4NXMJ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4nxmJ00
4NXNJ 5LM7E 2UU9J 4DV0J 4JI4J 1N34J 4DR3J 4NEZA 4GKJJ 1HR0J 4LF7J 4LF6J 2E5LJ 4X62J 3D3BJ 2VQFJ 4DV1J 1IBKJ 1FJGJ 4B3RJ 3OTOJ 1IBLJ 3T1YJ 4DR2J 4DV7J 5A2QU 4JV5J 3R2CJ 4YHHJ 1N32J 4DR4J 4DUYJ 4KY3A 4LFAJ 4JI1J 4DV6J 4DV4J 5IT9U 1IBMJ 4X66J 4NEYA 4LFBJ 4DR6J 4JI7J 4JI3J 5LMUJ 2UUBJ 2VQEJ 4B3TJ 2UXCJ 1HNZJ 2HHHJ 4OX9J 4KHPJ 5LMNJ 3JAMU 4LFCJ 2MEWA 2UXDJ 2UUCJ 4B3MJ 3T1HJ 5BR8J 4DV2J 4PWWA 2ZM6J 4JI5J 1HNXJ 4DR7J 2MQ8A 4JYAJ 4RJVA 1N33J 3IMQJ 1N36J 4NXMJ 1XMOJ 4DV3J 3J7AN 4X64J 4V1Ak 4DV5J 3D3CJ 2UUAJ 1XNQJ 4JI0J 1HNWJ 4JI6J 4GKKJ 2UXBJ 3J80U 5FLXU 4B3SJ 4LF8J 4DUZJ 2F4VJ 4AQYJ 4K0KJ 1J5EJ 4LF9J 4X65J 4DR1J 4LF5J 3W1YC 4JI8J 3J81U 5IWAJ 4DR5J 4JI2J 1I94J 4HHUA 3R2DJ 1XNRJ 2MTLA 1XMQJ 5AJ3J 4KYZA 4YY3J 4LF4J 2KVQE 2KL8A
chains in the Genus database with same CATH superfamily
2BJ8A 3DRPB 1ZTWA 2A6OA 2A18A 4K4XA 3T1HF 3C46A 3RZAA 3KHHA 1ELOA 3HJFA 2DGQA 4C11B 3KLEB 4HACA 2MXYA 4HHJA 3TQEA 2G4BA 1Q8LA 4OYOA 5KTQA 4YR2A 2F4VF 1HR0J 1VQ4S 3M2VA 3JQMA 1Q82T 3AOAA 5IT9Y 4K2JA 2QC3A 3AD9C 5C24A 3T9ZA 4NZ7A 2FJAB 4Q43A 5L1IA 3PTWA 3OJUA 5A6WA 1HQUA 2R8GA 4CLFA 2F9JA 3PV8A 1KQKA 4OL8A 1BQMB 3HX9A 2AX1A 1U1MA 4OHWA 4DL2A 1ZA1B 1N5TA 4FKYA 1NDLA 4JV5J 3DGPA 2F5GA 3SIPB 2B43A 4YHHJ 2CG4A 2Y8WA 1LOUA 1HQUB 3MOZA 3A13A 4TVAB 4CLTA 3V6DB 2R8KA 4A8XA 3CMQA 3NKYA 3H25A 4PWDB 4PCQA 4X4NA 1C4CA 2O01C 1FI4A 4EGLA 1QTNB 1S1UA 2W24A 5IT9U 3KK2A 3HHLD 2BDPA 3C6UA 2HIQA 2YWKA 1EHWA 4ZLNA 1S0OA 2ATCB 4DPTA 3KLGA 4WKRA 4DR6J 3C2PA 2OHDA 4ICLA 1MMDA 2CPYA 3AAWB 5E0OA 4K4VA 4L75A 4DSEA 3C3LA 3ISNC 2QL5B 5KFCA 2UXCJ 2HS3A 1APSA 4TY8A 3H5YA 2EC0A 4YP3A 4NLXA 4CYUA 4NPOA 4CZCA 3THVA 1F3VA 1H72C 2MGZA 5A0YA 4OX9F 4NASA 3TA0A 1UVLA 3CD7A 2JEGA 4R5PB 1RTDB 4V19J 2VBYA 2F1FA 2GC8A 2F65A 4Q0BB 2B8QA 3OBIA 5EHHA 2BQRA 3N9UC 1TAUA 1M1HA 1JX4A 2EG2A 1K1QA 1TMJA 5KFGA 2RQMA 5IC6B 3OFFA 1UVKA 4URSA 4IG0B 4F04B 5JMNA 2GMLA 3K89A 4DV6F 2VOPA 2CJYB 2CQDA 3FEZA 3TNVA 4ZIVA 1XBWA 5KFUA 5DETA 1AUDA 3HZEA 4MK8A 4JI0F 1RTZA 2OLWA 4DJBA 3A8EA 1TL1B 3HZGA 3WX4A 3ZTRA 3RR8A 3HD1A 3BSOA 3KLHA 1UFKA 1S99A 1LWXA 2VDIA 3EMTA 2ZWOA 3OFGA 4KFBB 2KG0A 3AH6A 1IR0A 3PJ9A 3D0IE 1NSKL 1SC3B 4DPXA 1P9YA 3N0VA 3RRKA 4UY85 4FS2A 2KHDA 3NGRA 3ENVA 2EFNA 1U8SA 2M70A 3OXFA 1S7IA 4ZPAA 2YWHA 3K5LA 4AE5A 1LEOA 3K59A 1AA1B 1X9WA 3HF5A 1HNWF 1GXLA 2HNZA 2BJEA 1FFWB 4OYBA 3V4IA 1MROA 1IR2A 2YWGA 3HKWA 4UT4A 1JLEB 1VBXA 2PC6A 4YB7A 1D0EA 4F4KA 1GNKA 2VUGA 4KAIA 2HYIB 2DNLA 1T05A 2Y1LB 3TO8A 1DY3A 2MZSA 4JI2J 1NDCA 1I94J 5AJ3F 5C42A 4QIEA 1BWEA 1HQEA 1QM9A 4O4RA 3H8YA 3FDSA 2V69A 3FQKA 2P6TA 4WP3A 2QA2A 4ZPTR 2W7PA 1NZAA 4WE1B 3HSDA 4OIXA 4OHZA 5KOWA 4A8QA 3JB9k 3RW6A 3PKMA 1HWJA 4H4MB 3D7SB 3ZTSA 2HZAA 3QWUA 3FMWA 2J0SD 5DJBA 2LEBA 2DO0A 4PPZA 2UU9J 2DNMA 4ZPDA 3J7ZT 2ZOMA 1NUEA 3N5BA 3NEKA 1LKZA 4WJBA 3BGLA 3TJAA 1S6OA 1YJRA 2IYGA 4IYQA 2M5YA 2R2UA 3Q0AA 1L3VA 1ZH5A 3UN3A 4ED0A 2M4MA 3R7BB 2W8LA 3JTOA 3D6TB 4ED5A 1L5UA 4LF6J 2RHSB 1HMVA 2XMJA 3CD6S 4QYZJ 4DN9A 2ZH5A 4S0MA 3KLIB 5E3PA 5DDRC 1VRTB 1F5CA 1RAGB 1YKWA 2DH7A 4PQAA 5KG6A 2C2NA 4J9OA 2N4CA 2MZQA 2YKNB 3FFIA 2E5LF 4LF6F 1KP6A 3F41A 5IQQA 1RT5A 1RLDA 2GA7A 1FRJA 3R1LA 2R7WA 4M8LA 4KHRA 4FYDA 2IFXA 2YWFA 3NAHA 4NLRA 4QBUA 5DGBA 3DDKA 3GR0A 5KOXA 3KK2B 2XYHB 1S4FA 3PW7A 1ZPWX 5KFKA 3PW2A 1S48A 2RS8A 4BLGA 2QFIA 4JB8B 5EWGA 2J6SA 1CVJA 1V6HA 4MIWA 5DM6Q 1DQ9A 2XHWA 4X66J 2VIHA 2ZM6F 2EW9A 3R5DA 2KTQA 2D69A 2HMIA 4B3RF 1V9OA 3MPYA 4CH0S 1KQGB 1DURA 4URQU 2W2OP 3E2EA 5CYJA 5HATA 4CM2A 4YB6A 3KG1A 4JI2F 3IG1B 5KFIA 5DS7A 2KYXA 3V6JA 1NEEA 2H5JB 2MEWA 3P5BP 4ZDNA 3N79A 2I8EA 1Q8IA 1ZPVA 2V2ZA 4K4ZA 4HDGA 2HHXA 2AIRB 3AHPA 4DCPB 2J5AA 2RNEA 4OLPA 2QMWA 4B9TA 4PRFA 4KGMA 1D3WA 1UEVA 3G6ES 4NCAA 4A8YA 3QAUA 1PG5B 2GS8A 4PXBA 1NXIA 3RUBL 2XNRA 4B9NA 3EGWB 3UQSA 4DX6A 1F9HA 5C25B 4O3PA 3LP1B 4N56A 1M90T 1VQKS 3H7HB 2D9PA 1OYEA 2BZ2A 1NPPA 4Z2XA 2GMJA 1N32F 3IM9A 2WCXA 4RNMA 1FD8A 4JV0A 3M1VA 1OQ3A 3SMZA 3BZQA 1CJVA 3QGGA 4CH1A 2IRXA 4QOTA 2BJDA 4YEAA 1DLOB 1PSDA 2RHQB 3KDNA 3UVJA 4JI6J 3C19A 4LSZB 3DLGB 4TXSA 4UZCA 4X66F 1RGVA 3SQGA 4CQ1A 1UWAA 2XWXA 4PG5A 3SDEA 3PIPQ 1FEEA 4MH8A 4OYMA 1S12A 1UZHA 3CO9A 2IMWP 1CJVB 4FBTA 4V19X 3P8BB 1S9EB 2U2FA 3G8TA 2Q6BA 4WFXA 3WIUA 2W4PA 3RAXA 3R27A 1WI6A 2LQBA 2B8PA 4EYHB 1RT7B 1RKJA 4LF9J 1I51B 3MEDA 1JLFA 1IWAA 2DXDA 4KPYA 1SJ3P 2ALYB 5CZVA 2RQ4A 1H73A 2RDDA 3I0RA 3J81U 4F50A 2ZZMA 1EKRA 3DU5A 1FTRA 5F3ZA 2R7RA 2P8IA 2K3KA 3L95X 4WE1A 1O6XA 4CTAA 5CA5A 2RUGA 3R2DJ 5D4NA 3M2RB 4R8UA 1H38A 2PEBA 2KXNB 2XY7A 4EMDA 4X4UA 3ET6A 3MPUB 1TFYA 2RQKA 3DOLA 2KVQE 2OH2A 1U0SA 4FVMA 4P2FA 4NXNJ 2OPPB 5J2MB 4CT8A 1GMUA 1CQMA 4M5DA 3M9OB 5KAKA 4DV0J 5DQIA 1KQFB 3ET6B 4I67A 2E44A 5K8PA 4AD6A 4ZP9A 1AZSB 1OPZA 1WEXA 4F0HA 1S72S 2FD2A 3A8KA 2L9WA 2HFZA 3BQ1A 3VAMA 1RWVB 3MM7A 4B3OB 5HP1B 4H4OA 1HD1A 4ZVTB 5GMEA 4RW6A 2EKNA 3LGMA 1HBUA 4ECQA 2EC2A 2E9TA 1BC6A 1W2IA 3T5KA 4OI3A 1X5OA 3BSCA 1X4HA 4WWSA 2B4PA 2XGPA 2WRMA 4ECYA 3CNQP 4EUVA 1QE1B 2Y8YA 2V0NA 4ZJLA 2O1PA 2J6UA 4ANCA 2XO6A 3PFEA 2B5JA 2CNOB 4Q2LA 3V6HA 1KWMA 2PO4A 1HBUB 3GR1A 1CQNA 3PFOA 4OX8A 3KLFB 2XMTA 1C0UA 4IOAQ 1FNOA 1U2RA 1MSWD 3CJ3A 1QE1A 4NEYA 3KJNB 4QWBA 1YX2A 3ZZOA 2R7TA 3CB4A 2C3YA 3NBPA 4OHXA 4IG3A 3C66A 1LWEB 5M2PA 4X4OA 3IG1A 2OEJA 4OYXA 4KTQA 1HNZJ 2RE1A 2KZMA 3WC0A 2W9CA 2D3UA 3CCMS 5J2QB 1H98A 2RVJA 1QJHA 3CJ5A 2ZJPQ 4FF1A 3UD4P 2A6MA 4ICLB 2BACA 4WZQA 2UUTA 1KTQA 3M6UA 3MD3A 3VALA 2FC9A 2FJVA 1FT8A 1O8BA 2Z30B 1LWEA 4CIOA 2VQEF 3OVBA 2AJ1A 2Y1RI 2MKYA 3PNIA 2HNDB 4LIRA 1VGYA 1WEZA 2CQ4A 2XNQA 3KMQA 2AYMA 5A0YB 5IQ6A 4HH0A 4PWWA 1WDTA 4OV1A 1SBRA 1KOOA 4DL7A 1VYAA 4GMKA 3M8PB 3R6GB 3BN4A 3DFEA 1RT2A 2HQGA 1JLAA 4PYAA 1VK8A 5KFPA 3RB4A 1HA1A 1VRQC 3VQSA 1DZ5A 4R25A 4R0JA 4DL6A 1V3SA 2ZC4A 3QJPA 3U02A 4LQ3A 3PYEA 3HHNB 1D9AA 1FEHA 4YN3B 3H20A 3G9CA 1VHFA 5CHCB 2QMUB 4JUZA 1UJ5A 2WW8A 3IRXA 3Q8YA 3NGDA 1LK7A 2IM3A 4J9KA 5HJYA 5F8NA 4DSIA 1LW2A 1TL1A 4OYWA 1G2EA 2KRBA 3S7RA 2JHEA 4ER8A 4J9LA 4DCJB 2IM1A 3A3NB 2M7SA 3M2VB 4USHA 2FZGB 2JH3A 2R9LA 3E3XA 3SXLA 1FRIA 4RL1A 4HI1A 4DU8A 5KFQA 2OPSA 2XWYA 3ULHA 3LP2B 4DR1J 2DGVA 1P9QC 2FHKA 4QIFA 3VAJA 4ID5B 3VGSA 4DF8A 4RX6A 1KLMB 1XTZA 4OZJA 4ZPVR 3PHTA 1QAYA 3LH2S 1E6VA 2CZVC 3GYXB 4PXDA 1CC8A 5KG1A 4A4JA 3BO3A 5I3UA 1XMQF 3P4UB 4LBIA 5A8RB 4GVBA 2OMOA 5D0HA 2FVRA 1H3DA 4RUHA 1A7GE 2MLYA 2QLJB 5CYQB 1T03A 2XGQA 5CXTA 2KG1A 3TX0A 4OMFG 3VWSA 4K5SA 5ETKA 5KT5A 4ZPCA 2ZKTA 2DHXA 2JVOA 1U1QA 1TZ0A 3GZ7A 4TKTA 1CJKA 1X4DA 2BA9A 2DYAA 2R7SA 1TKXA 5F0UA 4NLSA 4OZ0A 1Q95G 1VCTA 2CQHA 5ITHA 3BR9A 2ERRA 4U8YA 4K2XA 3CUNA 3IBFB 1VK3A 2OPQA 1AFIA 2HGLA 3N01A 4RZRA 2EI5A 2D41A 2AQ4A 1JLQB 5J2NB 4PG7A 2CKWA 1VQ5S 1HYSB 3H4BA 1Y9OA 2AEMA 2MHEA 3DYAB 3H5UA 1YITS 5EX0A 1P1LA 4KH1B 5L38A 3OHBA 3IO1A 3RRHA 2BM1A 4USTA 4WFZA 2IYIA 5L39A 2C2KB 2D7SA 3RAQA 1C4AA 2FZCB 2HVEA 2LLZA 2GMHA 3MOJB 2AW0A 2XTJP 2YBVA 3NY0A 2QGFB 3L9ZA 4USVA 3HJVA 1RBLA 2YKNA 2I38A 3FFIB 3G6VA 1RXOB 4I7FA 2RUSA 5LT5A 1S76D 1DRZA 2QRRA 4ZCKA 2JZ5A 5K9FA 3HHEA 1M5KC 1PYOB 2LCWA 5K5MA 4IFYA 1WORA 5L9XA 4Y2IA 2V8DA 1IKWB 1J2VA 1FX2A 4C98A 3K58A 3OJSA 3PW5A 3HO1A 2HVIA 1R8AA 3OTBA 3QATA 2HVHA 2Q66A 2V50A 3GILA 1TK5A 1IKYA 4DDFA 5B09A 3CJQA 4QW9A 2RD5C 5LMNJ 2B7BB 2W7AA 2GVDA 3D28A 2WVEA 5HLFB 5CYQA 4RNNA 1X5PA 3MTKA 1QD1A 2V6AA 4QPTA 1JLEA 2ROEA 5EGYA 2R7OA 4BC7A 2QT7A 2CQ3A 3CCQS 3CCRS 5L9NA 5LXRA 4B9SA 4D3GA 4G6VB 3PKYA 3KXDA 1E6YB 3FNNA 3IM8A 1QSYA 5LOQA 3W9HA 2MY7A 2ABYA 1S1TA 3F56A 2CQPA 3M05A 3MHYA 3QT5A 2B3TB 2UXBF 2V68A 1YJNS 1XN9A 5F0WA 2AWZA 2HURA 4ELTA 1GAOA 2PMZD 1JNRB 3A8JA 3TZWA 5EWFA 4WFBQ 1YRXA 1S5ZA 2DXEA 4WP8A 3UR0A 2QYCA 3H40A 1YJTA 3LQVA 1NMEB 5A8KB 4Y34A 1OWXA 2MKKA 3QYYA 4IDKB 2V4QA 1D9DA 3X1LB 5J2PB 4KHPF 1X8DA 1XIQA 3HSJA 3RG6A 3CIZA 1LW0A 2XYGB 4I68A 4LF9F 2CQGA 1IQZA 3BBBA 2F8MA 3UFCX 5AE3A 3KFWX 3VGVA 2YWEA 4CO1A 3MR2A 1TK8A 2PFDA 2R4FA 4OV6A 3MXHP 2H5EA 1IBKF 2H3EB 1SXLA 4L3KA 4LR7A 3GIMA 1SC6A 2V2VA 3BH6B 1YHQS 3ADAC 2YH0A 1F5AA 1KTVA 2DRDA 2I5JB 3BKFA 3D68A 4HDHA 2ZDOA 3JTPA 3NGTA 4MIAA 4OI6A 3T6BA 1RCXB 5KG5A 4UZBA 2DIUA 1X0FA 2LFVA 1FWPA 1TV6A 2HNYB 1PKUA 2Z57B 3MFHA 3GIKA 5IM0B 2M3DA 2A0FB 5E3RA 4OI4A 3KG0A 4L76A 3OPKA 2E7XA 3ENQA 4YS2A 2Y1IA 4ZVPB 5AE2A 1WSRA 4DR5J 3FEXB 1S6QB 2YNIA 2P2CB 4HHUA 1K0VA 2J7KA 2GCFA 5ETVA 2BE2B 3D5MA 2HG4A 4U6PA 3I0RB 2WSCC 5LJ3Y 1T03B 1EIYB 4LSLA 1FKPA 1SQEA 3DRSB 4QW8A 3QRQA 4CLKA 2XZDB 4TU8A 2CIMA 4FPIA 4ZP7A 1KRPA 1VQYA 4F7VA 5E2QA 3PO5A 4HVZA 2OI2A 4IH5A 3JSMA 3M2RA 4RNHA 1VDHA 4R8UB 3KTQA 4B9LA 3EGNA 4YDXA 5GAEU 3OTDA 1QVFR 2CPDA 3G86A 4A8WA 1HQEB 2IMOA 1RHKB 2U1AA 4U95A 5K8MA 1PYSB 2QV6A 2D3O1 1VC5A 3TARA 2MMYA 3TJ8A 2RKIB 1ZM3A 3GTYX 1U7LA 1TL5A 2PT0A 3D3BJ 3J7YI 2VQFJ 3N6LA 5F8LA 1K44A 4CCHA 4LMZA 2VL1A 2JC1A 1T9WA 4IQXA 3AFGA 1KFDA 2NS1B 2FUG9 5ETTA 5KG2A 4UOHA 1TMMA 4O44B 3T41A 1YJ9S 2XSJB 4Y65A 3PM9A 3T1YJ 4KFBA 5CABA 1UEUA 1YIJS 2XLJA 4P7VA 2C2ZB 4EBEA 1H7XA 3MR3A 2FLNA 1FXRA 2KFZA 3ILJA 1YJWS 4F4ZA 1RU1A 2VKZG 2DNKA 3VGTA 2ZHBA 4A8OA 1JJ4A 1F1BB 4FF3A 4DR4J 4NA3A 3AA8A 1GFWB 2C22A 5CYMB 1HMVB 5D77A 1N4LA 4KRWA 1BQMA 1R8BA 2IC3A 2KT3A 1SUQA 2YQ1A 3EZOA 4KB7A 5KG4A 5KT2A 4J9NA 4AFFA 4DV4J 2WAQD 3MM8A 3M1VB 4NI2A 3Q89A 2WOMB 3DMJB 3BEGB 1RAAB 3C16B 3HMJG 2K7KA 1DBDA 4NLUA 3GFYA 1QAIA 2HEKA 4J91A 4ZLLA 1FE0A 3EDQB 3M2UB 1PBAA 4U67Q 4RBVA 2XULA 2GVDB 3DCAA 3HFZB 4F8RA 4DU7A 2B4VA 1T9TA 2BE2A 2H4WB 4MKYA 4I2QB 3NMRA 2NQPA 2AU0A 1M5SA 4Y3CA 3C16A 2E1CA 5DZ6A 3IWNC 1RACB 2IA0A 3QIDA 5KFSA 2G1DA 3TVYA 1Q0NA 3F73A 2UU9F 3EVOA 2DCUB 3R8YA 1RQ0A 2P9GA 3SFUA 2BQ3A 2E5JA 5IZHA 5F9LA 3NOCA 1MWYA 3AXKA 4LFBF 2WBRA 1LNQA 3J81Y 1U49A 1N48A 1X4GA 2BE9B 2DBBA 3OXLA 3JYTB 3KK3B 1HNXJ 1B7YB 4KGZB 3I4PA 1X31C 1EKSA 4NCGA 5G0RA 1Q7YT 1KSPA 2B9YA 3K2YA 3UCZP 3ZFVA 1I94F 2EPIA 1DARA 5HI7A 2GZOA 1RTJA 2CADA 2CDRB 2IAJB 2MLZA 1N33J 1QAXA 4D3HA 2DEJA 2ZVSA 3C15A 1RHRB 1RJJA 4NRTA 5GADI 4FS1A 3EWGA 3KNGA 5KT3A 3KLVA 2R7QA 2MJUA 5DO2A 4K59A 3L09A 3R7NB 3IWLA 3CDUA 2LDIA 4C3KA 2IBKA 2YKPA 2VV5A 1Q5VA 4MKBA 1CULA 4QR0A 4C8ZA 1SH3A 4RW7A 1RWMB 3TEGA 1NJIT 3PYDA 1AYEA 4YFUA 2DNPA 4DI6A 4ETZA 3HVWA 3K8WA 3GCWP 3QLHB 3KLHB 1PGZA 3CWJA 1FJEB 2VONA 2GQCA 2K06A 5D15A 3GIJA 2C2OB 2XO7A 4ED6A 3W63A 3QSIA 3MD1A 2MQOA 1CJUA 4FXVA 3W62A 2I2YA 