4AQYJ 3VGUA 2XEXA 3TZWA 4NLTA 4ZLPA 3M30B 5CD4H 1M5SA 4LF8F 2PEBA 2Z8QA 2R7TA 1BWEA 2C2ZB 2DKOB 1B0TA 3ZNJ1 1DURA 1LQ9A 5IV3A 3A3PB 2A6OA 4G3IA 2O01C 3AB2B 4UY8T 3D66A 4J9PA 3RB4A 1NEEA 4ECZA 2M88A 1TKXB 1DQAA 2LCWA 4XO0A 3WQPA 2JHEA 3ETOA 3WX4A 3QRRA 1YJUA 4TY9A 1OO0B 5KT2A 1XN9A 5G4DA 5F9NA 2OP5A 4ED5A 4WYLA 3PO4A 2ZH1A 3AOAA 3VZHA 2XGPA 1VQSA 4IG0A 1C0UA 1IBKF 5A6WA 3NCQA 3TZXA 3MEGA 1X0FA 1U1LA 4IRCA 4USUA 2EWHA 2EKNA 2YKMA 3QAUA 1X7VA 1JJHA 1RWWB 3T5LA 2KTQA 4C2MA 1U1QA 1FNXH 1LV5A 3TOQA 2QE5A 4RWXA 2Y9HA 3WBZA 1RAJA 2JLGA 2XQCA 1HW9A 1S12A 2J76E 2F63A 1H6KX 1Q7LB 2UUCJ 2GQ2A 3ZZZA 1HNIA 3EDQB 4A46A 2DNZA 1NK4A 4KBIA 2H3EB 2R2TA 3UDVA 5KG5A 2ZVSA 3GPAA 4L72B 1IKXB 4K7QA 2CYYA 2C3UA 3C19A 1GMWA 3HHKA 5KTQA 4USWA 3BGRB 3HXMA 3M8QB 3M2RB 1LK5A 1TR0A 5HN0A 5KG4A 4OMFG 8RUCA 3OR1B 4RUBA 2BM0A 4RUAA 2RNEA 3RU0A 2GHVC 2BM1A 1QVFR 3DDNA 4PWDA 4LFBF 4ZLJA 2JH3A 2BJ7A 3OR2B 4FNIA 1FEEA 4TQSA 4DV4J 4DR1J 3L7OA 5E3RA 1WHYA 2XI2A 1UP1A 2AHOB 1NBEB 2JLFA 4J9NA 4Y2CA 2FY8A 5HMYA 4WZQA 1TKTB 2W4DA 2XSJB 1R3NA 2NXNA 5BYRA 1RLDA 1VI7A 3QT8A 3EMTA 3R27A 4ZVPB 1DZ5A 2QLBB 1FJ7A 1CVJA 1S9EA 3FBFA 2XM3A 1NSKL 2QTWA 2ERRA 5D78A 3ELHA 2DNMA 2OI2A 1S1XB 3W2WB 1V3SA 3MCOA 1NK6A 4WFBQ 1TL3A 5H1SV 1ZZFA 2RVJA 4JI4J 3F73A 4HI2A 2IC3A 3A3NB 4WXOA 4Q45A 3OBIA 2C3PA 5T7LA 5J1PA 4MKVA 2MLYA 4OHWA 1RBAA 4DV5F 3CE8A 2XMMA 3M2UB 1K8AT 4DX8H 3GFZA 2LQ5A 4DR7F 3IRXA 3OLBA 1KLNA 1NJXA 2HFSA 2I5JA 2NR0A 2QSWA 1RT2B 1VRUA 3JQKA 5ETLA 5AE2A 4LF8J 1URRA 4ITSA 1U45A 2YNIA 4LIRA 2KHDA 2W4PA 2H4WB 5A8KA 1XJWB 1WSRA 1DTTA 2RS8A 4HT5A 3FFIA 4LRDA 5FLXU 3AAWB 5A0YA 5GAHI 3IGVA 3QYYA 4R0JA 3UD4P 1UWBB 3DLBA 2UVVA 2ABYA 3TQEA 4HHJA 2YY3A 4JOUA 1KKHA 2BRKA 1N56A 3KK3B 3ZZRA 1U0HB 4OLOA 3IFEA 1QY7A 1HBOB 2J5AA 1S1TA 2Q6CA 2PMHA 3B82A 3RR8A 1H7XA 2UU9F 4O4GA 1AYEA 3KLHB 3ETMA 1KN6A 2J7WA 5MAOA 4F3MA 1R0AB 1NSPA 3K5OA 1FNMA 3LPYA 4ZVTB 4KB7A 2C1EB 2OSQA 4UTGA 2JOQA 2IHR1 3C3LA 4M94A 2LQ9A 1IBKJ 4DQPA 3KMSA 1CJTA 2HHQA 1SVDA 1RYRA 4MK8A 1U2FA 3RZAA 3PRVA 3OW2R 2VKZG 2MLZA 1T9TA 2GIFA 1VQNS 1X4AA 2XBPA 4U96A 3K58A 2O3DA 3G8TA 5FIIA 1KFSA 2MQLA 2ZM6F 2K06A 3QO9A 4CLKA 4QWEA 2BW2A 2V2QA 2LXFA 3C66A 1W7WA 3GIKA 2EW9A 2XYGB 3WIUA 1UVKA 3KJVA 1IN0A 4L73A 2Y8YA 1G4CA 4OI2A 2V69A 1WKLA 4LF4F 2MQMA 3FBBA 4OJHA 2ZH4A 3DDKA 5KOWA 3BYRA 1X5TA 3PG9A 3IBWA 2OPSB 3BBFA 3H0PA 3PW4A 2Q43A 2ILZA 3TAMB 4LFBJ 1RSCA 1HBMB 4LBIA 3JQJA 2A18A 2GAHC 3RR7A 2ZHBA 3QIPA 5GVQA 2FLPA 2VFTA 1A7GE 2ZEJA 1URNA 5L1KA 1LWCB 1HWLA 1CJUA 4LF1A 4N8NA 3I82A 3DOKA 4M5HA 2D1CA 2B9XA 3TVZA 3FQLA 2NPFA 4OZ5A 1NU4A 5KG6A 2UV8A 2J7KA 3T5JA 5KFKA 3RRHA 2FHMA 3LP1A 1VYAA 1T9UA 3EGWB 1TVRB 1RT5B 