4NXMF

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nxmF00
4JI3F 2UXBF 4JI8F 2BXJA 1IBMF 4DUYF 4DV7F 4X64F 3OTOF 1HNZF 4DV0F 3T1HF 2UU9F 1F60B 4DR4F 2J5AA 4B3RF 4DUZF 4DV3F 1XNQF 4JYAF 2F4VF 4K0KF 5AJ3F 4DR3F 2BVZA 5BR8F 4LF5F 4AQYF 4GKJF 2KJVA 4JI4F 5LMNF 2B7BB 1IBKF 1RISA 4OX9F 1N34F 1G7CB 4KHPF 4LFBF 4DR7F 4DV6F 4LF6F 2VQEF 4JI5F 5IWAF 3T1YF 4GKKF 2E5LF 4B3TF 1G1XA 2KJWA 5LMUF 1XMQF 1B64A 2UUCF 4X66F 1IBLF 1HR0F 1HNWF 4B3MF 1LOUA 1FJGF 1IJEB 1IJFB 2YY3A 1VMBA 4YHHF 4NXNF 1XNRF 1N32F 2VQFF 1HNXF 2UUAF 4DV4F 4LFAF 4X65F 4NXMF 1CQMA 4B3SF 4LF4F 4DR1F 1FKAF 1N36F 4DR6F 2HHHF 2RJZA 3R3TA 4X62F 4DR5F 1I94F 4DV2F 4JV5F 4JI2F 4DV5F 4JI0F 1GH8A 2B7CB 1QJHA 4YY3F 2UXDF 3ZZPA 4LF8F 4LF9F 4LFCF 2UUBF 2ZM6F 1XMOF 1N33F 4DV1F 4DR2F 4LF7F 4JI6F 1CQNA 2UXCF 4JI1F 1J5EF 4JI7F
chains in the Genus database with same CATH superfamily
4PQAA 1NJZA 1SJFA 4KBIA 4JV2A 4JI8F 1FDBA 1UL3A 1RT6A 3D3CJ 3HHEA 4LRBA 4QWAA 1J5OA 3TA0A 1W2BR 3MMCB 3H0PA 4NL5A 3W8GA 4B08A 2HNYA 4P75A 1HHSA 1ZM9A 1EHWA 1RB0A 4O3PA 2R2RA 1EP4B 1Q4RA 1XMOJ 1QSSA 1HHQA 4CO4A 4LQ3A 4G3IA 2IIHA 3I96A 3PRBA 4OHWA 3PHTA 1JLFA 3Q8SB 2B51A 2DEIA 4F0HA 4M94A 4DSFA 4Y2IA 3BJYA 2KM8B 3DYAB 2L08A 1S77D 3IXQA 2DH8A 5F9LA 1WKKA 3CULA 2YTCA 3U1MA 5HATA 1EQ0A 3KK3B 1YBAA 2XMKA 3DC2A 3U7JA 1RTIB 3E8OA 3OSNA 2BQRA 1X9MA 5L1IA 1RHJB 5BYQA 2A0FB 4KY3A 3BPDA 3AD8C 3EGWB 3PFEA 5D3GA 2CZ9A 1ZPWX 1F5AA 5KFJA 3QZ7A 2RD5C 4S0MA 3C15B 1HBNA 2YNIA 5KFXA 2LU1A 2YPYA 1RT4B 2B8QA 1UJ6A 3ET6B 2POKA 3R5BA 3TUJC 3HJFA 4I6AA 3GU0A 1VIOA 1WEYA 3KDOA 4C6AA 4XPEA 1SBRA 2XTJP 1YRUA 2V68A 1T7PA 3W9HA 4X4UA 2GHWA 4XDCA 1HPZB 2ZH4A 3KLVA 5CHCB 2N7CA 4B3TF 3K0JA 2DGXA 2ZOMA 5ETTA 2CQ4A 4ZIVA 2AX0A 2W4CA 5AXMA 3QFHA 3NNAA 1YBTA 3SFUA 1T95A 1HL6A 1MG7A 4EYIB 1R8PA 2NLWA 3MR5A 4NYZA 3IWNC 3GP9A 2K1RA 4B3MF 3C16B 4ELVA 4ZLPA 2DNQA 3PHEA 3AA8A 1IJEB 3ONQA 3PZPA 1NB2A 4ETZA 2ATLA 3G82A 1CC7A 5E3PA 3FEXB 2DYAA 5T7LB 3UR0A 3RBDA 4MK8A 4WTOB 1B7FA 2VJUA 2HHTA 3KLFB 1U0SA 2ROPA 2W2PP 4U96A 3PX6A 3UN3A 4V19X 5J2PA 3PYEA 2VH7A 4LQ9A 2J8AA 1BLUA 4OI3A 3OL8A 3TI0A 2B4UA 3QFWA 3DLEA 1VRUA 2IBKA 2GIQA 2VC1A 3TUPA 4B3OA 1LQ9A 1V3ZA 3OUYB 2HHHF 2HBQB 4CO3A 3NNCA 1NDKA 3P49B 2R2TA 1CJTA 2OPSB 1XC9A 3L09A 3NMAA 4OX7A 5CD4H 5L38A 4DR3J 3KOAA 4P7VA 2IMWP 1TL4A 4CM2A 2ACMA 2PFFB 2CUYA 4KV8A 4JV5J 3FUYA 3AXKA 2BJ1A 3SDEA 1TL3B 4JB8B 4V1Ak 1S6QA 5CYMA 4YY3F 4F4XA 5IV3A 2VDHA 2O66A 3FCHA 1SQFA 5DG8A 3A3OB 3CO0P 1UFKA 2P9EA 3ZXWA 1NSKL 2F1FA 3POTB 1MU2A 1WOSA 2JOQA 4F04B 1M1GA 1VQNS 3PV8A 1KVIA 5K8OA 2Z57B 4OHZA 3ZZOA 2YNHB 3DLKA 1T05B 1L3SA 3AODA 4OI1A 3P6YC 4ILLA 5F8GA 3OD2A 3LH2S 2ZBQA 4E98A 4X4TA 1LXJA 4Z7YA 3VAIA 4FP9A 2IYGA 4JI3F 1NSPA 1FTCA 3NGTA 4Q2LA 3W63A 1WC3A 1FDAA 4DL7A 2HHHJ 1X9SA 3UWTA 5DDQC 2F63A 1QTNB 2DNRA 4MKAA 1DQ9A 4YDDB 4ZVPB 1HNZF 4FBUA 3MM7B 1VBZA 4C8YA 3BSNA 1FKOA 1TKTA 2QIFA 4KKOB 2A2CA 4IRKA 2L9WA 2VFTA 3DLGA 3HZEA 3M30A 1RT5B 3UI3A 4DUZF 3J81Y 1FF2A 3CCQS 2M0GB 3JSBA 2NR0A 3D6FB 2GJ2A 3G71S 1XNQF 4PXCA 1LW2B 4OYBA 4Y34A 4IG3A 3UCZP 1FRHA 3MTKA 3OTDA 2XNQA 4Q8EA 1K1SA 1R43A 5DETA 2IJFA 1D3WA 3G6VA 1RWXB 2G1DA 2MSSA 1H2VZ 4RW7B 1N36J 4WZMA 3BQ0A 1U1PA 1TK8A 4O3RA 1OY9A 2AP6A 2HLTA 2L48A 3UN2A 3AH6A 2QT7A 1U4BA 4A8FA 3MECB 2P2CB 3M6UA 4FYWB 5B0AA 4KSEB 1HI1A 2JVOA 2JLEA 2QLXA 1KLNA 4WP3A 4OYAA 2YWKA 1C0TA 3RB6A 1NDPA 2V63A 5C7PA 4Y3CA 2XY5A 4A47A 4RW4A 3EXCX 2PA3A 3KJNB 4NYPA 2I1RA 4DV6F 3GIIA 4P10A 1DZ5A 5F41A 2OTJS 2RMLA 4NA1A 5EGYA 2ILYA 2BKNA 3IWLA 4TU9A 1WSRA 2G13A 3US5A 3DXSX 4RWWA 1Y0HA 8RUCA 4IO9Q 4PUOA 1S99A 4BLGA 2R8JA 1PKUA 1S6OA 3LW5C 2XYGB 2KDOA 2AF6A 1B64A 1FX2A 3JQMA 4F3MA 3IRXB 1JLCA 1XR7A 2M2BA 4JUZA 3CC2S 3FRZA 4V19J 1FKPB 1S6PB 3SDEB 3A1YG 3FNNA 2LEBA 2WVDA 3M8YA 2DCLA 2JHEA 1VK8A 2QFIA 4LFAJ 2VZ9A 4H4KC 2EEYA 1GMWD 3R27A 3SCJE 4FN5A 1DTTA 1CJUA 1IM6A 5KG7A 1S0MA 5IS2A 1YITS 4M5IA 2W2QP 1VQ5S 1SIZA 3DHXA 4NEZA 1KNZA 3MCMA 2MGZA 1P1LA 1PG5B 1HBMB 1MMNA 2DY9A 2GC8A 4QIWD 5LM7E 3CC4S 4B9LA 3CTRA 2ZH2A 4WF9Q 3E01A 1RHUB 3MURP 3N6MA 1FD2A 4MIAA 1R6YA 2C1EB 2CQPA 3MEGA 5EUHA 1FKAF 2IY5B 1UKUA 3Q86A 4CLUA 3HFKA 3N0VA 4R0JA 1U24A 2DO0A 4UW2A 4R8UB 4DL3A 5DDPC 3I5BA 5KFAA 1PAEX 4I7FA 3R7BB 5J2QB 1HWUA 4H4OA 1VJWA 1B0TA 1TV6B 2DNMA 3KLHB 4LVOP 2ZD1A 3FVYA 3H42A 1NK0A 2GHVC 3OHBA 2VPYB 5KFMA 2IBOA 4MKYA 4CZCA 1UP1A 2VBZA 4WZQA 4PYAA 2JNJA 1HI0P 2J9EA 4M5GA 2HHQA 3R1LA 3KJVA 4LFCF 1F5CA 1R0AA 1NK5A 1CULB 2HEKA 3QWUA 2XQCA 3KMQA 1XMOF 4DS4A 2UXDJ 3LGMA 2FVPA 3K2YA 2NZ4A 4LRCA 4DV1F 1JLEA 2IRXA 5KG1A 2ZITA 2NS1B 3CWJA 2AJ2A 2B4VA 2KU7A 3BR8A 1FTRA 2PA8D 2RB7A 3I4PA 1GT8A 1VRUB 1T9YA 2EKNA 2ZHOA 1TKXB 4WU3A 1RWWB 4LMZA 1FXRA 1X0FA 2YNHA 3K8VA 3DOMA 5HJXA 4KH1B 2M70A 2V4QA 2BE2A 1WORA 2HAIA 2UUBJ 5FJ4A 4O23A 1N5SA 2DHHA 1EARA 3CJ3A 2DGTA 3I0SA 3V81A 3C15A 4FXVA 4X64F 2VG6B 5CABA 4ANCA 2XULA 2QA4G 5CQGA 4ED1A 3V5RA 1GX5A 2G2ZA 3NGUA 2BACA 1H72C 2D74B 3GFZA 4P2FA 2BJEA 2D3UA 5IV4A 2AV5A 2PMHA 4NYOA 3UNGC 3TANA 1LWFB 3ITHB 3GQCA 3QRQA 1FNMA 2IDEA 1X4DA 4C11B 3DYAA 2P6SA 