4ZVUB 1HWLA 1ZA2B 4K5RA 3W1YC 3AT1B 4PZVA 3VCDA 4JV1A 2ZZNA 1T9VA 2HIYA 1SJQA 2PDAA 1UW4A 2G9OA 2QSFA 4O3SA 1IM4A 2FHJD 3H0PA 4LVNP 4RNOA 1VRTA 3SZ2A 1JK9B 4X84A 4KGKA 1T3OA 1FD2A 4CT9A 2W2NP 1DHMA 1NK4A 4JI3F 4H4KA 4XDDA 4N7TA 4Z7YA 3J80Y 4G1IA 4KO0A 1WC6A 1KLMA 3ICLA 2VF3A 1NSQA 1NRKA 2HBRB 1NH8A 5AXKA 2QIFA 3MEGA 2M8DB 1KDNA 1SQGA 5LM7E 5A8RA 3TAPA 2CNLB 4MKVA 3OL9A 2WB1D 3W5YA 1TL4A 4ECWA 1FESA 3WX8A 1GMWD 3DLEA 4F2SA 1G7CB 4ANEA 4H4MA 5LMNF 4DUZF 4GKJJ 3LP0B 3V6KA 1Q81T 1N6QB 1BQNB 1YBUA 3GV7B 3PYGA 1FJGJ 4MJKA 2J9CA 2OD4A 5HMZA 1PCAA 3MAQA 2IVYA 4W92B 3K0JA 2DNNA 4ANDA 4ECRA 4G65A 1KR4A 1TKZA 4PXEA 1GEHA 3GONA 5FDLA 1VMBA 4OJHA 3ZZUA 1Z1ZA 1CLFA 1N0VC 4USKA 1DLOA 2MYFA 3DC2A 2E5IA 4BWJA 1B64A 4LUBA 1RYRA 1TK0A 3QLHA 3O1LA 1O51A 1VQLS 3W65A 1NM2A 4IRKA 4N76A 4I64A 1AUSL 1QDUB 4B3OA 2EWHA 1N5YB 2QZ8A 2FPHX 4H4OB 4YHHF 3PEHA 3DOMB 4JV5F 2Z2LA 1OMSA 3CCTA 2RRNA 3LP1A 2VBWA 3VF0B 2D3OR 4C8OA 1SV5A 3D6MB 3ZTQA 4IR9A 1MN9A 1MMNA 2B6AB 4L73A 4U7CA 2E5GA 4DSKA 4HT5A 2G0IA 3IRXB 3G8SA 1NHKL 1K0TA 5F8GA 5LMUJ 5HO4A 3CC4S 3IP0A 1S0MA 4DL0C 2HHHJ 4B3MF 1GK8A 5T7LA 2RT3A 2KYZA 4NE9C 3MM5A 3Q2TC 1HNIB 1JQGA 1V5VA 5E3QA 3MR7A 2JEFA 5IWAF 5D3GB 2UXDJ 5H9FK 1X4CA 3UWTA 1WOPA 2CJQA 1U4BA 1YK9A 2ZC3A 3RBXA 1I1GA 3DM2B 3FUYA 1HD0A 3D0HE 2GIRA 3JSBA 3M32B 5DDOC 4NLPA 4P6QA 4K0KF 1R31A 1ZAWA 3DRRA 1WF2A 4XTTA 3PVXA 2L3MA 4CLUA 4Q5VA 4AL5A 1UFLA 1HNIA 2H5IB 3GSIA 1GXTA 1NPRA 4ID5A 5MAOA 2ASLA 2LXFA 1S9GB 4YDDB 3IBCB 4CM0A 2ZH1A 1YZ7A 1BY9A 1HHQA 1Q79A 3H5SA 4WU2A 3OUYA 3D1QA 1Z2ZA 2HRUA 3HVTB 4C6AA 3S8SA 1VC6A 3CC7S 1T3NA 1HARA 1S59A 4IQMA 4TYAA 3HT0A 2R8IA 4CLPA 5ETOA 1J5OB 4G1QB 1U0HA 5ETQA 4DR2J 1XNQF 1N36J 3QT8A 1JMTA 4EU0A 3PRVA 4DOZA 4LF5F 1XQIA 1TKZB 1FK9B 4X65F 4X64J 1NK5A 2KXHA 1C2PA 1FRXA 2F63A 3ZZRA 4W90B 3EXCX 3HI9A 4IUFA 1JXVA 2KKHA 3MM6A 4UQGA 3IGVA 4B08A 4G1QA 3BM7A 5B0BA 1OQ6A 1FKOB 4B3SF 4ELVA 4IOBA 3FKBA 4ILRA 4WFYA 5L8RC 4DPOA 4K4YA 5FLXU 4ED1A 1XR7A 3GB0A 1WHYA 4PKDB 3KWMA 1IXKA 4UTGA 2VASA 2AJ0A 1YBTA 3MURP 2PD1A 3VAIA 3I9V9 5B0DA 1X9MA 3I87A 5I42A 1T0TV 2LVWA 1WELA 2RRBA 1YZ6A 2V2KA 3GJSB 1XMOF 1YSJA 2DGXA 2UUCF 2YNGB 4WCEQ 1SJFA 4LF4F 3V2UC 4LFCF 2APOA 1CC7A 1NH7A 5A8WA 2HVDA 1TU0B 2VA2A 1WJ9A 3D1HA 2ROGA 1H74A 2CPEA 3I32A 1VIOA 3U1MA 3G71S 1Y0HA 4M5JA 3OW2R 3W3SA 5C2GA 1K9MT 5GVQA 3HSZA 1N88A 3F0NA 1NHVA 4DL4A 3AD8C 1JJHA 2FVSA 2WVFA 2OO4A 2MGZB 5J1NA 3POTB 2ZEJA 2CDQA 1U1KA 2Y3YA 2UVWA 5I3PA 5T41A 3SV4A 2B0GA 4DQSA 1VQ9S 4Q8EA 2AZ3A 1VI7A 3K7RA 2CPFA 1N34J 3KHLA 4TQSA 2BXJA 4DR3J 2FY8A 4USJC 1RHMB 4F4YA 3PX0A 3PW4A 3CCZA 3DHXA 2K8GA 4HLBA 5CAAA 1HNZF 2POKA 4NLYA 4Q44A 3UR3C 2OFGX 2BMBA 4X62J 1RYSA 1IJFB 5AXMA 4C48A 5DGAA 1RUSA 3H98A 1UPPA 4PUOA 1RWPB 1XMBA 3T5HA 2QEXS 1VQ7S 1W26A 4F2RA 3BYPA 4DWIA 2RKIA 2LEPA 4NLVA 1UW9A 2BJ7A 2DR6A 3MM6B 4OZ5A 3LO3A 5GAGU 4DV4F 3D67A 4LBPA 2DCLA 1N5YA 2Q1LA 4YR0A 3SYZA 2LYVA 5BYQA 4RW6B 4LBHA 4ZPBA 2COLA 4K4WA 3ELHA 1VC0A 4PAAA 2VC0A 3VVUA 1ICEB 4FVCA 4RR5A 3GCXP 5GADU 1R8HA 3D54A 4I56A 1HNVA 3HKZD 5IXUA 1Q8KA 1T94A 3LW5C 5IS2A 2XY6A 3DI6B 2AGPA 4ED2A 3CCLS 5LXYA 1CPZA 3RAMA 4ZP8A 4U8VA 4WBFA 1HBOA 4NRUA 2CPHA 1F9FA 1UFWA 1B4SA 1YI2S 1S1XB 5KFTA 1FRMA 2AF6A 2BYCA 2V4RA 3DHWC 4PQUA 3KHGA 1U09A 2YWWA 4C4WA 4B9VA 3NNHA 3M6WA 4EK2A 3SQGB 2EXUA 3OR1A 2WHOA 1AROP 5F3TA 1HQ2A 1X4BA 3W2VB 5HMWA 4RUCA 4RBUA 3ISND 2UZAA 4TY8B 3FBFA 3OVAA 3BGOP 2ZD1A 1RHUB 1ZAXA 2Z0GA 3T5LA 2XMAA 3I5BA 2ADBA 2HFSA 3TA1A 4KSEB 1S4EA 1A0OB 2YKQA 1D8ZA 3K57A 1RAIB 3HVAA 2DGUA 2FQQB 2ZDPA 4F25A 3LPYA 4OZ2A 3G82A 3HD2A 3MEKA 4FYYB 4NL5A 2HZVA 4C8YA 1JLCB 3IMQJ 2XC9A 4AL6A 2DR9A 2M8HA 3W2WB 4CLYA 5K20B 3KUEA 3RTVA 4JBCA 3J7AN 1WHWA 4V1Ak 4DV5J 2ASDA 2C2MB 2ZE2A 2CWXA 1LWFB 3G82B 1VQNS 3H2UB 3T3FA 4LF8F 3QMQA 2MKIA 4C0BA 4PEOA 3HP6A 2AJ2A 2BE7D 2WBMA 1FO1A 1WWHA 4C8NA 2P9EA 9ATCB 3THTA 4WZMA 3ZZPA 1RWUA 2X51A 3H4DA 5DDQC 1U02A 2HFUA 3ITHB 4QYRA 5J1EB 1S0NA 1EB0A 1N34F 4DQPA 1J5EJ 3ILOA 4K4SA 2DNQA 3KHRA 3VAHA 4PYDA 2GW8A 1G3OA 3TVKA 1RBAA 3CCES 1OJ4A 2OSQA 4HTJA 4BS2A 3LAKA 2ATLA 2I0XA 5KG7A 5KFDA 1UEKA 1VQ8S 2B9XA 4ECUA 1VS3A 1F2HA 2DISA 2ZH2A 5GAEI 1U2FA 2W9BB 1IKVA 2FVPA 2DY1A 2F4FA 3W2VA 4CRJA 2OMLA 3POTA 3TUPA 4LF4J 3DOKA 4A8KA 4DS5A 4JOUA 4OJGA 4TNOA 2DGSA 5I3UB 1NSPA 4MK7A 3HVRA 5CD4A 4QYZK 5F8MA 1H0HB 5AT1B 4ZJOA 1S7HA 3AJ2A 3T1AA 5RUBA 2AP6A 1YWXA 1KEKA 3DU6A 1PO6A 4AXIA 3MGJA 3NMAA 1FNMA 2HFVA 3GFHA 4XIUA 5CCMA 3C14B 1SL1A 1FX4A 1LWCB 2HRYA 3R5BA 1UTAA 2NXNA 4U96A 2O66A 5K14A 4O4GB 2AYGA 3W5XA 2RH3A 3IS9B 2O3DA 3NS7B 1RE1B 4ALZA 4DR2F 1RAJA 1Q86T 4B3RJ 1TL7B 2XBPA 4WK1A 1EETB 2J8SA 2ZUGA 2XI2A 3MDFA 1IBLJ 2Z2MA 1OY9A 2OIHA 2XS5A 3M6XA 4CO4A 1OPIA 4QCLA 4K50A 1S49A 2XSFA 2HLUA 3PACA 1R0CB 1UCNA 2AJFE 4UOFA 3TZXA 4QWAA 4J9SA 1U1NA 1S57A 3M8QA 3KLIA 1N36F 2IHR1 2QTWA 4CNZA 1WKLA 3TAMA 3DYAA 5FDLB 2IVFB 1GXUA 4JI1J 4LSNB 3OL8A 1RTJB 4Z7CA 3V81A 4J9PA 1RT5B 4ZPWR 4EBCA 3TA2A 4L74A 1M5VC 1MLAA 3GMGA 2M9KA 3LWLA 3CCSS 2ZVIA 4YMEA 2BKNA 3GYGA 4RPFA 2R7UA 4WKYA 2RAQA 4TQRA 4OI1A 4Y0FA 4Y28C 4PG6A 1RWWB 1W25A 2W2QP 5C5JA 4QWCA 2W9BA 3B82A 1NK6A 3OFHA 1PIEA 1VRUA 4KGVB 4MFBB 4QQBA 1KC8T 5F8HA 1RU2A 2FLPA 2BJ9A 1RT6B 2DNZA 4F26A 3DOKB 1WSVA 2B7CB 3DMJA 3AA9A 1IR1A 2X3GA 4UOCA 5IT0A 3RBEA 1DQ8A 3RR7A 1X4AA 5EUHA 2YH1A 1H7WA 1GTHA 1KFSA 1LXNA 5D3GA 1IKYB 4J90A 2VPYB 3ONQA 4FN5A 4QPXA 3PRDA 3LGNA 4X4QA 2NSBA 3K5OA 3TQ1A 3NCPA 2YX7A 3I4HX 4WYLA 1AB8A 3CE8A 2NXEA 3CDEA 5KFZA 5K8NA 3IAM9 3R6LB 3QZ8A 2XCPA 2ZH4A 1S97A 2PIIA 3ETMA 3TANA 3SCLE 3GJRB 3R5GA 2BBEA 1FWKA 3OR2B 4QWEA 4Q7AA 1B3TA 1U26A 3W5ZA 5E5NA 1LWFA 2PMHA 1JKHB 1C1BA 4LF2A 4PWUA 3V4MA 1TR0A 2DD8S 5HL7Q 3D4JA 4J9VA 4KBIA 1J5OA 3FRYA 2ZNZA 3JSYA 4J7CA 4CNYA 1HNWJ 4N8NA 5CCLA 4GVLA 2DNHA 5ETLA 1TKTB 4CH7A 2FHJA 2CZ4A 1FK9A 3Q8RB 1WTBA 1NKBA 1G6BA 1KOHA 3PG9A 2BOPA 4J9MA 4DUZJ 4GKJF 2X1BA 1U6BA 1WOSA 3MCSA 4HR2A 2JLEA 4ID8A 2C28A 1RAFB 3C15B 3CJ0A 4Y2MA 1P6TA 1S6UA 5E3AA 3J7Z5 2HSEB 5CZXA 1CSJA 4FXDA 3BR8A 4F3MA 5GAGI 5HMYA 1V5IB 2XZWA 5KT7A 2XY5A 5C25A 3G8QA 5ETRA 2DHHA 2VD3A 4BWMA 4AYBD 1VLYA 2GVZA 2J9DE 2NUUG 1LK5A 3C6TA 3MM9A 3CJKB 3MMAA 4ZHRB 3IN5A 4ILLA 5DG7A 2RDIA 3CJ2A 3W8PA 7FDRA 3D6HB 1NK8A 2DPIA 2UUBF 1NU4A 4ZCIA 1HIYA 1SIZA 2DKOB 1SPBP 1D1UA 3GP9A 2LEAA 3EPIA 1DAXA 4YY3J 3W9JA 5FD1A 4P2SA 2NREA 3SI8A 1UP1A 2G2YA 1SC1B 1GX5A 1TTHB 4KO0B 4OFZA 2IC3B 4EWTA 3RB3A 3DN9A 1VQ6S 3CGIA 4LSLB 3NAIA 5KFBA 5DLFA 5F8IA 2Y0BB 2BW2A 3LAMA 5JXSA 2IVMA 1P27B 2DTJA 5HROA 2R42A 2BQUA 4GRSA 4L3NA 4F4XA 1JB0C 4DV1J 2PGCA 5HANA 2L9DA 3QGIA 4NA2A 3PXGa 2KZZA 2XLKA 1XK8A 2VFRA 4KKOB 3WIVA 4DPYA 4DV7J 2V8VA 3MPDA 1Q53A 4WXWA 3ZC4A 3P49B 4NLDA 4DLEA 3DLBA 2UXBJ 3H90A 1EX8A 1NHUA 2KI2A 3EZUA 3BYRA 2KM8C 4I2PB 7AT1B 1VQMS 4BBYA 1Y3KA 2BKOA 1H2VZ 3B8HA 3UDVA 5HN0A 4DFPA 2MY8A 4O44A 2KN4A 3M8PA 1KVJA 4DFKA 1C1CA 2QG9B 2BOAA 4NOHA 1U1LA 2BRKA 2ADCA 4BC9A 4HACB 4RO0A 4LFBJ 2NPIA 2YPZA 2GO8A 3BH7B 2LKZA 2UUAF 4JI7J 2JL9A 2X1FA 2DR7A 1B0PA 4KGXB 3UPFA 4B3TJ 4FBUA 3B6BA 4IO9Q 5F8JA 2P9CA 2GGPB 8ATCB 2MKSA 5F41A 1XERA 2F40A 2C1EB 5HP1A 2OJ3A 2K1RA 3MECB 3G87A 2JVRA 1TP7A 4ZCMA 5C7PA 3J81j 3T1HJ 1SL0A 2AKWB 3FCWA 4OYAA 1JXEA 1RBOB 2HBQB 2IJNA 1MG7A 1VIXA 1WOOA 2KFNA 5KG3A 4JI5F 4ZN1A 1RWKB 2GGPA 1PC4A 4RNFA 3QGHA 4G3IA 2OPSB 2XMKA 2CQCA 3B54A 4I2QA 4DV2F 3S01A 1FFSB 1VISA 1AT1B 3ISZA 2FJEB 3SFGA 3FMBA 4NLGA 2E5HA 2VDHA 2HLTA 1KD1T 4JI1F 5B0AA 1Y3JA 4M94A 4ED7A 2CQ1A 3I31A 2XS7A 3ILLA 1RWNB 3M8ZA 2MQPA 3FSYA 1YQHA 3R1HA 4ED8A 5FLXY 2HBYB 2VKRA 1SKWA 3AODA 4IKAA 1JNZB 1RISA 3SSQA 2M2BA 1Q8BA 1ROFA 4C3LA 2CWKA 5KFRA 2VA3A 3QT7A 3US5A 2BM0A 2UVUA 3WBZA 3JXOA 3EM1A 2QFJA 3EE3A 4FKXA 1IBMF 1TQLA 2CJAA 1AZSA 2MQNA 2QX0A 2V5HG 3J80U 5FIIA 4PPDA 2ZE2B 2ZH7A 2FLLA 4GKKF 1WHXA 2HBZB 3BSNA 4DXLA 1S79A 1R8CA 4UUWA 1LW2B 3SSSA 5LSLA 1LFWA 2CA9A 3MTJA 4NX9A 2OPQB 1H2UX 2Q79A 4K4TA 2UVVA 1VBKA 3TAQA 1FE4A 1CJTB 1F6TA 1S1VA 2LP4A 3BO2A 3IGNA 2E29A 4ZVFA 1OO0B 2IPOB 2E7WA 3AXMA 3OXGA 3TR5A 4I0WA 4YR3A 2XLIA 3UCUP 4CLZA 2FC8A 4DL3A 1G4CA 3OTOF 2Y9HA 5B0CA 4MK9A 4P7TA 3M8WA 3KJVB 3EYZA 2ZBRA 3HHLB 2K1RB 4TN2A 5DLGA 2KH9A 2RQCA 1YJ7A 2FDNA 2QJ3A 3MM5B 3FK4A 4NYOA 1U6ZA 5HBMA 1YDLA 2LMIA 1MN7A 1Y4ZB 2YX1A 4KYZA 3KYLA 3IAS9 3BN7A 1B0VA 2Q3PA 3DM2A 3LA0A 4HI2A 1BGXT 2MKHA 3ZO7A 1HHTP 1IKXA 2NCKL 3IC1A 3VVTA 1OIAA 4CTAB 1WKKA 4DBQA 4CO3A 1EQ0A 2RF2B 2B9WA 3CO0P 2QA4S 1I3OB 1IKWA 2IA6A 4ZIWA 4RW4A 3OL7A 2HQFA 1F0XA 2WVCA 3GFXA 2WSEC 5HVGA 5J2QA 2KDOA 1FNXH 4DSJA 3QIPA 4KV8A 3LF0A 1WC5A 2RU3A 3CJSA 4WFNQ 5THWA 3CF5Q 1R0AB 2ZOGA 5B7WA 3Q8UA 3FEYB 4U7UD 1GMVA 1OYDA 2OGUA 2QLBB 3DXSX 3R3TA 2LA4A 2MJNA 2MSTA 4JI8F 4X62F 4EI2A 5E7OB 3KK1A 1NPKA 3G4SS 1HBMA 2XCAA 4JYAJ 2HHQA 2MZTA 3NLCA 3WQPA 3LOUA 1OS5A 2HWHA 2V4JB 3FJ2A 3VZIA 4EO6A 2W9AA 1QUVA 1JWWA 2W1BA 1YJVA 1N56A 1ITPA 3TP2A 1URRA 1FHTA 4ATNA 4PUOB 3NXZA 4ILMA 2VH7A 1XEZA 3SCIE 5D8HB 3TUZC 3HVTA 5A8KA 2H51B 2J6TA 2Z4PA 2XYPB 3PRBA 2KJWA 3CW2C 1H6KX 2CXEA 3DLKA 2ZUAA 4QWDA 1M0SA 3AQOA 3HHKA 4ES2A 1UA1A 3PY8A 1SB6A 4C11A 2GAGC 2HZCA 2CPJA 5HJXA 3W60A 3PYFA 3MECA 4DX5A 4ECZA 4RW9A 1WF0A 5A8WB 5KFHA 4X4TA 3MUVP 1DTQA 1GQEA 4FYVB 4F3OA 4LFCJ 2ILYA 5HBMB 4LR8A 3W8GA 4RWXA 1K8AT 2UUCJ 2YNHB 1HI8A 3D0GE 1SH2A 5LJ5Y 3DLLQ 3NG8A 4IH6A 2CVEA 1NK7A 2ZZTA 3EVMA 4A8FA 3OR1B 2VB6A 5T7LB 3U1LA 5HSPA 1PJ5A 4X4PA 3SBMA 3PX6A 4A8SA 1EP4A 4DG1A 5EX3A 3BQ2A 1XC9A 2W9CB 1BWVA 1M1GA 3ZTOA 5CH7B 2ZFHA 1WC3A 1FRKA 3I96A 1E6VB 3UO0A 4CO0A 5B08A 5DQGA 2RDJA 1RA6A 2MQLA 3V6DA 2HGMA 3GE9A 1S6QA 4BCAA 3R7SB 4P52A 2MB0B 2R2SA 3O5TB 4CDIA 1EQMA 2WW4A 4ECXA 4H4KC 3WZ0A 2V34A 4I6YA 2C2DA 4B02A 3K17A 3GV8B 1XNQJ 2J9DA 1SJ1A 1RWXB 5K8OA 2L41A 2JEIA 2UUBJ 2DK2A 2DT9A 2W4DA 3H5XA 2LECA 2G1HA 1LW0B 1N5VA 3UN5A 1S10A 3D66A 1JLCA 2D3ZA 3LPEA 3UD3P 1PBUA 1A9NB 3QJLA 2R7VA 3NGKA 2EKYA 1NDKA 5C24B 1TKTA 1S6PA 4FF4A 1N5SA 3BO4A 1S1TB 4MYTA 3EX7B 4NXMF 3HM9A 4DF4A 2UXDF 2H9ZA 3X3UA 2XSJA 3RB0A 3D6FB 4I6AA 2MPUA 1RK8A 4J37A 1WF1A 3VAKA 2DITA 4FYXB 2W8KA 2GHPA 1RCOB 1UVNA 2MTLA 4LIWA 3QWPA 4M5NA 4NMLA 2HHWA 1BHNA 1CBKA 2L08A 3TW0A 4N77A 4ELUA 1IKVB 1SJRA 3P96A 3O3LA 2ACYA 1D9FA 2EG1A 3P45B 4K7QA 4Y2CA 1JJ2R 5I3QA 2HK3A 1TAQA 2CRLA 1ZOTA 4NZ6A 1VBYA 2H54B 2JLGA 2DRBA 3UN2A 1SCJB 1ZZNA 2JFKA 1W7WA 4CP5A 2KM8B 3DI6A 2OD6A 4EZ6A 4GVBB 2ZBPA 1L3SA 3LANA 3MFIA 3Q8VA 3R9LA 1H2TZ 1RT7A 1WC0A 4MTPA 