4USTA 1ZPWX 1HNWF 2ZHOA 4BLGA 4P2SA 1UEKA 1NZ8A 3MMBB 4IDKB 2F9JA 4TQRA 2XMWA 1FERA 2VH7A 1U2RA 1YBTA 2V2KA 4C48A 1NPRA 1N5VA 4RBVA 3D68A 1MWZA 2LECA 4QIEA 1NNDA 4DV5J 1TTHB 2H4YB 5K14B 4DR7J 2F8EX 2KJWA 1AFJA 4KFBB 3UNGC 5HSPA 2YWFA 3W5YA 5DG8A 1E6VB 3IS9A 3GYNA 4ZVHA 1U1PA 2QRRA 3V6DA 2CJYB 2JJ4D 4NPOA 4KPCA 5KG0A 1YKWA 2HYIB 5IT9Y 2UV8G 3CSKA 3K89A 3IMQJ 2DNGA 2IPOB 4CH0S 1C0TB 2VA3A 5D4LA 2ADBA 2CQBA 1K0TA 2QC3A 2EG1A 4BWMA 3NBPB 2FC8A 5L9NA 3N79A 3VVUA 1FA0A 1FWLA 3SXLA 2L3MA 2MJUA 3E51A 2GV1A 3DRSB 5IC6B 3SCKE 2YKPA 4C8OA 2J0QD 2DXDA 3C15B 4H4OB 2XNQA 3TARA 3KHRA 4CO2A 3PW2A 4JI3F 5EDWA 3NWRA 2KH9A 5KT6A 1HI0P 3K0JA 1BC6A 4KR0B 2H5JB 2UU9J 4PQAA 5B7WA 2BABA 2BJEA 4R0EA 5ETTA 1QLNA 4KPYA 1N5YB 3NG8A 4BS2A 4GC6A 5THWA 3TEHB 3GCWP 3UCUP 4DJBA 2GMJA 1D3WA 2P6TA 4RL1A 1R8HA 2V9WA 3F0NA 3M8YA 5DZ7A 1X60A 1BGXT 1QSSA 5EWGA 4N56A 1ULRA 4CM0A 1YIJS 4KHPF 4KJIA 3CJ3A 2LA6A 3I4PA 1YZ6A 4ECQA 2DTJA 4HL9A 2J6TA 1JLFB 3MUMP 2C2OB 5IT0A 3HHEA 5DG9A 3Q8YA 4Y2AA 3Q8VA 4RW8A 3M6UA 4BWJA 4I69A 3BYPA 2JLEA 1FX2A 3HVAA 4OZ2A 3CJKA 3Q24A 3D6FB 2C3OA 2HBQB 3H4BA 2ZM6J 2L9WA 3TZYA 1YG0A 5F3TA 3BDPA 2ASLA 4P52A 2M52A 2E1CA 3US5A 4YR3A 3MMAB 2BJ1A 5KAKA 4KC5A 4Q0BA 5D3GB 2K7KA 2XMUA 3GE9A 1U25A 4NI2A 2EI5A 5B0GA 3G71S 2CWKA 3RAQA 2DNYA 3CW2C 4NEZA 1FKPB 1Q4RA 3OVAA 1TKXA 3MPWA 2AD9A 2HQDA 1AFIA 3OSNA 2H48B 5M2RA 3D0HE 3QRPA 3RB3A 2PT0A 3D28A 3GZ7A 3U1NA 3TNVA 4DPWA 5HQ8A 1YHQS 2A0FB 3TUPA 1Q86T 4D3HA 1SJRA 1N6QB 2CNNB 5KG3A 1XR5A 4QCLA 1YRXA 2DGQA 3THVA 4NZ0A 2Q79A 4I67A 2D3UA 4LT6A 4ZHRB 2KT3A 2VBYA 3CDAA 5DS7A 5IWAF 4OIXA 4ID5B 3MTKA 1F5CA 3FEYB 1Z2ZA 2VG5B 1U7LA 2HFVA 5KG7A 1TV6A 1VBYA 1R89A 1FVQA 3MM9B 2MKJA 3VGTA 2CWXA 1HNWJ 4OYXA 2K2PA 4LFAF 4Z7YA 4PXCA 5KFHA 3CIMA 1V5VA 3CCLS 4RWWA 3BZQA 1S5ZA 3SV3A 3QPIA 2RU9A 5IT9U 2PFFB 4O3RA 2LU2A 5BYQA 1WHXA 4GVLA 2F40A 2P2CB 1RCOB 2RKIB 2LQBA 4HTJA 3KUEA 4ZCIA 2HHHF 1S1UB 1DY3A 1YJVA 2MSTA 3NGKA 3GSDA 3BGRA 1Q0NA 1W2BR 4UZBA 3M6XA 4NWBA 1RHQB 2XC9A 3DMJB 1J5EF 4XDDA 2LQ8A 1S1VA 4DQQA 3MM7B 1NH7A 1V3RA 2KJVA 4B9TA 3ZZPA 4C8YA 4CWBA 3OR2A 1JJ4A 1FFWB 3THPA 3NNHA 4DR4F 3VCDA 4ES2A 3V4MA 2RIJA 1RQ0A 3M8RA 4IQMA 2IDLA 1OSCA 3M8WA 3U1MA 5CZXA 1MWQA 4DV2F 1DAXA 3J81Y 3H59A 1ZTWA 4DPOA 1FD8A 2XSJA 1ZAWA 2LVWA 5J2MA 3N5FA 4JI3J 3H42A 4ECWA 2CJ9A 1X0PA 3AOCA 4QYZJ 3Q2TC 4KO0B 2WVFA 4JUZA 4GC7A 2V63A 1UFWA 4KAIA 4URSA 1S1WB 2W25A 4F4AA 5ITHA 2J9DA 4FPIA 4MK9A 4FYYB 4F36A 1Q5YA 3GIIA 3LA0A 3CCUS 2KYXA 2ZH3A 3DM2B 4LSNB 4QWDA 5L9XA 9RUBA 2Z4PA 4KHPJ 3O1LA 2HAIA 3DNCA 4ED2A 3CD6S 2ALYB 1TL1B 1FI4A 3F44A 3FJ2A 2BV3A 4FDFA 5KFXA 4B3OB 1NK9A 3DLLQ 4LF5J 3M2UA 3LUYA 3I0RB 1TMMA 1VRTB 2G13A 