4NXMJ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4nxmJ00
4DV2J 4LF5J 2KL8A 4KYZA 3J81U 3OTOJ 2E5LJ 4JI3J 4DV4J 1N32J 1HNZJ 1N34J 4KY3A 4NXNJ 4DV3J 3IMQJ 4JI5J 1IBKJ 4X66J 4JI6J 1IBLJ 1IBMJ 4JV5J 2F4VJ 2KVQE 4JYAJ 4X62J 2MTLA 3R2CJ 2VQEJ 4RJVA 5LMNJ 4PWWA 1FJGJ 4X65J 4GKJJ 4B3SJ 4LFAJ 4NEYA 1N36J 1XMOJ 2UUBJ 1I94J 1N33J 4YY3J 2ZM6J 4KHPJ 4DV6J 4LF7J 2UUCJ 1XNQJ 2VQFJ 4LF6J 4LF4J 5LM7E 3J7AN 4DR3J 4DR6J 4DV5J 2UUAJ 2UXDJ 2UXCJ 4V1Ak 4LFCJ 3W1YC 5IT9U 4DV0J 4DV1J 4DR5J 4AQYJ 1HNXJ 3J80U 3T1YJ 4OX9J 4HHUA 4YHHJ 5LMUJ 3R2DJ 1XMQJ 4LF8J 4DUYJ 4GKKJ 4JI2J 4K0KJ 4NXMJ 4B3TJ 4DR7J 5IWAJ 4X64J 4JI8J 2MQ8A 4NEZA 1HR0J 4LF9J 5AJ3J 4B3RJ 1HNWJ 5BR8J 5FLXU 1XNRJ 5A2QU 4DV7J 3D3BJ 2UU9J 4DR1J 4DUZJ 2HHHJ 4JI1J 4DR2J 4B3MJ 2UXBJ 4LFBJ 3D3CJ 3T1HJ 4JI0J 4DR4J 1J5EJ 4JI7J 3JAMU 2MEWA 4JI4J
chains in the Genus database with same CATH superfamily
3HFZB 3H25A 2R9LA 4CLFA 1SJFA 2M52A 3W5ZA 4A8MP 1RZMA 3U7JA 3M2UA 2BOPA 1NSKL 2CFXA 2E7VA 3HLUA 3F41A 4IOAQ 3GG0A 3TUIC 2AT1B 1NKCA 1KFSA 1ZM3A 5LMUF 3V4MA 2DH9A 2O01C 2MKKA 1JXLA 2QZ8A 3ILOA 1TV6A 4CLSA 3J81Y 5T41A 1TK8A 1KSPA 3EVMA 3W8GA 3EDRB 2W4PA 2ZFHA 3CVKA 4LF8F 1NK5A 5CYMA 1LK7A 4JI4F 3GILA 4DX6A 3UD5A 3OTOF 4IQMA 4CLWA 1YJ7A 4YB6A 2ZDPA 2ZH4A 1S57A 4GVBB 4MIWA 4ZMMA 3M8RA 3VAGA 4MK8A 2VH7A 2Q43A 4NYOA 1TL3B 3EGNA 4HDGA 1SJRA 1T02A 2MQNA 3L09A 4ZCLA 4DR4J 1D0EA 1U0SA 2FHKA 2JLEA 2FLNA 3IWLA 4F0MA 4F36A 3P45B 4QW8A 1OQ3A 4EFAC 4XK8C 5LSLA 1LWFA 4ELUA 3R3TA 4K2XA 2E29A 1YRXA 2XQCA 2MDAA 2W9CA 3IS9B 4ES1A 4ENOA 4J9PA 3CIZA 1BC6A 4ZCIA 1TL4A 1AYEA 2R2UA 1S0NA 3UDVA 1F60B 4OX9F 1HQ2A 3CJRA 4NZ7A 3LW5C 2V4JA 1U6FA 2UXDJ 4PXEA 1L3TA 2ZBCA 4YS2A 4ITSA 2QL7B 2EC0A 5AT1B 2QGFB 1RU2A 1H72C 1FEHA 5IM0A 3T6BA 4IR1A 3CJKA 3UI3A 2HS3A 4EBEA 2JVRA 1OJ4A 4P2SA 3R97A 3EX7B 4RUAA 2R7WA 2QA2A 2HHPA 3VGSA 3QLHA 2E5LJ 2LEBA 2GVDA 4JUZA 3TWZA 2W2MP 4JI5J 2PFFB 2HLUA 3VVUA 2KYXA 1BXNA 2R2RA 4USMA 2OEJA 4CO5A 1BWVA 3K2YA 3EDQB 2BYCA 2RE1A 4ZJOA 4A8WA 2GX8A 2U1AA 4AQYF 2C2DA 4QPTA 1LXJA 5HJYA 1L3KA 4DUYF 2PD1A 3FFIA 4DWIA 1PJ5A 3Q23A 3FEYB 4F4AA 4DR5J 4DL3A 4U8YA 1HBNA 4ZVPB 1ZPVA 1NH8A 3ILJA 2LQ9A 3NGUA 2EPIA 4CYUB 3NGRA 5A0YA 3AQOA 3QT6A 2KFNA 4ZIWA 1X4FA 4CO3A 2CQCA 2E9RX 1S1TB 1H2VZ 1SKRA 2B0GA 1RT6A 4DPWA 1VI7A 4ZN1A 2XNRA 4WBFA 2QN6B 3SDEA 4LBIA 2P2CB 2Y0SD 5H9EJ 2A6OA 1KNZA 2UZAA 4C11A 3BGLA 1MMDA 1NO8A 5KFBA 4CO0A 2IBOA 2A10A 4DCJB 4I2PA 2ZH1A 4EBCA 1KVJA 8ATCB 4WK3A 2EBEA 3RU0A 3PW7A 1X5OA 2F8EX 1F3VA 2YXLA 2VG6A 4USVA 1VBYA 4N76A 3MTJA 3F56A 3GIIA 4IG0A 4LR8A 3MWBA 2PA3A 3W2VA 5KFRA 2QFIA 2XY7A 4LFCF 2D3ZA 4LBHA 2RILA 3DRXA 4DN0A 2QA4G 1RAAB 2NUUG 1WACA 1S6QB 3CXCR 3NNAA 1QAYA 3OUYB 3OPKA 1ZM2A 2MQPA 1CPZA 5KFCA 4D3HA 3IAM9 4QOTA 2YNIB 3I4PA 4JI0F 3V6DA 4OYIA 1HW8A 5KFVA 3GYGA 2MKJA 3SCJE 2PEHA 2W8LA 4X4UA 4J7CA 3WC2A 3ENAA 3T1HJ 3KNGA 1HHQA 3LGMA 3SSRA 3NBPA 2Q3PA 2V50A 3G8TA 1VJQA 4ZLLA 4ZVUB 1PC5A 2BE2B 2O66A 2B43A 1GXTA 4AUKA 3OR2A 3CC4S 4FF1A 3LTOA 4P9SA 3M9NB 1HNVB 2M88A 2WSEC 2IAJB 3WQPA 1WSRA 2MZRA 5KFGA 2ZZMA 2DXEA 2ZBPA 1T8EA 2IPOB 4ECUA 1VK3A 2VC0A 3CIMA 1TKZA 3OVAA 2CA9A 3LPEA 4WTYA 1EJ7L 2ZUGA 4Q5VA 3QJJA 1XR7A 4NLXA 3C2PA 1VQYA 3BYPA 4USHA 4C3LA 1Z2ZA 4K4SA 3CW2C 5KT3A 4PYDA 4MYUA 3G6XA 3EMTA 2K8GA 5CABA 3PIOQ 1XIQA 1F1BB 2OGUA 5A2QU 3ZTSA 3L4BC 1VBXA 4ZVHA 2P6TA 3OBIA 4CTAB 2LQJA 2OD6A 1L3SA 4EWTA 4IG3B 4QR0A 2XLKA 1HBMA 3I0RB 4KYZA 1FXDA 1FNXH 1CJTA 2JL9A 3HHLA 4KGZB 2W24A 4Q44A 3NOCA 1X0FA 2IJRA 4EK2A 3ZTRA 1XQIA 1SC3B 1Q4RA 3IRXA 4FXDA 3QIDA 3SSQA 3HM9A 3FNNA 2MTLA 2UV8A 4O44A 5G4DA 2RUGA 2VOOA 2QLFB 2R8KA 1Y0HA 4A46A 2AIRB 2E5IA 4GC7A 4KFBB 2MHNA 3G6ES 3FCWA 2KG1A 1FD8A 2HWTA 1SKSA 4NE9C 5IC4B 5F0WA 2QFJA 5JXSA 2EK6A 4USWA 4WFZA 5L1IA 4NEZA 1I3OB 1H7XA 5F8JA 3TZWA 3IP0A 3B8HA 4B9TA 3OVBA 5E33A 4V19X 1CULA 2W2NP 1RA6A 5EWGA 2CJQA 4MTPA 3MR3A 3MECB 4P2FA 2CG8A 3SZ2A 3HD1A 3GPAA 3M8SA 3OFGA 2XBPA 4RNNA 5MLCV 2KZZA 4USTA 3L7UA 4U95A 1KDNA 2XLJA 1VRTA 5JVGQ 3MD3A 6FDRA 3WZ0A 5A8RB 1H73A 2RKIA 2GMHA 4ZPVR 3KLHB 4Q43A 2DR6A 3KKFA 1FNOA 3PIPQ 3HCXA 2QSFA 2BW2A 2UXBF 3FMBA 4OIXA 2BX6A 1Q7LB 3GG1A 2UUAJ 4Y2IA 3B82A 1HW9A 2XSJB 3H4DA 3AA8A 4DJBA 5CQGA 2R2TA 3SMZA 2IDEA 5HROB 4PWUA 1AUDA 4FS1A 1PAEX 2YPYA 4TU8A 3CWJA 4KHRA 5IWAJ 2K7JA 4RO0A 2FY1A 3ZZYA 1NM2A 2OLWA 1S9GB 3ZZOA 2ZNZA 3W66A 3DOMA 1LQ9A 5J2NA 1TU0B 2BRLA 4NL5A 3R6LB 4DHVA 4KHPF 4DFKA 1RLCL 1H98A 5D8HB 2CJBA 2VFVA 4IDKB 2QA1A 1BMQB 2ZHOA 4LR7A 3C19A 4DX8H 4OYPA 1Q81T 2IYIA 2MKCA 1N4LA 2JLFA 2XULA 2WTFA 4NCAA 2W2OP 4KGVB 4CH1A 3ITHA 1H74A 3MMAA 1NK8A 3DNCA 1HMVA 4O3PA 2IRXA 1UVIA 2MQLA 3JYTA 2LFVA 3DDKA 