2VKZG 4NZ0A 1DBDA 1JMTA 1KS2A 2C3OA 3E51A 3FBFA 1H7XA 4NLXA 1JKHA 4QQBA 1GTHA 1FRMA 2IFXA 4CNYA 3KK2B 2CPHA 3GTYX 3KK3A 2ZEJA 3TWZA 4CCHA 2BVZA 4B3OB 1PBAA 2AHOB 4OI2A 3ZZYA 1U1OA 3UD4P 1S0VA 1HD1A 3SQOP 3VVUA 3PW5A 2ALZA 1WHYA 2A6MA 1S1UA 3ZZZA 5KT5A 2DT9A 2GMLA 2GVDB 1ICEB 2XY7A 4JI4F 4N76A 4FYDA 3BZQA 2FY1A 1TTHB 3UDLA 2N82B 3J7AN 5E5NA 1RWKB 1P6TA 4I2QB 3B82A 1FDDA 2C2ZB 5B08A 5J2MA 4DSEA 1R0AB 5KAKA 1DQ8A 5I3UB 4LUBA 4DFMA 4QU7A 4OZ5A 1IBKJ 1WC5A 5LT5A 1NSAA 1N5TA 4U67Q 1LWCA 1X4GA 4RNOA 2F9JA 2PMWA 3QIPA 5B0GA 1SVDA 1FESA 3PRVA 1PC4A 2CNNB 2NXUA 2EXUA 4NLSA 4DCOB 4DSJA 3IA0A 2FJVA 4FYXB 5KFWA 5G0RB 4O3SA 3NWGA 3BGFA 4PUOB 3V6DB 3DXBA 1X5SA 4Y2KA 4R25A 2A2DA 4B9SA 2LMIA 3QT5A 3H25A 3N9UC 2LQBA 5HBMA 5GAGI 3KK1B 4M5KA 4QYZJ 2KM8C 3G6ES 1HKAA 1R8BA 3HHLB 2DNLA 2Q43A 4MFBB 2MHEA 4H4KA 4PG4A 2YY3A 4ZMMA 2RE1A 4L76A 1M1KT 3RR7A 1C0TB 3ZC4A 5KFBA 3GG0A 2FVCA 1T9WA 1N5YA 4FBTA 1XNRF 3ET6A 1FEHA 3GB0A 3M2RA 3R5DA 5GMDA 2KRRA 3MAAB 1K44A 2VUGA 1XIQA 3MGJA 2IMOA 2ZJPQ 1KHWA 3BSAA 3CCWA 2IJNA 3O1LA 1E6YA 3JSRA 2HPUA 3PYGA 1LK7A 2C3PA 3D5MA 3D54A 5CA5A 3JQKA 4NOHA 3LP1A 5KFGA 4C8OA 3IFEA 4DUYJ 1BUXA 2KVIA 4K59A 2MQMA 2R7WA 1ZZFA 4ZVQB 4NZ7A 5M2RA 5RUBA 5JMNA 2BJ8A 2FC9A 3R5GA 1D9AA 5IQQA 1S72S 1KFSA 4OV6A 3ISZA 3JSMA 1JLGB 1Y4ZB 3HT0A 3VTIA 2GVZA 1RAIB 2QA1A 1RQ0A 5A8WA 2AIRB 2CJBA 3JS9A 1ACMB 5K8PA 1TKTB 2RU9A 2MLYA 4KKOA 5E3QA 2R8HA 3SV4A 3CW2C 1I94J 3B6BA 1SKSA 2M8DB 2QL7B 1TK5A 4ZJOA 3D6TB 4ZVGA 3KUGA 3T41A 6FD1A 5DG9A 3KJVB 3CT9A 3KLGA 1WF1A 5B7WA 2VG5B 4WXOA 2FHOB 2B9WA 3D1HA 2RQ4A 2XY6A 1WHXA 3H20A 1JXLA 4LF7F 2ZC4A 5CZVA 1GXTA 5G0RA 3OTOJ 4GO7X 2CADA 1R8AA 2UXBF 1IUJA 2OPPB 2GCFA 4OZ2A 2GMHA 4I0WA 1HBOA 3VGUA 4C0BA 5HQ8A 1FXLA 2X1AA 1HHTP 2ZFHA 4HTIA 3M05A 5IT0A 1S1XB 2X7IA 4LR7A 2GAHC 2BEFA 5EWEA 1H3DA 2CQGA 4M8LA 1QVFR 3LGHA 1F1BB 5LL6d 2ZH5A 1YKWA 4BHQA 1EIYB 4K4YA 1RT5A 2U1AA 3VAKA 5KG0A 4B17A 5CYMB 4CH0S 2HYIB 3CC7S 2J5AA 2MHNA 2HHXA 1GMVA 3EGZA 3BBCA 3BF4A 3KG0A 3PR5B 4YDXA 4I6WA 1JJCB 4CYUA 4Y00A 1CJKB 1WKJA 1YJVA 1P9QC 3DOKA 3H4DA 2QL9B 2DGOA 4QIFA 1U26A 4NA2A 2ROEA 3D6HB 2AWZA 5HBMB 3TRGA 5MAOA 3KK1A 4DR3F 2OPQB 3CJ5A 4ITSA 5BR8F 4QWCA 3H5UA 1KONA 3W9JA 2DCUB 4CO1A 5KG5A 2KYZA 5C42A 3DRPB 4LJMA 2V4JA 3G4SS 1SKUB 1ZAVA 3Q8UA 1SI9A 3CJ4A 4XDDA 3CMES 1NO8A 1GQEA 2CJ9A 2E1RA 4ANDA 4M5JA 4EBDA 1N34F 1YJUA 2XNRA 4RNMA 2CXEA 3M2RB 4G65A 4DR7F 4DZ6A 5H9EJ 4ZOSA 4DF8A 1LNQA 2ZOGA 3QGPA 4BCAA 5J2MB 1YQHA 4Q44A 4MTPA 4ZVRB 3EZ5A 4DXLA 1Q53A 3QMQA 2GGPB 5F9NA 2W7PA 3UVJB 4ID5A 1QAXA 1S57A 1AW0A 5I42A 2EG2A 3ENVA 1V9OA 4RJVA 1NB7A 1YDLA 2IVYA 1HMVB 4DEZA 3K5MA 2PO4A 1NEEA 3NKYA 5B0BA 5A8KA 3R5AA 1R0BG 2UVWA 4RW6B 1GNKA 3AOCA 4DG1A 1S9EA 3B78A 3R6GB 4K7QA 1J27A 1TL7A 5AXNA 1HQUB 2V94A 4J9MA 1YJTA 2R4FA 4DV4J 4YOEA 2CPFA 4GC7A 2EBEA 3MEDA 1O0PA 5K14B 5THWA 4NASA 3LPYA 1X31C 2AEFA 5KFVA 2FYXA 1AA1B 1G6BA 1B99A 1YHQS 2K3IA 4WFBQ 3N5BA 4KRWA 3WC0A 2WK4A 3BQ1A 4NLDA 3W61A 2CNLB 5JXSA 4DL0C 3GLJA 4USHA 2AT1B 4Q8FA 2HFVA 2WSCC 2H5IB 3OV7A 2JWNA 1HNWJ 2V8HA 2MQPA 2XWYA 1N36F 5C24B 1FWPA 2YKAA 2GHPA 2BOAA 2M9KA 3KLEB 1TUWA 2GAGC 3HO1A 1RTDB 2H5JB 4LSZB 2FY8A 4FVMA 5MLCV 1WOOA 4K4ZA 1I1GA 4QR0A 5C42B 1R6VA 5H9EK 2ZM6J 4YQWA 2HHVA 3CPWR 3G87A 3I82A 2KXFA 4NWBA 4ZP8A 3ZZPA 3R5JB 3RZAA 2W01A 3E3XA 2MQLA 2QC3A 2HZCA 4USJC 5HQLA 4C8KA 3AJ1A 5D0HA 3D4JA 3TX0A 5J1EB 3LP2B 1Y5LB 2O1PA 2R3VA 4Q7AA 2PT0A 4DS5A 1M5PC 4ENOA 3DNCA 1GXUA 3GIKA 3MMAB 3PFOA 5KFCA 2HHUA 1BD6A 2Z58B 3EDQB 3CJ0A 3C8YA 4NI2A 3DOMB 4JV1A 5D3GB 1Q95G 2CZVC 1IN0A 1IKYB 2QJ3A 4LBPA 4P2XA 1VQPS 1Y11A 1J5EF 2KTQA 2MY7A 1S9EB 2AGOA 1PC5A 1TL7B 3LF0A 5IT4A 2ZVIA 2OPPA 1AZSB 1HBUA 2WBRA 2XMVA 3KKFA 2J8SA 4RW9B 5GADU 2HVHA 3SEOA 3KMSA 4IFYB 3QO9A 1REVB 2BJ3A 3KYLA 2R7TA 1NSQA 1WC0A 2W1BA 1NMEB 5M2PA 2ZBIA 3ZNJ1 2Q6BA 3BO2A 2YKPA 2D3O1 5ETNA 2P9GA 1ROFA 1SQGA 3B54A 1EETA 5HVFA 3UVJA 1KP6A 4EFAC 2YKQA 2VOOA 1FFSB 2V9KA 5JUMA 2W9CA 1LFWA 4OYPA 2J7KA 1MSWD 4DI6A 4K5RA 3M9OB 4B9TA 2RH3A 1WELA 2D9PA 4USKA 3PIPQ 3D68A 3W2WA 1FK9B 1WUUA 1NJIT 3WC2A 2J0SD 5GAGU 2HSEB 4K0KF 1OO0B 4P2MA 4EO8A 3RG6A 2CJYB 2V4JB 2VKRA 3FBBA 2MKJA 4W90B 1EJ7L 1NPPA 5DDOC 2CPXA 1J5EJ 3CCZA 2R2UA 4Y2AA 3BB5A 1YJRA 3AOBA 1U8SA 4JI8J 2WTFA 5EX0A 2B5JA 5DGAA 1Q81T 4CDIA 1IR0A 3C6TB 1B7YB 2HURA 4LFCJ 2JEIA 2KYXA 4ZCMA 2BANB 1CVJA 3OQ2A 2Y8YA 2QRRA 2QFJA 1KOOA 1IKVB 3I55S 1N48A 3ILJA 4FF3A 1O8BA 4USUA 3GG1A 2E5JA 2BA9A 4ZVUB 1Y10A 2E1MC 3MMBA 2YH0A 3L7PA 4Q2MA 4DV1J 2CQDA 3DRXA 1AUDA 1XR5A 1YG0A 3PJXA 1NH7A 2C3UA 4DN0A 5E3AA 4FVCA 2OELA 4UOHA 2EFNA 2GQCA 4O0NA 2O01C 1NCLA 4OJHA 3BGRB 5F3TA 2OGUA 4A8KA 1L5UA 4OLPA 1TMJA 3O5TB 3OL6A 4DLEA 2FJEB 2MXYA 1KLMA 5FLXY 2PD1A 2YWHA 1S10A 2DRDA 1Q7LB 3I5AA 3OR1A 4X66F 1PYSB 2J6SA 4NCBA 4NXNJ 2KI2A 4NCAA 2WVCA 2WONB 4RW8B 1HNXJ 1RT2B 3D0GE 2X3DA 3MM9A 2GZOA 3THPA 5I3PA 1U48A 1U1RA 2Y8WA 3F0NA 4X2BA 1IR1A 1U6ZA 5D6GA 4C8ZA 4C48A 4L73A 1E6VA 3OVBA 8AT1B 1DJ0A 1NPKA 2OD4A 2DNYA 4WE1A 3P96A 3JAMY 3MMAA 5E41A 3J7YI 3M8RA 2HZVA 3D0IE 3KLGB 1ZYQA 