4FXWA 4F0HA 4TU9A 1Q8LA 4C3LA 2L41A 1CQMA 1FESA 2XULA 3ET6B 3WC0A 4QW9A 4JV2A 1B7FA 2BQRA 2LQJA 5KFTA 5DDPC 1A6LA 2HRUA 3H2VE 1GT8A 2R42A 3TUZC 2NZ4A 4GMKA 1VQYA 2AJ1A 3LAKA 1HNVB 4KGKA 4GO5X 3UR3C 1RCXB 2MZTA 2KFYA 2QMUB 3DLEA 3HHLD 1GXUA 4U7UD 2NUUG 1IKWA 2RH3A 5D0HA 1GTEA 3HZEA 2BKPA 1UZDA 5HLFA 4QJVA 1VGYA 1U1OA 2PA8D 4KSEB 3KK3A 3WX8A 2OGUA 1SCJB 2NXJA 2DO0A 4LRCA 3ONQA 1N54B 8AT1B 4P7TA 2EFGA 1LXNA 1NHVA 3W60A 3KLHA 2XHWA 3CCZA 2N3OA 4C9DA 7FD1A 4A8MP 4EGLA 3S7RA 3IWLA 4ED8A 2MKYA 1RTHB 3UD3P 1FF2A 2EFOA 3RJMB 2XMTA 1FCAA 3EICA 3DRPB 3HJVA 4RW6B 4B9SA 4F2RA 5IWAJ 1R31A 4YMEA 4DR3F 3P96A 2XSFA 2GZOA 2HHSA 2IBOA 4X62J 4YS2A 4RNNA 4JYAF 1RHMB 1C1CB 5A8RB 1UW9A 2CADA 4ZN1A 4LFAJ 1MROA 1K1SA 1RWXB 3OL6A 2WSFC 5GMKa 1FFGB 4WWSA 1BE4A 4ZVUB 2BANB 3A12A 2XMKA 3QJPA 4X4TA 3BH7B 1N32J 1KSPA 2CUYA 2M0GB 2B56A 2DNPA 3PDNA 1WF1A 2XZDB 3GLJA 5F0UA 2ZDPA 5DZ6A 4ZJLA 3ZZ0A 4FZVA 3BPSP 3V4IB 4N76A 2HHHJ 5I3UA 4MAKA 3JTPA 3CO9A 1CG2A 3PX4A 1TUVA 2CNKB 3LGNA 4DQSA 1RWOB 2QLJB 3J81U 2BXJA 4AL5A 1REGX 1J5EJ 2YNGB 5DGAA 3TAMA 3BSNA 3P5BP 3KG0A 2CQHA 3G2XA 4DR4J 1S4FA 2QV6A 2YKNB 1FVSA 1PBAA 1GFWB 3HHLC 5D77A 3QRQA 1LWCA 4ZVFA 1RK8A 1RUSA 1PIEA 4DV2J 2VA2A 3HHDA 5FJ4A 2JC0A 5ETOA 3M9OB 3TW0A 1L3KA 2QL7B 2MGZB 3I9ZA 2YWKA 2B4UA 1SC3B 4ZP7A 4LR9A 1IVZA 3MCSA 2G1DA 2BYCA 1RT5A 2ZBRA 4M5MA 4OZ1A 3DU6A 2L08A 5SZTA 1YI2S 2HMIA 1UAWA 1RU2A 2UVRA 4IDKA 1IQTA 5DJBA 3TA2A 1SC4B 2FUG9 3CJQA 4XPEA 1PAUB 5HK4A 1MN9A 1L3VA 3R6GB 3KNGA 3MURP 4M1KA 2MKKA 3PM9A 2IA6A 3AJ1A 3VAKA 4Z7CA 4F0MA 3CMAS 4P2FA 3SSRA 4ERDA 1RA7A 4JI6F 2ADCA 1CJVA 3CUNA 1KNZA 1S6UA 1HHSA 1E6VA 5KFIA 1SJ3P 3CCSS 1S9GB 4K5SA 4DUZF 2SXLA 1KONA 4O3NA 1A9NB 4NXNF 1VC0A 4IFVA 4FBUA 4NCAA 1C0TA 1I51B 1M5VC 3D7SB 4B02A 5GADI 2OFGX 1AZSB 3CNQP 2MKCA 2KN4A 1S9FA 4H4OA 4FVMA 5AXMA 5E3AA 2F5GA 5K9FA 4MKBA 2EC2A 4NYZA 4CDIA 2DR9A 4JI1F 1U1KA 4EI2A 3UVJB 4WP8A 2RQ4A 3EDRB 4LF6F 4LSZB 2CVEA 1NH8A 3D67A 2MHEA 4FVCA 1AA1B 1N5YA 1ZAVA 3QZ8A 2NXUA 4OI3A 3P3DA 4CO1A 3PYEA 3I4HX 4DPTA 2OPRA 4UW2A 4OI1A 3C14B 1D9FA 2OTJS 2K8GA 4QPTA 4KGMA 2ZC3A 3NCPA 1IBCB 1BWVA 4P2MA 4RW9A 4ILRA 3BREA 3VALA 3HPOA 4DR3J 2R8HA 3RRKA 1SJFA 1PKUA 4F67A 1JLFA 1HARA 1GNKA 4DR2F 4JYAJ 2CPYA 1NAQA 4K0KF 4B3SJ 3FKBA 1SH0A 1UTAA 2RQCA 4RZRA 3W7BA 3H4DA 2CRLA 1KVKA 2LDIA 1U2CA 1OY9A 3EZOA 1RWUA 3BS9A 4CIOA 2MSSA 4IR9A 2UUTA 2VJUA 1Y11A 5K20B 2H9ZA 4NCGB 5HROB 1WG4A 2IIHA 5HAOA 3MMAA 2YX4A 3P49B 4ILLA 3D3CJ 3DLGB 4I2PA 2WVCA 3GV8B 4F4ZA 2W9BA 3B54A 2M7SA 2CQPA 4LR7A 4CLFA 4L3NA 1MLAA 3MHYA 3UPFA 5J1EA 4WTYA 1YQHA 1HYSA 2WHOA 1XNQJ 3BB5A 5GMDA 1OPZA 4DL7A 2HVEA 1L5UA 3GQCA 1Q8KA 1C2PA 4Q8FA 2DGWA 2HBZB 2CNLB 