1RAIB 3ELHA 3D2WA 4RW8B 4G3IA 2EFNA 3MPVA 2ZBQA 3KLFB 2WONA 3HP6A 2R7TA 3HKZD 2B9YA 3O8WA 2P9GA 3SSSA 5LMUJ 3JXOA 3W2WA 3DGVA 5C42B 1IKYA 4WF9Q 2COLA 2W4DA 4TLQA 1FKPB 2E1MC 3BR9A 1N56A 4U6PA 3B4DA 3H5SA 1UVKA 3D54A 5DGAA 3UN3A 2AJ0A 3LOUA 1N32F 3QT8A 4XPCA 2Z30B 2ABYA 3R7BB 4A48A 1S1XA 4KR0B 4OJGA 4JI4J 3AY0A 4WU3A 3OTOJ 1RI7A 1X5PA 1WOPA 2XHWA 1MG7A 4YR2A 4A8YA 1KONA 5A6PA 1QAIA 1RUSA 4LUBA 2AQ4A 2QX0A 4DFJA 4DLEA 3LO3A 1B70B 1FWPA 3BGRA 2NS1B 1EZZB 3NAHA 1C1BB 2ZZTA 1U25A 4PG7A 4BHQA 2KFYA 2FDNA 5ETNA 1WD6A 4FXVA 1P6TA 2F9DA 3J7YU 4TQSA 1X0PA 2X51A 5LM7E 3J7ZT 2D1CA 1RT5A 3PNIA 1MWYA 1XMBA 4KC5A 3UD4P 3I56S 2IVYA 2GJ2A 1KHWA 4ED7A 2KXNB 1FXRA 3MFHA 2PO4A 5K8MA 2V5HG 3RRGA 1QSYA 2YWEA 1IKVB 3IM9A 4PUOA 1FTCA 5KG3A 5LOQA 4J5OA 4BDPA 2Z8QA 2XS5A 1TL1B 2R7XA 5KT7A 4B3SF 5D4LA 1U7LA 5A6WA 2CJKA 3PTWA 4LVNP 4I1TA 3M9OB 1TL5A 2BE9B 3ZXWA 1TP7A 4QZVB 1KRPA 3MR5A 2AYEA 1R31A 2OPQB 4OX8A 1R0BG 3JQJA 5FJ4A 1URRA 3MUMP 5CAAA 3M8PA 5L39A 1UVJA 4O3OA 4ZVEA 1DY3A 2D9OA 3PYGA 1SC6A 1AZSB 1E6VA 3NS6A 1XTZA 3ILIA 3PW4A 2L3MA 2UUCJ 2W2QP 3HJFA 1Q79A 5DDPC 1HQEB 2MY7A 4TQRA 2IJNA 2KRRA 3RW7A 4B08A 5DRKA 1RGVA 2KXFA 1Q0NA 2D74B 4ZCKA 3PO5A 1X5TA 1KQKA 1FDAA 3MD1A 3W5XA 4YQWA 4P73A 1TMMA 2GAGC 3IA0A 3CGIA 3OW2R 1R0AB 5ETSA 3OL9A 1DBDA 3G6YA 1U1LA 5ETTA 5J1PA 1S12A 3AOAA 3D6HB 4YEAA 1BGXT 3LP0B 2GNKA 3G4SS 2HZAA 3UDCA 3R5BA 2ACYA 1NMEB 3OSPA 4USKA 2Y1RI 3CJ8A 2KU7A 2AX1A 3M8QA 2RHSB 3CCZA 4CM2A 2HPUA 3KG1A 4OHZA 2BKOA 2OKQA 3SQGA 1XMQF 4DG1A 2UVWA 1NJYA 1JJHA 5ETPA 4LSLB 4C8OA 3JSBA 3M32B 4F4WA 4X62J 4FNHA 1DURA 3UD3P 3VALA 2N7YA 2HNDA 4BLGA 4RR5A 1JLFB 5C24A 4PWDB 1HNWF 2OPRB 4DV1F 3AH6A 3M6VA 4AL5A 1C0TA 2YWGA 3K0JA 5FD1A 3UPFA 3IC1A 3R8YA 4L72B 5JUMA 4USUA 4CLKA 4FBTA 4B3RF 3KDOA 1LWXA 3H2LA 1Z2LA 4J91A 1MWZA 4X4TA 2AZ1A 3V5RA 4ID5B 4OLOA 3KUGA 4DR1J 1JLBA 3R5GA 2J0XA 4Y2AA 5KFTA 1FRKA 3ZZZA 3J80Y 3FZ2A 1WKJA 4FYWB 1KS2A 3MPUB 5HMWA 2UVVA 5HMYA 1FWKA 2VG7A 3BH7B 3PR5B 5KT2A 2CPIA 1SQFA 1CJVB 1WJ9A 1VQ7S 4KGMA 1VJWA 2OPPA 2LYVA 2C2RA 1UCNA 2ZC3A 2DITA 3MM7B 3R1HA 2XB2D 3TA0A 1PCAA 3D0HE 4KT0C 4LIWA 4WFAQ 3KWMA 2J9EA 2H5EA 3G71S 3C6TB 3HVAA 5CZXA 4NASA 4FKYA 5MAOA 4K4ZA 4L3NA 4ED2A 4OZ2A 3PRBA 3CJ0A 4WJBA 3N6LA 4Y34A 3GFXA 1UZHA 2P5VA 4F4XA 1ZZFA 3LWLA 4EBDA 1SJQA 4TY8B 1Q16B 3LGHA 4C8MA 5KFXA 3NCRA 4K5RA 4DR2J 4NLQA 1UZDA 4IO1A 3WC0A 3ZNJ1 1C4AA 4UT4A 1Q8KA 4OL8A 4Z37A 2B8PA 4OI2A 1HI8A 4ZVQB 3OFHA 3OL7A 3I87A 1F9FA 3NGTA 3BS9A 4HACB 2AMCB 2DPIA 2VZ9A 4QIGA 1S76D 3KLGB 1E6YB 1ELOA 1U2FA 2XI3A 2UUBJ 5FDLB 2NSCA 4O0NA 5EWEA 4OYAA 4OZ1A 3CMAS 3LP2B 3PO4A 4URQU 8RUCA 4NRTA 1NJWA 3HX9A 2W9AA 2VA2A 5LSRA 3TZZA 3O2IA 1TUWA 2DCUB 1REGX 3Q8SB 1FO1A 4LRAA 2DXDA 1RHMB 1IR2A 3QT5A 2DHGA 1PAUB 3MM9B 5T7LA 4LF9J 4R0JA 1LFPA 2IM0A 3D3BJ 4K50A 5HN0A 3CC2S 4KIAA 1NDCA 2K1RA 1FKOA 4D3GA 1ZAVA 4CO2A 5EWFA 4RNMA 3PX0A 5E3CA 5SZTA 3G8SA 3MEDA 5J2PB 2MSTA 4DF4A 3MI7X 3MAAA 2F3JA 2ALZA 1U09A 5DLGA 4RZRA 3SYZA 4K0KF 4N8OA 3DU5A 5FIIA 4RKUC 2HK2A 1XBWA 1WI8A 4CLTA 2C28A 1WDTA 4WP8A 1EQMA 3R7NB 1GNKA 1LFWA 3A12A 2OFHX 1MN7A 2P9EA 2LU2A 2W8KA 2Y1JA 4FPRA 1IKWA 1HYSB 2YWFA 2CQ2A 4M8LA 4BWJA 4OV6A 2BQ3A 2HWHA 5K5MA 5B08A 2IC3A 4JOUA 2UXBJ 1JJ4A 4QQBA 4ZPDA 4M5JA 1F2HA 2J5AA 5KG6A 1SB6A 4KRWA 2I38A 4CP5A 2HQDA 3NP5A 2E5GA 2YNHA 2KM8C 1YJUA 2VF3A 1S9EB 3ZC4A 4DOZA 1PGZA 2PI4A 3TR5A 1T3NA 4FP9A 2DH8A 4LQ3A 3DOKA 1CJUB 1FESA 2L9WA 3QRQA 3GP9A 2ZHBA 2OTLS 4KE5A 2RF2A 4WZQA 2DHXA 4KHPJ 1QE1A 3THVA 3DI6B 4G1PA 1RWOB 1NK4A 1RTHA 4EU0A 4PRFA 1WC3A 3T5HA 3OR1B 3H2UB 2HNYB 5JJBA 5EHHA 1S77D 1NJXA 1Q95G 1VRUA 3M2RB 2E9ZA 4OZ5A 4HHUA 2V8GA 1C4CA 2CVIA 5U47A 4FF3A 1NJIT 2I5JB 5A76A 1U47A 5HP1A 5KT6A 3GIMA 2MYFA 3G2XA 3GIRA 4HKQA 5DZ7A 1RWNB 4I56A 1N34F 3C6UB 2IMWP 1N33F 3RGIA 2XI2A 5KFJA 4YP3A 4F4YA 3LALA 4QIFA 5D3GB 4B3OA 1WF1A 4NLWA 2BJDA 3L95X 2J0SD 2AJFE 1MROA 4DL6A 2VPZB 4MMOA 1K0TA 4DBQA 3CCMS 3QQCD 5BYSA 1UWBA 2UUWA 2V4RA 2KKHA 2HHTA 4DR7F 5EGYA 3I6PA 2DGUA 5E41A 5B0BA 1F5BA 1S1UB 3RB6A 1CS4B 4H4OA 1JWWA 5HJXA 3CCTA 4KKOB 2CAJA 2KRBA 5KFFA 4O4GB 3A3NB 2GS8A 5DZ6A 2YNFB 4FYVB 4F04B 5H9FJ 3MXHP 5HMXA 2XCAA 1VIXA 3TO8A 4ES3A 2V8HA 2PGCA 4I69A 1MU2A 3EPGA 4QU6A 3ZZUA 4YDXA 1HNIA 1R3NA 1CVJA 4H54A 2BMBA 5IQ6A 3TUPA 1ZETA 1X4CA 1SV5B 2ZH2A 2I6WA 4I7FB 3JAMU 1UL3A 4P74A 2B6AA 4ZLPA 4Q7AA 5KFUA 4DR3F 4JI3J 1JX4A 2VODA 3OJSA 4ALZA 1B0PA 1RAGB 3A13A 3BQ2A 1RAOA 3KTQA 1T9UA 3QRRA 4UOHA 3ONQA 3DDNA 5DS7A 1M0SA 3VQTA 3MOJB 2AJ1A 4B3SJ 5IT4A 2Z0GA 1ULRA 1JLAA 3R1LA 2KG0A 1K8AT 4B02A 2BANA 3G82A 3DRSA 2QO3A 3VHQA 2RU9A 4DQSA 2HFNA 4P52A 4MKBA 2Y1IA 1TAUA 5LT5A 