3CJ4A 4E0DA 1XNRF 3UE2A 1HPZA 3BKUA 1R6YA 3B4MA 1MROB 2LU2A 1UJ4A 3MPWA 2W4CA 3OTOJ 1N5QA 2G2ZA 1RHQB 2I9SA 4DV1F 2R7XA 1PJ6A 3HCXA 1HLWA 1FDDA 5JJBA 2GIQA 4C0HA 2FHMA 2EBEA 1U45A 2CJKA 3VHQA 2AT1B 3OVSA 2KT5A 3CCVS 2BANB 2FLOA 2M88A 2PEHA 1U8WA 1HFEL 4F4AA 1X5SA 4RBTA 1JLQA 4XK8C 1FA0A 2V94A 4LFAJ 1HYSA 2OPPA 3OR2A 5MLCV 2LA6A 3LGHA 3TAMB 2DR8A 1TUGB 1CEZA 4M5MA 1FJCA 2PFFB 5SUHA 4N8OA 3WDOA 1RAHB 4ED3A 3CDWA 3JTNA 4DMZA 2OAUA 2OELA 4NWBA 3GFZA 5HQMA 3VQTA 4JI3J 1UJ6A 3DGVA 1DTQB 3GU0A 2AEFA 2JFDA 3EVWA 1F3FA 4Y2KA 1TUVA 3SCJE 5KG0A 2VQEJ 3BQ0A 1BLUA 3CD5A 3BV8A 4P73A 3T6JA 2P5VA 3KUHA 4J9UE 5AXNA 3FRZA 1RI7A 3QRPA 1X5TA 2OEMA 1TL3B 3BDEA 3NCQA 4M1KA 4DLGA 1GH8A 4B3MJ 2HHHF 2AMCB 1ZZFA 3QSYB 1EP4B 4DG1B 2C2RA 4ZVGA 2HWIA 1KQSR 3BDPA 1UVMA 3HHDA 4I69A 1Q7LB 4DR7F 2GJ2A 1UL3A 4QU7A 2LDYA 5EDWA 3BGRA 3ITHA 1K47A 2HFOA 1T9YA 2MQMA 3B4DA 3CDAA 3HLUA 4ENOA 1P8GA 4FXWA 3LP2A 5BR8F 3A3PB 2OUGA 3JS9A 4QJVA 4F36A 1UPMB 2HS4A 3EDRB 4MFBA 2FJDB 4OZNA 4P9SA 2YNFB 3NP5A 3RGIA 4DUTA 4PG8A 3O6QA 2EK1A 5HLFA 5C42B 3E01A 4LRCA 2VBZA 2N7CA 2YKAA 4ZKAA 4YB1P 2A2CA 4UQTA 1JLBA 4KR0B 1RP5A 2FIUA 2KO1A 2CNNB 4CLWA 4J9RA 2M52A 1UETA 2WONB 1UA0A 2OPRA 1RLCL 1RT4B 2R3VA 2PSZA 3I9ZA 3IXQA 4E8UA 2UUAJ 4JI7F 2C3MA 4M63A 4LT6A 1OY8A 3HHLC 3FQLA 1FJGF 2A1BA 3NOGA 2BANA 1AW0A 1FRHA 2W2MP 3TWZA 2N3OA 1F2GA 1WG5A 4ECSA 2Z2YB 1VQPS 1DQAA 3NRBA 5L46A 2JJ4D 2JEJA 3A4TA 4AQYJ 5ETNA 4DUYF 5H1SV 4WIQA 1N6QA 2IM0A 3Q22A 3SEOA 4W4MA 2E1PA 2UV8G 1HWUA 5M2RA 5T14A 3KK3A 4DV3F 1I6JA 3N5FA 4ECVA 3QZ7A 1DTTB 1T8EA 4NA1A 5BYSA 4YOEA 2HWTA 2DNYA 5KFAA 5HQLA 2ROPA 3PJWA 3KG4A 4WIIA 4DX7A 4JYAF 1K1SA 2MDAA 1NJXA 1YJUA 3LALA 1NNDA 3MMAB 2MSSA 1PC5A 3M30A 1HW8A 3MEEA 3OFEA 3RJMB 3TRGA 5DG9A 3LWMA 4TLQA 3DRYA 2G0CA 1RTIB 1QVGR 2YX4A 4NI2B 3W9IA 2GJIA 2QLFB 3AY0A 2CZ9A 3IA0A 2ZHAA 4JI4F 2BJ3A 4KIAA 4MMOA 3S1TA 2CJXB 4JI4J 2CVIA 3RW7A 2D74B 4AT1B 5KFNA 2FVQA 4IR1A 1FDAA 4NEZA 2CAJA 2K7JA 3L3CA 1RTIA 2V8PA 1JXLA 2GO9A 1KVIA 3P6YC 5GAHU 2F8EX 5A76A 2GV1A 1PILA 1JLGB 2WONA 1O5JA 1Y7PA 2AX0A 3Q8SB 3OTCA 5HK4A 2KJVA 2CQBA 2YQ0A 2CPZA 3MCOA 3M6VA 3PR5B 2ZOFA 1U48A 1C1BB 1NZ8A 1T95A 1WEYA 4KV8B 2HQ3A 2CNKB 4ECTA 2VG5B 2FGOA 3R2CJ 1ZM9A 2KVIA 1QTMA 1EAYC 4HTIA 4LFAF 1N32J 2VJVA 4DUYJ 4AQYF 1HI0P 2FY1A 3GPAA 3MMBA 1VOMA 4N41A 2HPUA 1Q1KA 3CD0A 3QFWA 1CJKB 1RWOB 2VZ9A 3NS6A 2WB4A 2ZJRQ 4ES3A 3EJMA 1VQSA 3P5TL 3N6MA 1MU2A 1UKUA 5ADZA 2DY9A 3C8YA 4OYIA 2QA4G 2DIVA 4M5HA 3A12A 1R0BG 3O44A 5J2PA 4JV2A 1RADB 2BRLA 3KNAA 1JKHA 5D0EA 3M8YA 5CD4H 2EFVA 4FPRA 1CG2A 2RU9A 2VHGA 2B56A 5BJRA 2DGOA 1C0TB 3KKFA 4TY9A 4DN0A 3S6EA 3TOQA 3PX4A 2GHWA 4C0OC 5HVHA 2CG8A 2G2OA 2IDLA 4WXOA 5BR8J 4DQRA 4X4SA 4WF9Q 3MR5A 2VG6A 3FCHA 3G6YA 4QR1A 3I55S 1N8RT 1FCAA 2OEKA 2YVSA 4DR7J 1FVQA 2HQIA 5IM0A 3KJVA 2ILZA 4FNHA 1Z4UA 3IBWA 3BJYA 2VICA 2ZITA 1LXJA 3QAEA 4KQZA 5DG8A 4OHVA 1AFJA 2B4UA 3JQKA 3G6XA 5H9FJ 3V5RA 1U1PA 1F9EB 4DV5F 1WACA 1SQFA 3KLFA 2YNIB 2XMWA 2N7YA 1GMWA 2DNOA 2EFQA 5LSRA 3V81B 2MLXA 3D3CJ 3HPOA 4EBDA 4KT0C 1ZETA 3CJTA 4OYPA 3OV7A 2HHTA 4NMXA 4NYPA 1URNA 2HHPA 1FF2A 3Q86A 2HAIA 4X4RA 3FCVA 4UF4A 1MW7A 1UWBB 3E51A 4DPUA 3QT6A 4M95A 4QU6A 3MMBB 4MYUA 3CVKA 4DPWA 4I2PA 4USUA 3CC2S 4UY8T 3QRRA 8RUCA 3NGUA 4CI0B 3TI0A 3MMCB 4C8LA 2DB1A 1R0AA 4ZOSA 1FKOA 5HROB 4LRAA 1MWQA 1N52B 3R97A 3AJ1A 3BGUA 1X7VA 2QYGA 1YRTA 3MM7B 3RBZA 4Q8FA 1QLNA 1TVRA 4RKUC 2KFYA 5C2CA 3PZPA 1FRLA 4RUAA 1IBLF 2DGTA 3PW0A 1VFJA 2NYIA 3DRPA 4M5IA 2Y1JA 3DXBA 2JLFA 1ZTTA 1L3TA 2WVBA 3VZHA 1XNRJ 4GO7X 4ETXA 1Y5LB 3SQOP 5J2MA 4F02A 2KU7A 4HKQA 2VPWB 3KLEA 1B7FA 3MAAA 5AJ3J 3Q23A 2PMWA 3HT3A 4DR5F 2EEYA 2VPZB 4F4WA 3MM9B 3CJKA 2ASJA 2IY5B 4OJ3A 3W66A 1X9SA 1R3NA 3I82A 2H48B 3RU0A 2HHSA 1WTFA 3HFKA 3SDEB 1WKJA 3I6PA 2LXIA 3HHLA 2LQ8A 3EICA 1Y10A 2Q43A 1I5OB 4IG3B 3Q8QB 3M9NB 3CJRA 3HXMA 2R8JA 2J7WA 2VG7B 4LF7J 2E7VA 4OLOA 1S1XA 1HWKA 1B0TA 2FYXA 2JRSA 1JJCB 3CJ8A 3M4XA 3ZNJ1 1W2BR 1IBKJ 3W7BA 2DGWA 1R8PA 3M7VA 2GX8A 3TZZA 3UDLA 1D8YA 5IC4B 7FD1A 4O3OA 3KMSA 3BSAA 2GNKA 3NL0A 4TLRA 4DFMA 1SJ4P 2X7IA 4MKAA 1FTCA 4Y6IA 2RSQA 4DZ6A 3KLGB 1X4EA 3DRXA 6FD1A 5D78A 2HVZA 2XMUA 2N3LA 4CWBA 2ASYA 4ZVHA 3K5MA 3MMCA 2XB2D 2F7VA 1OSDA 2V4JA 4KKOA 4DV6J 1X0PA 1BXNA 1U0HB 2EK6A 3KUGA 4QIVA 5EN1A 3H59A 2WZ1A 2VJUA 1V3RA 1FWLA 3GYNA 4ZLPA 1HBNB 2XQCA 3GSDA 3FVYA 3GJTB 4LF1A 4LJMA 2BR0A 1UVJA 2HAFA 2DHGA 2XM3A 2KT2A 3I0SA 4HH1A 4EZ9A 2DEIA 3T19A 4LF7F 4OX9J 5FJ4A 1L3UA 3EUNA 1FDNA 4FNIA 4C7QA 2AV5A 1HI1A 5BYRA 3VAGA 5D0RA 3NS5A 4OQJA 1UAWA 1NAQA 2W01A 1HBNA 3ZZTA 5KFWA 4LRBA 1HBOB 3RBDA 1MWZA 5A6PA 2RB7A 1NKEA 1M5OC 1IJEB 5ETSA 2XS2A 4DX8H 1RB0A 2EBGA 5KFJA 4P71A 5HQ8A 3UW1A 2V9WA 4DR6F 1Q16B 4X2BA 3PIOQ 4I6WA 1NLKL 5D4PA 2YNGA 2I6WA 5CYMA 1SC4B 5ETPA 1RA7A 2CYYA 3MPVA 4RW9B 2AGQA 1S1UB 2OFHX 1EJ7L 4ZCLA 1RTHA 2K3IA 1NDPA 1CJTA 1S1VB 3Q83A 4Q2MA 5DZ7A 3MM8B 3A1YG 4XDCA 4ZVQB 3GIIA 5KFYA 2YNHA 4LVOP 1C0UB 4USWA 3G2XA 5KFEA 3EZ5A 2I5JA 3PEJA 3FZBA 4FZVA 5DRKA 1SL2A 1S1WB 3NBPB 1SVDA 1KN6A 3M2UA 2CJBA 3Q2SC 2HK2A 3MUMP 2D1CA 4P10A 3E01B 2BVZA 1AXQA 3KK1B 3RRGA 3VGUA 4K4UA 1VJQA 2VFTA 1HBMB 4GKKJ 2PE8A 3K5NA 1NK0A 4ZS6A 3KJQB 1IKXB 1WHVA 4F3QA 2L48A 4QIWD 2F4VJ 2HW3A 4L6V3 1LWCA 3CTRA 5AXLA 3GJQB 1U6FA 1FDBA 4RW4B 5K14B 4CO5A 4K0KJ 1D09B 1RABB 1J27A 2DJWA 5J2NA 1WG4A 5U47A 5IT4A 4WYWA 4JI8J 2V8HA 1RZMA 1TL7A 1U2CA 1E6YA 4PR6A 4HL9A 2NXUA 2UV8A 3UI3A 5IWAJ 1RT2B 4C8KA 4RUBA 1CS4A 4UUXA 5L1KA 2RS2A 1XWLA 4DS4A 2BABA 4MAKA 3J7A1 1F60B 1KS2A 3OL6A 4R5PA 2DHAA 2FTRA 3GG1A 2Q6CA 2C42A 1XMQJ 1RTDA 2V63A 1Y11A 4IOCQ 4DCOB 3QJJA 2P6SA 4WP9A 4LREA 2KL8A 4CO2A 4RW8A 4DR3F 1IM6A 4W98A 1YBAA 3J7YU 1Y5NB 4U9RA 4DR1F 2FVCA 2X3DA 3RB6A 2LQJA 4ZMMA 3OTEA 3TUJC 5B0GA 4LQ9A 3L4BC 3JSRA 1V3ZA 1ACMB 2B6AA 4IO1A 4HHHA 1SI9A 3MAHA 2V67A 4PQUB 2JOQA 4TYBA 1ZM2A 4PG4A 5J1EA 4B3TF 2VC1A 3ZZ0A 3F44A 2WSFC 1T7PA 2R2TA 5HAOA 4E98A 1TKDA 1FVSA 4B17A 4NCBA 3A8IA 4DQIA 2RIJA 3W64A 2IBOA 5KT6A 3EGZA 4RU9A 2IJFA 4KH0B 2AYEA 2HRTA 3BKTA 1BMQB 3BPDA 3HSGA 6FDRA 3D2WA 1M1KT 2AYBA 2PI4A 4QZVB 4F0KA 3FZ2A 1T02A 2F8HA 2E66A 4A47A 2JSXA 2ZBIA 3CT9A 5KFMA 5H9EJ 2YNFA 4OZLA 2EFPA 2BUNA 1OY6A 2VFVA 4OYZA 4WPAA 2N4DA 3DLJA 2VPXB 1YTYA 2J76E 1P1TA 2R2RA 3BPSP 1JLBB 1YG0A 3M9MB 1IBMJ 4NXNF 3M8QB 3BS9A 4B9UA 4IH7A 3SSRA 4DQQA 3JSMB 3DLEB 4P74A 5KFLA 2N82B 2C3UA 2VFUA 3HDSA 2UUWA 2NXCA 3ENAA 3QNWB 1B99A 1U25A 3AD7C 4L72B 4ZVEA 4M5LA 4CYUB 3I56S 2UVRA 1BQNA 3R5JB 2W2PP 2XMVA 3ZXWA 1SH0A 5G4DA 2XZTB 3CXCR 4DSFA 1NCLA 3IS9A 2HQCA 4NCGB 5G0RB 4ZK7M 2OTJS 4NZ0A 4UOGA 3OSPA 2D9OA 3QGPA 3UCGA 5L1JA 3QFHA 1A6LA 4A46A 4ZVRB 2BV3A 1R27B 4DFJA 1YRUA 5ETMA 4C3MA 4DV2J 4ERDA 4M5KA 1VRUB 4ZP6A 2O5DA 3CIMA 3H2LA 4YY3F 2EVZA 4ITSA 3N28A 1DTTA 4JI5J 2PA3A 3WHIA 3PJXA 2H4YB 4KJIA 2MQ8A 4LSNA 1VLOA 3CCWA 1CULB 1NKCA 1VBZA 2AEJA 2RJZA 5KFFA 2C2EA 3MR6A 2BX6A 4ZHRA 3I5AA 1SUQB 3PR4A 3C6UB 3DLHA 2AHOB 2VBXA 3TEHB 3P3DA 5I4MA 3QPIA 5GMKa 4Q45A 2MZ1A 3G96A 4DV3J 4LRFA 5LMUF 3K8VA 1NJYA 4FYWB 2J0XA 2NZCA 1N33F 4ZITA 4I4BA 4USIA 3KOAA 3PHEA 4KC5A 2B9EA 3MEDB 5JUMA 3IRWP 1TV6B 2HNYA 4DEZA 1RT3A 2F3JA 2PI5A 4OI0A 4ZVOB 1HNXF 3BBFA 3FC9A 2ZH6A 1KONA 3OQ2A 8AT1B 2ZBQA 2C3OA 3NNCA 4LR9A 1IWGA 2XG8A 3GIRA 5DM7Q 4EEYA 2ACMA 5IV4A 4DV0F 2LQ9A 2DVIA 2XEXA 1S9FA 1NK9A 2BW7A 3ENWA 4ZN3A 4TU7A 3MEGB 2BJ1A 4DV7F 3BBCA 2I1RA 2PA8D 5F9NA 3IR7B 4IG0A 4DL5A 3M8RA 2CUYA 3DDNA 5JVHQ 2AGOA 5D6GA 1PAUB 4IDKA 4M5DB 3TYTA 2AJQA 1KBRA 2IAJA 4RW8B 1RDRA 1QUPA 2JDJA 1PAEX 1TL3A 3OT9A 2ALZA 4F67A 4F0MA 3ZZYA 1ZAVA 2QLWA 2QMXA 2ZWPA 1RT1B 4ZVSB 2IRUA 4WU3A 5KFOA 2VOOA 4ZLJA 1GX6A 2J8AA 2E1AA 4CLLA 3QBCA 2Z56B 3UD5A 5L1LA 1HL6A 4RW7B 2IJRA 5D4LA 5LL6d 2M0GB 2KXFA 3MCNA 1QSSA 2LXUA 1JLFB 3GLJA 1XJWB 2CJ9A 1IQTA 5SZTA 2E5LJ 2HNZB 3V4IB 4ES1A 3A3OB 4A8MP 4JI6F 2B5JB 1CJUB 3DOMA 1LQ9A 1FJ7A 3CMAS 2VU5A 4PXCA 2Z58B 2VQFF 2VODA 4PWDA 3ETOA 4NLQA 5A2QU 3SCKE 2FJXA 2MHNA 2HMIB 2MQQA 3K5PA 1HW9A 2BEFA 3KDOA 3PDNA 3BF4A 1HPZB 2OKQA 3QO9A 4NLTA 3TUIC 2YPYA 1LV5A 2Z2ZA 1ZBTA 4KY3A 2VG5A 4DZDA 3MMJA 3JYTA 1K73T 3FBEA 1ZM4A 3BGRB 1S9EA 1WD6A 3DDIA 3N6NA 2NSCA 1Y00A 1NJWA 2JX2A 5E41A 3VTIA 3CCUS 1ZYQA 3U1NA 1RAEB 2QLXA 3JQJA 5H9EK 4E2FB 1JIHA 1BUXA 3AB4B 3M32A 2MKCA 1KKHA 2A2DA 3CCJS 4DSLA 2QO3A 1YLXA 1KHWA 2EFOA 4HT7A 2HHUA 2HHVA 4O3QA 3W2WA 1REVB 1R7IA 2J7UA 2MZJA 4N5SA 1R89A 2J0QD 3BB5A 2ZH8A 2GAHC 3VAFA 3H2VE 2AJ4A 4I1TA 4Q0BA 3CDBA 1VQOS 1BD6A 3LP0A 3JAMU 2O67A 4FDFA 1U1RA 5D4OA 4TU9A 3TX8A 2F9DA 3DOLB 1RSCA 2GQ2A 2CQ2A 2IDEA 1REVA 1IN0A 1SKUB 4KE5A 1SKSA 3CMES 1MNEA 2RRAA 3IWXA 4RU2A 2DO4A 5JVGQ 2DPJA 2C3PA 3QQCD 2WK4A 4MT1A 2JC0A 4QIGA 4USMA 2ZJQQ 2E9ZA 2FB0A 4EO8A 3OLAA 2ZM6J 1S77D 2X1AA 4RWWA 2GVZB 3TJ9A 5HMXA 3U27A 4P2XA 3C6TB 3RYLA 1X4FA 3CEDA 2A10A 2MKJA 1TUWA 2NXJA 1ULRA 3NNAA 1C1CB 4ZA1A 3ZNUA 1RT6A 2E1MC 1UZDA 4RJVA 1XR6A 2L9NA 2JWNA 2CPIA 4OI2A 2WOMA 4RLEA 2G0JA 2ZH9A 4KPCA 4NLOA 1REGX 4R0EA 3ZTPA 1TFWA 2CQIA 1EARA 3CSKA 1L3KA 4EFAC 4NXMJ 2OTLS 2FGCA 1J5EF 2H1YA 3UVJB 1Z2LA 1R6VA 4QR2A 4O3NA 3DLGA 3Q24A 4M5GA 1Q5YA 3IR6B 4XO0A 4JI0J 1RT3B 2DH9A 3D1OA 3NWGA 2V9KA 1T9XA 1FKAF 2RMLA 3NGSA 4IRDA 1GT8A 1U1OA 2HS0A 5GAHI 5D0GA 1FERA 1T11A 5EWEA 1VR6A 2XHCA 2GIFA 3KJFB 3UDEA 4XAKA 5IV3A 2W25A 2XMMA 3ILIA 2NPFA 2YKOA 2OPRB 1UWBA 2QSWA 4UW2A 4N47A 1RT4A 3OSNA 1KLNA 4LF8J 1BE4A 4DR4F 1PYTA 2FZKB 3TVZA 1FFGB 2QL7B 4U7UK 1VJWA 1DJ0A 3T9NA 3M8SA 2ZBCA 3H42A 1SKRA 4O4GA 1KNZA 1WC4A 1LFPA 3HULA 1JLAB 2LU1A 1JLGA 3L7UA 3O2IA 4HEA9 1WI8A 4P75A 3T1YF 1NJZA 1MMLA 1O0PA 1S9GA 1EETA 3B78A 2E9RX 2NYHA 2QE5A 2V2QA 1U24A 3IFEA 2A3JA 4O0NA 3PO4A 2CPXA 1WC1A 1TKXB 1C0TA 1RT1A 3FBCA 4AL7A 5LSOA 6AT1B 2QA1A 3AOCA 2WTFA 4O0IA 1RKIA 1TVRB 4C97A 3MAAB 4OX7A 2YY3A 1XR5A 2GJFA 1T9UA 4Y2AA 3FSIA 2YQ3A 3L7OA 1UMJA 2VG6B 2QL9B 4JP8A 3M30B 2IRYA 3DLKB 3MEEB 5CQGA 1ZS6A 4YUDA 3OHAA 2DR5A 4BDPA 1HWIA 1S0VA 1RHJB 5KFXA 5IFMA 1HKAA 2CFXA 4AXJA 5J1PA 3GQCA 3GV5B 5DDPC 2V8GA 2DRAA 1TELA 3THPA 3TZYA 4FF2A 1RAOA 4WK3A 3CPWR 2OP5A 1M5HA 4OZ1A 2DXFA 1GTEA 1X60A 4H54A 5I42B 1NO8A 3NCRA 1NB7A 3ZZZA 1G1XA 2NUHA 4Z37A 3PCOB 3EXYA 1UVIA 3QO9B 3UNGC 3R5CA 3MUTP 1QAJA 5KT4A 2AZ1A 2LQ5A 2J9EA 1QY7A 3AB2B 3JAMY 3FBBA 5HVFA 2GFFA 1RTHB 2RILA 1F5BA 4WTYA 2DNGA 2EFGA 3I5CA 3DGPB 1OSCA 4XPEA 2GQQA 2FHOB 2R8HA 3OUYB 9RUBA 1EZZB 3AQPA 1M5PC 4C9DA 4O3RA 4NYZA 1U47A 4X4VA 1VHIA 1WUUA 3BREA 1NSAA 2FJBB 4K8RA 3LTOA 2Z8QA 2HNDA 2RF2A 3C14A 3E8OA 3R5AA 2WVDA 4J5OA 4KHMA 4URGA 1N54B 3L7PA 3MZIA 2HFNA 4J9QA 3GWCA 3QIPB 1Y5IB 1IBCB 2J0WA 2YKMB 3FSXA 4IFVA 4ED4A 4KHPJ 1B70B 3VR1A 2UP1A 1SIWB 3SV3A 1NBEB 1MU2B 3O8WA 2YXLA 2DH8A 5E33A 4HYKA 2UXCF 4OX6A 2HGNA 3MI7X 4PABA 2MZRA 2KHCA 3LUYA 1WG1A 4YB5A 4IRCA 3DNCA 5KFVA 3W61A 5A2QY 3CULA 3N4WA 1S6PB 5B0FA 3U7JA 3GG0A 2ZH3A 2NR0A 1WDDA 3OLBA 2HQDA 3Q8PB 1CS4B 2X1GA 4DHVA 1HHSA 2DNRA 5E3CA 2E1RA 3EGVA 1DFDA 2HKEA 1SV5B 3BGFA 4G1PA 4IFYB 2AD9A 1N0UA 4OZ3A 5M2UA 2W7OA 2FJWA 1HNVB 4FP9A 1XMOJ 2ZKUA 4LRDA 4XPCA 1KVKA 5AE1A 1QSLA 1IVZA 4ZJQA 1BQXA 1FXLA 4OJ1A 3VV2B 4GC6A 1Q4RA 2OSRA 3AJDA 2KRRA 2IM2A 1YVFA 2GHVC 3HFVA 3NWRA 4CLSA 4GC7A 2PN6A 4O23A 1KHVA 1Q78A 3FGVA 1R43A 2IIHA 2Y0SD 2G13A 2VFSA 2XI3A 4B3SJ 2SXLA 3MCMA 4I7FB 3UNYA 1HR0F 5BXIA 2KB2A 4P72A 4YQWA 2K2PA 1S1WA 2QN6B 3DRRB 4C2MA 4B9MA 3WC2A 3IR5B 4BHQA 2CQ0A 2VG7A 3D9BA 2ZHOA 4X64F 4X65J 4WTOB 2ZD1B 3EPGA 5DQHA 3UDCA 1FKPB 1YGYA 2H65B 3DRSA 4WFAQ 4LF5J 1WNEA 3DKDA 1NB2A 4AUKA 2ZNYA 2B51A 4EYIB 2YKMA 4IFVB 4P2MA 2NLWA 5GMDA 5B0EA 1FXDA 3I0SB 3MF5A 1PJ7A 1T05B 3T5JA 4OHYA 2BKPA 4GO5X 2NZ4A 4C8MA 4Y00A 2B4OA 3MWBA 4A48A 3HK2A 4MIBA 2DHSA 5IOLA 3OD2A 1IUJA 4NLWA 2YTCA 3AOBA 2JNJA