1QDUB 1O51A 4DXLA 5E7OB 3CCJS 4FF3A 4CQ1A 1Y3JA 2H1YA 2HZVA 2DXFA 4RW7B 1JKHB 4OX9F 2CQIA 3FCVA 2JVOA 2K7JA 2X1AA 3UWTA 4ZHRA 4DMZA 5A8WB 5HQLA 1RTDB 1S6OA 2CFXA 4DX7A 3J7ZT 4LUBA 1NZAA 1X9SA 4WE1B 2HVDA 2Q66A 2VG5A 2GJFA 1JX4A 3MM9A 2N4CA 2VFUA 2OIHA 5C25B 2KKHA 4GKJJ 4ZVGA 4DU7A 2E5JA 4LVNP 2J6UA 2RHQB 1Q95G 3I5CA 1U8SA 4WK3A 4QIFA 2LKZA 2VPWB 4NA2A 3GTYX 5CHCB 1YRUA 3X3UA 1NMEB 2DGUA 3UDCA 3GV7B 1T0TV 4JI6J 2VG6B 1S1UA 1KHVA 4KQZA 2IM2A 1PCAA 1HBUB 3OTBA 4TYBA 1QTNB 1SIWB 2V4JB 3S8SA 1VQ5S 2NCKL 2QYCA 4M5IA 1XERA 7AT1B 3MR3A 3DMJA 4DUZJ 1R0CB 1VQOS 4MT1A 4NXNJ 2X1GA 2PMWA 4J90A 2RF2B 3QT7A 4LREA 3KK2A 1WDTA 3NXZA 4A8KA 3RTVA 4ED3A 4DHVA 5U47A 4X4VA 2JFDA 1TL7B 3DOLB 1FJEB 1FWPA 4I2QB 2E9TA 4ALZA 2CXEA 2HBYB 1NXIA 4K50A 3A8EA 3R2CJ 4KV8B 2MTLA 5AJ3J 2XO6A 4JI5J 4DL6A 2YBVA 4N8OA 4UQGA 2QJ3A 1WELA 4JI1J 3JXOA 5E3QA 3FCWA 4LF6J 1LK7A 4UOCA 1S1WA 4PAAA 3A4TA 1T7PA 4URQU 2F4VF 2D9PA 3TUJC 3UN3A 2H5IB 1U8WA 2UVUA 2PFDA 4USHA 3EE3A 3GB0A 2FJBB 3NRBA 4ZPCA 4YQWA 1YDLA 1UCNA 4DR2J 1SKSA 4K0KJ 3HHNB 1NO8A 1WF0A 1WTFA 1HD0A 4WIIA 2BX6A 3I0RA 1VRTA 4NLXA 4RLEA 1OQ3A 3J81j 2BKOA 3VQTA 4RU9A 2MZRA 2F3JA 2J9DE 3M6VA 1YX2A 2CPIA 2R7XA 1OY8A 1KQGB 3VAIA 2B51A 2PE8A 3JTNA 1M5PC 2GVDB 2MKHA 2UZAA 1HNVA 4RNOA 5J2PB 1H98A 1FXRA 5J2NB 2ZOGA 4KE5A 4XTTA 1JLCB 5IV4A 1SC6A 2E5HA 2J7UA 3ILLA 1BLUA 1HQUA 1R8PA 1Q8BA 4USJC 4EU0A 2C28A 4EBEA 3KLFB 4ZJQA 3NGSA 1UETA 4QIWD 1L3UA 4K5RA 4ZN3A 4F4WA 3O5TB 4E98A 2IFXA 2QMXA 1DTQB 3PCOB 4OX9J 5DRKA 1RTHA 1XEZA 1DQ9A 3I5AA 3DRPA 4QW8A 1IBLF 3AQPA 3CJSA 5EWFA 3A8JA 3PY8A 4AE5A 3LGHA 3H5XA 4ZLNA 3TVKA 2PIIA 2G9OA 3CD5A 2HHXA 1J27A 3UNYA 5LXRA 3P45B 5LJ3Y 3HHLA 3QMQA 5C5JA 3PR4A 4C8NA 4P71A 1R0BG 2ZH2A 2VFVA 2YPYA 1PYTA 4RNMA 3ZZYA 1X4HA 2W8KA 4EZ9A 4IG0B 3MFHA 1B0VA 3MCMA 3D3BJ 2BANA 1VBZA 4DL2A 2AEFA 3RBDA 3MEGB 1H74A 2YKMB 2FJWA 2IM3A 4RJVA 2NQPA 2E44A 4DCPB 2RRNA 3V4IA 3W63A 1RTZA 3C2PA 2B4OA 3BR8A 2KI2A 1I94F 2PA3A 3PZPA 2XS2A 4B3MF 2IVMA 1T95A 2YNGA 1Q81T 1HNIB 2HPUA 3SDEB 5L38A 2V94A 4MKAA 5HO4A 2W2PP 4OYZA 3IR6B 1WC0A 2YKNA 2DNNA 1KWMA 1C1BB 3CJ8A 3ZTQA 5LM7E 1HWUA 4DSIA 1WC4A 5B09A 3FNNA 4B9NA 3D6TB 1WJ9A 4QOTA 5D4PA 1JXLA 3TUIC 2B5JA 3OD2A 2ZJPQ 4NLDA 4OYOA 2MGZA 3J7Z5 4PWDB 2YNHA 3M8ZA 4H54A 4YHHF 2IDEA 4TKTA 1AUDA 3HJFA 3PV8A 2F4VJ 4WFYA 3KFWX 1L3TA 3HM9A 2VU5A 4X65F 1ZETA 5DDRC 3I56S 2CVIA 1WC1A 3LF0A 3PFOA 4JI0F 4J9MA 2W4CA 1YJTA 3CWJA 4JP8A 2NXCA 2YPZA 2WB4A 4QWBA 1ZPVA 1JLQB 2HVHA 1V9OA 4P10A 4UOGA 2RT3A 5LT5A 1M5HA 3QBCA 1N5TA 3OL8A 3R5GA 4DSKA 4UF4A 2AJ4A 1S9EB 3KUGA 4ED4A 4ETZA 3FDSA 3W5ZA 2FHJA 3QGHA 4M5GA 1F9FA 1S9GA 3IG1A 3KHGA 2XNRA 2AV5A 4RBUA 2FLNA 5FDLA 4X2BA 