1N5YB 4ZLNA 3NWRA 3DOKB 1C1BA 1WI6A 3ZO7A 2CJAA 1N88A 1CJKA 3W9IA 3LO3A 2G0IA 4WFZA 4DR1F 4EBCA 2N3OA 2WB4A 2LYVA 3KHRA 2V5HG 3AB2B 4WU2A 2VPXB 2MZRA 3SSQA 1H2TZ 1RT6B 1UVLA 3MM5B 2BRLA 3HSJA 4JI2F 2XO6A 3T9ZA 1X4EA 2NPFA 3T5KA 2MZJA 2JFKA 4X66J 4DX8H 1XK8A 4IR1A 2CPYA 4UZBA 1SH3A 3G82B 1TL1A 1TKDA 4LF9F 1MU2B 4ECVA 4NCGA 5DDRC 2DRBA 3TAPA 1LW0A 3KJQB 3GZ7A 4NLPA 3VF0B 1W26A 3A8JA 1UZDA 3GONA 4F26A 3GR0A 2WBMA 3S8SA 2HZAA 3HKWA 1Z1ZA 1S9FA 3R2DJ 4ZPAA 2B0GA 2BZ2A 3QGGA 3KXDA 2ASLA 5HROA 3H2LA 3GCXP 2FVSA 4ECQA 2E5IA 2VASA 2DNNA 2C42A 3GPAA 1F9HA 3MPWA 4LRFA 1Q79A 3Q2SC 5HO4A 1N5VA 5FDLA 2B5JB 2HK3A 2YPZA 3C6TA 4NLVA 2EFVA 4ECUA 1JK9B 4KT0C 1BQNA 3NGRA 2GS8A 3CDEA 2PC6A 4JI2J 4HTJA 1XNRJ 1DFDA 4RW9A 1MN7A 5ETLA 2Z30B 4F67A 1SC3B 3FFIB 3R7NB 3K8WA 4J90A 2AGPA 3LTOA 3V4MA 1VLOA 4K2JA 1NDLA 2MZSA 2Y3YA 1JQGA 4TVAB 2F8MA 3TARA 2IM0A 1UVNA 3UDEA 5HANA 2X1GA 1A6LA 3FEZA 1LWXA 3R97A 3RRGA 3J80U 4MAKA 5D78A 4C98A 1S1VB 3TZXA 1N0UA 1OQ6A 2D7SA 3OTEA 3DRPA 4C0OC 3G8TA 3D66A 3GFYA 2V2QA 4TNOA 1VC5A 3BO4A 2OPQA 3I5CA 1S49A 4ED2A 1XMBA 2B7BB 3HX9A 1OY6A 3T6JA 3T6BA 1C4AA 1WEXA 4FF1A 4JI0J 1G7CB 1R7IA 2XC9A 2R8IA 4OX8A 1X4BA 5DS7A 1UW9A 2OH2A 2HVDA 5BXIA 1W25A 1UWAA 2C3YA 2XWXA 1S59A 1UAWA 2PI5A 2FJXA 2QX0A 4DQIA 3ZZUA 1RZMA 2HFOA 4EWTA 3NS5A 5JJBA 1KQSR 2MQQA 4O3NA 4NLOA 4KFBB 3H2VE 4DX5A 2AYGA 4RNNA 4IQXA 4MYUA 2KJWA 3DRRA 2Y1JA 4FYVB 4I1TA 3OSPA 1RLDA 1YJ7A 3CSKA 1XNQJ 3MUTP 2HRYA 1PJ7A 2FIUA 2UUCF 3V81B 1IM4A 1F3VA 1HBOB 3MDFA 3U1LA 3JTPA 4PXBA 4CWBA 2VA2A 1HNWF 4NLTA 2V4RA 2R7SA 3AQPA 2DO4A 1TL1B 2OPRB 4KJIA 3K5OA 1VMBA 5HQMA 1VYAA 4HDHA 4OYOA 2BV3A 3OFHA 3M8SA 5C2GA 5L1KA 1YJWS 1UEVA 1A9NB 1JB0C 1W2IA 2C22A 2HWIA 3RUBL 1YI2S 4JI6J 2KG0A 2JEFA 1TQLA 2M88A 2GO9A 1WF0A 3TEHB 4QWDA 3QSYB 4NXMF 1RDRA 4LBIA 2FZCB 3TO8A 2OFGX 2P6TA 1IQZA 4LREA 3WIUA 5HROB 2QZ8A 4LF4F 3X1LB 2KFNA 3M2VA 2M3DA 4ID5B 3CCRS 4F0MA 2KT3A 4OI4A 2GX8A 5EWGA 4ZP7A 1MROA 1ITPA 1SC1B 4PWDA 4OYZA 1VRTB 2ATCB 4PZVA 4ZCKA 2HMIB 1NK6A 5LSOA 2WONA 4RW8A 3D3BJ 2W7AA 4EZ6A 3HHNB 3ZTOA 2DNKA 1Q86T 3BV8A 2DHAA 5IC4B 3KHHA 1KTVA 4ED4A 1T3OA 1BWVA 1RWUA 1VOMA 3RRKA 3M8PA 4ZVFA 3LUYA 2CQ0A 3A3PB 3IG1A 4ALZA 1TAUA 4ZLLA 1YZ6A 3CD5A 3GFHA 1AROP 3BYRA 2FLPA 4L75A 3MD1A 2H3EB 1K47A 4CP5A 1C0UA 2VODA 3VZIA 2WSFC 4JI6F 3EYZA 2FLOA 4RX6A 1KQFB 1NLKL 3VAMA 2DR7A 2Z8QA 4RZRA 4MYTA 2ZJRQ 1BHNA 2ZDPA 3QJPA 4TN2A 4WFXA 4U6PA 2CJQA 1MMLA 3FSYA 1DAXA 1ZS6A 2EC2A 3VZHA 2CPEA 4EU0A 3C46A 3QJJA 1CS4B 2BXJA 5L1JA 1IBMF 2CIMA 1LEOA 1RHKB 1T94A 2V9WA 2E1AA 5KT6A 1S7IA 4DU7A 4L72B 4FS1A 3HF5A 1DURA 1MWQA 3FMWA 3I56S 1QY7A 1RHMB 4HH0A 1HWJA 2IC3B 2AEJA 1IKXA 1X7VA 1WACA 1FJGJ 2LA6A 3IP0A 2MZQA 1SCJB 1LWCB 3OFEA 2C28A 2DY1A 1T03B 1UJ4A 3SBMA 1G2EA 3POTA 3M9MB 2WVBA 3PM9A 2DR5A 4MJKA 2FHMA 2RT3A 4KPCA 4PCQA 5IQ6A 1AXQA 4OI0A 3HMJG 4LFBJ 1S76D 4IQMA 3TZZA 3B8HA 2PDAA 2J76E 3PG9A 4X4RA 1S5ZA 3D0HE 1JLBB 4KGXB 5IT9U 4U9RA 4C8NA 4MFBA 2YNFA 3BR9A 4F4WA 4TY8B 1XWLA 4JI5J 5F8NA 2J7UA 2HVEA 1XQIA 4ERDA 2IA0A 1JLAA 2WOMB 2MEWA 5ETMA 2W4DA 4OX9F 3SCIE 1LWEA 2QE5A 2R42A 3CNQP 3H59A 2M7SA 2HQ3A 4WPAA 1N6QA 1DARA 4IFYA 4IRDA 3MR7A 2KRBA 1FFWB 2V6AA 4N5SA 2RHQB 4HYKA 1FNOA 2KG1A 1C1CA 2DIVA 5KFZA 4QJVA 3M30B 2GJFA 2Y1LB 4WYLA 4YB6A 4C2MA 2Y0BB 4F2RA 1KLMB 1T9UA 5D15A 4YN3B 2MZ1A 1MROB 2UUAJ 4HR2A 3DLBA 4AFFA 4KFBA 1HYSA 4C3MA 1XMQF 3HCXA 3HHLA 2V8DA 3JQJA 2R7VA 4TYAA 3OL7A 2ZUAA 4ECRA 1LOUA 1VQOS 1T3NA 3BH7B 1RT3A 5KT2A 1REVA 3OPKA 3VQSA 3ICLA 1I6JA 4JI4J 2IDLA 2CYYA 4Y65A 1RTHB 1EX8A 2VQFF 1KN6A 2HVIA 5B0FA 3IMQJ 3L4BC 3MR6A 5I3QA 1FWLA 2HHSA 2HGNA 3IC1A 4NLUA 1HD0A 1YLXA 3IM9A 3AD7C 4LR9A 4DDFA 1QD1A 4AE5A 5KFEA 1LXNA 1VGYA 2J0XA 2MPUA 5D4PA 1BQXA 3K89A 3ZTQA 1V6HA 2RJZA 3R3TA 3M2VB 1D8ZA 1TV6A 2DIUA 3SFGA 4M5HA 3PY8A 4O4RA 1S1UB 5AT1B 2KXHA 2AGQA 3EE3A 3MPDA 1O5JA 2V67A 1YBUA 3M6WA 1QJHA 2GW8A 4A8YA 4J9PA 2AEMA 2E66A 4OMFG 1AT1B 1GAOA 1I5OB 4OYXA 3C66A 4HT5A 3SMZA 3Q22A 1YX2A 2LVWA 3CCUS 2NYHA 4DV3J 1WI8A 4FXDA 1U6FA 2N4DA 4UOGA 1JLEB 3M8PB 1LWFA 3HVTA 3ITHA 4U95A 2VA3A 3KLFA 1B0VA 4MT1A 4KPYA 4GVBA 2BE7D 3PJ9A 2MKHA 5JVGQ 1TVRA 2ASYA 2VDIA 4IOAQ 4Z2XA 1X4FA 1Y3JA 1VFJA 2XMTA 1NNDA 3H2UB 1TMMA 3HZGA 3KJFB 3ZZRA 3HVWA 4KH0B 4NLRA 3BSOA 4DUYF 1HBNB 5KFHA 2QMXA 4RNHA 5D8HB 2XHWA 1NK7A 2CQBA 5E3RA 5DZ7A 1NUEA 1Z2ZA 2E7XA 2DKOB 3AOAA 2G2YA 3BEGB 3QATA 4USIA 4B02A 3UD5A 2GIFA 4X4SA 4EYHB 3K58A 1PGZA 5HN0A 2LU2A 3ETMA 5D0GA 2ZH1A 3MEEB 4CH1A 4DV3F 3EUNA 4NX9A 2OAUA 3M32B 2F4VF 4U8YA 4DL6A 1F3FA 4I64A 1VRQC 2YQ3A 4OQJA 3ZFVA 3QQCD 4A8SA 3G8SA 3C2PA 3L95X 3IR5B 2HLUA 2E44A 1D0EA 1RHQB 3W8PA 1RWOB 2L3MA 5D4OA 3JYTA 2F7VA 2NSCA 1YJ9S 1RYRA 1HNIB 2R7UA 1XJWB 2IM1A 1RISA 2VG6A 3CDUA 2O67A 4NPOA 5H9FJ 2R7RA 1IKWA 2DH7A 3BSCA 3G86A 1X60A 2CG4A 4ZCIA 1C1CB 2WB1D 1BQMB 3DLLQ 2KZZA 2EK6A 4MMOA 3VCDA 1N6QB 1TELA 4P9SA 2U2FA 3CCLS 4CO5A 4DPYA 5IWAF 3J81j 5BJRA 2CKWA 3QZ8A 3DOLB 3CMQA 3M1VB 2K7JA 2HAFA 3GJQB 2RQKA 3TQEA 2ASJA 1RBOB 4WFNQ 2C2DA 1G1XA 3NOGA 5LMUF 1WWHA 4NLYA 1XBWA 2GQQA 3GYGA 