chains in the Genus database with same CATH topology
4NXNJ 5LM7E 2UU9J 4DV0J 4JI4J 1N34J 4DR3J 4NEZA 4GKJJ 1HR0J 4LF7J 4LF6J 2E5LJ 4X62J 3D3BJ 2VQFJ 4DV1J 1IBKJ 1FJGJ 4B3RJ 3OTOJ 1IBLJ 3T1YJ 4DR2J 4DV7J 5A2QU 4JV5J 3R2CJ 4YHHJ 1N32J 4DR4J 4DUYJ 4KY3A 4LFAJ 4JI1J 4DV6J 4DV4J 5IT9U 1IBMJ 4X66J 4NEYA 4LFBJ 4DR6J 4JI7J 4JI3J 5LMUJ 2UUBJ 2VQEJ 4B3TJ 2UXCJ 1HNZJ 2HHHJ 4OX9J 4KHPJ 5LMNJ 3JAMU 4LFCJ 2MEWA 2UXDJ 2UUCJ 4B3MJ 3T1HJ 5BR8J 4DV2J 4PWWA 2ZM6J 4JI5J 1HNXJ 4DR7J 2MQ8A 4JYAJ 4RJVA 1N33J 3IMQJ 1N36J 4NXMJ 1XMOJ 4DV3J 3J7AN 4X64J 4V1Ak 4DV5J 3D3CJ 2UUAJ 1XNQJ 4JI0J 1HNWJ 4JI6J 4GKKJ 2UXBJ 3J80U 5FLXU 4B3SJ 4LF8J 4DUZJ 2F4VJ 4AQYJ 4K0KJ 1J5EJ 4LF9J 4X65J 4DR1J 4LF5J 3W1YC 4JI8J 3J81U 5IWAJ 4DR5J 4JI2J 1I94J 4HHUA 3R2DJ 1XNRJ 2MTLA 1XMQJ 5AJ3J 4KYZA 4YY3J 4LF4J 2KVQE 2KL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN J;  5LM7 E;  2UU9 J;  4DV0 J;  4JI4 J;  1N34 J;  4DR3 J;  4NEZ A;  4GKJ J;  1HR0 J;  4LF7 J;  4LF6 J;  2E5L J;  4X62 J;  3D3B J;  2VQF J;  4DV1 J;  1IBK J;  1FJG J;  4B3R J;  3OTO J;  1IBL J;  3T1Y J;  4DR2 J;  4DV7 J;  5A2Q U;  4JV5 J;  3R2C J;  4YHH J;  1N32 J;  4DR4 J;  4DUY J;  4KY3 A;  4LFA J;  4JI1 J;  4DV6 J;  4DV4 J;  5IT9 U;  1IBM J;  4X66 J;  4NEY A;  4LFB J;  4DR6 J;  4JI7 J;  4JI3 J;  5LMU J;  2UUB J;  2VQE J;  4B3T J;  2UXC J;  1HNZ J;  2HHH J;  4OX9 J;  4KHP J;  5LMN J;  3JAM U;  4LFC J;  2MEW A;  2UXD J;  2UUC J;  4B3M J;  3T1H J;  5BR8 J;  4DV2 J;  4PWW A;  2ZM6 J;  4JI5 J;  1HNX J;  4DR7 J;  2MQ8 A;  4JYA J;  4RJV A;  1N33 J;  3IMQ J;  1N36 J;  4NXM J;  1XMO J;  4DV3 J;  3J7A N;  4X64 J;  4V1A k;  4DV5 J;  3D3C J;  2UUA J;  1XNQ J;  4JI0 J;  1HNW J;  4JI6 J;  4GKK J;  2UXB J;  3J80 U;  5FLX U;  4B3S J;  4LF8 J;  4DUZ J;  2F4V J;  4AQY J;  4K0K J;  1J5E J;  4LF9 J;  4X65 J;  4DR1 J;  4LF5 J;  3W1Y C;  4JI8 J;  3J81 U;  5IWA J;  4DR5 J;  4JI2 J;  1I94 J;  4HHU A;  3R2D J;  1XNR J;  2MTL A;  1XMQ J;  5AJ3 J;  4KYZ A;  4YY3 J;  4LF4 J;  2KVQ E;  2KL8 A; 
#chains in the Genus database with same CATH topology
 2BJ8 A;  3DRP B;  1ZTW A;  2A6O A;  2A18 A;  4K4X A;  3T1H F;  3C46 A;  3RZA A;  3KHH A;  1ELO A;  3HJF A;  2DGQ A;  4C11 B;  3KLE B;  4HAC A;  2MXY A;  4HHJ A;  3TQE A;  2G4B A;  1Q8L A;  4OYO A;  5KTQ A;  4YR2 A;  2F4V F;  1HR0 J;  1VQ4 S;  3M2V A;  3JQM A;  1Q82 T;  3AOA A;  5IT9 Y;  4K2J A;  2QC3 A;  3AD9 C;  5C24 A;  3T9Z A;  4NZ7 A;  2FJA B;  4Q43 A;  5L1I A;  3PTW A;  3OJU A;  5A6W A;  1HQU A;  2R8G A;  4CLF A;  2F9J A;  3PV8 A;  1KQK A;  4OL8 A;  1BQM B;  3HX9 A;  2AX1 A;  1U1M A;  4OHW A;  4DL2 A;  1ZA1 B;  1N5T A;  4FKY A;  1NDL A;  4JV5 J;  3DGP A;  2F5G A;  3SIP B;  2B43 A;  4YHH J;  2CG4 A;  2Y8W A;  1LOU A;  1HQU B;  3MOZ A;  3A13 A;  4TVA B;  4CLT A;  3V6D B;  2R8K A;  4A8X A;  3CMQ A;  3NKY A;  3H25 A;  4PWD B;  4PCQ A;  4X4N A;  1C4C A;  2O01 C;  1FI4 A;  4EGL A;  1QTN B;  1S1U A;  2W24 A;  5IT9 U;  3KK2 A;  3HHL D;  2BDP A;  3C6U A;  2HIQ A;  2YWK A;  1EHW A;  4ZLN A;  1S0O A;  2ATC B;  4DPT A;  3KLG A;  4WKR A;  4DR6 J;  3C2P A;  2OHD A;  4ICL A;  1MMD A;  2CPY A;  3AAW B;  5E0O A;  4K4V A;  4L75 A;  4DSE A;  3C3L A;  3ISN C;  2QL5 B;  5KFC A;  2UXC J;  2HS3 A;  1APS A;  4TY8 A;  3H5Y A;  2EC0 A;  4YP3 A;  4NLX A;  4CYU A;  4NPO A;  4CZC A;  3THV A;  1F3V A;  1H72 C;  2MGZ A;  5A0Y A;  4OX9 F;  4NAS A;  3TA0 A;  1UVL A;  3CD7 A;  2JEG A;  4R5P B;  1RTD B;  4V19 J;  2VBY A;  2F1F A;  2GC8 A;  2F65 A;  4Q0B B;  2B8Q A;  3OBI A;  5EHH A;  2BQR A;  3N9U C;  1TAU A;  1M1H A;  1JX4 A;  2EG2 A;  1K1Q A;  1TMJ A;  5KFG A;  2RQM A;  5IC6 B;  3OFF A;  1UVK A;  4URS A;  4IG0 B;  4F04 B;  5JMN A;  2GML A;  3K89 A;  4DV6 F;  2VOP A;  2CJY B;  2CQD A;  3FEZ A;  3TNV A;  4ZIV A;  1XBW A;  5KFU A;  5DET A;  1AUD A;  3HZE A;  4MK8 A;  4JI0 F;  1RTZ A;  2OLW A;  4DJB A;  3A8E A;  1TL1 B;  3HZG A;  3WX4 A;  3ZTR A;  3RR8 A;  3HD1 A;  3BSO A;  3KLH A;  1UFK A;  1S99 A;  1LWX A;  2VDI A;  3EMT A;  2ZWO A;  3OFG A;  4KFB B;  2KG0 A;  3AH6 A;  1IR0 A;  3PJ9 A;  3D0I E;  1NSK L;  1SC3 B;  4DPX A;  1P9Y A;  3N0V A;  3RRK A;  4UY8 5;  4FS2 A;  2KHD A;  3NGR A;  3ENV A;  2EFN A;  1U8S A;  2M70 A;  3OXF A;  1S7I A;  4ZPA A;  2YWH A;  3K5L A;  4AE5 A;  1LEO A;  3K59 A;  1AA1 B;  1X9W A;  3HF5 A;  1HNW F;  1GXL A;  2HNZ A;  2BJE A;  1FFW B;  4OYB A;  3V4I A;  1MRO A;  1IR2 A;  2YWG A;  3HKW A;  4UT4 A;  1JLE B;  1VBX A;  2PC6 A;  4YB7 A;  1D0E A;  4F4K A;  1GNK A;  2VUG A;  4KAI A;  2HYI B;  2DNL A;  1T05 A;  2Y1L B;  3TO8 A;  1DY3 A;  2MZS A;  4JI2 J;  1NDC A;  1I94 J;  5AJ3 F;  5C42 A;  4QIE A;  1BWE A;  1HQE A;  1QM9 A;  4O4R A;  3H8Y A;  3FDS A;  2V69 A;  3FQK A;  2P6T A;  4WP3 A;  2QA2 A;  4ZPT R;  2W7P A;  1NZA A;  4WE1 B;  3HSD A;  4OIX A;  4OHZ A;  5KOW A;  4A8Q A;  3JB9 k;  3RW6 A;  3PKM A;  1HWJ A;  4H4M B;  3D7S B;  3ZTS A;  2HZA A;  3QWU A;  3FMW A;  2J0S D;  5DJB A;  2LEB A;  2DO0 A;  4PPZ A;  2UU9 J;  2DNM A;  4ZPD A;  3J7Z T;  2ZOM A;  1NUE A;  3N5B A;  3NEK A;  1LKZ A;  4WJB A;  3BGL A;  3TJA A;  1S6O A;  1YJR A;  2IYG A;  4IYQ A;  2M5Y A;  2R2U A;  3Q0A A;  1L3V A;  1ZH5 A;  3UN3 A;  4ED0 A;  2M4M A;  3R7B B;  2W8L A;  3JTO A;  3D6T B;  4ED5 A;  1L5U A;  4LF6 J;  2RHS B;  1HMV A;  2XMJ A;  3CD6 S;  4QYZ J;  4DN9 A;  2ZH5 A;  4S0M A;  3KLI B;  5E3P A;  5DDR C;  1VRT B;  1F5C A;  1RAG B;  1YKW A;  2DH7 A;  4PQA A;  5KG6 A;  2C2N A;  4J9O A;  2N4C A;  2MZQ A;  2YKN B;  3FFI A;  2E5L F;  4LF6 F;  1KP6 A;  3F41 A;  5IQQ A;  1RT5 A;  1RLD A;  2GA7 A;  1FRJ A;  3R1L A;  2R7W A;  4M8L A;  4KHR A;  4FYD A;  2IFX A;  2YWF A;  3NAH A;  4NLR A;  4QBU A;  5DGB A;  3DDK A;  3GR0 A;  5KOX A;  3KK2 B;  2XYH B;  1S4F A;  3PW7 A;  1ZPW X;  5KFK A;  3PW2 A;  1S48 A;  2RS8 A;  4BLG A;  2QFI A;  4JB8 B;  5EWG A;  2J6S A;  1CVJ A;  1V6H A;  4MIW A;  5DM6 Q;  1DQ9 A;  2XHW A;  4X66 J;  2VIH A;  2ZM6 F;  2EW9 A;  3R5D A;  2KTQ A;  2D69 A;  2HMI A;  4B3R F;  1V9O A;  3MPY A;  4CH0 S;  1KQG B;  1DUR A;  4URQ U;  2W2O P;  3E2E A;  5CYJ A;  5HAT A;  4CM2 A;  4YB6 A;  3KG1 A;  4JI2 F;  3IG1 B;  5KFI A;  5DS7 A;  2KYX A;  3V6J A;  1NEE A;  2H5J B;  2MEW A;  3P5B P;  4ZDN A;  3N79 A;  2I8E A;  1Q8I A;  1ZPV A;  2V2Z A;  4K4Z A;  4HDG A;  2HHX A;  2AIR B;  3AHP A;  4DCP B;  2J5A A;  2RNE A;  4OLP A;  2QMW A;  4B9T A;  4PRF A;  4KGM A;  1D3W A;  1UEV A;  3G6E S;  4NCA A;  4A8Y A;  3QAU A;  1PG5 B;  2GS8 A;  4PXB A;  1NXI A;  3RUB L;  2XNR A;  4B9N A;  3EGW B;  3UQS A;  4DX6 A;  1F9H A;  5C25 B;  4O3P A;  3LP1 B;  4N56 A;  1M90 T;  1VQK S;  3H7H B;  2D9P A;  1OYE A;  2BZ2 A;  1NPP A;  4Z2X A;  2GMJ A;  1N32 F;  3IM9 A;  2WCX A;  4RNM A;  1FD8 A;  4JV0 A;  3M1V A;  1OQ3 A;  3SMZ A;  3BZQ A;  1CJV A;  3QGG A;  4CH1 A;  2IRX A;  4QOT A;  2BJD A;  4YEA A;  1DLO B;  1PSD A;  2RHQ B;  3KDN A;  3UVJ A;  4JI6 J;  3C19 A;  4LSZ B;  3DLG B;  4TXS A;  4UZC A;  4X66 F;  1RGV A;  3SQG A;  4CQ1 A;  1UWA A;  2XWX A;  4PG5 A;  3SDE A;  3PIP Q;  1FEE A;  4MH8 A;  4OYM A;  1S12 A;  1UZH A;  3CO9 A;  2IMW P;  1CJV B;  4FBT A;  4V19 X;  3P8B B;  1S9E B;  2U2F A;  3G8T A;  2Q6B A;  4WFX A;  3WIU A;  2W4P A;  3RAX A;  3R27 A;  1WI6 A;  2LQB A;  2B8P A;  4EYH B;  1RT7 B;  1RKJ A;  4LF9 J;  1I51 B;  3MED A;  1JLF A;  1IWA A;  2DXD A;  4KPY A;  1SJ3 P;  2ALY B;  5CZV A;  2RQ4 A;  1H73 A;  2RDD A;  3I0R A;  3J81 U;  4F50 A;  2ZZM A;  1EKR A;  3DU5 A;  1FTR A;  5F3Z A;  2R7R A;  2P8I A;  2K3K A;  3L95 X;  4WE1 A;  1O6X A;  4CTA A;  5CA5 A;  2RUG A;  3R2D J;  5D4N A;  3M2R B;  4R8U A;  1H38 A;  2PEB A;  2KXN B;  2XY7 A;  4EMD A;  4X4U A;  3ET6 A;  3MPU B;  1TFY A;  2RQK A;  3DOL A;  2KVQ E;  2OH2 A;  1U0S A;  4FVM A;  4P2F A;  4NXN J;  2OPP B;  5J2M B;  4CT8 A;  1GMU A;  1CQM A;  4M5D A;  3M9O B;  5KAK A;  4DV0 J;  5DQI A;  1KQF B;  3ET6 B;  4I67 A;  2E44 A;  5K8P A;  4AD6 A;  4ZP9 A;  1AZS B;  1OPZ A;  1WEX A;  4F0H A;  1S72 S;  2FD2 A;  3A8K A;  2L9W A;  2HFZ A;  3BQ1 A;  3VAM A;  1RWV B;  3MM7 A;  4B3O B;  5HP1 B;  4H4O A;  1HD1 A;  4ZVT B;  5GME A;  4RW6 A;  2EKN A;  3LGM A;  1HBU A;  4ECQ A;  2EC2 A;  2E9T A;  1BC6 A;  1W2I A;  3T5K A;  4OI3 A;  1X5O A;  3BSC A;  1X4H A;  4WWS A;  2B4P A;  2XGP A;  2WRM A;  4ECY A;  3CNQ P;  4EUV A;  1QE1 B;  2Y8Y A;  2V0N A;  4ZJL A;  2O1P A;  2J6U A;  4ANC A;  2XO6 A;  3PFE A;  2B5J A;  2CNO B;  4Q2L A;  3V6H A;  1KWM A;  2PO4 A;  1HBU B;  3GR1 A;  1CQN A;  3PFO A;  4OX8 A;  3KLF B;  2XMT A;  1C0U A;  4IOA Q;  1FNO A;  1U2R A;  1MSW D;  3CJ3 A;  1QE1 A;  4NEY A;  3KJN B;  4QWB A;  1YX2 A;  3ZZO A;  2R7T A;  3CB4 A;  2C3Y A;  3NBP A;  4OHX A;  4IG3 A;  3C66 A;  1LWE B;  5M2P A;  4X4O A;  3IG1 A;  2OEJ A;  4OYX A;  4KTQ A;  1HNZ J;  2RE1 A;  2KZM A;  3WC0 A;  2W9C A;  2D3U A;  3CCM S;  5J2Q B;  1H98 A;  2RVJ A;  1QJH A;  3CJ5 A;  2ZJP Q;  4FF1 A;  3UD4 P;  2A6M A;  4ICL B;  2BAC A;  4WZQ A;  2UUT A;  1KTQ A;  3M6U A;  3MD3 A;  3VAL A;  2FC9 A;  2FJV A;  1FT8 A;  1O8B A;  2Z30 B;  1LWE A;  4CIO A;  2VQE