4V19X 4DPUA 1AZSA 5T7LB 2HQ3A 1NJIT 4ZMMA 4NA3A 2BZ2A 1ZYQA 4ELVA 3M8PB 2WTFA 2NZCA 2UVWA 1HR0F 1NK7A 3JQMA 4ETXA 1VRUB 3EZUA 4YUDA 3W9JA 1CEZA 1P9QC 3VWSA 2WZ1A 1HI8A 3MMCB 1UA0A 1D0EA 3HFZB 2LDYA 3AD7C 2YNIB 4HDHA 2OSRA 1X4CA 2OPPA 5A76A 3FFIB 3LO3A 2GNKA 4FF4A 4Q44A 3CJRA 4ZPTR 1QSLA 2HAFA 2D3O1 1H72C 5IT4A 2FHKA 5KT7A 4F50A 3C14A 4AUKA 3LTOA 4C0OC 2JEJA 2MKIA 4DV1F 4YDXA 1SJQA 3PYFA 5HQMA 2EFPA 4IRDA 2I0XA 2AWZA 4JI7F 4CYUA 2PI4A 1H73A 4MH8A 2QA4G 3CMQA 2QZ8A 1WEYA 1N33J 2VG7A 3BO4A 2HNZB 1FDAA 4A8FA 3IWXA 1RGVA 2XWXA 1LEOA 4WKRA 5K5MA 2XLKA 1M90T 3VAJA 4CLPA 1RBLA 3QZ7A 2N7YA 2E1PA 4KGVB 1CJTB 2DGVA 2DNKA 2OD4A 3CMES 5HROA 4WF9Q 2RMLA 4O23A 2FPHX 5L1JA 1LOUA 5HMWA 3DLGA 3PJWA 4M5LA 1U6BA 2EPIA 3ZTOA 2DCUB 4H4KA 1Z1ZA 1GXLA 4DV3F 1I94J 2HZCA 2CG8A 2FB0A 2CPFA 2QG9B 3G6ES 1SH2A 4HKQA 1T9XA 2ASJA 4B3MJ 3QO9B 1KR4A 2E1RA 2DHXA 2MQ8A 1S7IA 2BUNA 4Y2MA 3LWMA 1X4FA 4EZ6A 2MQPA 3MM8A 4RW7A 4YB5A 5D0EA 4ZPWR 1SXLA 1JNRB 4DV0F 1KRPA 4QIVA 3MAQA 5BXIA 1RT7B 4LR8A 2UP1A 1IKYA 1ZH5A 2ZUAA 5A8WA 2YQ3A 2KFNA 1R7IA 2OUGA 3OJUA 1HPZB 3KKFA 1PSDA 4PABA 2C2RA 1RAAB 4WE1A 3VTIA 5D6GA 1P27B 2QN6B 3HSZA 2ZBIA 2ZH9A 3JSYA 4YHHJ 3GILA 2JX2A 3B78A 5DQGA 3QIPB 2CQ2A 4ECTA 2ZH5A 1ITPA 3FZBA 4AL7A 3PW7A 4X65J 2E7VA 3DGPA 4PR6A 1CJUB 4BC9A 3DRRB 5CYJA 4PPDA 3WHIA 3MUTP 4JI0J 3RW7A 1HLWA 4K4SA 4TYAA 3O6QA 3UI3A 3IBFB 2XO7A 1RWMB 1FRIA 1KP6A 2VG6A 2RJZA 3M9NB 2WVBA 4TU8A 2H51B 2HG4A 2AIRB 2D74B 4IOBA 1MN7A 4AD6A 2AGOA 4J9VA 2ASDA 2MY8A 1K73T 2A10A 4NL5A 1U49A 2RF2A 4J37A 1D8ZA 3GWCA 3SQGB 3DOMA 3FCHA 2VOOA 4DBQA 3DOLA 4DX5A 2GGPA 3ADAC 1DBDA 1HR0J 3MPYA 3VAGA 4KV8A 1QAXA 4XPCA 1S10A 3FBEA 3V6DB 5J1NA 2RAQA 2OD6A 4DR6J 3H2LA 1RAOA 5HJYA 4V19J 2FVQA 4OV1A 1UVIA 4ZPAA 2ZBPA 2O66A 4DV4F 4DR1F 2CZ9A 2C3YA 3OFHA 2I8EA 3OT9A 1GTHA 2YTCA 2VUGA 4M5DB 1S79A 3I0SA 4MIBA 2GIRA 4DFJA 2PI5A 3MM5B 2XZWA 2A2DA 4DN0A 4HYKA 4DOZA 1J5OA 3PIPQ 2GJ2A 1UVMA 2RUGA 4K4XA 1IQZA 3PW5A 3M32B 2RDIA 1X4GA 2AX1A 5KOXA 4K4YA 3R1HA 1S7HA 1U02A 2IA0A 1YGYA 1RISA 2RS2A 5K8PA 3C46A 1F5AA 1JMTA 2NXEA 4OYIA 3AJDA 4JI4F 1N88A 2W9CB 3OTEA 1UMJA 3CJTA 2M8DB 1M1GA 1XWLA 1N34F 1GEHA 4G1PA 2MDAA 4OJ3A 4ZPDA 5J2PA 2HVIA 2IM1A 1TUWA 1JLCA 4DV3J 2M4MA 1MMDA 2CPEA 4I56A 1TP7A 2VPZB 3PYGA 3QAEA 4HVZA 3KLFA 3TAQA 2V50A 4Q0BB 1RWNB 3QLHB 2EFVA 3N5BA 4NI2B 3FK4A 1DTQA 1VCTA 4DV0J 1WOPA 2FYXA 2DNHA 1NK5A 4L6V3 4X4RA 4FS2A 3KHLA 4Y3CA 2DHGA 2MQNA 1J2VA 1NDPA 4KHMA 2RSQA 3HKZD 4OJ1A 2DPJA 2R7UA 3K2YA 1FRXA 1TUGB 3JAMY 1HKAA 9ATCB 2X7IA 3Q22A 4OHVA 4CM2A 3Q8SB 5E5NA 2EFNA 4P6QA 3N4WA 3NOCA 3LOUA 2KT5A 2V6AA 4M5NA 4K4VA 3GU0A 4UT4A 3EGNA 4DSJA 2C2DA 2GHPA 1VQ8S 3ITHA 4OYAA 3V81B