2JC1A 2WW8A 4NRTA 3UD3P 3OTBA 4AL6A 1U1QA 3H7HB 5GAHU 1S1TB 5KFDA 4RU2A 2DHGA 3FMBA 1T9TA 4F3OA 3TAQA 1KTQA 5KFKA 4XO0A 1RTDA 3H5SA 1FJ7A 1LFPA 1UJ5A 4G1PA 1U0HB 3O3LA 1AYEA 1GX6A 1PILA 1RA7A 3EVOA 1NDCA 3A13A 1SV5B 2N3LA 2IVMA 3B4DA 3EVWA 3NGDA 1UEUA 4F4ZA 1NKEA 4Q45A 3L7UA 4DUZJ 3SV3A 4H4MA 1T03A 1RCXB 2Y9HA 1SKRA 1JX4A 3VAJA 3OR2B 3GIRA 4NA3A 4PEOA 3RW6A 2CNKB 3M9NB 2IAJA 4ILMA 3N5FA 4OLOA 2NXNA 3EVMA 4RLEA 3CCSS 1RT1A 2GJIA 1FK9A 2YX1A 2GIRA 1JLBA 2X3GA 5KFUA 1VLYA 3OXLA 1M1HA 5ITHA 2DR9A 4D3GA 4ELUA 1I94F 1HFEL 4DCJB 5CH7B 3TJ8A 7FD1A 5AJ3J 3H40A 3MM7A 5FLXU 2D3OR 4Y6IA 1NU4A 5KFRA 3G6YA 1BC6A 1EP4A 2QYGA 4JI0F 2HQCA 4GKJJ 1WG1A 4PABA 4B3RJ 2HHPA 3TUIC 4DV6J 1V5VA 2RDIA 3FDSA 3MMJA 2XHCA 4TLRA 1U7LA 3R7SB 3TA2A 3I31A 3KFWX 4B9VA 2LP4A 1HQEB 3ZZTA 3MM6B 2QV6A 2EFQA 3F41A 4ZVSB 1VI7A 2DGSA 1VC0A 3CD6S 2AJQA 2ZH9A 5KT3A 1FRJA 3K5LA 1O51A 3D1OA 3HXMA 2EFOA 2JX2A 1SL1A 2BR0A 4J9LA 2UUCJ 1BWEA 3A3NB 1HWKA 4RWXA 1SH0A 1ZPVA 5HVHA 1NZAA 2LQJA 5KFYA 3ILOA 2K8GA 4M5LA 4ICLB 3BPSP 1RTZA 4LSNA 4NLQA 2IRUA 2OSQA 2HQIA 2MMYA 3DGPA 3N4WA 4IOBA 5IM0A 4DL2A 2QEXS 4DV7F 1CS4A 2CPJA 2VB6A 2WCXA 3M2UB 4R5PB 3MCOA 4DV0F 4JI7J 2I5JB 2ADCA 3VGSA 2GVZB 1IKVA 1F60B 3EZOA 1HNVA 4G1QB 3F56A 1Q5VA 4F4KA 1OYDA 3DKDA 1D9DA 4B3RF 2W2MP 2C2EA 1U49A 4ZPWR 4QIEA 1OPIA 3O44A 4CM0A 5J2PB 2OKQA 4FXWA 4DFJA 2EFGA 3TJ9A 4DZDA 2MZTA 4YB1P 5KFIA 3DMJA 4ED3A 3NAIA 3GE9A 3RW7A 3C6UB 3DM2A 3WX4A 2YVSA 3AQOA 4WWSA 3DLHA 2HQFA 4RBUA 3Q2TC 1N34J 1JJHA 3DN9A 3GSIA 2DR6A 1RAAB 4FPRA 4QPXA 1HNIA 5DQGA 3MUMP 3C16A 4OFZA 4DWIA 3ENAA 3W1YC 3FK4A 3GCWP 3EJMA 4HI1A 4YP3A 2OIHA 2A3JA 5KT4A 2JVRA 3J7A1 4F3QA 1S6QB 3CJ2A 3QLHA 1FE0A 3AA9A 2XYHB 3M6VA 3V6KA 4LFBF 2EKYA 1ZM4A 3LP2A 4URSA 3NCRA 4RL1A 4ES2A 5F8LA 1DHMA 2VQEF 3HSZA 2AMCB 1VQ9S 1F9FA 4K8RA 3CIMA 4YFUA 1HPZA 2B8PA 2FJDB 3I9V9 3SSSA 5CCMA 5KT7A 2F9DA 3T1YF 4F8RA 2F4FA 1PIEA 3ELHA 2LDIA 2UVVA 3C14A 1G3OA 2P9CA 5LMNJ 3NBPB 3AB4B 4USVA 3TZYA 4DV2J 3LAKA 3M7VA 1IKYA 4C11A 1VQ8S 4WKRA 3GJSB 1IR2A 3HHDA 3T3FA 1VIXA 1MNEA 3BBFA 1G4CA 3VV2B 5A6WA 4F25A 3DGPB 5AE3A 3J81U 4LRDA 1S1VA 1ZTWA 1J5OB 3K57A 2QLBB 5DO2A 5GADI 4TU7A 1SJQA 2Z4PA 4KGKA 4OZ1A 2HQGA 2MKIA 2B9XA 1TL3A 2PEHA 2RVJA 2V8VA 4CH7A 1FJGF 1U2FA 2W4PA 3EGNA 1H74A 2CPIA 2GVDA 2RKIB 2K1RB 2WVFA 3W62A 2D69A 1QSLA 3N79A 3UDCA 1U2RA 1N32F 5ETQA 4QOTA 2LA4A 2UUAF 1CLFA 4NMLA 4LF2A 2ZBCA 2M8HA 2OFHX 3FRYA 3HVTB 3MOJB 4TXSA 3UE2A 4X65F 3DLEB 1S4EA 1MN9A 5GAEU 3V6HA 2BBEA 4U7UK 3V6JA 1VHIA 5I4MA 3V4IB 4J7CA 3TYTA 2IPOB 4TU8A 4ED7A 1YZ7A 2LQ9A 1NJWA 3H5XA 1AFIA 4KAIA 1H98A 5I42B 3RB4A 5C24A 1HMVA 2WW4A 2ZC3A 4FKYA 4P2SA 4WTYA 4OYWA 4Q43A 2VQFJ 3BH6B 4ZA1A 4DV2F 2CDQA 3S01A 4CI0B 2HNYB 2VIHA 4OX9J 1TP7A 3AFGA 4F2SA 2EVZA 3MXHP 2JH3A 5CD4A 1WC1A 4CLLA 2HBRB 2V69A 2AYEA 3NS6A 1JXVA 1ELOA 2J9CA 4O44B 4O3QA 1KVJA 3U1NA 1NBEB 5K14A 4RUAA 5M2UA 1SC4B 2JZ5A 5G4DA 5J1EA 4C3LA 2JDJA 2AW0A 1N32J 1ZA1B 1K0VA 5E33A 1HQEA 5F8JA 2SXLA 2HNZB 1WTFA 3S6EA 2KH9A 1WHVA 4JI1F 2XZDB 3SIPB 1VISA 1RI7A 3W2VB 2L41A 4KO0B 4UY8T 4TQRA 4QR2A 1GK8A 1S9GA 3HD1A 3OFFA 5DQHA 3VAGA 4B3SF 1NKBA 4GO5X 3QLHB 2VPZB 2AZ1A 4CLSA 2YNIB 5KTQA 2MLXA 1NHKL 2OO4A 5DM7Q 2DTJA 3LP0A 2AD9A 4A8XA 1D1UA 2BQ3A 2HRTA 3WIVA 4R5PA 4UUXA 2W9BA 1QVGR 3PNIA 4HI2A 2QMWA 4DQSA 4N41A 1QLNA 4IH5A 4M5DA 1FD8A 2DXFA 2C2NA 4I6YA 5L46A 2LDYA 1VQ7S 3M8ZA 3IBFB 5CYJA 2ABYA 2A1BA 2XZTB 3DMJB 3ZNUA 1R31A 3GJTB 3MEGB 3OFGA 3JAMU 3CJSA 3R1HA 1D8YA 4K4TA 3CD7A 4H54A 3VAFA 1AFJA 2OLWA 2H9ZA 5D0EA 2KFZA 1ZA2B 2C3MA 3OR1B 2C2MB 1X5TA 3Q89A 1UWBB 4ATNA 5A8KB 5IWAJ 3T5JA 2Z0GA 4DL4A 3SXLA 2I0XA 3HP6A 1TZ0A 3M2UA 5LMUJ 2RHSB 2WHOA 1OPZA 1Y00A 1RE1B 3R8YA 2R7XA 4KQZA 1CBKA 4K4VA 3WX8A 3THTA 3TP2A 4CT9A 1Q0NA 1Z2LA 3IG1B 5D0RA 2X1FA 3Q24A 3Q0AA 4LF7J 1H7WA 2OUGA 1U8WA 2IAJB 3O2IA 3T5HA 4GKKF 1SJRA 1V5IB 5IXUA 4HEA9 2Q1LA 4ETXA 2XG8A 3CXCR 2ZJQQ 3MAQA 4BC7A 1S0OA 4IG3B 1FVSA 2B43A 2HRUA 3A4TA 3R6LB 4ZN1A 1ZAWA 1N8RT 2W8LA 1JJ4A 2CJKA 1JLQA 1FA0A 3MR3A 2IJRA 3CJQA 3RJMB 2CQ1A 1ZBTA 4X4NA 3PW0A 1MW7A 1TU0B 2R7OA 3NL0A 4HH1A 3MFHA 2OEKA 2QN6B 4LIRA 4KV8B 4QIGA 2XS7A 2B4OA 3UW1A 3FC9A 3CGIA 3A12A 3GWCA 2G2OA 4IDKB 4O44A 1U09A 1IJFB 2CA9A 2UZAA 1Y5IB 3PKMA 4YHHF 3W3SA 2CQ3A 4KIAA 1OMSA 2D3ZA 3P3DA 4LR8A 2HQDA 2L9NA 1S1WB 5HSPA 2OEJA 2G0CA 1C0UB 2XMJA 2EC0A 4WE1B 3MMBB 1IWAA 2OMOA 2N4CA 3KWMA 2AJ4A 4CO2A 2DEJA 2WAQD 1LW2A 3UO0A 3DLKB 2H65B 3JXOA 3VGTA 1QTMA 2VONA 3DOLA 3M1VA 1R8HA 2DGWA 3BGUA 4UOCA 3UCGA 1WTBA 4GKKJ 4JYAJ 4JP8A 1F6TA 2B56A 2Z2ZA 4P52A 4ZPTR 2HMIA 4L6V3 3HFVA 3T9NA 1PO6A 3HJVA 3P8BB 3KLIB 4O4GB 3VALA 3CJKB 4ER8A 5GAHI 1GH8A 2MQNA 2VFRA 2XBPA 1VJQA 3ZZ0A 5HMWA 2YKOA 4DR7J 1FHTA 2FZGB 1TUGB 1KHVA 2AYMA 4N47A 3W5XA 5CCLA 2NPIA 4OX6A 2JSXA 3SYZA 4PPDA 3H5YA 4IO1A 3FSXA 2DD8S 2KVQE 2YKMB 1XN9A 3MEDB 3K59A 1PCAA 4ZPCA 5SUHA 6FDRA 3IR6B 5HLFA 2XS2A 5F8HA 1EAYC 1RAFB 2B6AA 3OVAA 5T14A 4ECSA 2AJ1A 2H4WB 4YS2A 1A0OB 4C7QA 4DR2F 1U1MA 2I38A 2B9EA 1FRKA 4PG6A 1GXLA 1NHUA 1T0TV 3V4IA 2CDRB 4HACB 4OJ1A 1MWZA 2FJBB 