5GAHU 3UNYA 1FRHA 3K89A 1JLQB 3T3FA 1RTJB 5ETKA 3B6BA 1V3RA 3S8SA 1RWXB 3FQLA 2Y8YA 2FZGB 1TVRB 3DRYA 1F9HA 3HD2A 3ISNC 2RDJA 4A8QA 2B56A 1WI6A 4N5SA 1T05B 2HBZB 1IM4A 4NYZA 3CJ3A 1AROP 5F8GA 3MMBA 2CQBA 3JS9A 3GCXP 2AJ2A 4CRJA 1FKAF 3S7RA 1Y7PA 4LF2A 2UV8G 3A1YG 3OL8A 3EICA 2RIJA 2LXIA 1RTIB 5KG7A 2OEMA 3RB4A 3R2CJ 3BREA 4X2BA 1OPIA 3KNAA 4HI2A 1YKWA 2WHOA 2C2MB 2KXHA 4RLEA 4FVMA 4P2XA 3BJYA 4ZPAA 2HURA 2I9SA 4ZIVA 4RNFA 1XMQJ 4OMFG 2NXJA 2HZVA 4G1QA 2XMAA 2WB1D 1MMLA 2JOQA 5JVHQ 1PILA 1L3VA 1B3TA 2J8AA 3RBZA 2PE8A 4OJ1A 1N6QA 1HNWJ 1AB8A 1NAQA 5KOXA 3OFEA 4LIRA 1H38A 4QPXA 3EGVA 2G0IA 3Q8RB 3JSYA 4YUDA 1AFJA 1M5SA 1KTQA 2HQIA 1DJ0A 3G6VA 2R7RA 3QJPA 3T5KA 1N5SA 4AXIA 4PKDB 1LWEA 5AXMA 2ZE2A 2HGLA 3H2VE 4AFFA 5KOWA 4YB5A 5KFEA 1GT8A 1J2VA 4MFBB 4FS2A 4XDCA 4K4WA 3F0NA 1QVGR 4LFAJ 3HT3A 2JH3A 5ETQA 1HNXF 1BUXA 3FEXB 5LJ5Y 2HMIB 1CC7A 2WVBA 4HYKA 2F8MA 2F65A 1P9YA 5DLFA 1WOOA 3MMJA 5H9EK 3HO1A 1PKUA 1S1UA 1MW7A 3PFEA 4F02A 4ID8A 3T1YJ 1S1WA 1FX2A 4DV7F 2V2ZA 4WFXA 2MZ1A 1R27B 2R7UA 4KBIA 3QRPA 3GQCA 3MM8B 4RNOA 4K59A 2QMWA 3K57A 5HLFB 4J37A 1FRLA 2M4MA 2XYPB 4WXOA 1C1CB 1VCTA 4LF7F 4ZCMA 1OIAA 3TVZA 5RUBA 5K20B 4KY3A 3X1LB 1YJWS 3KLIA 4NLRA 1HPZB 4MKAA 1AW0A 4RPFA 3LGNA 2VC1A 3MM5B 4O3QA 2HFOA 3PKMA 2DISA 1IQZA 2FQQB 1I5OB 2HFVA 2JVOA 5HI7A 1RACB 4FZVA 3SBMA 1K9MT 4R0EA 3DGPA 1RT1B 2VA3A 1R8PA 1YDLA 1URNA 1TQLA 4M5KA 4DX7A 2B5JA 2VBZA 4YR3A 4WK1A 1BQNB 1FFSB 3POTB 2YKNB 1RHKB 4LBPA 2ZD1A 1IR0A 2XG8A 3C15B 4ICLA 1WKKA 4C0OC 2MQQA 1GFWB 1W7WA 1N5YA 1BQMA 1VR6A 1X4DA 5B7WA 4PPDA 4NLDA 2JJ4D 1YIJS 4IFYB 1S6PA 3AXKA 2N82B 4UZCA 1SUQA 3S1TA 3EZUA 3I9V9 1HA1A 2DNOA 4M5DA 2ADBA 5ETMA 3L7PA 3EGZA 1ITPA 3H90A 1IJEB 2VASA 2DVIA 5D4OA 3V81B 2E7WA 1CBKA 1BLUA 3VAFA 2ASDA 1R6YA 1REVB 5DG8A 2RQKA 1S1VA 3RB3A 4WE1B 1FF2A 1VQSA 4DV0F 2DEJA 4PG8A 1KEKA 1RISA 2R2SA 4IFVB 1Z1ZA 1Y9OA 1RWUA 1TELA 3Q8YA 5DO2A 3FUYA 1DQAA 1B0VA 4KO0A 2HBYB 2V8DA 2GV1A 2HBRB 1YWXA 3KDNA 5KFQA 3NWRA 2B7CB 2ASYA 3HVRA 4NMXA 4AXJA 1K1QA 2JC0A 5C25B 4K0KJ 4DSLA 4Q0BA 1JK9B 3E8OA 1X4HA 4I68A 3E51A 4O4RA 2BZ2A 4AD6A 1J5EF 1Q86T 2JHEA 1HHTP 1PO6A 2HRYA 3R7SB 3CDUA 2IIHA 4RBVA 5IC6B 1IBKF 1HQUA 3MMCA 3OQ2A 1IBLF 4N47A 1M90T 1M1HA 3KLEB 2QV6A 3QGPA 4B9VA 3EWGA 1IKXB 3LP1B 4EUVA 7AT1B 2JRSA 3KK1B 5GAEU 2DNKA 3KK2B 3PJWA 3FEZA 2KVQE 2NYIA 3D9BA 1TKXA 3S01A 4FYXB 4DCPB 1UA0A 4FDFA 4E8UA 2XO7A 2V63A 2Y0BB 4OX6A 2OD4A 1KC8T 2BE7D 2XM3A 1NB2A 1QLNA 3I31A 2XMWA 3PEJA 2N4CA 4JP8A 1A9NB 4I2QB 1X31C 1JJ2R 1YJNS 2GIRA 2M7SA 1VS3A 4ZKAA 3KUEA 1U45A 1SIWB 4ECZA 4ZA1A 3MUVP 1DTQB 4LJMA 5KFHA 1JJCB 5J1EB 2DNMA 2V4QA 3MAQA 1TL7A 1XK8A 4MKYA 4QR2A 4WPAA 3MDFA 2HQ3A 4X65F 3UQSA 3AD9C 2NZ4A 1FNMA 4J9LA 1NLKL 2FC9A 3DXBA 4H4MB 2GGPB 1UEKA 4ZPWR 3GSDA 1VIOA 2BJ7A 4DV3J 1Y5NB 1VLYA 2EFQA 1HARA 3MCNA 3VAJA 2XGQA 2YWHA 5J2MA 4DN9A 3OXFA 4ATNA 4F50A 3BBBA 2MZSA 4LREA 1UFLA 4P7VA 3E2EA 3IGNA 1N33J 3QWPA 5BYQA 2HBQB 1NUEA 2FLLA 3OLBA 1IVZA 2JEFA 1RWWB 4X64F 4M5MA 2M2BA 1HBUA 1Q5VA 4R8UA 3GJRB 4NLYA 4DR7J 2AW0A 4JV0A 1EKSA 1FK9A 3MAHA 3CMES 2MB0B 3TAMB 2GA7A 5HSPA 4JI7F 1K47A 1GMUA 4PR6A 2YQ1A 4LF5F 3QPIA 2GVZA 1VBKA 2GCFA 1VISA 4YR0A 4F0HA 2H1YA 4CLYA 4RW9B 3DLGB 1RBAA 1CJKA 1S9FA 3I82A 3D1OA 3QSIA 3N01A 4JV1A 2QC3A 5I42A 2YH0A 1X9MA 3MFIA 2V69A 3NS7B 4NX9A 2D3O1 3K5NA 4NI2B 3QIPB 3IWXA 4KH0B 3DLJA 3P96A 4A47A 2ZZNA 4LF4J 3UE2A 1B7YB 4DR3J 4K4UA 2ADCA 4EZ9A 2WK4A 1JLEA 4ZP8A 3KLVA 4QWDA 2DR5A 1KOOA 4M5LA 2MLZA 4WKRA 2VHGA 4N56A 3HXMA 2O1PA 1MLAA 2XMKA 3SV3A 3IWNC 1EP4B 3HFKA 4NCGB 3NGDA 7FD1A 3MOZA 3JSMA 5IV4A 2O5DA 1GX6A 3DLHA 3QJLA 4ZPBA 2ZOMA 5G0RB 2UVRA 2FHMA 2G2YA 1RQ0A 3BSNA 5DJBA 4UOCA 1W2IA 3ENWA 4GKJF 1X4GA 5CYJA 1XR5A 2N4DA 1PC4A 2E7XA 3G8QA 4IRDA 1FJGJ 4HHHA 2R3VA 1FHTA 3G9CA 3PYDA 2C2ZB 2A0FB 4C3MA 4Q8EA 3K5OA 4A8KA 3TAPA 2Z2ZA 4IR9A 2GHWA 3Q89A 2GC8A 1KKHA 5AXLA 1LW0A 1U1OA 2WOMB 2ZUAA 2LQ8A 2H65B 2DGTA 2DTJA 1Y5LB 2VBWA 4WKYA 4FVCA 4NLOA 1J5OA 4JI8J 1YRTA 3N0VA 3LQVA 4F3OA 2DGOA 1M1GA 3BF4A 1T11A 2KDOA 1QVFR 3U1LA 1W25A 4DUZJ 4EEYA 3ADAC 5DETA 2EI5A 3PYEA 1GH8A 1FRIA 3C14B 2WVFA 3MM6A 2CPXA 2VICA 4IRCA 4ZHRB 4IOBA 4GMKA 1RYRA 2J7KA 1RT4A 1EB0A 2QRRA 4PYAA 2QLWA 3E01A 1KVKA 2JEIA 5DM6Q 4JI6J 2LU1A 5CYQB 2F4VJ 4CLLA 3IGVA 2FVRA 4TLRA 4LMZA 1G6BA 1GMVA 3D6TB 4LSNB 3FMWA 3VAHA 2OMLA 3DN9A 2HHHF 1XNQJ 1N48A 1G1XA 3PHEA 2IRUA 2RQCA 4NLUA 2R7OA 1GMWD 2MKYA 5A8KB 1R8BA 2VIHA 3RTVA 4J9QA 5I3PA 2BJ9A 4C0HA 4R5PA 1VRQC 3K5MA 4LRCA 1YTYA 3GFHA 5AJ3J 3QO9B 3T19A 4CNYA 3MPDA 2WBMA 2CXEA 1XEZA 3DYAA 4KV8B 4OLPA 5B0AA 2DHAA 3RR8A 5DG9A 3CCJS 3MEEA 1F2GA 4OZ0A 4DEZA 1TTHB 