chains in the Genus database with same CATH topology
1FCAA 3SZ2A 2FGCA 1T94A 3DRPB 4RW6B 3RAMA 3OHBA 1CC8A 4B9SA 4PQUA 4LSLA 4F2RA 2R7VA 1VC6A 2VFSA 4IQXA 1R31A 1G1XA 4R8UA 1PO6A 3BSCA 2YH1A 4YMEA 1VK8A 2DITA 4OX7A 4DR3F 3P96A 4B9MA 3I9V9 2APOA 2QA4S 2XSFA 2YX1A 1NK8A 2DRBA 3DLKA 1TV6B 1WHVA 4Y2IA 3VAFA 4IKAA 4DWIA 5IQQA 4ILMA 2HHSA 1HL6A 2GA7A 2XB2D 1X9WA 1TK0A 2MMYA 2P6SA 2IBOA 4QR0A 4NZ6A 3BGUA 3MWBA 4RNNA 4JYAF 3NAIA 4HH0A 4K4WA 1S1TB 3CVKA 1NKCA 3D1OA 4X4UA 1C1CB 5A8RB 4O44B 4OFZA 5HP1B 3QJJA 3FMWA 1O8BA 2BRLA 5KFLA 2MQOA 4QWCA 4RW4B 2ZE2B 2FD2A 1S0NA 2IYIA 3TA1A 5LL6d 1MROA 1K1SA 3HVTA 1Q78A 1HW8A 1BQMB 4O4GB 1ZM9A 3OL6A 1HNXF 3CJ5A 2WSFC 2IMWP 3V6HA 3BQ0A 5GMKa 1X4DA 2NSBA 1G7CB 2OFHX 4RU2A 3QGPA 4NLSA 4XDCA 4J5OA 3SDEA 4QQBA 1HWIA 1T3NA 2HS0A 2ZJQQ 2BANB 2GGPB 3LP0A 2XMKA 1VQLS 3QJPA 1GAOA 4X4TA 1KSPA 3V5RA 1MWYA 1R6YA 2M0GB 2OO4A 3N01A 3Q8QB 1FTCA 2B56A 4NCBA 5B0EA 1IKVB 2DNPA 4AXIA 3MEKA 3PDNA 3D1QA 3N28A 1S97A 2QT7A 1NK0A 4C3KA 4NLQA 1WF1A 1FE4A 3UCGA 4QR1A 2VOPA 4DEZA 1C1BA 2FJEB 3CC2S 1FKOB 1D1UA 5K8MA 2ZDOA 5F0UA 4ZCLA 2ZDPA 1SJ4P 4WFZA 1F0XA 2XY5A 4NCGA 2VC1A 1SL2A 4PUOA 3ZZ0A 3JYTA 1DLOA 4FZVA 3V4IB 4NMLA 4YFUA 4M95A 2CPHA 4C0HA 1YJRA 4N76A 5I3UA 4MAKA 3RYLA 3JTPA 3CO9A 3DI6A 2EVZA 2FJXA 4YDDB 1CG2A 2BOPA 1HBNB 1R8BA 2RD5C 4FF2A 2AW0A 3MD3A 3FEXB 4ZVEA 3PX4A 2OKQA 2PC6A 2RRBA 1TUVA 1RT3B 2IAJA 3RW6A 4Q8EA 4JV5F 5IFMA 3GIMA 1S6QB 5CXTA 3LGNA 5AXKA 1LFPA 4DQSA 4MIWA 2E66A 2BXJA 1S1VB 1UJ5A 2OLWA 1RT4B 2U2FA 5I3PA 4AL5A 4I6WA 4PXEA 2R2RA 3A1YG 4OX8A 2YNGB 2XMVA 3TO8A 4DV7F 2MHNA 3JSMB 2FHOB 1PILA 5DGAA 5J2QB 4AQYF 1FXDA 1TKZA 3TAMA 3BSNA 2GMHA 2GQQA 3GIJA 4ZCMA 2YVSA 2DB1A 2FTRA 3OV7A 2G4BA 3KG0A 3PNIA 2CQHA 4NLGA 1D9AA 2NUHA 3I0SB 2PGCA 3ENWA 2XLJA 4YEAA 1S4FA 2QV6A 3H98A 2Y1RI 5D4OA 1DARA 4NLYA 4NLWA 3M30A 2YKNB 2X1BA 1FVSA 1TL5A 2WONB 1Q7YT 3V2UC 3HHLC 4PCQA 2DRAA 2UXDF 4LMZA 5D77A 2ZZNA 2KM8C 3MEEA 1LWCA 4ETZA 3TA0A 5J2MB 2AU0A 4ZVFA 2VODA 1RK8A 2YH0A 1K1QA 3O44A 5F8MA 3KJVB 4LFCF 5EN1A 3C8YA 3FGVA 2ZOFA 2MQQA 1J5OB 2VA2A 3HHDA 3PW0A 1JKHA 3BDEA 3U27A 3BQ2A 4FXVA 1JLQA 1ZM4A 2JC0A 4CNYA 2BQ3A 5FJ4A 3M9OB 3DXSX 3EX7B 3IN5A 4RBTA 1T8EA 1FHTA 3TW0A 2QO3A 4NA1A 3DXBA 3CF5Q 3PX6A 2VONA 1APSA 2HQIA 1L3KA 4W90B 1HD1A 2XGQA 1OSDA 1WNEA 1BY9A 1S48A 4CH1A 5JVHQ 1RTDA 3PKMA 2MGZB 3I9ZA 1SKWA 2YWKA 4A8OA 2B4UA 4PPZA 2EBGA 4ZP7A 2HS4A 2J8AA 3QIDA 3H5YA 4ELTA 1RA6A 4B08A 5HMXA 1JWWA 3MCSA 2W7PA 3T3FA 2LEPA 5EHHA 2JEGA 5EX3A 2G1DA 2FJAB 3LWLA 2BYCA 5KFBA 2A1BA 3Q8PB 3PVXA 1RKIA 1RT5A 3RB6A 4OZ1A 3SEOA 4DS4A 3DU6A 2L08A 5SZTA 2KG1A 1JK9B 3OPKA 3MXHP 1YI2S 2HMIA 2KRBA 2HHUA 3PJXA 4ES3A 1VK3A 1UAWA 