2M52A 3V6DA 3E2EA 1NXIA 1T9XA 4A46A 4F0KA 1QDUB 3DFEA 3KLEA 3TX8A 4U8VA 4J9KA 2KL8A 5EDWA 1VR6A 4IOCQ 2QSWA 5C25A 1MWYA 2YKNA 4ZITA 1WG4A 1Q7YT 4WXWA 2CG8A 1M5KC 3TEGA 2UXBJ 1T9VA 4JOUA 2G4BA 2NXEA 4ID8A 4DR4F 3GV8B 4PXEA 4DF4A 3CDBA 2RDDA 2QLFB 3M6XA 1L3KA 4W98A 4DLGA 1Z4UA 1JIHA 3MAAA 4LBHA 4I68A 2F65A 1YJNS 3OW2R 2W25A 2ZH8A 2MB0B 1WEZA 1F2GA 2YNGA 4ZVOB 2KN4A 2NXCA 5LSRA 3PW4A 2KT5A 1UPPA 1BGXT 3O6QA 3K7RA 3C19A 4R0EA 5HI7A 3RGIA 3V2UC 3NBPA 4PG8A 2MYFA 5CZXA 4ED6A 4LF1A 3TVKA 3TNVA 2GNKA 4NEYA 3W60A 1K8AT 4NZ6A 1NM2A 2UUTA 3PR4A 1TR0A 3JTOA 4EI2A 4IYQA 2XLIA 4LF6J 1JKHB 4EZ9A 4K4SA 1TKXA 3I87A 1SQEA 4MK9A 2OI2A 4WCEQ 2VJVA 3MM5A 1M0SA 3HSGA 2KJVA 1H38A 5IZHA 4GKJF 5LSLA 4ED5A 4QPTA 5LMNF 2HGLA 4C9DA 1BMQB 1HQ2A 1WD6A 3OJUA 1S4FA 5ETKA 1CJUB 2HS3A 3CCVS 3VAHA 1NK9A 1VQLS 2D41A 4IFVA 3MF5A 2HKEA 1EKSA 1EKRA 2V2KA 4PWWA 4LF6F 1Q5YA 3OBIA 3PDNA 1ULRA 3W5YA 5GAEI 2AKWB 2MKKA 4YEAA 2ZH7A 5I3UA 5B09A 2VICA 4XIUA 1GFWB 2D9OA 4GVBB 2Y1IA 1L3VA 5K5MA 2FVQA 3I6PA 4WBFA 3MCSA 2QMUB 4XPCA 2W8KA 2XSFA 2UP1A 1NJYA 2ZNZA 2YQ0A 3MZIA 2NQPA 3D28A 2NUHA 3HHLD 1AB8A 5F8MA 1CC8A 2V2VA 4JV0A 2BUNA 4ZPVR 2GMJA 4ZJLA 4DV0J 2DGVA 2AYBA 4PR6A 2YNFB 3K17A 3VHQA 2ZNYA 3AXMA 3LPEA 1X4AA 2I5JA 2XYPB 5IFMA 2X51A 4NXMJ 1Q8KA 4ANEA 3IO1A 3N28A 3NNHA 1ZOTA 4YB5A 3PXGa 3PW2A 2VF3A 3QWPA 1SUQB 3QYYA 1B0PA 1U25A 1UVKA 3TQ1A 3H90A 4MIWA 4XTTA 2NYIA 2VFUA 2V8GA 4DV4F 3NMRA 5DLFA 3HVAA 3JTNA 4OYIA 4QBUA 4PQUA 1C4CA 2BRKA 2YWEA 3RBZA 3NGSA 1RXOB 5IOLA 4I2PB 3CDWA 4OHVA 4C97A 5KOWA 3SZ2A 4AXIA 1TFWA 1CSJA 3CMAS 3GV7B 1FE4A 1F9EB 3TW0A 5KFFA 3SQGA 2J6UA 2UV8A 2XI3A 3RBXA 1JLQB 1OSDA 1JNZB 1NZ8A 2BE2B 3DLJA 3P4UB 4UQTA 3UQSA 2ZE2A 5A2QY 3T1HJ 4BC9A 5ETRA 2I2YA 4TY8A 4LT6A 2VPWB 4TY9A 2XCAA 1N0VC 4YMEA 4EBEA 4DV5F 4ZJQA 3R2CJ 2HNDA 1R8CA 3M8QA 3U02A 4KHMA 2IA6A 1LWEB 1UFLA 4KYZA 5U47A 4TQSA 3DU5A 4IG0B 4CIOA 1P9YA 3RB3A 2UXDF 3BYPA 2JFDA 2JL9A 5L8RC 3ISNC 3J7ZT 5CXTA 1TAQA 1Q1KA 2HWTA 2C2KB 2YWWA 3PYDA 5F3ZA 1RU1A 1UPMB 3HD2A 4CLFA 9ATCB 5EWFA 2ZM6F 3FBCA 5HP1A 5K8NA 4Y0FA 2YKMA 4ZHRA 5H9FK 2CVIA 4CNZA 2BKOA 1KDNA 1QUVA 2VBWA 3EXYA 3KNGA 2VHGA 1T8EA 2FZKB 5LJ3Y 4QYZK 3W2VA 4J9VA 2F40A 2CRLA 2CPZA 4KO0A 3TJAA 1KKHA 2Q79A 3DRYA 3VVTA 4DR1J 1RP5A 2HNZA 3SI8A 1S12A 3UN5A 5AXKA 2PFDA 2LXUA 1U45A 2VD3A 4FDFA 1VDHA 3PTWA 4GMKA 1RAHB 4DQPA 4TLQA 1VRTA 3OT9A 1JLAB 1KFDA 2WOMA 1M5VC 1KRPA 4IH7A 1XEZA 1U0HA 7AT1B 2W9BB 4ECZA 2DH9A 5HMXA 1SB6A 2XSJA 4ZVTB 1RBAA 3CCES 4ED0A 4P6QA 2E5GA 4M5DB 1SUQA 4B9MA 4IRCA 2RIJA 4G1IA 3A8KA 3HHKA 4YR0A 1BE4A 1S1WA 2CQCA 1UVMA 2RRNA 3M32A 3MWBA 4LSLA 3RAMA 5KFSA 4IUFA 1RT1B 5L1LA 3L3CA 3IS9A 1KOHA 1X4CA 1GMUA 2DNZA 3OUYA 2EI5A 1PAUB 1RGVA 3UCUP 1NK4A 3I32A 3LALA 4NE9C 2F5GA 3QAUA 4C3KA 5E7OB 2ZHBA 4LF5F 3H8YA 4X84A 4UOFA 2Z2YB 3JSMB 3EDRB 1RKIA 2NREA 4K0KJ 2APOA 1TK0A 1IBKF 3IGVA 5HVGA 1SPBP 4QCLA 3ETOA 1Q16B 4H4MB 4F02A 4OJ3A 4CTAB 4KHPF 1S0NA 5A8RA 3GYNA 1EQMA 2DNOA 1UVJA 1N56A 1IBLJ 4J9RA 4IFVB 3NGKA 3LGNA 3MEKA 2ZWOA 3LOUA 4I4BA 3W65A 1FWKA 2GFFA 3W7BA 5K20B 4ZPDA 3TZWA 3HT3A 3KHGA 2CNOB 4N77A 4EEYA 4WP8A 3MFIA 2BM0A 3VWSA 1V3RA 1UZHA 2H48B 3VGVA 4HACA 4PRFA 1VQYA 2OPSA 1QAYA 1XR6A 2CPDA 2E7VA 2FJAB 5AXLA 3OVSA 2BOPA 1YRTA 5CAAA 3KK2A 2F4VJ 2Z2MA 3GSDA 2QA4S 1PJ6A 5A6PA 1UA1A 1AZSA 1HBUB 1HR0F 4B3TJ 4NLGA 1CPZA 1DLOA 1KC8T 1FERA 3OL9A 5EN1A 4K4WA 4XK8C 1SXLA 2DB1A 2VFSA 4ES1A 4AL5A 3KUEA 4KHRA 1U1NA 2Z56B 4FF4A 4DR6J 1SKWA 3WBZA 2LXIA 3IGNA 5ETSA 2FVRA 1D9FA 4NXNF 4DJBA 2EW9A 1GEHA 1PYTA 2XZWA 2OEMA 3BREA 1K9MT 4J37A 5FIIA 2W24A 1F0XA 1HNXF 4KHPJ 4YUDA 5L9XA 1YGYA 3QJLA 4DU8A 2W9AA 1URRA 2OHDA 4J9QA 1ZM3A 2DITA 4HT7A 3KG4A 4HHUA 1Y5NB 1QAJA 4OL8A 2F8HA 1CJTB 1WHWA 4OIXA 3CDAA 1RTIA 3DM2B 3T1HF 3C14B 2JLGA 1M90T 2HVZA 1FCAA 3QAEA 4RR5A 3RRHA 2ALYB 3O8WA 3RYLA 4UZCA 2Q66A 5KFLA 2V0NA 2MTLA 4JV5F 5ADZA 3W5ZA 1QE1B 3QO9B 2XGQA 1WF2A 5DZ6A 2QYCA 1MLAA 2AX1A 3GYXB 5HMYA 4RW6A 2FTRA 4DG1B 2LQ8A 3MUVP 1FNXH 2RSQA 1RT4A 1JLFB 1RT3B 2PE8A 3NRBA 5HAOA 4BWJA 1DTTB 3PW7A 1B70B 1VBKA 1S79A 1Y3KA 5HLFB 1H73A 5T7LA 1XTZA 2RKIA 4FZVA 4LSLB 5AE1A 1M5OC 4HHHA 2W7OA 1NAQA 4O3OA 1M5HA 5F0UA 3T19A 3T1AA 4DFKA 4CT8A 5F0WA 1FFGB 1SH2A 3C6UA 4LF9J 4L3NA 4N7TA 3RBEA 4DCPB 4DSKA 1FT8A 5H1SV 3KTQA 3MPYA 4KR0B 3RAXA 3KUHA 4YB7A 1RADB 1TVRB 2ROGA 4R8UA 4J9OA 4PG5A 4WYWA 3TVZA 3ULHA 4YR2A 1WDDA 1EB0A 4WFYA 3QGIA 3PRDA 4M95A 4A8QA 1DLOB 3CVKA 1KEKA 5KOXA 2QO3A 3LQVA 1IQTA 4CLZA 5ETPA 4DBQA 1DTQA 4YHHJ 5DGBA 2WSEC 2VU5A 4A8WA 2UVRA 4JI3J 3QPIA 4W92B 3TAMB 4RPFA 5C2CA 2Q3PA 2YNGB 2R8GA 1K1QA 3IAS9 3FQLA 1RWVB 4MKBA 1HWLA 2GGPA 3W66A 5HP1B 4Z7CA 4A48A 1Q8LA 4OV1A 4LF4J 4HDGA 4DSIA 4UT4A 2M5YA 5CYQB 4DPWA 3UPFA 3EICA 4WK1A 4AT1B 4JYAF 4E2FB 4RW7A 2BM1A 4UY85 1JLCB 1OJ4A 1SC6A 2ADBA 3CUNA 2X1BA 3D9BA 4F4YA 2ZH3A 3RTVA 3NG8A 4ED8A 1VQ6S 1UFWA 3MM9B 1S97A 5JVHQ 4W4MA 2DJWA 4DR5J 1KQGB 4F36A 4NMXA 4RUCA 2J9DE 5KFOA 2XCPA 2HFZA 3IBCB 4C8LA 2VG7A 3Q8QB 2W2OP 3DRSB 5A76A 2MGZB 3I9ZA 4DV7J 1J2VA 1FKOB 2CFXA 3H4BA 4G1QA 3FJ2A 1CULA 1ZM2A 