4X4RA 4RW7B 2HHWA 4MIBA 3OSNA 1B99A 3ENQA 2PI5A 4KAIA 4MJKA 1Q8LA 3H40A 2DBBA 2ZWOA 4OJ3A 4YY3F 3DMJA 3CCLS 1P9QC 4ILLA 1FRXA 4X84A 4LF7J 1VC5A 1RADB 1U2CA 4J9NA 1ZH5A 1UVLA 1RABB 2CDQA 1ZAXA 5LL6d 3C46A 3JQKA 2YWWA 1RLDA 4DSJA 4PG4A 4YHHJ 4F4KA 3PM9A 5IT0A 4DPUA 3BM7A 3J7YI 1S97A 3TOQA 4EO6A 1S79A 4M95A 3CJQA 5ADZA 3FRYA 3WIUA 3CDWA 2P9CA 1D8YA 2DNGA 3V4IA 2IYGA 1RCOB 4DCOB 3KHLA 3ZFVA 4CZCA 1M5VC 1UFKA 3ZTQA 2JEGA 1ZAWA 3I5AA 3DOLB 1HBOB 4Y00A 1FT8A 5H1SV 4E2FB 1N5QA 3T1AA 3KK3B 4WFNQ 4A8SA 2YNGB 1HD0A 4UUWA 1TKTB 4PXCA 2H48B 3CJ2A 2HYIB 3B4MA 1NSQA 3S6EA 2BABA 2Z2LA 3M30B 1ICEB 1LW2B 1R8CA 3N28A 3LF0A 1U2RA 2MMYA 3WHIA 1JIHA 4TNOA 4YMEA 2XS2A 1WG1A 2HHUA 1QAJA 1RT2A 2DKOB 4RW6B 3KJVB 5M2RA 1YZ7A 4DL7A 4XDDA 4WYLA 3HHLC 5HBMB 2FIUA 1HIYA 4ZP7A 4YDDB 2CQ1A 1DTTA 1ZM4A 1CSJA 2JFDA 2CJAA 1LEOA 4OHYA 5DDQC 2W25A 5KT4A 3RBEA 4CLUA 5KG1A 3HHKA 2C1EB 3K17A 3SQOP 1S7HA 4CO1A 1N8RT 1NSAA 2OPSA 3HVTB 4LSZB 1N54B 2LXFA 1EAYC 1TK0A 4X4SA 2KYZA 3FRZA 1VQ8S 4PQUA 1A7GE 4L75A 4OX7A 4WFBQ 2DNQA 1JKHA 3DC2A 2F4FA 2UXCJ 4ZJLA 2J9DE 1S48A 2AYMA 4A4JA 2MZQA 4ECXA 1SJ4P 1RTDA 2PN6A 1QDUB 1NK9A 2ZVIA 2ASLA 2DNNA 3MEKA 3QWUA 5AE3A 1DLOB 1T9TA 2XCPA 1KLMA 5D77A 4LQ9A 4RW4A 3DM2A 5F9NA 5J2QA 9ATCB 3DLKA 2LEAA 3AJ1A 1ZPWX 2EW9A 2XMUA 5KFNA 3KMSA 1B7FA 3M2VA 2W9BA 4QWBA 3SXLA 4H4KC 4LFBJ 1QM9A 1R8AA 2FZCB 3M1VA 4UUXA 2OUGA 3I9ZA 3W65A 2FHJD 2AEMA 4TY9A 4XIUA 1FERA 3CCQS 2VDIA 3BN7A 3ETOA 2AP6A 2OH2A 3A8IA 1GTEA 4X65J 5EDWA 4PXDA 1RT3B 4TU9A 4K4TA 2B8QA 3M7VA 2BXJA 1RU1A 4DF8A 2V9WA 1GK8A 4OQJA 3UN2A 4DV5J 2CPFA 3AB4B 1SC4B 2MXYA 4DPOA 3SEOA 4DV4F 1KFDA 3RRKA 2BUNA 3UVJA 2BRKA 1BE4A 5B0FA 4DSKA 2X3GA 4DU7A 5A8WA 1U26A 3D4JA 4TU7A 4ZLJA 2B3TB 4ZVOB 3CUNA 1NDKA 2H3EB 1KP6A 2ROEA 3TW0A 1RHQB 2QYGA 2G1HA 2MGZB 3FZBA 2XO6A 1O0PA 3MEGB 1CG2A 3HVWA 5F0UA 1WC0A 3ET6B 4BCAA 1KD1T 2CPJA 2YKMB 4W4MA 4J9KA 3O3LA 1RT7B 3CNQP 2MSSA 4ANCA 2ASJA 3CCWA 2YPZA 4OZ3A 3W9JA 2QJ3A 4RWWA 2VB6A 4CLPA 3GJQB 4UZBA 4URGA 4KGKA 2HSEB 4QWAA 2ZJRQ 1B4SA 1LWCB 1APSA 2X1GA 1P1TA 4NPOA 5K14B 3Q22A 3TARA 4GVBA 2DO0A 3L3CA 4OV1A 1H7WA 4PABA 2FC8A 4BC9A 1TL3A 2IA6A 1JLCB 1UTAA 4DR4F 1PYSB 3DRRB 1LXNA 3QGGA 3NL0A 1CC8A 2BW7A 2B4VA 4IRKA 4G1IA 4KGXB 3SFUA 3I0SB 1M5PC 1Q7YT 2NUHA 3PXGa 2HGMA 1ZTTA 2I8EA 1Y4ZB 2W2PP 2DNHA 2OFGX 2AWZA 4NA1A 4A8XA 3IS9A 3IBWA 3TA1A 5H9FK 3RUBL 3BN4A 3W9IA 1HWLA 4CIOA 3NCQA 1U0HB 3N79A 2KFZA 1TUVA 5C5JA 1GEHA 1WC6A 4X4VA 2YTCA 3NEKA 2BV3A 3C3LA 3D7SB 1NHVA 3T9ZA 4I6YA 3MCSA 3W5YA 1SIZA 4JI2J 1UW9A 3JTNA 3UFCX 3K5LA 2RRBA 3DU6A 1NJZA 3Q2SC 5KG2A 2BOAA 2GIFA 2KO1A 2E5LF 1DQ8A 1YHQS 1JLGB 1SH0A 3AJ2A 4JI5F 2CQDA 5HAOA 5D4PA 4W92B 2HHQA 4RU2A 4F26A 6AT1B 4PG5A 2L48A 2F40A 5A2QY 2AGQA 1I6JA 3DLEB 1YG0A 4X66J 4QWEA 4NOHA 1PSDA 1T9XA 2BJ3A 2EVZA 2VUGA 2X7IA 2CZ9A 4IQXA 1WHWA 3I96A 2BEFA 4X4PA 5CHCB 2CNNB 5IFMA 2W1BA 2G1DA 1M5KC 5GMEA 2AYGA 4PCQA 2K7KA 3FQKA 2XHCA 4CYUA 2QL5B 3D6FB 5F3TA 1YVFA 3PX4A 1T03B 1RBOB 5E3AA 1S1TA 3TVKA 4DZDA 1EHWA 2C2EA 2UVUA 3NNCA 3DCAA 3EXCX 4DL0C 4JYAF 4ECWA 3EE3A 3IG1B 2HHHJ 2LP4A 2RD5C 4YN3B 1GTHA 3DLBA 1BY9A 2HNZB 4U7UK 1R43A 4H4KA 1IM6A 3PR4A 3IR5B 3A8EA 5C2CA 4DFPA 2EBGA 1HNZJ 3CJSA 1T9YA 3O44A 4NZ6A 1SKUB 3CD7A 3PEHA 3DRPB 4RNHA 2KN4A 2KJWA 4N7TA 3NG8A 3C16B 5I3UB 1C0UB 3LWMA 2FJDB 2RNEA 4N77A 2E66A 2KTQA 2QT7A 3NGSA 5CA5A 2M5YA 4KSEB 4FYYB 2HVIA 1S59A 1S6QA 4UTGA 5HK4A 3OUYA 1JXVA 1LNQA 4C48A 3MUTP 3BSCA 2J7UA 2GQ2A 3HPOA 2XLIA 2YNIA 4FYDA 3TYTA 3BQ0A 1YGYA 2W4CA 2R8GA 4O3SA 3BGUA 4B9SA 1XR6A 3WX4A 1O6XA 2XZDB 2VG5B 4DS5A 3F44A 2JX2A 3QFHA 4ZVFA 5EN1A 3NLCA 4WXWA 1OQ6A 2A6MA 4J9SA 3HZEA 3UN5A 2W7OA 2BE2A 3KHRA 1TK5A 3W62A 3NS5A 2IBKA 5M2UA 3CD5A 2ZOFA 1DHMA 5F41A 4B9MA 3K8VA 3M2UB 2B9WA 2DGWA 3KJNB 3ISND 1HNVA 1Q1KA 2VJVA 2ATLA 2IAJA 3OTCA 2AV5A 2NXCA 5KFZA 1VLOA 4C4WA 4AYBD 1TV6B 4JI1F 3HKWA 2CG4A 3IR6B 3FVYA 4WYWA 2QTWA 4ZLNA 4HH1A 3MPYA 4NZ0A 3N6NA 2VL1A 3GWCA 4ETXA 3PKYA 4LF8J 5KFDA 3FBEA 5CYMB 1D1UA 4JBCA 2DYAA 3FBCA 2LQBA 3ILLA 4RL1A 3KXDA 3PW0A 1IBCB 3HK2A 4IUFA 4CTAA 3QYYA 1P1LA 1MWQA 4IG3A 4ES2A 3GCWP 3I0RA 2OSRA 5GAHI 4ED3A 3QGHA 4LF6F 1K44A 3H98A 2J6UA 1K0VA 4MK9A 1RAFB 2LLZA 4NA2A 1PBAA 1NDLA 2B4PA 2VBXA 4WFYA 1LWFB 4GO5X 1QSSA 1FRJA 3Q83A 3CB4A 3AOCA 1OYDA 1SBRA 4J90A 3QAEA 2W9CB 5LJ3Y 2C2OB 1BD6A 1WKLA 4KFBA 4OI1A 1SI9A 3FSIA 5B0DA 2PMZD 1HL6A 2ZC4A 4OHWA 3HT0A 3HJVA 1QTNB 2V4JB 5J1NA 4F67A 3HI9A 4OX9J 1PIEA 2I0XA 1ZA2B 3V6HA 2C2KB 1YBUA 1HD1A 4C9DA 4QJVA 4FKXA 5IM0B 3GONA 3CJKB 3D1HA 3R27A 2LKZA 2MQMA 3MECA 2DR7A 1N0UA 1PJ7A 2RMLA 2FJAB 1S6OA 4DV6F 5L46A 2BQUA 2VQFF 3I32A 1JB0C 1UP1A 