3TRGA 1RI7A 2UVRA 5B08A 2V8HA 4IDKA 1IQTA 1LW2B 4O3OA 5DJBA 3TA2A 1FXLA 3MPVA 4OZ0A 2FUG9 5HBMA 4EO6A 5GADU 3TANA 5C25A 4XPEA 2WK4A 4PKDB 3T1HF 3FSIA 1TFWA 1N5QA 1BQXA 4ZDNA 1L3VA 1KC8T 1U1NA 2Q3PA 3T5HA 2WW8A 1XMOF 1JLEB 1S76D 3HZGA 1MU2B 1KLMA 4WFNQ 3KNGA 4WJBA 3CCVS 3MURP 2RQKA 4M1KA 4I0WA 2MKKA 3DOKB 4A8SA 3M8SA 1XTZA 3PM9A 2LEAA 3VAMA 3NS6A 2W9AA 3GG1A 2V9KA 2LA4A 1FRHA 2IA6A 3MI7X 2UUWA 3AJ1A 3M8PA 1M5KC 3VAKA 5CA5A 4TY8A 3CMAS 1MMLA 3SSRA 3BM7A 5JVGQ 3QGIA 2J6SA 5LSLA 5KFRA 4ERDA 1RA7A 4JI6F 1NRKA 1GH8A 4PG8A 4IO1A 3HDSA 3R3TA 2ADCA 2CZVC 4HDGA 1Y00A 4CT8A 3SFGA 3CUNA 3MMCA 1LKZA 2E1AA 1KNZA 1Y7PA 1LFWA 1S6UA 2CQ1A 1HHSA 1E6VA 2E29A 3LP1B 3OFFA 5KFIA 2DHAA 2Y0SD 3DRYA 1SJ3P 2ZITA 3N6MA 4A8YA 4OHZA 1X5PA 4AL6A 1HBUA 3CCSS 5T41A 1Q8IA 1S9GB 4K5SA 2CQ0A 2VPYB 5FD1A 2V4JA 3MOJB 4DUZF 1LW0A 2SXLA 4Y65A 1KONA 4TN2A 4C3MA 3W2VB 4D3GA 4K59A 2DNOA 4O3NA 1A9NB 1X5SA 1N5SA 3DLEB 3POTB 4MMOA 1VC0A 1H2UX 4A8XA 4NXNF 4IFVA 4FBUA 4NCAA 1C0TA 2WOMB 2X3GA 1IKWB 1XC9A 3HI9A 3OL7A 1M5VC 2LU1A 3PHEA 4B02A 5GADI 1S0MA 2X1FA 3M2VA 2OFGX 2VV5A 3N6LA 5LMUF 2UUCF 2ROGA 4TLQA 4CO0A 2FVPA 1ZAXA 5I3QA 4ATNA 2IJFA 5HLFB 2WAQD 3D0GE 3H5UA 2E9RX 1X4BA 3UCZP 2F9DA 2MKCA 4OI6A 5D8HB 3AA8A 2KN4A 1IM4A 3G8SA 4RKUC 3ZZUA 2ZBCA 1S9FA 1N4LA 3CDBA 1DHMA 4H4OA 1RTJB 3OTDA 2BJDA 4FVMA 4ED0A 4B9LA 1JLAB 5AXMA 2NSCA 4LF9F 4I2QA 5E3AA 2EKYA 3ISND 4ZA1A 3MOZA 5C24A 5K9FA 2CDQA 4MKBA 1UVLA 1N33F 2RRAA 1IKXA 1M5OC 1GX5A 3F56A 4NYZA 3BSOA 1CSJA 3CCRS 2DR9A 4JI1F 1U1KA 1U48A 3IS9B 5KFJA 1FE0A 3GV5B 2B9WA 4YR0A 4O3QA 5KT5A 1HMVA 1S6PB 4DQRA 4ZP8A 5CYMB 2FLOA 2RQ4A 3N0VA 2HNZA 4LF6F 2FY1A 3M8QA 4C98A 2M3DA 5H9FJ 2CVEA 1NH8A 3M2RA 2MHEA 2DNLA 1Z4UA 4FVCA 4K2XA 1N5YA 4IG3A 1ZAVA 3K7RA 3ITHB 4CTAA 3QZ8A 2R8GA 2NXUA 3C6TA 4OI3A 5KFFA 3OR1A 4NOHA 4LJMA 3M6WA 3P3DA 4CO1A 4TLRA 2B7BB 5KT3A 1T03A 3I4HX 5KFEA 2OPRA 4PG5A 1FNOA 3J80Y 1B0PA 4UW2A 3MECA 4OI1A 2WB1D 4R8UB 1IJEB 2DNRA 2K8GA 5KFSA 5DLGA 1D9FA 2OTJS 4QPTA 4KGMA 4G1QA 2ZC3A 4C0BA 1SB6A 4KRWA 1HWKA 2R8KA 2R4FA 3NCPA 1HNZF 1H38A 1LWEB 1VHFA 4RW9A 2K3KA 3HF5A 4ES1A 4ILRA 3BREA 1F60B 5DM6Q 3HPOA 4P7VA 5B0CA 4AXJA 3VALA 1SBRA 2R8HA 2M5YA 4ECUA 2ZNZA 2D3OR 4DL0C 1H0HB 4YOEA 1REVA 3WZ0A 4IOAQ 1U24A 1IUJA 5F8NA 1S99A 2IMOA 3VR1A 4K4TA 2KXFA 4ICLB 2R2UA 3J7YU 3RRKA 1SJFA 3IWNC 4F67A 5B0BA 2HNDA 1JLFA 5IQ6A 1HARA 4HI1A 4WCEQ 4WKYA 1GNKA 4DR2F 1VQ6S 2CPYA 1NAQA 1QUVA 4K0KF 2RQMA 4XK8C 1MROB 2J9CA 2N3LA 3G6YA 5KFYA 2K1RA 1SH0A 3DLHA 1MNEA 2RQCA 3NAHA 1TKTA 4RZRA 4BBYA 2IM0A 2EFQA 3ZZOA 1NKBA 2GHWA 4BHQA 4Q7AA 2B9YA 4DSFA 2KZMA 3W7BA 3H4DA 2Y1IA 4HEA9 1SL1A 3S01A 2CRLA 5IM0B 3CCQS 6FDRA 4DR7F 4NRUA 1T05B 