3CO9A 3ILIA 2PGCA 5D4LA 1C1BB 2Y1RI 4DR2J 1EETB 3PX0A 4AXJA 4K5SA 1NJXA 1JWWA 2XLKA 1N4LA 1F2HA 3QGHA 1VBYA 1IBCB 2RRBA 4OI6A 4X62J 2J6TA 2E9TA 4Q0BB 5GMKa 2RS2A 1N52B 6AT1B 2H5EA 2FLNA 1T05A 2KKHA 1CG2A 4H4OB 3ZTSA 4Q0BA 4ZIWA 4I7FB 5J2QA 4FNIA 1OQ3A 1RLCL 2CAJA 2EG1A 2JRSA 4PG7A 4ZN3A 2RUSA 5GVQA 3IRWP 4XAKA 3A8IA 4A8MP 2E1CA 3DDIA 3IRXA 4KC5A 3TA1A 4P73A 1VS3A 2JLFA 2WVEA 5L9NA 3CCMS 4DR4J 3P45B 4PWDB 2VV5A 1TKZB 3WZ0A 1HARA 1RT2A 5HMZA 3SSRA 4CLYA 1IKWB 1LK5A 2DNHA 2COLA 3ILLA 4N56A 2O5DA 4HHJA 4RW4B 1TL5A 3HK2A 5ETOA 1RAJA 4DL5A 2VG5A 1URNA 4ECYA 4LFAF 1APSA 4Y2CA 1NHVA 5FD1A 2D1CA 3D67A 4RUBA 4AUKA 3SCLE 2G9OA 4ZHRB 1U1LA 3BS9A 4USWA 2W9CB 1B4SA 1Y7PA 1GTEA 4OZJA 2YXLA 1X4HA 4WIIA 2QLJB 1SJ4P 4ES3A 4FPIA 3A8EA 3T1YJ 3NEKA 1RHRB 4DN9A 1S9GB 2FPHX 4WP9A 2R7QA 3KHLA 2DRAA 2JEJA 1QE1A 5KG6A 1WOPA 2FHKA 2MKCA 4X62F 4G6VB 4B3SJ 3OXGA 4RNFA 3LA0A 3UFCX 4RUHA 4WIQA 1HW8A 1PBUA 2OSRA 5DRKA 1KVKA 2FUG9 2J7WA 5BR8J 2C2OB 1YK9A 2ZE2B 1S7HA 2K7KA 2VL1A 3I0RA 3Q8PB 3J7Z5 5HK4A 3FGVA 2ZZMA 2MSTA 3FZBA 2ACYA 3DLGB 4D3HA 2UUWA 2YQ1A 5J2NA 2AU0A 2VBYA 4Z37A 1SV5A 5LXRA 3QSIA 3DCAA 2FJWA 2J0QD 1RCOB 2XMMA 4PXDA 3TUZC 3QIPB 2LKZA 3Q8VA 3EX7B 3GMGA 5B0EA 2RS8A 4Q5VA 4DX7A 2CVEA 1SL2A 2XMWA 3BN7A 1R3NA 2QSFA 2RF2B 3DRRB 3PCOB 4KGVB 2BE9B 1R89A 4NLWA 4BWMA 2AJ0A 3EWGA 4WK3A 5E0OA 1QM9A 4F50A 2JEGA 4JI7F 4M1KA 1L3TA 4RU9A 1I51B 3S7RA 3G6XA 2V8PA 1H6KX 5B0CA 4CO0A 1YIJS 1DY3A 3CIZA 5DM6Q 3PJWA 3RAQA 1B3TA 2J9DA 3G96A 2JC0A 3LWLA 4YR3A 2I9SA 4F4AA 1KWMA 2E1PA 4CLTA 1QSYA 1SJ3P 2ZOFA 4BDPA 3FQKA 2M4MA 3HKZD 3J7YU 3PKYA 2UXCJ 5EHHA 1RTJA 3K5PA 3QT7A 4X64J 3PYFA 2KFYA 1Q8BA 1H2UX 4ZKAA 2HFSA 1KBRA 3DHWC 3CCJS 2KB2A 2XLJA 1YSJA 1F5BA 2ZH6A 1WSVA 3JB9k 4OZNA 1OIAA 3MPVA 3PIOQ 2NXJA 4Y28C 4B9UA 3OXFA 4EGLA 2XI2A 4DOZA 1ZH5A 2CQIA 3SCKE 5DLGA 1H0HB 2RQMA 4KGZB 1R0CB 1VQMS 4P7TA 2VQEJ 3I0SB 4C8MA 4ZS6A 2OPRA 2VBXA 5FDLB 1OSCA 2BW7A 4ILRA 4LIWA 4TKTA 1Q82T 4ZDNA 2ZHAA 5K9FA 1FJEB 4I67A 4CLWA 2GQ2A 3DDNA 1HNVB 1FEEA 3D2WA 1U47A 4IR9A 4QWBA 1T02A 2BYCA 4N8NA 3S1TA 3UNYA 2R2SA 4JI5F 2KT2A 3G9CA 3CB4A 3P5TL 1HR0J 1PYOB 2EPIA 2GV1A 3FKBA 3RU0A 5BYSA 3HVRA 4J9SA 4HLBA 4RO0A 4DHVA 1FDNA 3N01A 2A6OA 2OMLA 1KR4A 1X8DA 1TUVA 3Q8RB 3DI6A 1VC6A 1KQKA 4URGA 2RRAA 1OS5A 5L39A 1V3SA 2MKYA 1O6XA 4MK7A 4K2XA 5AE2A 1EZZB 2E29A 1KSPA 3MR2A 5T41A 1IBLF 5C25B 2CJXB 2ZD1B 5LXYA 4OZ3A 2MDAA 2ZDOA 4QWEA 3OLBA 2YX7A 3MAHA 3GIMA 5E3CA 3ADAC 4M63A 4FKXA 2HFNA 1BQNB 4P72A 1DQAA 1UTAA 3IAM9 1GMWA 4QW8A 1RABB 4X65J 1SIWB 1YVFA 3HPOA 1VQ4S 1NH8A 4X4OA 2PIIA 4CRJA 4J9UE 4DSLA 1K0TA 2O3DA 2IM3A 1CJVA 2IRYA 1VHFA 1Q8IA 3OJSA 3N6LA 3B4MA 5SZTA 2BMBA 2H54B 5C5JA 2IM2A 1BXNA 2QL5B 2MJNA 3AT1B 2VFVA 1PJ5A 3OLAA 3W64A 2GO8A 5D4NA 2ILZA 3BM7A 3HULA 3KNAA 2FLLA 4DR6F 2AJFE 2WZ1A 3EZUA 3L9ZA 1ZETA 4LF5J 4RBVA 4USMA 2N7YA 4FS2A 1RWNB 4ICLA 3AY0A 4LSNB 4RBTA 3CJKA 3QIDA 3TR5A 2RQCA 1RKJA 2UU9J 5EX3A 3Q83A 4HVZA 1S1XA 4K50A 1N33J 2OD6A 2ZWPA 3ENQA 2CQ2A 3CEDA 3F44A 1WKLA 1RWPB 3HDSA 1UEKA 2B7CB 3HLUA 2PMZD 3GV5B 3BBBA 2IC3A 3EMTA 1OY8A 1RTJB 3MI7X 1KD1T 4DFPA 5IT9Y 3I0RB 5BYRA 1I3OB 4ZVEA 1RAEB 3BKFA 4PPZA 2E7WA 4DQQA 4U7UD 3MM8A 4JI1J 2DNPA 4ZP9A 3NS7B 4CYUB 4DPTA 1UA0A 3Q8YA 4PYDA 3MHYA 3GR1A 3P5BP 3ISND 4RKUC 4URQU 3U27A 1HBMA 3WHIA 2B3TB 1CQNA 5HJYA 2LEPA 2B4PA 4QZVB 5KFTA 2CZ4A 4CLKA 5A0YB 2FGCA 4LF8J 4MH8A 1UCNA 3G8QA 1RJJA 5B0DA 1Q78A 3DU6A 2LCWA 4ECXA 2GA7A 8ATCB 2DHSA 2UUBF 1X5PA 3PEJA 1RK8A 5DG7A 1FKPA 1S6PA 3OTOF 1ZZNA 1U1KA 2E9RX 4A4JA 2EBGA 1IKXB 3TOQA 5DJBA 2BANA 3MOZA 3MCNA 5HL7Q 2HWHA 1BQMA 1RAOA 2FB0A 2QTWA 2UU9F 4B3MJ 5LJ5Y 2MQOA 3MD3A 1FXDA 4KE5A 4ZVHA 3WDOA 2RDJA 2KHCA 1UMJA 3OTCA 4MIBA 3QNWB 3R5CA 5J1NA 4GC6A 2MKSA 4I2PA 3KDNA 4UUWA 4CQ1A 3N6NA 2HS4A 1Y9OA 3AD9C 4PWUA 4M5MA 2HS0A 2RILA 1IXKA 2DGUA 1S1TA 1UETA 1RA6A 2NZCA 5AJ3F 2HGMA 1SL0A 1K73T 1L3UA 3BGLA 4QW9A 2IVFB 4DPUA 4AQYF 3HHLC 3CJ8A 1FX4A 4LRAA 4PKDB 2ZUGA 1JJ2R 2XS5A 1NKCA 1JLGA 1UWBA 4IDKA 1WG5A 2LQ5A 3DRSA 3VQTA 4IG0A 1SJ1A 3LAMA 3GJRB 5A8WB 4X4PA 3EPGA 2C2RA 3QRPA 4OZ0A 3BGOP 1RAGB 3K5NA 1MMDA 2BJDA 1P8GA 3BDPA 2ZBPA 4P71A 4U7CA 2MJUA 1HLWA 2PN6A 1FRIA 1YWXA 3VR1A 4ECWA 3PVXA 2CQHA 2R9LA 2ZKUA 3LP1B 3M4XA 2QGFB 1HWIA 1U6BA 1VBXA 2V34A 4PAAA 1RSCA 1LKZA 2IYIA 2DK2A 4B9NA 1NPRA 2KZMA 2YWGA 1FO1A 4OHXA 4K4UA 3QBCA 3IM8A 4L3KA 2LLZA 4AQYJ 1LV5A 5ETVA 5KG4A 1DTQB 2H1YA 2HBYB 2EK1A 1WC6A 2Y0SD 2RU3A 3ENWA 1WNEA 2LFVA 3NOCA 1RT7B 2AZ3A 2G0JA 1REGX 2FC8A 4QIVA 2FHJD 4UF4A 1QAIA 2UVUA 2FHJA 3FBEA 4GVLA 4WKYA 1FJCA 2F3JA 2NCKL 4YY3J 2ASDA 3MPUB 4X4VA 1CQMA 2FDNA 4NI2B 4ZP6A 2A18A 5CYQA 1VQSA 1E6YB 2OTLS 3DI6B 4J91A 2BDPA 2QLWA 1VCTA 2VC0A 3QT8A 2IHR1 1OWXA 3FCVA 3WQPA 3FCWA 1PSDA 4C0HA 4DMZA 4DR5F 2BQUA 1X9WA 2HW3A 5F8IA 3GILA 4DQRA 3THVA 1XERA 1A7GE 1HQUA 1FRXA 1YTYA 3DDKA 1WDTA 3FFIA 4L74A 4USTA 2FD2A 5K8MA 5KFNA 4ZCLA 2XMAA 2NSBA 3M8WA 3QRRA 4QU6A 2E5HA 4I56A 4OJGA 1XMQJ 2CWKA 4LVNP 3D6MB 3I4HX 3TVYA 1HIYA 4FF2A 3H98A 3MEEA 2DPIA 5A2QU 1HNZJ 1HI8A 4BBYA 2MLZA 4GRSA 2NUUG 2B6AB 