3MGJA 3TJAA 4A8FA 3QLHB 2BJ1A 2J76E 1QD1A 5A8RA 1UW4A 4M5IA 3OTEA 2GVDB 3MF5A 3KLHA 3QATA 4CO4A 3VAMA 2MQOA 3PDNA 2UUAF 5BJRA 2WCXA 4QIVA 1GAOA 2KT2A 1WDDA 2XSJA 1KQGB 5KFWA 5L8RC 2Z4PA 2OI2A 4AQYJ 3FFIB 4UY85 5L1LA 5HROA 4DQIA 2CVEA 4BWMA 1WHVA 2CQIA 4MIAA 4EI2A 4DUYJ 3VGUA 1HBNB 4QWCA 3P6YC 5A0YB 2QMUB 3M8YA 2AYBA 1S9GA 1SXLA 1YQHA 3UNGC 5K8NA 4DU8A 4KTQA 1RT6B 3TNVA 1IQTA 3EXYA 3GV5B 4QBUA 3SDEB 3OL6A 4IDKA 1D9AA 3OFFA 4C11B 4HDHA 1YLXA 1NPKA 3J81U 2DGXA 4DV4J 3BSOA 2HRUA 4I2PB 2MKIA 3RAXA 3SI8A 1B0TA 2J0WA 1WC1A 3KYLA 1RKIA 4B17A 2EKYA 1SJ3P 3KJQB 3PACA 1VQOS 1D9FA 2VG6B 2CQ3A 4Z7YA 4M5NA 2PMWA 1UKUA 5BR8F 1V5IB 2BR0A 4IG0B 4RW8A 3TQ1A 5HQMA 3W2VB 1FXLA 3PRVA 1BHNA 3KLFA 3IN5A 3PW2A 4U67Q 4LFCJ 1WEXA 3Q0AA 2RJZA 4RWXA 1FCAA 5C42A 3GIKA 2LQ5A 2YVSA 3W63A 1FKPA 2IRYA 2YY3A 4TYBA 2APOA 2MJUA 2D41A 2XZTB 5HANA 2V8PA 1YRUA 2CQGA 4WTOB 3V6DB 2BQRA 3I5BA 1FJCA 4B9NA 2HHSA 4JI0J 1HWKA 1RYSA 1UJ5A 4DLGA 3TZXA 4HEA9 4Y2CA 4K8RA 3NBPB 4KHMA 1FDDA 1RJJA 3K8WA 2VPWB 3NRBA 2R4FA 3KOAA 1C1BA 2FJEB 4O3NA 1S4EA 5HO4A 3OR2B 3TJ8A 4DPTA 3ZNUA 1ZM9A 1TUGB 2DR8A 1WG5A 2XY5A 1FTRA 1FDBA 2EWHA 4FNIA 3HSJA 4LRBA 5KFYA 1TKZB 5B09A 4DS4A 2HG4A 3BBCA 1DAXA 1XWLA 3TQEA 2A18A 1IKVA 2BKNA 4OYXA 2R7VA 3NCPA 2CPZA 3G96A 2GO9A 1TL1A 2Y9HA 2X1BA 5GVQA 5KFPA 4TKTA 2Z58B 2AKWB 2JFKA 2CQPA 5KTQA 5M2PA 2OPQA 2LA4A 4V19J 3GU0A 1UVMA 4NLTA 3VAKA 1HBMB 4OYBA 2HHXA 2A3JA 8AT1B 1CJTB 3HHLB 2B4OA 2CADA 1RA7A 3M6UA 5KFSA 2HWIA 2RQ4A 1AZSA 2UUCF 2VKZG 3M9MB 3IRXB 1S10A 3THTA 4CT9A 3JTPA 1HQEA 1U1MA 3BKTA 4O44B 1XNRF 2B51A 3TANA 3EZ5A 1IWGA 3CDAA 5GAEI 2G13A 5KAKA 4HR2A 3P4UB 5E3RA 3AAWB 4I67A 3GFZA 3LAMA 1R0AA 1SQEA 1EIYB 2H5JB 3RBDA 3AD8C 1UVNA 3LP0A 2MKSA 2DNZA 4UQGA 3VV2B 1WC4A 1T0TV 3QBCA 3T5LA 4GVLA 4WIIA 4CI0B 2MLXA 1CULB 2E1AA 3Q24A 1NPRA 3TZYA 4X62F 1EARA 2HQGA 5GADU 2DT9A 4MK7A 4LSLA 3M32A 4XPEA 3OHBA 1SPBP 1VRTB 2E1RA 2AJ4A 4P7TA 3LPYA 4JYAJ 1JLFA 3BO4A 2VBYA 4PWDA 2RU3A 4C0BA 2OPRA 2RKIB 4F4ZA 1SL1A 5HVGA 3V6KA 1RKJA 2R42A 1CQMA 3CPWR 3N5FA 5DDOC 2MLYA 2G9OA 2Z2MA 4Q2MA 3ZTOA 2PIIA 1Y11A 2L9DA 4M1KA 5BXIA 3LA0A 3W7BA 2IM3A 2F9JA 3QMQA 5E2QA 4DR1F 3NNHA 2ZITA 4Y0FA 3IO1A 4ID5A 2YH1A 3B78A 1IN0A 3JB9k 1IBMF 2VV5A 2Z2YB 4OJHA 2FLPA 4P72A 3VGVA 4K2JA 2C2NA 2DH7A 2J6SA 3P5TL 3PHTA 3OTDA 4BBYA 1D9DA 3DOMB 1FJ7A 5J2NB 2WVDA 2R8HA 1PG5B 1CJVA 1WSVA 1V3ZA 1Q82T 3CEDA 4MAKA 5DQHA 3RB0A 2B4UA 4PG6A 5EX0A 3MM7A 4DUTA 1AFIA 5B0GA 1S6UA 3CE8A 2KH9A 4GKKF 3QSYB 2BACA 2YKAA 4NXMF 1Y10A 1UEVA 3I5CA 3CCES 5L38A 1EKRA 2RAQA 2LDYA 1FI4A 1AXQA 3C6TA 3ITHB 4MYTA 1PYOB 3MMAB 1HMVB 2XC9A 2I1RA 1XJWB 3CT9A 1R0CB 3Q8UA 3JYTB 4YFUA 2LMIA 3UR3C 4DL2A 2DNYA 2J6TA 4XO0A 2WONB 4ECTA 4NRUA 1GX5A 5CD4H 3TUZC 3R5JB 2PSZA 4TY8A 1RHUB 3N5BA 1NPPA 4DR2F 2FUG9 3W2WB 3O1LA 2LVWA 1IKYB 4JI1J 1NK6A 4TYAA 3RR7A 2KB2A 1Q5YA 2WB4A 1VBZA 1UPPA 5GAGU 1N32J 1S1XB 2LDIA 2VFTA 2CWKA 1SVDA 2YKPA 2MZTA 4HACA 2UUBF 5KG5A 1FDNA 4PPZA 3KLGA 1E6YA 3FBFA 5CZVA 4WZMA 3BGRB 2XYGB 5FDLA 4ECSA 4WWSA 1NCLA 3GLJA 3IFEA 4KB7A 2DD8S 1BQXA 3EVWA 2V2QA 2BDPA 1CEZA 2E1PA 4LF6J 3LP2A 3H59A 1H0HB 3P5BP 2PT0A 4WU2A 4DZ6A 2E1CA 1HWUA 2YBVA 1RT5B 3ZZPA 3IXQA 4DV2F 2XMTA 5EX3A 4LF9F 4UOGA 4Q2LA 3BZQA 3NWGA 3MM9A 5D78A 2DNRA 1D3WA 2CPYA 2HFUA 2KT3A 3RG6A 4TN2A 3EYZA 1YSJA 4PUOB 2W7AA 4PAAA 2EC2A 3LAKA 3CSKA 2ZJPQ 2MJNA 1T94A 1VC6A 2E5HA 5J2PA 1G4CA 4G6VB 3GYNA 5ETOA 1NKBA 4NA3A 4ZOSA 1HLWA 4O23A 5HVFA 2CJXB 5KT5A 3M8PB 2EK1A 2AZ3A 2FGOA 2U2FA 3JAMY 1MNEA 4RU9A 1VQNS 1R7IA 2NQPA 4DV6J 1E6VB 2DB1A 2K06A 2VQFJ 1U8WA 4NWBA 4B3MF 1SC1B 3WBZA 3H5UA 1OPZA 3ETMA 3TX0A 3RJMB 1OY6A 4W98A 1HYSA 2HKEA 4OI6A 2Y8WA 4F0KA 3GV8B 3A8JA 4QR1A 2GMJA 2WBRA 3N6MA 3T5JA 3EVOA 2ZH7A 4JV5F 2CDRB 4KQZA 2XMVA 3FJ2A 2IA0A 2F8HA 2EFGA 5FLXY 3A4TA 2ROGA 3UW1A 2ZKTA 4EYHB 2ZVSA 3OXLA 3IBFB 3OD2A 3GFYA 3PW5A 2XYHB 3ISZA 2VU5A 2YX4A 4DMZA 3HHDA 1S9EA 4EO8A 4Y3CA 3C8YA 3AXMA 2VFRA 2RUSA 5IV3A 3M8QB 1CJUA 4QYZJ 1N5TA 3BGFA 3SQGB 4DG1B 3LH2S 3HHNB 4DSIA 2VOPA 3DI6A 2DJWA 2QA4S 3OHAA 4F25A 2HNDB 2Z57B 5F8IA 5C24B 3U1MA 5HVHA 3OR1A 1SQGA 3JTOA 2HNYA 1C0TB 3M2RA 1YJ9S 4C8NA 4NMLA 1KHVA 4DV1J 5L1JA 1HI1A 1A0OB 1UEUA 2GO8A 3R2DJ 2I5JA 4U7CA 4HTIA 4L76A 4GC6A 3J81j 4B3RJ 5BR8J 1VQPS 4ELTA 2JDJA 1NBEB 3C6UA 2AHOB 1OO0B 4CWBA 1JLBB 6FD1A 2DK2A 3FKBA 1VQ6S 3NAIA 2M0GB 1XMOF 1KQSR 1QJHA 5D3GA 3RBXA 2C3YA 4N41A 2GW8A 2G4BA 5DQIA 2QE5A 2JC1A 2RS2A 2O3DA 2VG7B 2Q6BA 5C7PA 3HHLD 2MPUA 3BSAA 4KPYA 1WUUA 2VONA 2OPPB 3VZIA 4Z2XA 4PXBA 2DHSA 1A6LA 1QY7A 1CS4A 4NEYA 1ZYQA 2POKA 1B64A 5ETVA 4HVZA 4KKOA 3D0IE 4P10A 4O4GA 1VK8A 4V1Ak 2YNFA 1RE1B 2KJVA 