F;  3OVB A;  2AJ1 A;  2Y1R I;  2MKY A;  3PNI A;  2HND B;  4LIR A;  1VGY A;  1WEZ A;  2CQ4 A;  2XNQ A;  3KMQ A;  2AYM A;  5A0Y B;  5IQ6 A;  4HH0 A;  4PWW A;  1WDT A;  4OV1 A;  1SBR A;  1KOO A;  4DL7 A;  1VYA A;  4GMK A;  3M8P B;  3R6G B;  3BN4 A;  3DFE A;  1RT2 A;  2HQG A;  1JLA A;  4PYA A;  1VK8 A;  5KFP A;  3RB4 A;  1HA1 A;  1VRQ C;  3VQS A;  1DZ5 A;  4R25 A;  4R0J A;  4DL6 A;  1V3S A;  2ZC4 A;  3QJP A;  3U02 A;  4LQ3 A;  3PYE A;  3HHN B;  1D9A A;  1FEH A;  4YN3 B;  3H20 A;  3G9C A;  1VHF A;  5CHC B;  2QMU B;  4JUZ A;  1UJ5 A;  2WW8 A;  3IRX A;  3Q8Y A;  3NGD A;  1LK7 A;  2IM3 A;  4J9K A;  5HJY A;  5F8N A;  4DSI A;  1LW2 A;  1TL1 A;  4OYW A;  1G2E A;  2KRB A;  3S7R A;  2JHE A;  4ER8 A;  4J9L A;  4DCJ B;  2IM1 A;  3A3N B;  2M7S A;  3M2V B;  4USH A;  2FZG B;  2JH3 A;  2R9L A;  3E3X A;  3SXL A;  1FRI A;  4RL1 A;  4HI1 A;  4DU8 A;  5KFQ A;  2OPS A;  2XWY A;  3ULH A;  3LP2 B;  4DR1 J;  2DGV A;  1P9Q C;  2FHK A;  4QIF A;  3VAJ A;  4ID5 B;  3VGS A;  4DF8 A;  4RX6 A;  1KLM B;  1XTZ A;  4OZJ A;  4ZPV R;  3PHT A;  1QAY A;  3LH2 S;  1E6V A;  2CZV C;  3GYX B;  4PXD A;  1CC8 A;  5KG1 A;  4A4J A;  3BO3 A;  5I3U A;  1XMQ F;  3P4U B;  4LBI A;  5A8R B;  4GVB A;  2OMO A;  5D0H A;  2FVR A;  1H3D A;  4RUH A;  1A7G E;  2MLY A;  2QLJ B;  5CYQ B;  1T03 A;  2XGQ A;  5CXT A;  2KG1 A;  3TX0 A;  4OMF G;  3VWS A;  4K5S A;  5ETK A;  5KT5 A;  4ZPC A;  2ZKT A;  2DHX A;  2JVO A;  1U1Q A;  1TZ0 A;  3GZ7 A;  4TKT A;  1CJK A;  1X4D A;  2BA9 A;  2DYA A;  2R7S A;  1TKX A;  5F0U A;  4NLS A;  4OZ0 A;  1Q95 G;  1VCT A;  2CQH A;  5ITH A;  3BR9 A;  2ERR A;  4U8Y A;  4K2X A;  3CUN A;  3IBF B;  1VK3 A;  2OPQ A;  1AFI A;  2HGL A;  3N01 A;  4RZR A;  2EI5 A;  2D41 A;  2AQ4 A;  1JLQ B;  5J2N B;  4PG7 A;  2CKW A;  1VQ5 S;  1HYS B;  3H4B A;  1Y9O A;  2AEM A;  2MHE A;  3DYA B;  3H5U A;  1YIT S;  5EX0 A;  1P1L A;  4KH1 B;  5L38 A;  3OHB A;  3IO1 A;  3RRH A;  2BM1 A;  4UST A;  4WFZ A;  2IYI A;  5L39 A;  2C2K B;  2D7S A;  3RAQ A;  1C4A A;  2FZC B;  2HVE A;  2LLZ A;  2GMH A;  3MOJ B;  2AW0 A;  2XTJ P;  2YBV A;  3NY0 A;  2QGF B;  3L9Z A;  4USV A;  3HJV A;  1RBL A;  2YKN A;  2I38 A;  3FFI B;  3G6V A;  1RXO B;  4I7F A;  2RUS A;  5LT5 A;  1S76 D;  1DRZ A;  2QRR A;  4ZCK A;  2JZ5 A;  5K9F A;  3HHE A;  1M5K C;  1PYO B;  2LCW A;  5K5M A;  4IFY A;  1WOR A;  5L9X A;  4Y2I A;  2V8D A;  1IKW B;  1J2V A;  1FX2 A;  4C98 A;  3K58 A;  3OJS A;  3PW5 A;  3HO1 A;  2HVI A;  1R8A A;  3OTB A;  3QAT A;  2HVH A;  2Q66 A;  2V50 A;  3GIL A;  1TK5 A;  1IKY A;  4DDF A;  5B09 A;  3CJQ A;  4QW9 A;  2RD5 C;  5LMN J;  2B7B B;  2W7A A;  2GVD A;  3D28 A;  2WVE A;  5HLF B;  5CYQ A;  4RNN A;  1X5P A;  3MTK A;  1QD1 A;  2V6A A;  4QPT A;  1JLE A;  2ROE A;  5EGY A;  2R7O A;  4BC7 A;  2QT7 A;  2CQ3 A;  3CCQ S;  3CCR S;  5L9N A;  5LXR A;  4B9S A;  4D3G A;  4G6V B;  3PKY A;  3KXD A;  1E6Y B;  3FNN A;  3IM8 A;  1QSY A;  5LOQ A;  3W9H A;  2MY7 A;  2ABY A;  1S1T A;  3F56 A;  2CQP A;  3M05 A;  3MHY A;  3QT5 A;  2B3T B;  2UXB F;  2V68 A;  1YJN S;  1XN9 A;  5F0W A;  2AWZ A;  2HUR A;  4ELT A;  1GAO A;  2PMZ D;  1JNR B;  3A8J A;  3TZW A;  5EWF A;  4WFB Q;  1YRX A;  1S5Z A;  2DXE A;  4WP8 A;  3UR0 A;  2QYC A;  3H40 A;  1YJT A;  3LQV A;  1NME B;  5A8K B;  4Y34 A;  1OWX A;  2MKK A;  3QYY A;  4IDK B;  2V4Q A;  1D9D A;  3X1L B;  5J2P B;  4KHP F;  1X8D A;  1XIQ A;  3HSJ A;  3RG6 A;  3CIZ A;  1LW0 A;  2XYG B;  4I68 A;  4LF9 F;  2CQG A;  1IQZ A;  3BBB A;  2F8M A;  3UFC X;  5AE3 A;  3KFW X;  3VGV A;  2YWE A;  4CO1 A;  3MR2 A;  1TK8 A;  2PFD A;  2R4F A;  4OV6 A;  3MXH P;  2H5E A;  1IBK F;  2H3E B;  1SXL A;  4L3K A;  4LR7 A;  3GIM A;  1SC6 A;  2V2V A;  3BH6 B;  1YHQ S;  3ADA C;  2YH0 A;  1F5A A;  1KTV A;  2DRD A;  2I5J B;  3BKF A;  3D68 A;  4HDH A;  2ZDO A;  3JTP A;  3NGT A;  4MIA A;  4OI6 A;  3T6B A;  1RCX B;  5KG5 A;  4UZB A;  2DIU A;  1X0F A;  2LFV A;  1FWP A;  1TV6 A;  2HNY B;  1PKU A;  2Z57 B;  3MFH A;  3GIK A;  5IM0 B;  2M3D A;  2A0F B;  5E3R A;  4OI4 A;  3KG0 A;  4L76 A;  3OPK A;  2E7X A;  3ENQ A;  4YS2 A;  2Y1I A;  4ZVP B;  5AE2 A;  1WSR A;  4DR5 J;  3FEX B;  1S6Q B;  2YNI A;  2P2C B;  4HHU A;  1K0V A;  2J7K A;  2GCF A;  5ETV A;  2BE2 B;  3D5M A;  2HG4 A;  4U6P A;  3I0R B;  2WSC C;  5LJ3 Y;  1T03 B;  1EIY B;  4LSL A;  1FKP A;  1SQE A;  3DRS B;  4QW8 A;  3QRQ A;  4CLK A;  2XZD B;  4TU8 A;  2CIM A;  4FPI A;  4ZP7 A;  1KRP A;  1VQY A;  4F7V A;  5E2Q A;  3PO5 A;  4HVZ A;  2OI2 A;  4IH5 A;  3JSM A;  3M2R A;  4RNH A;  1VDH A;  4R8U B;  3KTQ A;  4B9L A;  3EGN A;  4YDX A;  5GAE U;  3OTD A;  1QVF R;  2CPD A;  3G86 A;  4A8W A;  1HQE B;  2IMO A;  1RHK B;  2U1A A;  4U95 A;  5K8M A;  1PYS B;  2QV6 A;  2D3O 1;  1VC5 A;  3TAR A;  2MMY A;  3TJ8 A;  2RKI B;  1ZM3 A;  3GTY X;  1U7L A;  1TL5 A;  2PT0 A;  3D3B J;  3J7Y I;  2VQF J;  3N6L A;  5F8L A;  1K44 A;  4CCH A;  4LMZ A;  2VL1 A;  2JC1 A;  1T9W A;  4IQX A;  3AFG A;  1KFD A;  2NS1 B;  2FUG 9;  5ETT A;  5KG2 A;  4UOH A;  1TMM A;  4O44 B;  3T41 A;  1YJ9 S;  2XSJ B;  4Y65 A;  3PM9 A;  3T1Y J;  4KFB A;  5CAB A;  1UEU A;  1YIJ S;  2XLJ A;  4P7V A;  2C2Z B;  4EBE A;  1H7X A;  3MR3 A;  2FLN A;  1FXR A;  2KFZ A;  3ILJ A;  1YJW S;  4F4Z A;  1RU1 A;  2VKZ G;  2DNK A;  3VGT A;  2ZHB A;  4A8O A;  1JJ4 A;  1F1B B;  4FF3 A;  4DR4 J;  4NA3 A;  3AA8 A;  1GFW B;  2C22 A;  5CYM B;  1HMV B;  5D77 A;  1N4L A;  4KRW A;  1BQM A;  1R8B A;  2IC3 A;  2KT3 A;  1SUQ A;  2YQ1 A;  3EZO A;  4KB7 A;  5KG4 A;  5KT2 A;  4J9N A;  4AFF A;  4DV4 J;  2WAQ D;  3MM8 A;  3M1V B;  4NI2 A;  3Q89 A;  2WOM B;  3DMJ B;  3BEG B;  1RAA B;  3C16 B;  3HMJ G;  2K7K A;  1DBD A;  4NLU A;  3GFY A;  1QAI A;  2HEK A;  4J91 A;  4ZLL A;  1FE0 A;  3EDQ B;  3M2U B;  1PBA A;  4U67 Q;  4RBV A;  2XUL A;  2GVD B;  3DCA A;  3HFZ B;  4F8R A;  4DU7 A;  2B4V A;  1T9T A;  2BE2 A;  2H4W B;  4MKY A;  4I2Q B;  3NMR A;  2NQP A;  2AU0 A;  1M5S A;  4Y3C A;  3C16 A;  2E1C A;  5DZ6 A;  3IWN C;  1RAC B;  2IA0 A;  3QID A;  5KFS A;  2G1D A;  3TVY A;  1Q0N A;  3F73 A;  2UU9 F;  3EVO A;  2DCU B;  3R8Y A;  1RQ0 A;  2P9G A;  3SFU A;  2BQ3 A;  2E5J A;  5IZH A;  5F9L A;  3NOC A;  1MWY A;  3AXK A;  4LFB F;  2WBR A;  1LNQ A;  3J81 Y;  1U49 A;  1N48 A;  1X4G A;  2BE9 B;  2DBB A;  3OXL A;  3JYT B;  3KK3 B;  1HNX J;  1B7Y B;  4KGZ B;  3I4P A;  1X31 C;  1EKS A;  4NCG A;  5G0R A;  1Q7Y T;  1KSP A;  2B9Y A;  3K2Y A;  3UCZ P;  3ZFV A;  1I94 F;  2EPI A;  1DAR A;  5HI7 A;  2GZO A;  1RTJ A;  2CAD A;  2CDR B;  2IAJ B;  2MLZ A;  1N33 J;  1QAX A;  4D3H A;  2DEJ A;  2ZVS A;  3C15 A;  1RHR B;  1RJJ A;  4NRT A;  5GAD I;  4FS1 A;  3EWG A;  3KNG A;  5KT3 A;  3KLV A;  2R7Q A;  2MJU A;  5DO2 A;  4K59 A;  3L09 A;  3R7N B;  3IWL A;  3CDU A;  2LDI A;  4C3K A;  2IBK A;  2YKP A;  2VV5 A;  1Q5V A;  4MKB A;  1CUL A;  4QR0 A;  4C8Z A;  1SH3 A;  4RW7 A;  1RWM B;  3TEG A;  1NJI T;  3PYD A;  1AYE A;  4YFU A;  2DNP A;  4DI6 A;  4ETZ A;  3HVW A;  3K8W A;  3GCW P;  3QLH B;  3KLH B;  1PGZ A;  3CWJ A;  1FJE B;  2VON A;  2GQC A;  2K06 A;  5D15 A;  3GIJ A;  2C2O B;  2XO7 A;  4ED6 A;  3W63 A;  3QSI A;  3MD1 A;  2MQO A;  1CJU A;  4FXV A;  3W62 A;  2I2Y A;  4ZVU B;  1HWL A;  1ZA2 B;  4K5R A;  3W1Y C;  3AT1 B;  4PZV A;  3VCD A;  4JV1 A;  2ZZN A;  1T9V A;  2HIY A;  1SJQ A;  2PDA A;  1UW4 A;  2G9O A;  2QSF A;  4O3S A;  1IM4 A;  2FHJ D;  3H0P A;  4LVN P;  4RNO A;  1VRT A;  3SZ2 A;  1JK9 B;  4X84 A;  4KGK A;  1T3O A;  1FD2 A;  4CT9 A;  2W2N P;  1DHM A;  1NK4 A;  4JI3 F;  4H4K A;  4XDD A;  4N7T A;  4Z7Y A;  3J80 Y;  4G1I A;  4KO0 A;  1WC6 A;  1KLM A;  3ICL A;  2VF3 A;  1NSQ A;  1NRK A;  2HBR B;  1NH8 A;  5AXK A;  2QIF A;  3MEG A;  2M8D B;  1KDN A;  1SQG A;  5LM7 E;  5A8R A;  3TAP A;  2CNL B;  4MKV A;  3OL9 A;  2WB1 D;  3W5Y A;  1TL4 A;  4ECW A;  1FES A;  3WX8 A;  1GMW D;  3DLE A;  4F2S A;  1G7C B;  4ANE A;  4H4M A;  5LMN F;  4DUZ F;  4GKJ J;  3LP0 B;  3V6K A;  1Q81 T;  1N6Q B;  1BQN B;  1YBU A;  3GV7 B;  3PYG A;  1FJG J;  4MJK A;  2J9C A;  2OD4 A;  5HMZ A;  1PCA A;  3MAQ A;  2IVY A;  4W92 B;  3K0J A;  2DNN A;  4AND A;  4ECR A;  4G65 A;  1KR4 A;  1TKZ A;  4PXE A;  1GEH A;  3GON A;  5FDL A;  1VMB A;  4OJH A;  3ZZU A;  1Z1Z A;  1CLF A;  1N0V C;  4USK A;  1DLO A;  2MYF A;  3DC2 A;  2E5I A;  4BWJ A;  1B64 A;  4LUB A;  1RYR A;  1TK0 A;  3QLH A;  3O1L A;  1O51 A;  1VQL S;  3W65 A;  1NM2 A;  4IRK A;  4N76 A;  4I64 A;  1AUS L;  1QDU B;  4B3O A;  2EWH A;  1N5Y B;  2QZ8 A;  2FPH X;  4H4O B;  4YHH F;  3PEH A;  3DOM B;  4JV5 F;  2Z2L A;  1OMS A;  3CCT A;  2RRN A;  3LP1 A;  2VBW A;  3VF0 B;  2D3O R;  4C8O A;  1SV5 A;  3D6M B;  3ZTQ A;  4IR9 A;  1MN9 A;  1MMN A;  2B6A B;  4L73 A;  4U7C A;  2E5G A;  4DSK A;  4HT5 A;  2G0I A;  3IRX B;  3G8S A;  1NHK L;  1K0T A;  5F8G A;  5LMU J;  5HO4 A;  3CC4 S;  3IP0 A;  1S0M A;  4DL0 C;  2HHH J;  4B3M F;  1GK8 A;  5T7L A;  2RT3 A;  2KYZ A;  4NE9 C;  3MM5 A;  3Q2T C;  1HNI B;  1JQG A;  1V5V A;  5E3Q A;  3MR7 A;  2JEF A;  5IWA F;  5D3G B;  2UXD J;  5H9F K;  1X4C A;  3UWT A;  1WOP A;  2CJQ A;  1U4B A;  1YK9 A;  2ZC3 A;  3RBX A;  1I1G A;  3DM2 B;  3FUY A;  1HD0 A;  3D0H E;  2GIR A;  3JSB A;  3M32 B;  5DDO C;  4NLP A;  4P6Q A;  4K0K F;  1R31 A;  1ZAW A;  3DRR A;  1WF2 A;  4XTT A;  3PVX A;  2L3M A;  4CLU A;  4Q5V A;  4AL5 A;  1UFL A;  1HNI A;  2H5I B;  3GSI A;  1GXT A;  1NPR A;  4ID5 A;  5MAO A;  2ASL A;  2LXF A;  1S9G B;  4YDD B;  3IBC B;  4CM0 A;  2ZH1 A;  1YZ7 A;  1BY9 A;  1HHQ A;  1Q79 A;  3H5S A;  4WU2 A;  3OUY A;  3D1Q A;  1Z2Z A;  2HRU A;  3HVT B;  4C6A A;  3S8S A;  1VC6 A;  3CC7 S;  1T3N A;  1HAR A;  1S59 A;  4IQM A;  4TYA A;  3HT0 A;  2R8I A;  4CLP A;  5ETO A;  1J5O B;  4G1Q B;  1U0H A;  5ETQ A;  4DR2 J;  1XNQ F;  1N36 J;  3QT8 A;  1JMT A;  4EU0 A;  3PRV A;  4DOZ A;  4LF5 F;  1XQI A;  1TKZ B;  1FK9 B;  4X65 F;  4X64 J;  1NK5 A;  2KXH A;  1C2P A;  1FRX A;  2F63 A;  3ZZR A;  4W90 B;  3EXC X;  3HI9 A;  4IUF A;  1JXV A;  2KKH A;  3MM6 A;  4UQG A;  3IGV A;  4B08 A;  4G1Q A;  3BM7 A;  5B0B A;  1OQ6 A;  1FKO B;  4B3S F;  4ELV A;  4IOB A;  3FKB A;  4ILR A;  4WFY A;  5L8R C;  4DPO A;  4K4Y A;  5FLX U;  4ED1 A;  1XR7 A;  3GB0 A;  1WHY A;  4PKD B;  3KWM A;  1IXK A;  4UTG A;  2VAS A;  2AJ0 A;  1YBT A;  3MUR P;  2PD1 A;  3VAI A;  3I9V 9;  5B0D A;  1X9M A;  3I87 A;  5I42 A;  1T0T V;  2LVW