1IBMJ 2H4YB 3IWXA 4HL9A 4OZLA 2LECA 1R27B 2DXEA 2HK2A 2KO1A 4DUTA 4IKAA 3MTJA 1P27B 2AQ4A 2UXCF 2JJ4D 3CJTA 4F7VA 2RF2A 1S6UA 4QR1A 2DBBA 2KHDA 3EM1A 3MMCA 3JYTB 3EPIA 2XGPA 5IC6B 3PX4A 1RU2A 1U02A 1P1TA 4O4GA 4I2QA 3R9LA 2H51B 2V50A 3AJDA 3KLIA 5A8RB 1FVQA 3J80Y 4HKQA 4BS2A 1BY9A 2DXDA 2QG9B 2XEXA 3HI9A 1CEZA 2K3KA 4FYYB 4FNHA 4IH6A 3F73A 2E5LJ 2ZZNA 2HG4A 3HFZB 2DNGA 1CJVB 3D1QA 5LOQA 3NP5A 2RNEA 4DPXA 2G1HA 4KTQA 2R8KA 1RYSA 1IVZA 2PEBA 2Q6CA 2YWFA 5DQIA 2RUGA 1RUSA 3UR3C 5KFQA 3MECA 3IN5A 2ERRA 1RACB 1U2CA 1AUSL 1N54B 3HSDA 3KLHA 4I69A 4UTGA 2KXNB 3CCTA 1D09B 2Z2LA 4WJBA 1W7WA 2OP5A 3PEHA 3IBWA 4MKVA 4CTAA 2YKNB 3CE8A 1WC4A 3CF5Q 3C3LA 1X0PA 4N8OA 3D7SB 2XM3A 2XMUA 2DPJA 3UDVA 4EUVA 1E6VB 2BKPA 4EMDA 3IR7B 1RTHA 2DR8A 4X4QA 2HIYA 2YBVA 5J2NB 1YRXA 4JBCA 1VQKS 1OYEA 5KG2A 3E01B 4EO6A 3AJ2A 4DX6A 2EFPA 2UV8G 4NRUA 3BQ2A 2E5LF 3AHPA 4TYBA 2HFUA 2FGOA 1S48A 2MQ8A 4ZK7M 4ZLJA 3NLCA 2A10A 1X5OA 3G2XA 3IS9B 3LANA 5A0YA 3NY0A 2DVIA 2BX6A 3BGRA 2LEAA 1HW9A 1T11A 3NCQA 4J9NA 4ELTA 1RWMB 2HIQA 2WRMA 5GMEA 1UVIA 1ZAXA 2I8EA 5IM0B 4C4WA 3BN4A 3RB0A 2L9DA 1ZTTA 4J5OA 2XSJB 2W2NP 4OYMA 5KG3A 1RBLA 2P5VA 2P8IA 2QA2A 4ZPBA 2XO7A 4OHYA 5E2QA 1LW0B 9RUBA 7FDRA 4NCGB 2FQQB 1FRLA 1QUPA 2VG7B 3BDEA 4QYRA 3BKTA 4E0DA 2B9YA 4P74A 1JXEA 2ZZTA 2I6WA 2OJ3A 3BO3A 3PO5A 2HHWA 1RT7A 2BABA 3X3UA 2HBZB 5J1PA 2V2ZA 2K06A 3GIJA 3NAHA 3BKUA 2LXFA 3OR2A 2XB2D 1WJ9A 3NCPA 3SQGB 1TFYA 2BW2A 4WFAQ 2BJ9A 4O0IA 4PQUB 1N5QA 4E8UA 4DV5J 2RAQA 3L7OA 5D77A 3W2WB 3ZTRA 3OHAA 1DRZA 3DGVA 3FSIA 3CD0A 1FI4A 3CJRA 4DPOA 3FZ2A 4CLPA 1M5SA 1HYSB 3LP0B 3ZTPA 3Q23A 3GFXA 4KGMA 1JNRB 4AD6A 3HM9A 5KFPA 4KB7A 2VOPA 2PI4A 3TAMA 2MY8A 1NK8A 3PO4A 1NRKA 2HNDB 2ZBRA 3M8QB 2ZVSA 4LF8F 3MM8B 2CWXA 3QT6A 4ECTA 1TKZA 2ZKTA 2PSZA 3RR8A 3NXZA 4AYBD 2J0WA 4A8OA 2K2PA 2E9ZA 3JSYA 1IWGA 2YX4A 3EGVA 4M5NA 2YH1A 3FEYB 2DISA 3AAWB 4Y2MA 4UQGA 2DHXA 2F8EX 1N33F 2EWHA 1UW4A 4K4XA 3MM6A 4EK2A 2DGQA 3LWMA 3PACA 3KG1A 1C2PA 4AL7A 1VK3A 3T5LA 2BJ7A 1HA1A
chains in the Genus database with same CATH topology
4PQAA 1NJZA 1SJFA 4KBIA 4JV2A 4JI8F 1FDBA 1UL3A 1RT6A 3HHEA 1J5OA 4QWAA 3TA0A 1W2BR 3MMCB 4NL5A 1RTDB 4B08A 2HNYA 1HHSA 1ZM9A 4O3PA 2R2RA 1QSSA 1EP4B 1Q4RA 4LQ3A 4CO4A 4G3IA 3I96A 3PRBA 4OHWA 1JLFA 3Q8SB 2B51A 4M94A 4DSFA 4Y2IA 3BJYA 2KM8B 3DYAB 2L08A 1S77D 3IXQA 2DH8A 5F9LA 3CULA 2YTCA 3U1MA 3KK3B 1YBAA 2XMKA 3DC2A 3U7JA 1RTIB 3E8OA 3OSNA 2BQRA 1X9MA 5L1IA 5BYQA 3EGWB 3PFEA 5D3GA 1ZPWX 1F5AA 5KFJA 3QZ7A 2RD5C 1HBNA 2YNIA 5KFXA 2LU1A 1RT4B 1UJ6A 2POKA 3R5BA 3TUJC 3HJFA 4I6AA 1VIOA 1WEYA 4XPEA 1SBRA 1YRUA 1T7PA 4X4UA 2GHWA 4XDCA 1HPZB 2ZH4A 3KLVA 5CHCB 2N7CA 4B3TF 2DGXA 2ZOMA 2CQ4A 2AX0A 2W4CA 5AXMA 3NNAA 3SFUA 1T95A 1HL6A 4EYIB 1R8PA 2NLWA 3MR5A 4NYZA 3IWNC 4B3MF 2K1RA 4ELVA 4ZLPA 2DNQA 3PHEA 3AA8A 1IJEB 3ONQA 3PZPA 4ETZA 2ATLA 1CC7A 5E3PA 3FEXB 3UR0A 5T7LB 3RBDA 4MK8A 1B7FA 2HHTA 3KLFB 3PX6A 2ROPA 4V19X 5J2PA 2VH7A 4LQ9A 2J8AA 1BLUA 4OI3A 3OL8A 3TI0A 2B4UA 3DLEA 1VRUA 2IBKA 2GIQA 2VC1A 4B3OA 1LQ9A 1V3ZA 3OUYB 2HHHF 4CO3A 3NNCA 3P49B 2R2TA 2OPSB 1XC9A 3L09A 3NMAA 4OX7A 5CD4H 5L38A 3KOAA 4P7VA 2IMWP 1TL4A 4KV8A 4YY3F 2KG0A 3SDEA 1TL3B 2VONA 1S6QA 5CYMA 4F4XA 2O66A 3FCHA 2P9EA 2F1FA 3POTB 1MU2A 2JOQA 1VQNS 3PV8A 1KVIA 5K8OA 4OHZA 3ZZOA 2YNHB 3DLKA 1T05B 1L3SA 4OI1A 4ILLA 3P6YC 5F8GA 4DLEA 3LH2S 3VAIA 4E98A 4X4TA 1LXJA 4JI3F 4FP9A 2IYGA 1FTCA 4Q2LA 1FDAA 4DL7A 1X9SA 3UWTA 5DDQC 4YDDB 2DNRA 4MKAA 1DQ9A 1HNZF 4FBUA 3MM7B 1VBZA 4C8YA 3BSNA 1FKOA 1TKTA 2QIFA 4KKOB 2A2CA 4IRKA 2L9WA 2VFTA 3DLGA 3HZEA 3M30A 1RT5B 3UI3A 4DUZF 3J81Y 1FF2A 3CCQS 2M0GB 3JSBA 2NR0A 3G71S 2GJ2A 1XNQF 4PXCA 1LW2B 4Y34A 3UCZP 4IG3A 1FRHA 3MTKA 3OTDA 2XNQA 4Q8EA 1K1SA 1R43A 5DETA 2IJFA 1D3WA 3G6VA 2G1DA 2MSSA 1H2VZ 4RW7B 4WZMA 3BQ0A 1U1PA 1TK8A 4O3RA 2AP6A 2HLTA 2L48A 1U4BA 3AH6A 2QT7A 4A8FA 3MECB 5B0AA 3M6UA 4KSEB 1HI1A 2JVOA 2JLEA 2QLXA 1KLNA 2YWKA 1C0TA 3RB6A 4Y3CA 2XY5A 4A47A 4RW4A 3EXCX 2PA3A 4NYPA 4DV6F 2I1RA 3GIIA 1DZ5A 5F41A 2OTJS 2RMLA 4NA1A 5EGYA 2ILYA 3IWLA 4TU9A 2G13A 3US5A 3DXSX 4RWWA 1Y0HA 4IO9Q 4PUOA 1S99A 2R8JA 1S6OA 3LW5C 2KDOA 2AF6A 1B64A 4F3MA 3IRXB 1JLCA 1XR7A 2M2BA 4JUZA 3CC2S 3FRZA 4V19J 1FKPB 1S6PB 3SDEB 3A1YG 3FNNA 2LEBA 2DCLA 2JHEA 1VK8A 2VZ9A 4H4KC 3R27A 3SCJE 4FN5A 1DTTA 1S0MA 5KG7A 5IS2A 1YITS 1VQ5S 1SIZA 3DHXA 1KNZA 2MGZA 1P1LA 2GC8A 1HBMB 1MMNA 4QIWD 3CC4S 4B9LA 3CTRA 2ZH2A 4WF9Q 3E01A 4B3SF 3MURP 3N6MA 1FD2A 4MIAA 1R6YA 2CQPA 3MEGA 5EUHA 1FKAF 1UKUA 3HFKA 3N0VA 4R0JA 1U24A 2DO0A 4UW2A 4R8UB 4DL3A 5DDPC 3I5BA 5KFAA 4I7FA 5J2QB 1HWUA 4H4OA 1VJWA 1B0TA 1TV6B 2DNMA 3KLHB 4LVOP 2ZD1A 3FVYA 1NK0A 2GHVC 3OHBA 2VPYB 5KFMA 2IBOA 4MKYA 4CZCA 1UP1A 2VBZA 4WZQA 1HI0P 2J9EA 2HHQA 3R1LA 3KJVA 4LFCF 1F5CA 1R0AA 1NK5A 3QWUA 3KMQA 1XMOF 4DS4A 3LGMA 2FVPA 3K2YA 2NZ4A 4DV1F 1JLEA 2IRXA 5KG1A 2ZITA 3CWJA 2NS1B 2KU7A 2B4VA 3BR8A 5E3QA 1FTRA 2PA8D 2RB7A 3I4PA 1GT8A 1VRUB 4D3HA 1CVJA 2ZHOA 1TKXB 4WU3A 4LMZA 1FXRA 1X0FA 2YNHA 3K8VA 3DOMA 2M70A 2V4QA 2BE2A 5FJ4A 2HAIA 4O23A 1N5SA 3V81A 