3BKFA 1PJ6A 5IT9Y 4DX5A 3TEGA 5F8NA 3EPIA 2IFXA 4URSA 2OAUA 2RRNA 5DG7A 2N3OA 3T41A 4IH6A 4ZS6A 1Q8IA 2FB0A 3UWTA 3NMRA 1QTMA 2XMJA 3UCZP 1TMJA 2W7PA 2HAFA 2ZH9A 1IUJA 1SV5A 3G86A 4JI3F 1Y3KA 4I7FA 3GZ7A 4NLGA 3ICLA 4OI3A 1NHKL 1OS5A 2V34A 2XZWA 3UO0A 2DIVA 3HZGA 1SH2A 1U6BA 4DFMA 3SCLE 3PJXA 2IJFA 3H7HB 3W9HA 2QLBB 1VOMA 4CH7A 2BJEA 2WSFC 4DSEA 2BM1A 4LF1A 1GQEA 1SL2A 2FJXA 2KI2A 4OYMA 2KVIA 3R9LA 1VQKS 3AODA 4X4OA 4ZVGA 3KHHA 2R8IA 4C97A 2V67A 1JLQA 2DGQA 3R6GB 1RTJA 2WW8A 4K7QA 3CCVS 3BO2A 3E3XA 2Y1LB 1BWEA 1XNRJ 2QIFA 2FLOA 1TVRA 3UCUP 5T7LB 4CM0A 4K4YA 1QUPA 3V2UC 2CIMA 4OYZA 5C2GA 1T05A 4C8ZA 1RP5A 1TZ0A 4Y2MA 1N36F 4FN5A 1OY9A 4F3MA 2K1RB 3EUNA 4J9VA 1FKOB 3ENVA 5D15A 3HSZA 1I51B 3QZ7A 2NR0A 3MEDB 3FCVA 4NLVA 1RTIA 4ZVTB 3MAAB 2ATCB 1KN6A 1FE4A 3W60A 1UJ6A 3BPDA 1FFGB 1T9WA 2OELA 4YB7A 1FJEB 4C6AA 1NRKA 2PFDA 3HULA 3M4XA 4RBTA 5HATA 1X4AA 4PQAA 1JQGA 3J7AN 3CDBA 3TAQA 1YJTA 2BM0A 2HEKA 2NREA 2OP5A 3GE9A 1ZBTA 4OI4A 3J80U 2J0QD 1WTBA 1AT1B 3SCIE 1FVSA 4R25A 1NZ8A 2FPHX 3TP2A 1WC5A 1IKWB 3AJDA 1YBAA 1HWIA 1RK8A 2O67A 3MHYA 2DCLA 2VQEF 4GO7X 2IC3B 5D0HA 1U49A 3CTRA 3H42A 2QLXA 1TKDA 1GXUA 2HVDA 4CQ1A 3BGOP 4C8YA 3P8BB 1RDRA 5HL7Q 1K1SA 4MFBA 3HF5A 4UQTA 4LFAF 1OY8A 2YNHB 1IBMJ 2G2OA 2DXFA 3Q8QB 4AL6A 4B3TF 3OV7A 1NNDA 2C42A 2FJWA 1OYEA 1G7CB 3DOKB 1UJ4A 2A1BA 2HMIA 1DARA 3T1YF 2AEJA 2RF2B 2GIQA 1QE1B 4LR9A 2B7BB 4AE5A 1JMTA 1RTHB 3Q2TC 4YOEA 2D3UA 1TR0A 2NZCA 4GKKJ 1VRUB 3DFEA 1FE0A 3MM8A 2PEBA 4NXMJ 4IYQA 2BVZA 5CH7B 5KFIA 1RAHB 5DQGA 3Q8PB 5HLFA 3FDSA 3KG4A 1G3OA 5HP1B 1C1CA 2QLJB 2DO4A 1VFJA 2HK3A 2LXUA 1X9WA 3GMGA 5BYRA 1RHRB 1DFDA 1X4EA 3MCOA 4DQPA 2KL8A 5T14A 2EFPA 1N34J 3MTKA 3BB5A 1HPZA 1TAQA 1LV5A 2XTJP 2C22A 3PV8A 1VQ4S 2YX1A 4B3OB 3MM5A 2IY5B 3D6MB 1NSPA 1MROB 1RCXB 4AL7A 1TFYA 5DGBA 1WF0A 2DY9A 2V6AA 1UWBB 5D4NA 2DEIA 4DSFA 3FCHA 3IR7B 4H4OB 1GMWA 1RT1A 5CCLA 2RQMA 5DM7Q 5CCMA 2HW3A 3MR2A 4RBUA 4N8NA 1BQNA 3POTA 2YKNA 3CULA 3D5MA 5KFKA 3C15A 5L9NA 2NYHA 3V6JA 4DL4A 2HS0A 2VPXB 3A3PB 2CNLB 4K5SA 2XGPA 5F8MA 4IFYA 4ZITA 1MU2B 4HH0A 4ANDA 1HNIB 5CXTA 3CD6S 2D7SA 1RSCA 4DQRA 4ZDNA 4DV2J 3QZ8A 2H4WB 2DNLA 2M3DA 2B6AB 3NMAA 5F3ZA 3V81A 3BDPA 3AQPA 3VQSA 4AT1B 3P49B 3ZZRA 2FJBB 1REVA 4CLZA 1ACMB 2QMXA 5SUHA 1F9EB 4WE1A 3M05A 4HT7A 4CCHA 2UUTA 4USIA 4OFZA 2M8DB 1H3DA 1HR0F 4IFVA 2HVEA 1S49A 2M8HA 2UU9F 3AFGA 3EZOA 1F5CA 4QCLA 4X4QA 5I3QA 3JQMA 1JLAB 4F2RA 2J7WA 2WVEA 3OTBA 3OVSA 3BDEA 2BANB 3G82B 3DRSB 4U96A 5C25A 2PMHA 3BV8A 4C98A 4ED6A 4P2MA 1YK9A 2FYXA 3U1NA 5KG0A 2MY8A 5E0OA 1S0MA 4B3MJ 4OHXA 2CUYA 3KFWX 1WELA 4PZVA 1V5VA 3C66A 3KLEA 1UPMB 1L5UA 2WAQD 2DRBA 1IKXA 3LP1A 2DNPA 3DDIA 3KK1A 2VD3A 3KK2A 1WG4A 2D69A 4FXWA 3AOBA 2LEPA 4W90B 3UDEA 3MMBB 2XSFA 3R5DA 4JV5J 3HFVA 3BYRA 4ANEA 2H9ZA 3Q8VA 2CPEA 4GRSA 1NU4A 1O5JA 1VHIA 4OYWA 1W26A 3H20A 5AXNA 2DGSA 4XTTA 2HVZA 2Q66A 3HDSA 2PC6A 2NXEA 4I2QA 3THPA 3H0PA 1FRMA 3GYXB 2FVQA 2P6SA 2ZEJA 2ZHAA 3MZIA 1F3FA 2RS8A 1DTQA 1WEYA 4EGLA 5J1EA 1ZS6A 1N5VA 4CDIA 4G1QB 3UDLA 3GR0A 3PZPA 2Q79A 4K4XA 4RUBA 1EX8A 2XNQA 4ED1A 1N6QB 1KBRA 1NKEA 2BJ8A 3AD7C 3KHGA 2ZM6F 4DV3F 1KVIA 2HAIA 2J9CA 4H4MA 2GGPA 5ETRA 3QGIA 1YI2S 3TA2A 2H54B 3ZO7A 1JNZB 2KM8B 2PDAA 3T6JA 2DR9A 1LWEB 1D8ZA 2ZE2B 3PVXA 2FD2A 2HQFA 3KUHA 2RB7A 1ZA1B 2GHPA 2NCKL 1CLFA 1RWPB 2KHDA 3FSYA 3I4HX 4FPIA 4C2MA 3RYLA 1XMOJ 2H51B 2HZCA 4P71A 5DDRC 2LECA 1ZOTA 3JSRA 3D68A 3U02A 3VR1A 2HHVA 4HTJA 3AT1B 2ZBRA 2HRTA 4C3KA 2DPJA 3SCKE 2ZWPA 1P27B 3NY0A 3GB0A 2ZH6A 1HNXJ 1VQMS 1DQ9A 4OZJA 2R8JA 2G2ZA 1FA0A 4NXNF 1S1WB 1RWVB 1XC9A 3TAMA 2FVSA 3QAUA 4NYPA 2ZDOA 1N52B 3CCSS 3PX6A 3NKYA 2X1FA 2EFOA 4OZLA 2IHR1 4DV7J 4WP3A 1EETB 4ZP6A 2HIQA 2LCWA 4FF4A 4RW9A 4Y28C 3TUJC 4L6V3 3K58A 3DLGA 1M5HA 2W01A 2RVJA 3LANA 2ZJQQ 2QEXS 4DDFA 4I6WA 3J7Z5 3FK4A 2QG9B 3HHEA 2E5JA 5IXUA 5K8PA 2FHJA 3VZHA 2NXNA 3TVYA 3M8ZA 4M63A 1X9SA 3BO3A 2CZ4A 3KLIB 4NI2A 2HIYA 3QIPA 3DHXA 1R6VA 4LF4F 4M94A 2B9XA 1KWMA 2MZJA 1R89A 2ROPA 1VHFA 2F5GA 1VYAA 5KFLA 5HMZA 4U7UD 4L3KA 2WSCC 3W1YC 3J7A1 3OXGA 1ZTWA 4ZPCA 5F8HA 3DGPB 2DIUA 2DRAA 2BA9A 2B5JB 1V3SA 2ZH5A 2RSQA 1N0VC 1EP4A 2ZD1B 3OT9A 5FLXU 4XAKA 4ICLB 3CJ5A 1UETA 4HT5A 1BQMB 1N5YB 4NCGA 2EXUA 2OJ3A 1WORA 1NZAA 4DQQA 1S6PB 2FJVA 1LOUA 1SUQB 5G0RA 3QFWA 1T3OA 4E0DA 2YQ3A 1IWAA 2ZKUA 4DR6F 4M5DB 2DRDA 4EMDA 2DHHA 1RAJA 1RHJB 1FJGF 1SCJB 2J9DA 3FBBA 3TRGA 5L1KA 1RBLA 1M1KT 2FY8A 3VAIA 2FZKB 5E5NA 2JWNA 3PFOA 3PCOB 1N36J 4F3QA 1HKAA 2IM2A 3US5A 1S1VB 3IBCB 4ECVA 4ED8A 1Y00A 3D66A 2EEYA 1W2BR 2VKRA 2RT3A 2HQCA 2C3MA 1FD2A 2WOMA 1MMNA 4DV0J 4WP9A 4JI8F 3RW6A 1AUSL 5EUHA 2D9PA 4KO0B 