A;  1WEL A;  2RRB A;  1YZ6 A;  2V2K A;  3GJS B;  1XMO F;  1YSJ A;  2DGX A;  2UUC F;  2YNG B;  4WCE Q;  1SJF A;  4LF4 F;  3V2U C;  4LFC F;  2APO A;  1CC7 A;  1NH7 A;  5A8W A;  2HVD A;  1TU0 B;  2VA2 A;  1WJ9 A;  3D1H A;  2ROG A;  1H74 A;  2CPE A;  3I32 A;  1VIO A;  3U1M A;  3G71 S;  1Y0H A;  4M5J A;  3OW2 R;  3W3S A;  5C2G A;  1K9M T;  5GVQ A;  3HSZ A;  1N88 A;  3F0N A;  1NHV A;  4DL4 A;  3AD8 C;  1JJH A;  2FVS A;  2WVF A;  2OO4 A;  2MGZ B;  5J1N A;  3POT B;  2ZEJ A;  2CDQ A;  1U1K A;  2Y3Y A;  2UVW A;  5I3P A;  5T41 A;  3SV4 A;  2B0G A;  4DQS A;  1VQ9 S;  4Q8E A;  2AZ3 A;  1VI7 A;  3K7R A;  2CPF A;  1N34 J;  3KHL A;  4TQS A;  2BXJ A;  4DR3 J;  2FY8 A;  4USJ C;  1RHM B;  4F4Y A;  3PX0 A;  3PW4 A;  3CCZ A;  3DHX A;  2K8G A;  4HLB A;  5CAA A;  1HNZ F;  2POK A;  4NLY A;  4Q44 A;  3UR3 C;  2OFG X;  2BMB A;  4X62 J;  1RYS A;  1IJF B;  5AXM A;  4C48 A;  5DGA A;  1RUS A;  3H98 A;  1UPP A;  4PUO A;  1RWP B;  1XMB A;  3T5H A;  2QEX S;  1VQ7 S;  1W26 A;  4F2R A;  3BYP A;  4DWI A;  2RKI A;  2LEP A;  4NLV A;  1UW9 A;  2BJ7 A;  2DR6 A;  3MM6 B;  4OZ5 A;  3LO3 A;  5GAG U;  4DV4 F;  3D67 A;  4LBP A;  2DCL A;  1N5Y A;  2Q1L A;  4YR0 A;  3SYZ A;  2LYV A;  5BYQ A;  4RW6 B;  4LBH A;  4ZPB A;  2COL A;  4K4W A;  3ELH A;  1VC0 A;  4PAA A;  2VC0 A;  3VVU A;  1ICE B;  4FVC A;  4RR5 A;  3GCX P;  5GAD U;  1R8H A;  3D54 A;  4I56 A;  1HNV A;  3HKZ D;  5IXU A;  1Q8K A;  1T94 A;  3LW5 C;  5IS2 A;  2XY6 A;  3DI6 B;  2AGP A;  4ED2 A;  3CCL S;  5LXY A;  1CPZ A;  3RAM A;  4ZP8 A;  4U8V A;  4WBF A;  1HBO A;  4NRU A;  2CPH A;  1F9F A;  1UFW A;  1B4S A;  1YI2 S;  1S1X B;  5KFT A;  1FRM A;  2AF6 A;  2BYC A;  2V4R A;  3DHW C;  4PQU A;  3KHG A;  1U09 A;  2YWW A;  4C4W A;  4B9V A;  3NNH A;  3M6W A;  4EK2 A;  3SQG B;  2EXU A;  3OR1 A;  2WHO A;  1ARO P;  5F3T A;  1HQ2 A;  1X4B A;  3W2V B;  5HMW A;  4RUC A;  4RBU A;  3ISN D;  2UZA A;  4TY8 B;  3FBF A;  3OVA A;  3BGO P;  2ZD1 A;  1RHU B;  1ZAX A;  2Z0G A;  3T5L A;  2XMA A;  3I5B A;  2ADB A;  2HFS A;  3TA1 A;  4KSE B;  1S4E A;  1A0O B;  2YKQ A;  1D8Z A;  3K57 A;  1RAI B;  3HVA A;  2DGU A;  2FQQ B;  2ZDP A;  4F25 A;  3LPY A;  4OZ2 A;  3G82 A;  3HD2 A;  3MEK A;  4FYY B;  4NL5 A;  2HZV A;  4C8Y A;  1JLC B;  3IMQ J;  2XC9 A;  4AL6 A;  2DR9 A;  2M8H A;  3W2W B;  4CLY A;  5K20 B;  3KUE A;  3RTV A;  4JBC A;  3J7A N;  1WHW A;  4V1A k;  4DV5 J;  2ASD A;  2C2M B;  2ZE2 A;  2CWX A;  1LWF B;  3G82 B;  1VQN S;  3H2U B;  3T3F A;  4LF8 F;  3QMQ A;  2MKI A;  4C0B A;  4PEO A;  3HP6 A;  2AJ2 A;  2BE7 D;  2WBM A;  1FO1 A;  1WWH A;  4C8N A;  2P9E A;  9ATC B;  3THT A;  4WZM A;  3ZZP A;  1RWU A;  2X51 A;  3H4D A;  5DDQ C;  1U02 A;  2HFU A;  3ITH B;  4QYR A;  5J1E B;  1S0N A;  1EB0 A;  1N34 F;  4DQP A;  1J5E J;  3ILO A;  4K4S A;  2DNQ A;  3KHR A;  3VAH A;  4PYD A;  2GW8 A;  1G3O A;  3TVK A;  1RBA A;  3CCE S;  1OJ4 A;  2OSQ A;  4HTJ A;  4BS2 A;  3LAK A;  2ATL A;  2I0X A;  5KG7 A;  5KFD A;  1UEK A;  1VQ8 S;  2B9X A;  4ECU A;  1VS3 A;  1F2H A;  2DIS A;  2ZH2 A;  5GAE I;  1U2F A;  2W9B B;  1IKV A;  2FVP A;  2DY1 A;  2F4F A;  3W2V A;  4CRJ A;  2OML A;  3POT A;  3TUP A;  4LF4 J;  3DOK A;  4A8K A;  4DS5 A;  4JOU A;  4OJG A;  4TNO A;  2DGS A;  5I3U B;  1NSP A;  4MK7 A;  3HVR A;  5CD4 A;  4QYZ K;  5F8M A;  1H0H B;  5AT1 B;  4ZJO A;  1S7H A;  3AJ2 A;  3T1A A;  5RUB A;  2AP6 A;  1YWX A;  1KEK A;  3DU6 A;  1PO6 A;  4AXI A;  3MGJ A;  3NMA A;  1FNM A;  2HFV A;  3GFH A;  4XIU A;  5CCM A;  3C14 B;  1SL1 A;  1FX4 A;  1LWC B;  2HRY A;  3R5B A;  1UTA A;  2NXN A;  4U96 A;  2O66 A;  5K14 A;  4O4G B;  2AYG A;  3W5X A;  2RH3 A;  3IS9 B;  2O3D A;  3NS7 B;  1RE1 B;  4ALZ A;  4DR2 F;  1RAJ A;  1Q86 T;  4B3R J;  1TL7 B;  2XBP A;  4WK1 A;  1EET B;  2J8S A;  2ZUG A;  2XI2 A;  3MDF A;  1IBL J;  2Z2M A;  1OY9 A;  2OIH A;  2XS5 A;  3M6X A;  4CO4 A;  1OPI A;  4QCL A;  4K50 A;  1S49 A;  2XSF A;  2HLU A;  3PAC A;  1R0C B;  1UCN A;  2AJF E;  4UOF A;  3TZX A;  4QWA A;  4J9S A;  1U1N A;  1S57 A;  3M8Q A;  3KLI A;  1N36 F;  2IHR 1;  2QTW A;  4CNZ A;  1WKL A;  3TAM A;  3DYA A;  5FDL B;  2IVF B;  1GXU A;  4JI1 J;  4LSN B;  3OL8 A;  1RTJ B;  4Z7C A;  3V81 A;  4J9P A;  1RT5 B;  4ZPW R;  4EBC A;  3TA2 A;  4L74 A;  1M5V C;  1MLA A;  3GMG A;  2M9K A;  3LWL A;  3CCS S;  2ZVI A;  4YME A;  2BKN A;  3GYG A;  4RPF A;  2R7U A;  4WKY A;  2RAQ A;  4TQR A;  4OI1 A;  4Y0F A;  4Y28 C;  4PG6 A;  1RWW B;  1W25 A;  2W2Q P;  5C5J A;  4QWC A;  2W9B A;  3B82 A;  1NK6 A;  3OFH A;  1PIE A;  1VRU A;  4KGV B;  4MFB B;  4QQB A;  1KC8 T;  5F8H A;  1RU2 A;  2FLP A;  2BJ9 A;  1RT6 B;  2DNZ A;  4F26 A;  3DOK B;  1WSV A;  2B7C B;  3DMJ A;  3AA9 A;  1IR1 A;  2X3G A;  4UOC A;  5IT0 A;  3RBE A;  1DQ8 A;  3RR7 A;  1X4A A;  5EUH A;  2YH1 A;  1H7W A;  1GTH A;  1KFS A;  1LXN A;  5D3G A;  1IKY B;  4J90 A;  2VPY B;  3ONQ A;  4FN5 A;  4QPX A;  3PRD A;  3LGN A;  4X4Q A;  2NSB A;  3K5O A;  3TQ1 A;  3NCP A;  2YX7 A;  3I4H X;  4WYL A;  1AB8 A;  3CE8 A;  2NXE A;  3CDE A;  5KFZ A;  5K8N A;  3IAM 9;  3R6L B;  3QZ8 A;  2XCP A;  2ZH4 A;  1S97 A;  2PII A;  3ETM A;  3TAN A;  3SCL E;  3GJR B;  3R5G A;  2BBE A;  1FWK A;  3OR2 B;  4QWE A;  4Q7A A;  1B3T A;  1U26 A;  3W5Z A;  5E5N A;  1LWF A;  2PMH A;  1JKH B;  1C1B A;  4LF2 A;  4PWU A;  3V4M A;  1TR0 A;  2DD8 S;  5HL7 Q;  3D4J A;  4J9V A;  4KBI A;  1J5O A;  3FRY A;  2ZNZ A;  3JSY A;  4J7C A;  4CNY A;  1HNW J;  4N8N A;  5CCL A;  4GVL A;  2DNH A;  5ETL A;  1TKT B;  4CH7 A;  2FHJ A;  2CZ4 A;  1FK9 A;  3Q8R B;  1WTB A;  1NKB A;  1G6B A;  1KOH A;  3PG9 A;  2BOP A;  4J9M A;  4DUZ J;  4GKJ F;  2X1B A;  1U6B A;  1WOS A;  3MCS A;  4HR2 A;  2JLE A;  4ID8 A;  2C28 A;  1RAF B;  3C15 B;  3CJ0 A;  4Y2M A;  1P6T A;  1S6U A;  5E3A A;  3J7Z 5;  2HSE B;  5CZX A;  1CSJ A;  4FXD A;  3BR8 A;  4F3M A;  5GAG I;  5HMY A;  1V5I B;  2XZW A;  5KT7 A;  2XY5 A;  5C25 A;  3G8Q A;  5ETR A;  2DHH A;  2VD3 A;  4BWM A;  4AYB D;  1VLY A;  2GVZ A;  2J9D E;  2NUU G;  1LK5 A;  3C6T A;  3MM9 A;  3CJK B;  3MMA A;  4ZHR B;  3IN5 A;  4ILL A;  5DG7 A;  2RDI A;  3CJ2 A;  3W8P A;  7FDR A;  3D6H B;  1NK8 A;  2DPI A;  2UUB F;  1NU4 A;  4ZCI A;  1HIY A;  1SIZ A;  2DKO B;  1SPB P;  1D1U A;  3GP9 A;  2LEA A;  3EPI A;  1DAX A;  4YY3 J;  3W9J A;  5FD1 A;  4P2S A;  2NRE A;  3SI8 A;  1UP1 A;  2G2Y A;  1SC1 B;  1GX5 A;  1TTH B;  4KO0 B;  4OFZ A;  2IC3 B;  4EWT A;  3RB3 A;  3DN9 A;  1VQ6 S;  3CGI A;  4LSL B;  3NAI A;  5KFB A;  5DLF A;  5F8I A;  2Y0B B;  2BW2 A;  3LAM A;  5JXS A;  2IVM A;  1P27 B;  2DTJ A;  5HRO A;  2R42 A;  2BQU A;  4GRS A;  4L3N A;  4F4X A;  1JB0 C;  4DV1 J;  2PGC A;  5HAN A;  2L9D A;  3QGI A;  4NA2 A;  3PXG a;  2KZZ A;  2XLK A;  1XK8 A;  2VFR A;  4KKO B;  3WIV A;  4DPY A;  4DV7 J;  2V8V A;  3MPD A;  1Q53 A;  4WXW A;  3ZC4 A;  3P49 B;  4NLD A;  4DLE A;  3DLB A;  2UXB J;  3H90 A;  1EX8 A;  1NHU A;  2KI2 A;  3EZU A;  3BYR A;  2KM8 C;  4I2P B;  7AT1 B;  1VQM S;  4BBY A;  1Y3K A;  2BKO A;  1H2V Z;  3B8H A;  3UDV A;  5HN0 A;  4DFP A;  2MY8 A;  4O44 A;  2KN4 A;  3M8P A;  1KVJ A;  4DFK A;  1C1C A;  2QG9 B;  2BOA A;  4NOH A;  1U1L A;  2BRK A;  2ADC A;  4BC9 A;  4HAC B;  4RO0 A;  4LFB J;  2NPI A;  2YPZ A;  2GO8 A;  3BH7 B;  2LKZ A;  2UUA F;  4JI7 J;  2JL9 A;  2X1F A;  2DR7 A;  1B0P A;  4KGX B;  3UPF A;  4B3T J;  4FBU A;  3B6B A;  4IO9 Q;  5F8J A;  2P9C A;  2GGP B;  8ATC B;  2MKS A;  5F41 A;  1XER A;  2F40 A;  2C1E B;  5HP1 A;  2OJ3 A;  2K1R A;  3MEC B;  3G87 A;  2JVR A;  1TP7 A;  4ZCM A;  5C7P A;  3J81 j;  3T1H J;  1SL0 A;  2AKW B;  3FCW A;  4OYA A;  1JXE A;  1RBO B;  2HBQ B;  2IJN A;  1MG7 A;  1VIX A;  1WOO A;  2KFN A;  5KG3 A;  4JI5 F;  4ZN1 A;  1RWK B;  2GGP A;  1PC4 A;  4RNF A;  3QGH A;  4G3I A;  2OPS B;  2XMK A;  2CQC A;  3B54 A;  4I2Q A;  4DV2 F;  3S01 A;  1FFS B;  1VIS A;  1AT1 B;  3ISZ A;  2FJE B;  3SFG A;  3FMB A;  4NLG A;  2E5H A;  2VDH A;  2HLT A;  1KD1 T;  4JI1 F;  5B0A A;  1Y3J A;  4M94 A;  4ED7 A;  2CQ1 A;  3I31 A;  2XS7 A;  3ILL A;  1RWN B;  3M8Z A;  2MQP A;  3FSY A;  1YQH A;  3R1H A;  4ED8 A;  5FLX Y;  2HBY B;  2VKR A;  1SKW A;  3AOD A;  4IKA A;  1JNZ B;  1RIS A;  3SSQ A;  2M2B A;  1Q8B A;  1ROF A;  4C3L A;  2CWK A;  5KFR A;  2VA3 A;  3QT7 A;  3US5 A;  2BM0 A;  2UVU A;  3WBZ A;  3JXO A;  3EM1 A;  2QFJ A;  3EE3 A;  4FKX A;  1IBM F;  1TQL A;  2CJA A;  1AZS A;  2MQN A;  2QX0 A;  2V5H G;  3J80 U;  5FII A;  4PPD A;  2ZE2 B;  2ZH7 A;  2FLL A;  4GKK F;  1WHX A;  2HBZ B;  3BSN A;  4DXL A;  1S79 A;  1R8C A;  4UUW A;  1LW2 B;  3SSS A;  5LSL A;  1LFW A;  2CA9 A;  3MTJ A;  4NX9 A;  2OPQ B;  1H2U X;  2Q79 A;  4K4T A;  2UVV A;  1VBK A;  3TAQ A;  1FE4 A;  1CJT B;  1F6T A;  1S1V A;  2LP4 A;  3BO2 A;  3IGN A;  2E29 A;  4ZVF A;  1OO0 B;  2IPO B;  2E7W A;  3AXM A;  3OXG A;  3TR5 A;  4I0W A;  4YR3 A;  2XLI A;  3UCU P;  4CLZ A;  2FC8 A;  4DL3 A;  1G4C A;  3OTO F;  2Y9H A;  5B0C A;  4MK9 A;  4P7T A;  3M8W A;  3KJV B;  3EYZ A;  2ZBR A;  3HHL B;  2K1R B;  4TN2 A;  5DLG A;  2KH9 A;  2RQC A;  1YJ7 A;  2FDN A;  2QJ3 A;  3MM5 B;  3FK4 A;  4NYO A;  1U6Z A;  5HBM A;  1YDL A;  2LMI A;  1MN7 A;  1Y4Z B;  2YX1 A;  4KYZ A;  3KYL A;  3IAS 9;  3BN7 A;  1B0V A;  2Q3P A;  3DM2 A;  3LA0 A;  4HI2 A;  1BGX T;  2MKH A;  3ZO7 A;  1HHT P;  1IKX A;  2NCK L;  3IC1 A;  3VVT A;  1OIA A;  4CTA B;  1WKK A;  4DBQ A;  4CO3 A;  1EQ0 A;  2RF2 B;  2B9W A;  3CO0 P;  2QA4 S;  1I3O B;  1IKW A;  2IA6 A;  4ZIW A;  4RW4 A;  3OL7 A;  2HQF A;  1F0X A;  2WVC A;  3GFX A;  2WSE C;  5HVG A;  5J2Q A;  2KDO A;  1FNX H;  4DSJ A;  3QIP A;  4KV8 A;  3LF0 A;  1WC5 A;  2RU3 A;  3CJS A;  4WFN Q;  5THW A;  3CF5 Q;  1R0A B;  2ZOG A;  5B7W A;  3Q8U A;  3FEY B;  4U7U D;  1GMV A;  1OYD A;  2OGU A;  2QLB B;  3DXS X;  3R3T A;  2LA4 A;  2MJN A;  2MST A;  4JI8 F;  4X62 F;  4EI2 A;  5E7O B;  3KK1 A;  1NPK A;  3G4S S;  1HBM A;  2XCA A;  4JYA J;  2HHQ A;  2MZT A;  3NLC A;  3WQP A;  3LOU A;  1OS5 A;  2HWH A;  2V4J B;  3FJ2 A;  3VZI A;  4EO6 A;  2W9A A;  1QUV A;  1JWW A;  2W1B A;  1YJV A;  1N56 A;  1ITP A;  3TP2 A;  1URR A;  1FHT A;  4ATN A;  4PUO B;  3NXZ A;  4ILM A;  2VH7 A;  1XEZ A;  3SCI E;  5D8H B;  3TUZ C;  3HVT A;  5A8K A;  2H51 B;  2J6T A;  2Z4P A;  2XYP B;  3PRB A;  2KJW A;  3CW2 C;  1H6K X;  2CXE A;  3DLK A;  2ZUA A;  4QWD A;  1M0S A;  3AQO A;  3HHK A;  4ES2 A;  1UA1 