3D0IE 4PXBA 1KD1T 2NS1B 1RT6A 4W92B 2AJQA 2AJFE 2LDIA 1K9MT 4IH6A 3NMAA 1RWUA 3BS9A 2BA9A 4CIOA 5DQHA 2MSSA 4IR9A 2UUTA 1F2GA 2XY6A 1WWHA 1Y0HA 1JLBB 3E01A 4YR2A 2H9ZA 4NCGB 5HROB 4PUOB 4X4NA 1WG4A 2M2BA 4M8LA 4ZPBA 3JYTB 3MMAA 1VBXA 2Z2MA 2YX4A 3P49B 4ZP9A 5I3UB 1JLGB 2N4DA 3DI6B 3MEDA 1KQSR 4ILLA 3DLGB 4I2PA 1VQPS 3CD7A 4TXSA 4B3TF 1S72S 1RT7A 4Z37A 5F8LA 1S1XA 3GV8B 4UY85 3W2WA 4PRFA 4F4ZA 2DHSA 5DETA 2W9BA 4CZCA 5IS2A 2HHTA 5DDQC 2M7SA 4IYQA 1R43A 1KTVA 2CQPA 1KOHA 4L3NA 3UPFA 3MHYA 5KFWA 5J1EA 1WHWA 3KLGA 4WTYA 4Y28C 3K5MA 1YQHA 2HIQA 1HYSA 4LQ3A 1HPZA 4FNHA 2KVIA 2XS5A 2WHOA 3GMGA 3BB5A 4HLBA 3MUVP 5J2NA 1OPZA 4OI4A 2VASA 1U6FA 4RW8B 3NGDA 3KLEB 4EYHB 3T1YF 3HFKA 1I1GA 3DU5A 4DL7A 1L5UA 3GQCA 1UW4A 1C4CA 1Z2LA 3Q8RB 2W8LA 1H3DA 1C2PA 3CJKB 4Q8FA 2E7XA 2EK1A 2DGWA 4TNOA 5LJ5Y 2V5HG 4N47A 4I6AA 1TK5A 3KYLA 2L48A 2XEXA 4Y6IA 2C42A 5KG2A 3KK1A 4NLTA 4ZLPA 1O51A 3M30B 5CD4H 1ROFA 2QIFA 3TR5A 5E7OB 1M5SA 4LF8F 3CCJS 4FF3A 1RT2A 4CQ1A 3D54A 1ZTTA 1KFDA 2Z8QA 1Y3JA 2R7TA 3MR2A 2FC9A 3CB4A 1BWEA 4EUVA 2UUBF 2GQCA 4RW7B 2VZ9A 5AE3A 1N48A 3CDEA 1B0TA 5KFMA 1DURA 7FDRA 1LQ9A 1JKHB 3DRRA 1UVNA 4OX9F 3R5AA 2CQIA 4O4RA 4B17A 2B4PA 3AH6A 5EGYA 4G3IA 2JVOA 3N6NA 2O01C 3OXGA 3AB2B 4KIAA 3PR5B 4LVOP 2DR7A 4UY8T 2K7JA 5CCLA 1NJZA 5BJRA 4J9PA 2X1AA 1BQNA 3UWTA 4OZNA 2AGPA 5G0RB 3NKYA 4ZHRA 3RB4A 1NEEA 5E0OA 4DMZA 5A8WB 3M4XA 3AHPA 4ECZA 1RTDB 1S6OA 2CFXA 3J7ZT 4LUBA 2M88A 1UWBA 4NLPA 1FJCA 1TKXB 4FS1A 3TI0A 2JZ5A 3PIOQ 1DQAA 4F2SA 2HLUA 1EP4B 1NZAA 1X9SA 3GR0A 4WE1B 4ED6A 2LCWA 5KFCA 1UVJA 4XO0A 2Q66A 2VG5A 2CPDA 4WFXA 4DFPA 5IXUA 2JC1A 2NYIA 2DK2A 1JX4A 2JHEA 2HMIB 1PC5A 3SYZA 3CTRA 1NB7A 3L09A 3MM9A 3ETOA 4IFYB 3X1LB 4O3SA 2N4CA 3WX4A 2VFUA 1HA1A 1YJUA 4FN5A 2OIHA 2B43A 3EZ5A 5HBMB 3DYAA 3DCAA 1HBOA 4ID8A 2KKHA 4TY9A 4U9RA 5C25B 3B4DA 1OO0B 5KT2A 1XN9A 5G4DA 4ZVGA 5DM7Q 5KFNA 5F9NA 2DGSA 2LYVA 3FSYA 3O3LA 2FLLA 2OP5A 2E5JA 2E7WA 4DSEA 4ED5A 3VAHA 4WYLA 4LVNP 3PO4A 2ZH1A 2FIUA 2J6UA 5KFGA 2GX8A 4J9RA 3SQGA 1OWXA 2CJBA 2OMOA 3I96A 3MTJA 3LW5C 3VZHA 3M1VB 2XGPA 3I5CA 1VQSA 4IG0A 1C0UA 1U8SA 3C6UB 3IAS9 2ZD1B 4WK3A 4ED1A 2VBXA 4QIFA 2LKZA 1FK9B 2VPWB 3R5BA 4EFAC 1R0AA 4NA2A 1IBKF 3SCJE 5CHCB 5A6WA 4OHYA 1VQ4S 4U67Q 1YRUA 3NCQA 1PGZA 3X3UA 3MEGA 3D1HA 1X0FA 1U1LA 2DGUA 1S0VA 3K8VA 4IRCA 1C4AA 3UDCA 3GV7B 2EWHA 2YKMA 3QAUA 1X7VA 2F7VA 4DR6F 3HX9A 3AA9A 2VG6B 4R5PB 1S1UA 1KHVA 4URGA 4KQZA 2ZFHA 2IM2A 3PX0A 1HBUB 1V6HA 2NPIA 3OTBA 4C7QA 3G86A 4TYBA 1Y5LB 1PC4A 1SIWB 1JJHA 2V4JB 3S8SA 1OS5A 1VQ5S 1GX6A 2E5GA 3KG4A 3T5LA 4MYTA 2KTQA 2HGLA 2QYCA 3KLIB 4C2MA 1XERA 4IFVB 1FKAF 2XG8A 1U1QA 1RTIB 4ECVA 1FNXH 1LV5A 3MR3A 3TOQA