3K5PA 4DUZF 3CJTA 4KH1B 2OEKA 1NEEA 3OJUA 1T9VA 4Q0BB 1WNEA 4F7VA 3GJSB 2EG1A 2QYCA 3RRHA 2V2KA 4F8RA 3C14A 4QIWD 2FTRA 3W3SA 4QW9A 2RDDA 3K59A 2HFZA 2BBEA 4ZHRA 1I94F 1Z4UA 4J9UE 1J5EJ 3ULHA 3L7OA 1Y3JA 2MEWA 3CC7S 2CJYB 4JI6F 3RZAA 2DGVA 4C8LA 2WW4A 2F4VF 1HQUB 3MMCB 2ZH8A 1QUVA 2DY1A 1NB7A 2I2YA 5CYQA 4ELVA 1JXEA 1IBKJ 2L41A 1IBLJ 2AU0A 1WHXA 1M5OC 3DKDA 1L3UA 4LSNA 1XNQF 2AGOA 3CMQA 2VQEJ 2VJUA 1TKXB 5I4MA 2A2DA 3CJ4A 4HLBA 5A8KA 2HS4A 3BKUA 2G0JA 1S4FA 1YJRA 5IT9U 1IXKA 4K4VA 4I64A 1YX2A 5AJ3F 4FBUA 4MT1A 1NHUA 3QO9A 4B3TJ 2CZVC 1WF2A 1H6KX 2V0NA 2A2CA 4KV8A 3SFGA 4LRFA 2EG2A 1TL7B 5GMDA 1C2PA 5D0EA 2ZBIA 4RX6A 5LMNF 1G2EA 3FGVA 2R7QA 4UY8T 2OHDA 4RW7A 3DLLQ 3W64A 4RUCA 1RAEB 5K9FA 2IDLA 4ED4A 1EETA 2D3OR 5GMKa 2HLTA 2JZ5A 5D0RA 2YQ0A 3D0GE 3MR6A 5KFAA 4MKVA 4CT8A 2V8VA 5J2MB 2G0CA 4PWWA 2XY6A 1Q78A 2JSXA 2OMOA 1NH7A 2CWXA 4ED5A 3PG9A 4TVAB 2OIHA 4YHHF 5L9XA 2XEXA 3DXSX 2OO4A 3WIVA 5KFOA 5KG4A 1NDPA 2C3OA 2CKWA 2H5IB 3HSGA 4Y6IA 5IS2A 3AHPA 4J9RA 1HBUB 3EJMA 5HQLA 3R5AA 1U1NA 1N88A 4WIQA 4IKAA 3O6QA 4X64J 4R8UB 1K73T 3D1QA 3MR7A 1FK9B 3I55S 4DXLA 3CF5Q 1RB0A 2ZH3A 2M70A 4ZVSB 2ERRA 4ILMA 2GVZB 1X60A 1F5AA 2XS7A 4JI7J 4LF5J 2B9EA 3D28A 3UR0A 5B0CA 3KJFB 1T95A 5ITHA 2CPDA 3AA9A 3DOLA 2NPIA 1HBOA 1WTFA 1HHSA 3HMJG 2WRMA 1U4BA 1CJKB 4YB1P 2V68A 3KK3A 2C3PA 2LA6A 2YNGA 1S0OA 1TKTA 1RTZA 5I42B 3DHWC 4EYIB 1VQ5S 3M30A 2CRLA 1RWMB 1LW2A 4ED0A 2L08A 3QT7A 4PEOA 4USJC 1U1KA 4O3RA 3CCRS 4HL9A 2VFSA 1DRZA 1DZ5A 3BH6B 4B9LA 3VGTA 3N4WA 3TJ9A 3PJ9A 4RW6A 4LT6A 1JLEB 3KJVA 4G65A 2IVMA 3CCUS 4CNZA 2RH3A 2MQ8A 1IR1A 1HR0J 3D67A 4IOCQ 3H4BA 4Q8FA 2VFUA 5HBMA 2UU9J 2P8IA 5KFMA 4OYOA 4DL5A 1I1GA 4Y2KA 1FX4A 4QYRA 2H4YB 1O51A 2ZOGA 2L9NA 3GTYX 3JSMB 1V9OA 2UXDF 1S7IA 3H8YA 3HVTA 1H2UX 3PRDA 2MKHA 3MCMA 2XWXA 2Z56B 3EM1A 1NXIA 2VPYB 2X3DA 3GJTB 2JEJA 3X3UA 4OI0A 2UXCF 4GKJJ 1YJVA 2N3LA 4Y65A 3KMQA 5GADI 3HSDA 1Y5IB 2ILYA 2V2VA 4QIEA 4F2SA 2AEFA 2GAHC 5THWA 5LXRA 1DLOA 1LW0B 2NSBA 4JV2A 2K2PA 1V6HA 3EGWB 4JB8B 2EKNA 1VQ9S 1J5OB 2IM1A 3K7RA 4LFBF 2OSQA 3FSXA 3LUYA 1U1QA 7FDRA 3D3CJ 1SJ1A 1WHYA 2YKQA 3L9ZA 2KT5A 2V94A 1RXOB 3MM6B 4DI6A 2R7SA 4ECQA 1JNRB 3OLAA 3MURP 3IMQJ 4DR5F 1RT4B 3ZZ0A 1MSWD 3PYFA 2UP1A 2ILZA 1U1RA 3E01B 3VF0B 2CQHA 3R5CA 3TI0A 4S0MA 1UWAA 1RT3A 2CPHA 2CYYA 2IMOA 3KG0A 4DV5F 3AB2B 4M5GA 2JLGA 2ZM6J 3GIJA 4E98A 5IZHA 1WWHA 1U48A 3UCGA 2AD9A 2JNJA 2HGNA 2GJIA 4C8KA 3U27A 4QU7A 2NXUA 2AGPA 4I4BA 1KTVA 3RAMA 1X8DA 3RAQA 2WVCA 4CH0S 4R5PB 5LXYA 4IH5A 3NOGA 1YITS 3W8PA 4QYZK 2CJ9A 1LKZA 5E7OB 4J9MA 5CD4A 2MGZA 3DYAB 4EZ6A 3MEGA 1XN9A 4HHJA 3ET6A 2QSWA 3MEEB 1T7PA 2YKMA 2Q1LA 3BBFA 5B0EA 4DPYA 1RT7A 4NXNJ 1OSCA 4B9UA 4P6QA 1H2TZ 2GQQA 5AE1A 4OHVA 1CQNA 4I0WA 4NCBA 1S5ZA 3DMJB 1PBUA 4BC7A 2CNOB 4YY3J 2YKOA 5GAGI 4WCEQ 1UA1A 1HFEL 1NK7A 1S99A 1LWCA 3T1HF 3CO0P 3VVTA 4ETZA 5K14A 3T9NA 1UAWA 1FEEA 3WDOA 1SH3A 2NPFA 3CO9A 1JLCA 4O0IA 5D0GA 2AX0A 3DRRA 1FWLA 2M9KA 4NLSA 2XMMA 4I6AA 2CQ0A 2ALYB 2FVCA 1SKWA 5AXKA 4ZVRB 5LSOA 2YX7A 4IH7A 3I0SA 4U8VA 1ZZNA 4NLPA 1WOSA 4DPXA 3V4IB 3IRWP 4RUHA 1VQLS 2F1FA 3ZZTA 3A8KA 1U8SA 3TEHB 4OZNA 3NXZA 2RRAA 1VGYA 2X1AA 5HQ8A 2FVPA 5E3PA 1U0HA 2FHOB 3P3DA 4RJVA 4UF4A 3TX8A 2KHCA 1NK0A 1OMSA 3G87A 2GQCA 3PY8A 1TFWA 2GFFA 2N7CA 1WEZA 3B54A 4JI2F 1F0XA 4DR6J 2XWYA 2CNKB 2GHVC 1QAXA 5E3QA 5F8LA 3GSIA 2EFVA 2HVHA 1KLNA 4Z7CA 4ZK7M 4Q45A 1YZ6A 4ECRA 3H5XA 1RT2B 2WZ1A 1Q53A 2RDIA 4ZP9A 2AJQA 4J9OA 1JLGA 1KR4A 1ROFA 2QL9B 3SV4A 2FGCA 1DTTB 1O8BA 4X66F 1EQ0A 3F73A 1PYTA 2Q6CA 3DLEA 2VDHA 1X4BA 1IJFB 3VWSA 1SL0A 4UOFA 3M8WA 4ZN3A 1AA1B 2K3IA 2Y3YA 1VDHA 4M5HA 2E9TA 2OPSB 4L73A 4ER8A 4KJIA 4P75A 4LRDA 3IAS9 3H5YA 2KZMA 3IM8A 3VTIA 1I94J 2RHQB 3FC9A 2ZNYA 1XERA 2J8SA 1YBTA 4PQUB 1U6ZA 1HI0P 1U1PA 3SIPB 4ILRA 1S72S 1T03A 1JKHB 1QSLA 5D6GA 3Q86A 1P8GA 1X5SA 2F7VA 4IO9Q 3CDEA 2MHEA 5ETLA 1X7VA 9RUBA 1FVQA 1U24A 1RTDB 1S0VA 3CD0A 3M6WA 3IG1A 2SXLA 3ZTPA 4ZPTR 1LK5A 2CQ4A 3M6XA 1J27A 1KLMB 4ECYA 2HNZA 4RW4B 3DM2B 1HNZF 5J2QB 4BS2A 2E44A 2F63A 3DLKB 2OTJS 3WX8A 1KOHA 3BPSP 3BQ1A 1VC0A 4ZJQA 2C3UA 3M2VB 2W9BB 3O5TB 1FFWB 2NLWA 1MN9A 3DRPA 2V9KA 3C16A 3M1VB 5I3UA 1GXLA 3GR1A 1C0UA 2AF6A 1RWKB 5IQQA 2YWKA 3A3OB 1HWJA 5IWAF 4A8OA 4UW2A 3W61A 5LMNJ 4KPCA 1D09B 2ACMA 4C7QA 1KQFB 2GMLA 2GZOA 5IOLA 3BEGB 5K8OA 4FF2A 3MPWA 1OWXA 4ERDA 2PA8D 4HI1A 2HFSA 4LVOP 4U9RA 3NGKA 5JMNA 1UMJA 3VCDA 1OSDA 2K3KA 2BKPA 3UVJB 4X4NA 4L74A 5F9LA 5AE2A 1U02A 2VG5A 1VMBA 3N9UC 3GV7B 4TXSA 1UFWA 5A8WB 2GJFA 1F6TA 3BR8A 4MH8A 2IVFB 3QNWB 1Q8BA 1R8HA
chains in the Genus database with same CATH topology