3CJ3A 3I0SA 2DGTA 4X64F 4FXVA 2VG6B 2QA4G 2XULA 4ED1A 5CQGA 3V5RA 1GX5A 2BACA 2D74B 3GFZA 2BJEA 2D3UA 2AV5A 2PMHA 4NYOA 3UNGC 3TANA 1LWFB 3ITHB 3GQCA 1FNMA 1X4DA 4C11B 3DYAA 2P6SA 2VKZG 4NZ0A 1DBDA 1JMTA 1KS2A 2C3OA 3E51A 4NLXA 1H7XA 4QQBA 1JKHA 1GTHA 1FRMA 2IFXA 4CNYA 3KK2B 2CPHA 3KK3A 4CCHA 4B3OB 2BVZA 3ZZYA 4OI2A 1U1OA 1S0VA 3UD4P 1HD1A 3PW5A 2ALZA 1WHYA 1S1UA 3ZZZA 5KT5A 2DT9A 2GMLA 4JI4F 2XY7A 4N76A 4FYDA 3BZQA 2FY1A 3UDLA 2N82B 5E5NA 4I2QB 1P6TA 3B82A 1FDDA 5B08A 5J2MA 4DSEA 1R0AB 5KAKA 1DQ8A 5I3UB 4LUBA 4DFMA 4QU7A 4OZ5A 5LT5A 4U67Q 1N5TA 1LWCA 1X4GA 4RNOA 2F9JA 3QIPA 5B0GA 1FESA 1PC4A 2NXUA 4NLSA 4DSJA 3IA0A 2FJVA 5KFWA 5G0RB 4O3SA 3NWGA 3BGFA 4PUOB 3V6DB 3DXBA 1X5SA 4Y2KA 4R25A 2A2DA 4B9SA 2LMIA 3H25A 4QYZJ 3N9UC 2LQBA 5HBMA 5GAGI 3KK1B 2KM8C 3G6ES 1R8BA 3HHLB 2DNLA 2Q43A 4MFBB 2MHEA 4H4KA 4PG4A 2YY3A 4ZMMA 2RE1A 1M1KT 3RR7A 1C0TB 3ZC4A 5KFBA 3GG0A 2FVCA 1N5YA 4FBTA 1XNRF 1FEHA 3GB0A 3M2RA 3R5DA 2KRRA 2ZJPQ 2VUGA 3MGJA 2IMOA 1KHWA 3BSAA 3CCWA 2IJNA 3O1LA 1E6YA 3JSRA 2HPUA 1LK7A 2C3PA 3D5MA 3D54A 5CA5A 4NOHA 3LP1A 5KFGA 4C8OA 3IFEA 2KVIA 4K59A 2MQMA 2R7WA 1ZZFA 5M2RA 4NZ7A 1KFSA 2FC9A 1D9AA 5IQQA 1S72S 3ISZA 3JSMA 1JLGB 1Y4ZB 3VTIA 2QA1A 1RQ0A 5A8WA 2CJBA 3G8SA 5K8PA 3SV4A 1TKTB 2RU9A 4KKOA 2R8HA 1SKSA 2M8DB 1TK5A 4ZVGA 6FD1A 5DG9A 3KJVB 3CT9A 3KLGA 1WF1A 5B7WA 2VG5B 4WXOA 2FHOB 2B9WA 3D1HA 2RQ4A 2XY6A 1WHXA 3H20A 1JXLA 4LF7F 2ZC4A 5CZVA 1GXTA 5G0RA 4GO7X 1R8AA 2UXBF 1IUJA 2OPPB 2GCFA 5HQ8A 2GMHA 4I0WA 1HBOA 4C0BA 1FXLA 2X1AA 1HHTP 2ZFHA 4HTIA 3M05A 5IT0A 1S1XB 5EWEA 1H3DA 2CQGA 4M8LA 1QVFR 5LL6d 2ZH5A 4BHQA 4K4YA 1RT5A 2U1AA 3VAKA 5KG0A 4B17A 5CYMB 4CH0S 2HYIB 3CC7S 2J5AA 2MHNA 2HHXA 3EGZA 3BF4A 3KG0A 3PR5B 4YDXA 4I6WA 4Y00A 1YJVA 1P9QC 3DOKA 3H4DA 4QIFA 2DGOA 1U26A 4NA2A 2ROEA 2AWZA 5HBMB 3TRGA 5MAOA 3KK1A 4DR3F 2OPQB 3CJ5A 4ITSA 5BR8F 3H5UA 1KONA 2DCUB 4CO1A 5KG5A 2KYZA 5C42A 3DRPB 4LJMA 2V4JA 3G4SS 1ZAVA 3CMES 1SI9A 3CJ4A 4XDDA 1NO8A 1GQEA 2CJ9A 2E1RA 4EBDA 1N34F 1YJUA 2XNRA 4RNMA 3M2RB 4DR7F 5H9EJ 4ZOSA 4DF8A 2ZOGA 3QGPA 4BCAA 5J2MB 1YQHA 4Q44A 4MTPA 3EZ5A 1Q53A 3QMQA 2GGPB 5F9NA 2W7PA 4ID5A 1QAXA 1AW0A 5I42A 2EG2A 3ENVA 1V9OA 1NB7A 2IVYA 1HMVB 4DEZA 3K5MA 2PO4A 1NEEA 3NKYA 5B0BA 5A8KA 3R5AA 2UVWA 4RW6B 1GNKA 4DG1A 2PFFB 1S9EA 3B78A 5AXNA 1HQUB 2V94A 4J9MA 1YJTA 2R4FA 4YOEA 2CPFA 4GC7A 2EBEA 3MEDA 1O0PA 5K14B 5THWA 3LPYA 5KFVA 1G6BA 1YHQS 2K3IA 4WFBQ 3N5BA 4KRWA 3WC0A 2WK4A 3BQ1A 4NLDA 5JXSA 4DL0C 4Q8FA 4USHA 2WSCC 3OV7A 2JWNA 2V8HA 2MQPA 2XWYA 1N36F 5C24B 2YKAA 2GHPA 2M9KA 3KLEB 4FVMA 5MLCV 4K4ZA 1I1GA 4QR0A 5C42B 4YQWA 2HHVA 3CPWR 3I82A 2KXFA 4NWBA 4ZP8A 3ZZPA 3RZAA 3E3XA 2MQLA 2HZCA 4USJC 5F8JA 4C8KA 3AJ1A 5J1EB 5FLXY 2UUBF 3LP2B 1Y5LB 2O1PA 4Q7AA 1M5PC 2PT0A 4DS5A 3DNCA 1GXUA 3GIKA 3MMAB 3PFOA 5KFCA 2HHUA 1BD6A 3CJ0A 3C8YA 4JV1A 5D3GB 1J5EF 2CZVC 1IN0A 1IKYB 1VQPS 2KTQA 2MY7A 1S9EB 2AGOA 1PC5A 5IT4A 3LF0A 2OPPA 1HBUA 3KKFA 2WBRA 2XMVA 4RW9B 5GADU 2HVHA 3SEOA 3KMSA 4IFYB 3QO9A 1REVB 2R7TA 3KYLA 5M2PA 3BO2A 2ZBIA 2Q6BA 2YKPA 2P9GA 1ROFA 1EETA 4EFAC 2YKQA 2VOOA 2V9KA 5JUMA 2W9CA 1LFWA 2J7KA 1MSWD 4K5RA 3M9OB 4B9TA 2RH3A 1WELA 2D9PA 3PIPQ 3W2WA 1FK9B 2J0SD 1NJIT 3WC2A 4K0KF 5GAGU 1OO0B 4EO8A 2V4JB 2VKRA 2MKJA 4W90B 5DDOC 2CPXA 3CCZA 2R2UA 4Y2AA 3BB5A 1YJRA 1U8SA 2WTFA 5EX0A 2B5JA 1Q81T 1IR0A 3C6TB 2JEIA 2KYXA 4ZCMA 2BANB 3OQ2A 2QRRA 2QFJA 1KOOA 1IKVB 3I55S 1N48A 4FF3A 1O8BA 3GG1A 2E5JA 2BA9A 3PKYA 3MMBA 2E1MC 2YH0A 3L7PA 4Q2MA 1AUDA 2CQDA 3DRXA 2OTLS 1XR5A 1YG0A 3PJXA 1NH7A 2C3UA 4DN0A 5E3AA 4FVCA 2EFNA 2GQCA 2O01C 5F3TA 4OJHA 3BGRB 4A8KA 1L5UA 4OLPA 3O5TB 3OL6A 2FJEB 2MXYA 1KLMA 2PD1A 2YWHA 1S10A 3OR1A 1Q7LB 3I5AA 4X66F 2J6SA 4NCBA 2KI2A 4NCAA 2WONB 4RW8B 1RT2B 3D0GE 3MM9A 1U48A 3THPA 5I3PA 1U1RA 4X2BA 1U6ZA 5D6GA 4C8ZA 1E6VA 3OVBA 1DJ0A 2OD4A 4WE1A 2DNYA 3JAMY 3P96A 5E41A 3MMAA 3J7YI 3M8RA 3D0IE 3KLGB 1ZYQA 1N5YB 3DOKB 1C1BA 1WI6A 2CJAA 1N88A 3LO3A 4WFZA 4DR1F 4EBCA 2N3OA 2WB4A 2LYVA 3KHRA 2V5HG 3AB2B 4WU2A 2VPXB 2MZRA 3SSQA 1H2TZ 1RT6B 1UVLA 3MM5B 2BRLA 4JI2F 3T9ZA 1X4EA 2NPFA 3T5KA 2MZJA 2JFKA 4DX8H 1XK8A 4IR1A 2CPYA 1SH3A 1TKDA 1TL1A 4LF9F 1MU2B 4ECVA 4NCGA 5DDRC 2DRBA 3TAPA 1LW0A 4NLPA 3GZ7A 3VF0B 4F26A 3GR0A 2WBMA 3S8SA 3HKWA 1Z1ZA 1S9FA 4ZPAA 2B0GA 2BZ2A 3QGGA 2ASLA 5HROA 3H2LA 2FVSA 4ECQA 2E5IA 2VASA 2DNNA 2C42A 3MPWA 1Q79A 3Q2SC 5HO4A 1N5VA 5FDLA 2B5JB 3C6TA 4NLVA 2EFVA 4ECUA 1JK9B 4KT0C 1BQNA 3CDEA 2PC6A 4HTJA 1DFDA 4RW9A 4F67A 3FFIB 3K8WA 2AGPA 3V4MA 2MZSA 3TARA 2F8MA 2IM0A 1UVNA 2X1GA 1A6LA 3FEZA 3RRGA 4MAKA 5D78A 4C98A 1S1VB 1N0UA 1OQ6A 2D7SA 3OTEA 3DRPA 4C0OC 3G8TA 3GFYA 4TNOA 1VC5A 3BO4A 2OPQA 3I5CA 1S49A 4ED2A 1XMBA 2B7BB 3HX9A 3T6JA 3T6BA 1C4AA 1WEXA 4FF1A 1G7CB 1R7IA 2XC9A 2R8IA 4OX8A 1X4BA 5DS7A 2OH2A 1W25A 2C3YA 2XWXA 1UAWA 2PI5A 2FJXA 4DQIA 3ZZUA 2HFOA 4EWTA 3NS5A 5JJBA 1KQSR 2MQQA 4O3NA 4NLOA 4KFBB 3H2VE 2AYGA 4IQXA 4RNNA 4MYUA 2KJWA 3DRRA 2Y1JA 4I1TA 3OSPA 3CSKA 3MUTP 2HRYA 2FIUA 2UUCF 3V81B 1IM4A 3MDFA 1HBOB 3U1LA 3JTPA 4PXBA 1HNWF 2VA2A 4NLTA