A;  3PY8 A;  1SB6 A;  4C11 A;  2GAG C;  2HZC A;  2CPJ A;  5HJX A;  3W60 A;  3PYF A;  3MEC A;  4DX5 A;  4ECZ A;  4RW9 A;  1WF0 A;  5A8W B;  5KFH A;  4X4T A;  3MUV P;  1DTQ A;  1GQE A;  4FYV B;  4F3O A;  4LFC J;  2ILY A;  5HBM B;  4LR8 A;  3W8G A;  4RWX A;  1K8A T;  2UUC J;  2YNH B;  1HI8 A;  3D0G E;  1SH2 A;  5LJ5 Y;  3DLL Q;  3NG8 A;  4IH6 A;  2CVE A;  1NK7 A;  2ZZT A;  3EVM A;  4A8F A;  3OR1 B;  2VB6 A;  5T7L B;  3U1L A;  5HSP A;  1PJ5 A;  4X4P A;  3SBM A;  3PX6 A;  4A8S A;  1EP4 A;  4DG1 A;  5EX3 A;  3BQ2 A;  1XC9 A;  2W9C B;  1BWV A;  1M1G A;  3ZTO A;  5CH7 B;  2ZFH A;  1WC3 A;  1FRK A;  3I96 A;  1E6V B;  3UO0 A;  4CO0 A;  5B08 A;  5DQG A;  2RDJ A;  1RA6 A;  2MQL A;  3V6D A;  2HGM A;  3GE9 A;  1S6Q A;  4BCA A;  3R7S B;  4P52 A;  2MB0 B;  2R2S A;  3O5T B;  4CDI A;  1EQM A;  2WW4 A;  4ECX A;  4H4K C;  3WZ0 A;  2V34 A;  4I6Y A;  2C2D A;  4B02 A;  3K17 A;  3GV8 B;  1XNQ J;  2J9D A;  1SJ1 A;  1RWX B;  5K8O A;  2L41 A;  2JEI A;  2UUB J;  2DK2 A;  2DT9 A;  2W4D A;  3H5X A;  2LEC A;  2G1H A;  1LW0 B;  1N5V A;  3UN5 A;  1S10 A;  3D66 A;  1JLC A;  2D3Z A;  3LPE A;  3UD3 P;  1PBU A;  1A9N B;  3QJL A;  2R7V A;  3NGK A;  2EKY A;  1NDK A;  5C24 B;  1TKT A;  1S6P A;  4FF4 A;  1N5S A;  3BO4 A;  1S1T B;  4MYT A;  3EX7 B;  4NXM F;  3HM9 A;  4DF4 A;  2UXD F;  2H9Z A;  3X3U A;  2XSJ A;  3RB0 A;  3D6F B;  4I6A A;  2MPU A;  1RK8 A;  4J37 A;  1WF1 A;  3VAK A;  2DIT A;  4FYX B;  2W8K A;  2GHP A;  1RCO B;  1UVN A;  2MTL A;  4LIW A;  3QWP A;  4M5N A;  4NML A;  2HHW A;  1BHN A;  1CBK A;  2L08 A;  3TW0 A;  4N77 A;  4ELU A;  1IKV B;  1SJR A;  3P96 A;  3O3L A;  2ACY A;  1D9F A;  2EG1 A;  3P45 B;  4K7Q A;  4Y2C A;  1JJ2 R;  5I3Q A;  2HK3 A;  1TAQ A;  2CRL A;  1ZOT A;  4NZ6 A;  1VBY A;  2H54 B;  2JLG A;  2DRB A;  3UN2 A;  1SCJ B;  1ZZN A;  2JFK A;  1W7W A;  4CP5 A;  2KM8 B;  3DI6 A;  2OD6 A;  4EZ6 A;  4GVB B;  2ZBP A;  1L3S A;  3LAN A;  3MFI A;  3Q8V A;  3R9L A;  1H2T Z;  1RT7 A;  1WC0 A;  4MTP A;  3CJ4 A;  4E0D A;  1XNR F;  3UE2 A;  1HPZ A;  3BKU A;  1R6Y A;  3B4M A;  1MRO B;  2LU2 A;  1UJ4 A;  3MPW A;  2W4C A;  3OTO J;  1N5Q A;  2G2Z A;  1RHQ B;  2I9S A;  4DV1 F;  2R7X A;  1PJ6 A;  3HCX A;  1HLW A;  1FDD A;  5JJB A;  2GIQ A;  4C0H A;  2FHM A;  2EBE A;  1U45 A;  2CJK A;  3VHQ A;  2AT1 B;  3OVS A;  2KT5 A;  3CCV S;  2BAN B;  2FLO A;  2M88 A;  2PEH A;  1U8W A;  1HFE L;  4F4A A;  1X5S A;  4RBT A;  1JLQ A;  4XK8 C;  1FA0 A;  2V94 A;  4LFA J;  1HYS A;  2OPP A;  3OR2 A;  5MLC V;  2LA6 A;  3LGH A;  3TAM B;  2DR8 A;  1TUG B;  1CEZ A;  4M5M A;  1FJC A;  2PFF B;  5SUH A;  4N8O A;  3WDO A;  1RAH B;  4ED3 A;  3CDW A;  3JTN A;  4DMZ A;  2OAU A;  2OEL A;  4NWB A;  3GFZ A;  5HQM A;  3VQT A;  4JI3 J;  1UJ6 A;  3DGV A;  1DTQ B;  3GU0 A;  2AEF A;  2JFD A;  3EVW A;  1F3F A;  4Y2K A;  1TUV A;  3SCJ E;  5KG0 A;  2VQE J;  3BQ0 A;  1BLU A;  3CD5 A;  3BV8 A;  4P73 A;  3T6J A;  2P5V A;  3KUH A;  4J9U E;  5AXN A;  3FRZ A;  1RI7 A;  3QRP A;  1X5T A;  2OEM A;  1TL3 B;  3BDE A;  3NCQ A;  4M1K A;  4DLG A;  1GH8 A;  4B3M J;  2HHH F;  2AMC B;  1ZZF A;  3QSY B;  1EP4 B;  4DG1 B;  2C2R A;  4ZVG A;  2HWI A;  1KQS R;  3BDP A;  1UVM A;  3HHD A;  4I69 A;  1Q7L B;  4DR7 F;  2GJ2 A;  1UL3 A;  4QU7 A;  2LDY A;  5EDW A;  3BGR A;  3ITH A;  1K47 A;  2HFO A;  1T9Y A;  2MQM A;  3B4D A;  3CDA A;  3HLU A;  4ENO A;  1P8G A;  4FXW A;  3LP2 A;  5BR8 F;  3A3P B;  2OUG A;  3JS9 A;  4QJV A;  4F36 A;  1UPM B;  2HS4 A;  3EDR B;  4MFB A;  2FJD B;  4OZN A;  4P9S A;  2YNF B;  3NP5 A;  3RGI A;  4DUT A;  4PG8 A;  3O6Q A;  2EK1 A;  5HLF A;  5C42 B;  3E01 A;  4LRC A;  2VBZ A;  2N7C A;  2YKA A;  4ZKA A;  4YB1 P;  2A2C A;  4UQT A;  1JLB A;  4KR0 B;  1RP5 A;  2FIU A;  2KO1 A;  2CNN B;  4CLW A;  4J9R A;  2M52 A;  1UET A;  2WON B;  1UA0 A;  2OPR A;  1RLC L;  1RT4 B;  2R3V A;  2PSZ A;  3I9Z A;  3IXQ A;  4E8U A;  2UUA J;  4JI7 F;  2C3M A;  4M63 A;  4LT6 A;  1OY8 A;  3HHL C;  3FQL A;  1FJG F;  2A1B A;  3NOG A;  2BAN A;  1AW0 A;  1FRH A;  2W2M P;  3TWZ A;  2N3O A;  1F2G A;  1WG5 A;  4ECS A;  2Z2Y B;  1VQP S;  1DQA A;  3NRB A;  5L46 A;  2JJ4 D;  2JEJ A;  3A4T A;  4AQY J;  5ETN A;  4DUY F;  5H1S V;  4WIQ A;  1N6Q A;  2IM0 A;  3Q22 A;  3SEO A;  4W4M A;  2E1P A;  2UV8 G;  1HWU A;  5M2R A;  5T14 A;  3KK3 A;  4DV3 F;  1I6J A;  3N5F A;  4ECV A;  3QZ7 A;  1DTT B;  1T8E A;  4NA1 A;  5BYS A;  4YOE A;  2HWT A;  2DNY A;  5KFA A;  5HQL A;  2ROP A;  3PJW A;  3KG4 A;  4WII A;  4DX7 A;  4JYA F;  1K1S A;  2MDA A;  1NJX A;  1YJU A;  3LAL A;  1NND A;  3MMA B;  2MSS A;  1PC5 A;  3M30 A;  1HW8 A;  3MEE A;  3OFE A;  3RJM B;  3TRG A;  5DG9 A;  3LWM A;  4TLQ A;  3DRY A;  2G0C A;  1RTI B;  1QVG R;  2YX4 A;  4NI2 B;  3W9I A;  2GJI A;  2QLF B;  3AY0 A;  2CZ9 A;  3IA0 A;  2ZHA A;  4JI4 F;  2BJ3 A;  4KIA A;  4MMO A;  3S1T A;  2CJX B;  4JI4 J;  2CVI A;  3RW7 A;  2D74 B;  4AT1 B;  5KFN A;  2FVQ A;  4IR1 A;  1FDA A;  4NEZ A;  2CAJ A;  2K7J A;  3L3C A;  1RTI A;  2V8P A;  1JXL A;  2GO9 A;  1KVI A;  3P6Y C;  5GAH U;  2F8E X;  5A76 A;  2GV1 A;  1PIL A;  1JLG B;  2WON A;  1O5J A;  1Y7P A;  2AX0 A;  3Q8S B;  3OTC A;  5HK4 A;  2KJV A;  2CQB A;  2YQ0 A;  2CPZ A;  3MCO A;  3M6V A;  3PR5 B;  2ZOF A;  1U48 A;  1C1B B;  1NZ8 A;  1T95 A;  1WEY A;  4KV8 B;  2HQ3 A;  2CNK B;  4ECT A;  2VG5 B;  2FGO A;  3R2C J;  1ZM9 A;  2KVI A;  1QTM A;  1EAY C;  4HTI A;  4LFA F;  1N32 J;  2VJV A;  4DUY J;  4AQY F;  1HI0 P;  2FY1 A;  3GPA A;  3MMB A;  1VOM A;  4N41 A;  2HPU A;  1Q1K A;  3CD0 A;  3QFW A;  1CJK B;  1RWO B;  2VZ9 A;  3NS6 A;  2WB4 A;  2ZJR Q;  4ES3 A;  3EJM A;  1VQS A;  3P5T L;  3N6M A;  1MU2 A;  1UKU A;  5ADZ A;  2DY9 A;  3C8Y A;  4OYI A;  2QA4 G;  2DIV A;  4M5H A;  3A12 A;  1R0B G;  3O44 A;  5J2P A;  4JV2 A;  1RAD B;  2BRL A;  3KNA A;  1JKH A;  5D0E A;  3M8Y A;  5CD4 H;  2EFV A;  4FPR A;  1CG2 A;  2RU9 A;  2VHG A;  2B56 A;  5BJR A;  2DGO A;  1C0T B;  3KKF A;  4TY9 A;  4DN0 A;  3S6E A;  3TOQ A;  3PX4 A;  2GHW A;  4C0O C;  5HVH A;  2CG8 A;  2G2O A;  2IDL A;  4WXO A;  5BR8 J;  4DQR A;  4X4S A;  4WF9 Q;  3MR5 A;  2VG6 A;  3FCH A;  3G6Y A;  4QR1 A;  3I55 S;  1N8R T;  1FCA A;  2OEK A;  2YVS A;  4DR7 J;  1FVQ A;  2HQI A;  5IM0 A;  3KJV A;  2ILZ A;  4FNH A;  1Z4U A;  3IBW A;  3BJY A;  2VIC A;  2ZIT A;  1LXJ A;  3QAE A;  4KQZ A;  5DG8 A;  4OHV A;  1AFJ A;  2B4U A;  3JQK A;  3G6X A;  5H9F J;  3V5R A;  1U1P A;  1F9E B;  4DV5 F;  1WAC A;  1SQF A;  3KLF A;  2YNI B;  2XMW A;  2N7Y A;  1GMW A;  2DNO A;  2EFQ A;  5LSR A;  3V81 B;  2MLX A;  3D3C J;  3HPO A;  4EBD A;  4KT0 C;  1ZET A;  3CJT A;  4OYP A;  3OV7 A;  2HHT A;  4NMX A;  4NYP A;  1URN A;  2HHP A;  1FF2 A;  3Q86 A;  2HAI A;  4X4R A;  3FCV A;  4UF4 A;  1MW7 A;  1UWB B;  3E51 A;  4DPU A;  3QT6 A;  4M95 A;  4QU6 A;  3MMB B;  4MYU A;  3CVK A;  4DPW A;  4I2P A;  4USU A;  3CC2 S;  4UY8 T;  3QRR A;  8RUC A;  3NGU A;  4CI0 B;  3TI0 A;  3MMC B;  4C8L A;  2DB1 A;  1R0A A;  4ZOS A;  1FKO A;  5HRO B;  4LRA A;  1MWQ A;  1N52 B;  3R97 A;  3AJ1 A;  3BGU A;  1X7V A;  2QYG A;  1YRT A;  3MM7 B;  3RBZ A;  4Q8F A;  1QLN A;  1TVR A;  4RKU C;  2KFY A;  5C2C A;  3PZP A;  1FRL A;  4RUA A;  1IBL F;  2DGT A;  3PW0 A;  1VFJ A;  2NYI A;  3DRP A;  4M5I A;  2Y1J A;  3DXB A;  2JLF A;  1ZTT A;  1L3T A;  2WVB A;  3VZH A;  1XNR J;  4GO7 X;  4ETX A;  1Y5L B;  3SQO P;  5J2M A;  4F02 A;  2KU7 A;  4HKQ A;  2VPW B;  3KLE A;  1B7F A;  3MAA A;  5AJ3 J;  3Q23 A;  2PMW A;  3HT3 A;  4DR5 F;  2EEY A;  2VPZ B;  4F4W A;  3MM9 B;  3CJK A;  2ASJ A;  2IY5 B;  4OJ3 A;  3W66 A;  1X9S A;  1R3N A;  3I82 A;  2H48 B;  3RU0 A;  2HHS A;  1WTF A;  3HFK A;  3SDE B;  1WKJ A;  3I6P A;  2LXI A;  3HHL A;  2LQ8 A;  3EIC A;  1Y10 A;  2Q43 A;  1I5O B;  4IG3 B;  3Q8Q B;  3M9N B;  3CJR A;  3HXM A;  2R8J A;  2J7W A;  2VG7 B;  4LF7 J;  2E7V A;  4OLO A;  1S1X A;  1HWK A;  1B0T A;  2FYX A;  2JRS A;  1JJC B;  3CJ8 A;  3M4X A;  3ZNJ 1;  1W2B R;  1IBK J;  3W7B A;  2DGW A;  1R8P A;  3M7V A;  2GX8 A;  3TZZ A;  3UDL A;  1D8Y A;  5IC4 B;  7FD1 A;  4O3O A;  3KMS A;  3BSA A;  2GNK A;  3NL0 A;  4TLR A;  4DFM A;  1SJ4 P;  2X7I A;  4MKA A;  1FTC A;  4Y6I A;  2RSQ A;  4DZ6 A;  3KLG B;  1X4E A;  3DRX A;  6FD1 A;  5D78 A;  2HVZ A;  2XMU A;  2N3L A;  4CWB A;  2ASY A;  4ZVH A;  3K5M A;  3MMC A;  2XB2 D;  2F7V A;  1OSD A;  2V4J A;  4KKO A;  4DV6 J;  1X0P A;  1BXN A;  1U0H B;  2EK6 A;  3KUG A;  4QIV A;  5EN1 A;  3H59 A;  2WZ1 A;  2VJU A;  1V3R A;  1FWL A;  3GYN A;  4ZLP A;  1HBN B;  2XQC A;  3GSD A;  3FVY A;  3GJT B;  4LF1 A;  4LJM A;  2BR0 A;  1UVJ A;  2HAF A;  2DHG A;  2XM3 A;  2KT2 A;  3I0S A;  4HH1 A;  4EZ9 A;  2DEI A;  3T19 A;  4LF7 F;  4OX9 J;  5FJ4 A;  1L3U A;  3EUN A;  1FDN A;  4FNI A;  4C7Q A;  2AV5 A;  1HI1 A;  5BYR A;  3VAG A;  5D0R A;  3NS5 A;  4OQJ A;  1UAW A;  1NAQ A;  2W01 A;  1HBN A;  3ZZT A;  5KFW A;  4LRB A;  1HBO B;  3RBD A;  1MWZ A;  5A6P A;  2RB7 A;  1NKE A;  1M5O C;  1IJE B;  5ETS A;  2XS2 A;  4DX8 H;  1RB0 A;  2EBG A;  5KFJ A;  4P71 A;  5HQ8 A;  3UW1 A;  2V9W A;  4DR6 F;  1Q16 B;  4X2B A;  3PIO Q;  4I6W A;  1NLK L;  5D4P A;  2YNG A;  2I6W A;  5CYM A;  1SC4 B;  5ETP A;  1RA7 A;  2CYY A;  3MPV A;  4RW9 B;  2AGQ A;  1S1U B;  2OFH X;  1EJ7 L;  4ZCL A;  1RTH A;  2K3I A;  1NDP A;  1CJT A;  1S1V B;  3Q83 A;  4Q2M A;  5DZ7 A;  3MM8 B;  3A1Y G;  4XDC A;  4ZVQ B;  3GII A;  5KFY A;  2YNH A;  4LVO P;  1C0U B;  4USW A;  3G2X A;  5KFE A;  3EZ5 A;  2I5J A;  3PEJ A;  3FZB A;  4FZV A;  5DRK A;  1SL2 A;  1S1W B;  3NBP B;  1SVD A;  1KN6 A;  3M2U A;  2CJB A;  3Q2S C;  2HK2 A;  3MUM P;  2D1C A;  4P10 A;  3E01 B;  2BVZ A;  1AXQ A;  3KK1 B;  3RRG A;  3VGU A;  4K4U A;  1VJQ A;  2VFT A;  1HBM B;  4GKK J;  2PE8 A;  3K5N A;  1NK0 A;  4ZS6 A;  3KJQ B;  1IKX B;  1WHV A;  4F3Q A;  2L48 A;  4QIW D;  2F4V J;  2HW3 A;  4L6V 3;  1LWC A;  3CTR A;  5AXL A;  3GJQ B;  1U6F A;  1FDB A;  4RW4 B;  5K14 B;  4CO5 A;  4K0K J;  1D09 B;  1RAB B;  1J27 A;  2DJW A;  5J2N A;  1WG4 A;  5U47 A;  5IT4 A;  4WYW A;  4JI8 J;  2V8H A;  1RZM A;  1TL7 A;  1U2C A;  1E6Y A;  4PR6 A;  4HL9 A;  2NXU A;  2UV8 A;  3UI3 A;  5IWA J;  1RT2 B;  4C8K A;  4RUB A;  1CS4 A;  4UUX A;  5L1K A;  2RS2 A;  1XWL A;  4DS4 A;  2BAB A;  4MAK A;  3J7A 1;  1F60 B;  1KS2 A;  3OL6 A;  4R5P A;  2DHA A;  2FTR A;  3GG1 A;  2Q6C A;  2C42 A;  1XMQ J;  1RTD A;  2V63 A;  1Y11 A;  4IOC Q;  4DCO B;  3QJJ A;  2P6S A;  4WP9 A;  4LRE A;  2KL8 A;  4CO2 A;  4RW8 A;  4DR3 F;  1IM6 A;  4W98 A;  1YBA A;  3J7Y U;  1Y5N B;  4U9R A;  4DR1 F;  2FVC A;  2X3D A;  3RB6 A;  2LQJ A;  4ZMM A;  3OTE A;  3TUJ C;  5B0G A;  4LQ9 A;  3L4B C;  3JSR A;  1V3Z A;  1ACM B;  2B6A A;  4IO1 A;  4HHH A;  1SI9 A;  3MAH A;  2V67 A;  4PQU B;  2JOQ A;  4TYB A;  1ZM2 A;  4PG4 A;  5J1E A;  4B3T F;  2VC1 A;  3ZZ0 A;  3F44 A;  2WSF C;  1T7P A;  2R2T A;  5HAO A;  4E98 A;  1TKD A;  1FVS A;  4B17 A;  4NCB A;  3A8I A;  4DQI A;  2RIJ A;  3W64 A;  2IBO A;  5KT6 A;  3EGZ A;  4RU9 A;  2IJF A;  4KH0 B;  2AYE A;  2HRT A;  3BKT A;  1BMQ B;  3BPD A;  3HSG A;  6FDR A;  3D2W A;  1M1K T;  2AYB A;  2PI4 A;  4QZV B;  4F0K A;  3FZ2 A;  1T02 A;  2F8H A;  2E66 A;  4A47 A;  2JSX A;  2ZBI A;  3CT9 A;  5KFM A;  5H9E J;  2YNF A;  4OZL A;  2EFP A;  2BUN A;  1OY6 A;  2VFV A;  4OYZ A;  4WPA A;  2N4D A;  3DLJ A;  2VPX B;  1YTY A;  2J76 E;  1P1T A;  2R2R A;  3BPS P;  1JLB B;  1YG0 A;  3M9M B;  1IBM J;  4NXN F;  3M8Q B;  3BS9 A;  4B9U A;  4IH7 A;  3SSR A;  4DQQ A;  3JSM B;  3DLE B;  4P74 A;  5KFL A;  2N82 B;  2C3U A;  2VFU A;  3HDS A;  2UUW A;  2NXC A;  3ENA A;  3QNW B;  1B99 A;  1U25 A;  3AD7 C;  4L72 B;  4ZVE A;  4M5L A;  4CYU B;  3I56 S;  2UVR A;  1BQN A;  3R5J B;  2W2P P;  2XMV A;  3ZXW A;  1SH0 A;  5G4D A;  2XZT B;  3CXC R;  4DSF A;  1NCL A;  3IS9 A;  2HQC A;  4NCG B;  5G0R B;  4ZK7 M;  2OTJ S;  4NZ0 A;  4UOG A;  3OSP A;  2D9O A;  3QGP A;  3UCG A;  5L1J A;  3QFH A;  1A6L A;  4A46 A;  4ZVR B;  2BV3 A;  1R27 B;  4DFJ A;  1YRU A;  5ETM A;  4C3M A;  4DV2 J;  4ERD A;  4M5K A;  1VRU B;  4ZP6 A;  2O5D A;  3CIM A;  3H2L A;  4YY3 F;  2EVZ A;  4ITS A;  3N28 A;  1DTT A;  4JI5 J;  2PA3 A;  3WHI A;  3PJX A;  2H4Y B;  4KJI A;  2MQ8 A;  4LSN A;  1VLO A;  3CCW A;  1CUL B;  1NKC A;  1VBZ A;  2AEJ A;  2RJZ A;  5KFF A;  2C2E A;  3MR6 A;  2BX6 A;  4ZHR A;  3I5A A;  1SUQ B;  3PR4 A;  3C6U B;  3DLH A;  2AHO B;  2VBX A;  3TEH B;  3P3D A;  5I4M A;  3QPI A;  5GMK a;  4Q45 A;  2MZ1 A;  3G96 A;  4DV3 J;  4LRF A;  5LMU F;  3K8V A;  1NJY A;  4FYW B;  2J0X A;  2NZC A;  1N33 F;  4ZIT A;  4I4B A;  4USI A;  3KOA A;  3PHE A;  4KC5 A;  2B9E A;  3MED B;  5JUM A;  3IRW P;  1TV6 B;  2HNY A;  4DEZ A;  1RT3 A;  2F3J A;  2PI5 A;  4OI0 A;  4ZVO B;  1HNX F;  3BBF A;  3FC9 A;  2ZH6 A;  1KON A;  3OQ2 A;  8AT1 B;  2ZBQ A;  2C3O A;  3NNC A;  4LR9 A;  1IWG A;  2XG8 A;  3GIR A;  5DM7 Q;  4EEY A;  2ACM A;  5IV4 A;  4DV0 F;  2LQ9 A;  2DVI A;  2XEX A;  1S9F A;  1NK9 A;  2BW7 A;  3ENW A;  4ZN3 A;  4TU7 A;  3MEG B;  2BJ1 A;  4DV7 F;  3BBC A;  2I1R A;  2PA8 D;  5F9N A;  3IR7 B;  4IG0 A;  4DL5 A;  3M8R A;  2CUY A;  3DDN A;  5JVH Q;  2AGO A;  5D6G A;  1PAU B;  4IDK A;  4M5D B;  3TYT A;  2AJQ A;  1KBR A;  2IAJ A;  4RW8 B;  1RDR A;  1QUP A;  2JDJ A;  1PAE X;  1TL3 A;  3OT9 A;  2ALZ A;  4F67 A;  4F0M A;  3ZZY A;  1ZAV A;  2QLW A;  2QMX A;  2ZWP A;  1RT1 B;  4ZVS B;  2IRU A;  4WU3 A;  5KFO A;  2VOO A;  4ZLJ A;  1GX6 A;  2J8A A;  2E1A A;  4CLL A;  3QBC A;  2Z56 B;  3UD5 A;  5L1L A;  1HL6 A;  4RW7 B;  2IJR A;  5D4L A;  5LL6 d;  2M0G B;  2KXF A;  3MCN A;  1QSS A;  2LXU A;  1JLF B;  3GLJ A;  1XJW B;  2CJ9 A;  1IQT A;  5SZT A;  2E5L J;  2HNZ B;  3V4I B;  4ES1 A;  3A3O B;  4A8M P;  4JI6 F;  2B5J B;  1CJU B;  3DOM A;  1LQ9 A;  1FJ7 A;  3CMA S;  2VU5 A;  4PXC A;  2Z58 B;  2VQF F;  2VOD A;  4PWD A;  3ETO A;  4NLQ A;  5A2Q U;  3SCK E;  2FJX A;  2MHN A;  2HMI B;  2MQQ A;  3K5P A;  1HW9 A;  2BEF A;  3KDO A;  3PDN A;  3BF4 A;  1HPZ B;  2OKQ A;  3QO9 A;  4NLT A;  3TUI C;  2YPY A;  1LV5 A;  2Z2Z A;  1ZBT A;  4KY3 A;  2VG5 A;  4DZD A;  3MMJ A;  3JYT A;  1K73 T;  3FBE A;  1ZM4 A;  3BGR B;  1S9E A;  1WD6 A;  3DDI A;  3N6N A;  2NSC A;  1Y00 A;  1NJW A;  2JX2 A;  5E41 A;  3VTI A;  3CCU S;  1ZYQ A;  3U1N A;  1RAE B;  2QLX A;  3JQJ A;  5H9E K;  4E2F B;  1JIH A;  1BUX A;  3AB4 B;  3M32 A;  2MKC A;  1KKH A;  2A2D A;  3CCJ S;  4DSL A;  2QO3 A;  1YLX A;  1KHW A;  2EFO A;  4HT7 A;  2HHU A;  2HHV A;  4O3Q A;  3W2W A;  1REV B;  1R7I A;  2J7U A;  2MZJ A;  4N5S A;  1R89 A;  2J0Q D;  3BB5 A;  2ZH8 A;  2GAH C;  3VAF A;  3H2V E;  2AJ4 A;  4I1T A;  4Q0B A;  3CDB A;  1VQO S;  1BD6 A;  3LP0 A;  3JAM U;  2O67 A;  4FDF A;  1U1R A;  5D4O A;  4TU9 A;  3TX8 A;  2F9D A;  3DOL B;  1RSC A;  2GQ2 A;  2CQ2 A;  2IDE A;  1REV A;  1IN0 A;  1SKU B;  4KE5 A;  1SKS A;  3CME S;  1MNE A;  2RRA A;  3IWX A;  4RU2 A;  2DO4 A;  5JVG Q;  2DPJ A;  2C3P A;  3QQC D;  2WK4 A;  4MT1 A;  2JC0 A;  4QIG A;  4USM A;  2ZJQ Q;  2E9Z A;  2FB0 A;  4EO8 A;  3OLA A;  2ZM6 J;  1S77 D;  2X1A A;  4RWW A;  2GVZ B;  3TJ9 A;  5HMX A;  3U27 A;  4P2X A;  3C6T B;  3RYL A;  1X4F A;  3CED A;  2A10 A;  2MKJ A;  1TUW A;  2NXJ A;  1ULR A;  3NNA A;  1C1C B;  4ZA1 A;  3ZNU A;  1RT6 A;  2E1M C;  1UZD A;  4RJV A;  1XR6 A;  2L9N A;  2JWN A;  2CPI A;  4OI2 A;  2WOM A;  4RLE A;  2G0J A;  2ZH9 A;  4KPC A;  4NLO A;  1REG X;  4R0E A;  3ZTP A;  1TFW A;  2CQI A;  1EAR A;  3CSK A;  1L3K A;  4EFA C;  4NXM J;  2OTL S;  2FGC A;  1J5E F;  2H1Y A;  3UVJ B;  1Z2L A;  1R6V A;  4QR2 A;  4O3N A;  3DLG A;  3Q24 A;  4M5G A;  1Q5Y A;  3IR6 B;  4XO0 A;  4JI0 J;  1RT3 B;  2DH9 A;  3D1O A;  3NWG A;  2V9K A;  1T9X A;  1FKA F;  2RML A;  3NGS A;  4IRD A;  1GT8 A;  1U1O A;  2HS0 A;  5GAH I;  5D0G A;  1FER A;  1T11 A;  5EWE A;  1VR6 A;  2XHC A;  2GIF A;  3KJF B;  3UDE A;  4XAK A;  5IV3 A;  2W25 A;  2XMM A;  3ILI A;  2NPF A;  2YKO A;  2OPR B;  1UWB A;  2QSW A;  4UW2 A;  4N47 A;  1RT4 A;  3OSN A;  1KLN A;  4LF8 J;  1BE4 A;  4DR4 F;  1PYT A;  2FZK B;  3TVZ A;  1FFG B;  2QL7 B;  4U7U K;  1VJW A;  1DJ0 A;  3T9N A;  3M8S A;  2ZBC A;  3H42 A;  1SKR A;  4O4G A;  1KNZ A;  1WC4 A;  1LFP A;  3HUL A;  1JLA B;  2LU1 A;  1JLG A;  3L7U A;  3O2I A;  4HEA 9;  1WI8 A;  4P75 A;  3T1Y F;  1NJZ A;  1MML A;  1O0P A;  1S9G A;  1EET A;  3B78 A;  2E9R X;  2NYH A;  2QE5 A;  2V2Q A;  1U24 A;  3IFE A;  2A3J A;  4O0N A;  3PO4 A;  2CPX A;  1WC1 A;  1TKX B;  1C0T A;  1RT1 A;  3FBC A;  4AL7 A;  5LSO A;  6AT1 B;  2QA1 A;  3AOC A;  2WTF A;  4O0I A;  1RKI A;  1TVR B;  4C97 A;  3MAA B;  4OX7 A;  2YY3 A;  1XR5 A;  2GJF A;  1T9U A;  4Y2A A;  3FSI A;  2YQ3 A;  3L7O A;  1UMJ A;  2VG6 B;  2QL9 B;  4JP8 A;  3M30 B;  2IRY A;  3DLK B;  3MEE B;  5CQG A;  1ZS6 A;  4YUD A;  3OHA A;  2DR5 A;  4BDP A;  1HWI A;  1S0V A;  1RHJ B;  5KFX A;  5IFM A;  1HKA A;  2CFX A;  4AXJ A;  5J1P A;  3GQC A;  3GV5 B;  5DDP C;  2V8G A;  2DRA A;  1TEL A;  3THP A;  3TZY A;  4FF2 A;  1RAO A;  4WK3 A;  3CPW R;  2OP5 A;  1M5H A;  4OZ1 A;  2DXF A;  1GTE A;  1X60 A;  4H54 A;  5I42 B;  1NO8 A;  3NCR A;  1NB7 A;  3ZZZ A;  1G1X A;  2NUH A;  4Z37 A;  3PCO B;  3EXY A;  1UVI A;  3QO9 B;  3UNG C;  3R5C A;  3MUT P;  1QAJ A;  5KT4 A;  2AZ1 A;  2LQ5 A;  2J9E A;  1QY7 A;  3AB2 B;  3JAM Y;  3FBB A;  5HVF A;  2GFF A;  1RTH B;  2RIL A;  1F5B A;  4WTY A;  2DNG A;  2EFG A;  3I5C A;  3DGP B;  1OSC A;  4XPE A;  2GQQ A;  2FHO B;  2R8H A;  3OUY B;  9RUB A;  1EZZ B;  3AQP A;  1M5P C;  4C9D A;  4O3R A;  4NYZ A;  1U47 A;  4X4V A;  1VHI A;  1WUU A;  3BRE A;  1NSA A;  2FJB B;  4K8R A;  3LTO A;  2Z8Q A;  2HND A;  2RF2 A;  3C14 A;  3E8O A;  3R5A A;  2WVD A;  4J5O A;  4KHM A;  4URG A;  1N54 B;  3L7P A;  3MZI A;  2HFN A;  4J9Q A;  3GWC A;  3QIP B;  1Y5I B;  1IBC B;  2J0W A;  2YKM B;  3FSX A;  4IFV A;  4ED4 A;  4KHP J;  1B70 B;  3VR1 A;  2UP1 A;  1SIW B;  3SV3 A;  1NBE B;  1MU2 B;  3O8W A;  2YXL A;  2DH8 A;  5E33 A;  4HYK A;  2UXC F;  4OX6 A;  2HGN A;  3MI7 X;  4PAB A;  2MZR A;  2KHC A;  3LUY A;  1WG1 A;  4YB5 A;  4IRC A;  3DNC A;  5KFV A;  3W61 A;  5A2Q Y;  3CUL A;  3N4W A;  1S6P B;  5B0F A;  3U7J A;  3GG0 A;  2ZH3 A;  2NR0 A;  1WDD A;  3OLB A;  2HQD A;  3Q8P B;  1CS4 B;  2X1G A;  4DHV A;  1HHS A;  2DNR A;  5E3C A;  2E1R A;  3EGV A;  1DFD A;  2HKE A;  1SV5 B;  3BGF A;  4G1P A;  4IFY B;  2AD9 A;  1N0U A;  4OZ3 A;  5M2U A;  2W7O A;  2FJW A;  1HNV B;  4FP9 A;  1XMO J;  2ZKU A;  4LRD A;  4XPC A;  1KVK A;  5AE1 A;  1QSL A;  1IVZ A;  4ZJQ A;  1BQX A;  1FXL A;  4OJ1 A;  3VV2 B;  4GC6 A;  1Q4R A;  2OSR A;  3AJD A;  2KRR A;  2IM2 A;  1YVF A;  2GHV C;  3HFV A;  3NWR A;  4CLS A;  4GC7 A;  2PN6 A;  4O23 A;  1KHV A;  1Q78 A;  3FGV A;  1R43 A;  2IIH A;  2Y0S D;  2G13 A;  2VFS A;  2XI3 A;  4B3S J;  2SXL A;  3MCM A;  4I7F B;  3UNY A;  1HR0 F;  5BXI A;  2KB2 A;  4P72 A;  4YQW A;  2K2P A;  1S1W A;  2QN6 B;  3DRR B;  4C2M A;  4B9M A;  3WC2 A;  3IR5 B;  4BHQ A;  2CQ0 A;  2VG7 A;  3D9B A;  2ZHO A;  4X64 F;  4X65 J;  4WTO B;  2ZD1 B;  3EPG A;  5DQH A;  3UDC A;  1FKP B;  1YGY A;  2H65 B;  3DRS A;  4WFA Q;  4LF5 J;  1WNE A;  3DKD A;  1NB2 A;  4AUK A;  2ZNY A;  2B51 A;  4EYI B;  2YKM A;  4IFV B;  4P2M A;  2NLW A;  5GMD A;  5B0E A;  1FXD A;  3I0S B;  3MF5 A;  1PJ7 A;  1T05 B;  3T5J A;  4OHY A;  2BKP A;  4GO5 X;  2NZ4 A;  4C8M A;  4Y00 A;  2B4O A;  3MWB A;  4A48 A;  3HK2 A;  4MIB A;  2DHS A;  5IOL A;  3OD2 A;  1IUJ A;  4NLW A;  2YTC A;  3AOB A;  2JNJ A; 
#chains in the Genus database with same CATH homology
 4NXN J;  5LM7 E;  2UU9 J;  4DV0 J;  4JI4 J;  1N34 J;  4DR3 J;  4NEZ A;  4GKJ J;  1HR0 J;  4LF7 J;  4LF6 J;  2E5L J;  4X62 J;  3D3B J;  2VQF J;  4DV1 J;  1IBK J;  1FJG J;  4B3R J;  3OTO J;  1IBL J;  3T1Y J;  4DR2 J;  4DV7 J;  5A2Q U;  4JV5 J;  3R2C J;  4YHH J;  1N32 J;  4DR4 J;  4DUY J;  4KY3 A;  4LFA J;  4JI1 J;  4DV6 J;  4DV4 J;  5IT9 U;  1IBM J;  4X66 J;  4NEY A;  4LFB J;  4DR6 J;  4JI7 J;  4JI3 J;  5LMU J;  2UUB J;  2VQE J;  4B3T J;  2UXC J;  1HNZ J;  2HHH J;  4OX9 J;  4KHP J;  5LMN J;  3JAM U;  4LFC J;  2MEW A;  2UXD J;  2UUC J;  4B3M J;  3T1H J;  5BR8 J;  4DV2 J;  4PWW A;  2ZM6 J;  4JI5 J;  1HNX J;  4DR7 J;  2MQ8 A;  4JYA J;  4RJV A;  1N33 J;  3IMQ J;  1N36 J;  4NXM J;  1XMO J;  4DV3 J;  3J7A N;  4X64 J;  4V1A k;  4DV5 J;  3D3C J;  2UUA J;  1XNQ J;  4JI0 J;  1HNW J;  4JI6 J;  4GKK J;  2UXB J;  3J80 U;  5FLX U;  4B3S J;  4LF8 J;  4DUZ J;  2F4V J;  4AQY J;  4K0K J;  1J5E J;  4LF9 J;  4X65 J;  4DR1 J;  4LF5 J;  3W1Y C;  4JI8 J;  3J81 U;  5IWA J;  4DR5 J;  4JI2 J;  1I94 J;  4HHU A;  3R2D J;  1XNR J;  2MTL A;  1XMQ J;  5AJ3 J;  4KYZ A;  4YY3 J;  4LF4 J;  2KVQ E;  2KL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...