4DV2J 4LF5J 2KL8A 4KYZA 3J81U 3OTOJ 2E5LJ 4JI3J 4DV4J 1N32J 1HNZJ 1N34J 4KY3A 4NXNJ 4DV3J 3IMQJ 4JI5J 1IBKJ 4X66J 4JI6J 1IBLJ 1IBMJ 4JV5J 2F4VJ 2KVQE 4JYAJ 4X62J 2MTLA 3R2CJ 2VQEJ 4RJVA 5LMNJ 4PWWA 1FJGJ 4X65J 4GKJJ 4B3SJ 4LFAJ 4NEYA 1N36J 1XMOJ 2UUBJ 1I94J 1N33J 4YY3J 2ZM6J 4KHPJ 4DV6J 4LF7J 2UUCJ 1XNQJ 2VQFJ 4LF6J 4LF4J 5LM7E 3J7AN 4DR3J 4DR6J 4DV5J 2UUAJ 2UXDJ 2UXCJ 4V1Ak 4LFCJ 3W1YC 5IT9U 4DV0J 4DV1J 4DR5J 4AQYJ 1HNXJ 3J80U 3T1YJ 4OX9J 4HHUA 4YHHJ 5LMUJ 3R2DJ 1XMQJ 4LF8J 4DUYJ 4GKKJ 4JI2J 4K0KJ 4NXMJ 4B3TJ 4DR7J 5IWAJ 4X64J 4JI8J 2MQ8A 4NEZA 1HR0J 4LF9J 5AJ3J 4B3RJ 1HNWJ 5BR8J 5FLXU 1XNRJ 5A2QU 4DV7J 3D3BJ 2UU9J 4DR1J 4DUZJ 2HHHJ 4JI1J 4DR2J 4B3MJ 2UXBJ 4LFBJ 3D3CJ 3T1HJ 4JI0J 4DR4J 1J5EJ 4JI7J 3JAMU 2MEWA 4JI4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 J;  4LF5 J;  2KL8 A;  4KYZ A;  3J81 U;  3OTO J;  2E5L J;  4JI3 J;  4DV4 J;  1N32 J;  1HNZ J;  1N34 J;  4KY3 A;  4NXN J;  4DV3 J;  3IMQ J;  4JI5 J;  1IBK J;  4X66 J;  4JI6 J;  1IBL J;  1IBM J;  4JV5 J;  2F4V J;  2KVQ E;  4JYA J;  4X62 J;  2MTL A;  3R2C J;  2VQE J;  4RJV A;  5LMN J;  4PWW A;  1FJG J;  4X65 J;  4GKJ J;  4B3S J;  4LFA J;  4NEY A;  1N36 J;  1XMO J;  2UUB J;  1I94 J;  1N33 J;  4YY3 J;  2ZM6 J;  4KHP J;  4DV6 J;  4LF7 J;  2UUC J;  1XNQ J;  2VQF J;  4LF6 J;  4LF4 J;  5LM7 E;  3J7A N;  4DR3 J;  4DR6 J;  4DV5 J;  2UUA J;  2UXD J;  2UXC J;  4V1A k;  4LFC J;  3W1Y C;  5IT9 U;  4DV0 J;  4DV1 J;  4DR5 J;  4AQY J;  1HNX J;  3J80 U;  3T1Y J;  4OX9 J;  4HHU A;  4YHH J;  5LMU J;  3R2D J;  1XMQ J;  4LF8 J;  4DUY J;  4GKK J;  4JI2 J;  4K0K J;  4NXM J;  4B3T J;  4DR7 J;  5IWA J;  4X64 J;  4JI8 J;  2MQ8 A;  4NEZ A;  1HR0 J;  4LF9 J;  5AJ3 J;  4B3R J;  1HNW J;  5BR8 J;  5FLX U;  1XNR J;  5A2Q U;  4DV7 J;  3D3B J;  2UU9 J;  4DR1 J;  4DUZ J;  2HHH J;  4JI1 J;  4DR2 J;  4B3M J;  2UXB J;  4LFB J;  3D3C J;  3T1H J;  4JI0 J;  4DR4 J;  1J5E J;  4JI7 J;  3JAM U;  2MEW A;  4JI4 J; 
#chains in the Genus database with same CATH topology
 3HFZ B;  3H25 A;  2R9L A;  4CLF A;  1SJF A;  2M52 A;  3W5Z A;  4A8M P;  1RZM A;  3U7J A;  3M2U A;  2BOP A;  1NSK L;  2CFX A;  2E7V A;  3HLU A;  3F41 A;  4IOA Q;  3GG0 A;  3TUI C;  2AT1 B;  1NKC A;  1KFS A;  1ZM3 A;  5LMU F;  3V4M A;  2DH9 A;  2O01 C;  2MKK A;  1JXL A;  2QZ8 A;  3ILO A;  1TV6 A;  4CLS A;  3J81 Y;  5T41 A;  1TK8 A;  1KSP A;  3EVM A;  3W8G A;  3EDR B;  2W4P A;  2ZFH A;  3CVK A;  4LF8 F;  1NK5 A;  5CYM A;  1LK7 A;  4JI4 F;  3GIL A;  4DX6 A;  3UD5 A;  3OTO F;  4IQM A;  4CLW A;  1YJ7 A;  4YB6 A;  2ZDP A;  2ZH4 A;  1S57 A;  4GVB B;  4MIW A;  4ZMM A;  3M8R A;  3VAG A;  4MK8 A;  2VH7 A;  2Q43 A;  4NYO A;  1TL3 B;  3EGN A;  4HDG A;  1SJR A;  1T02 A;  2MQN A;  3L09 A;  4ZCL A;  4DR4 J;  1D0E A;  1U0S A;  2FHK A;  2JLE A;  2FLN A;  3IWL A;  4F0M A;  4F36 A;  3P45 B;  4QW8 A;  1OQ3 A;  4EFA C;  4XK8 C;  5LSL A;  1LWF A;  4ELU A;  3R3T A;  4K2X A;  2E29 A;  1YRX A;  2XQC A;  2MDA A;  2W9C A;  3IS9 B;  4ES1 A;  4ENO A;  4J9P A;  3CIZ A;  1BC6 A;  4ZCI A;  1TL4 A;  1AYE A;  2R2U A;  1S0N A;  3UDV A;  1F60 B;  4OX9 F;  1HQ2 A;  3CJR A;  4NZ7 A;  3LW5 C;  2V4J A;  1U6F A;  2UXD J;  4PXE A;  1L3T A;  2ZBC A;  4YS2 A;  4ITS A;  2QL7 B;  2EC0 A;  5AT1 B;  2QGF B;  1RU2 A;  1H72 C;  1FEH A;  5IM0 A;  3T6B A;  4IR1 A;  3CJK A;  3UI3 A;  2HS3 A;  4EBE A;  2JVR A;  1OJ4 A;  4P2S A;  3R97 A;  3EX7 B;  4RUA A;  2R7W A;  2QA2 A;  2HHP A;  3VGS A;  3QLH A;  2E5L J;  2LEB A;  2GVD A;  4JUZ A;  3TWZ A;  2W2M P;  4JI5 J;  2PFF B;  2HLU A;  3VVU A;  2KYX A;  1BXN A;  2R2R A;  4USM A;  2OEJ A;  4CO5 A;  1BWV A;  3K2Y A;  3EDQ B;  2BYC A;  2RE1 A;  4ZJO A;  4A8W A;  2GX8 A;  2U1A A;  4AQY F;  2C2D A;  4QPT A;  1LXJ A;  5HJY A;  1L3K A;  4DUY F;  2PD1 A;  3FFI A;  4DWI A;  1PJ5 A;  3Q23 A;  3FEY B;  4F4A A;  4DR5 J;  4DL3 A;  4U8Y A;  1HBN A;  4ZVP B;  1ZPV A;  1NH8 A;  3ILJ A;  2LQ9 A;  3NGU A;  2EPI A;  4CYU B;  3NGR A;  5A0Y A;  3AQO A;  3QT6 A;  2KFN A;  4ZIW A;  1X4F A;  4CO3 A;  2CQC A;  2E9R X;  1S1T B;  1H2V Z;  1SKR A;  2B0G A;  1RT6 A;  4DPW A;  1VI7 A;  4ZN1 A;  2XNR A;  4WBF A;  2QN6 B;  3SDE A;  4LBI A;  2P2C B;  2Y0S D;  5H9E J;  2A6O A;  1KNZ A;  2UZA A;  4C11 A;  3BGL A;  1MMD A;  1NO8 A;  5KFB A;  4CO0 A;  2IBO A;  2A10 A;  4DCJ B;  4I2P A;  2ZH1 A;  4EBC A;  1KVJ A;  8ATC B;  4WK3 A;  2EBE A;  3RU0 A;  3PW7 A;  1X5O A;  2F8E X;  1F3V A;  2YXL A;  2VG6 A;  4USV A;  1VBY A;  4N76 A;  3MTJ A;  3F56 A;  3GII A;  4IG0 A;  4LR8 A;  3MWB A;  2PA3 A;  3W2V A;  5KFR A;  2QFI A;  2XY7 A;  4LFC F;  2D3Z A;  4LBH A;  2RIL A;  3DRX A;  4DN0 A;  2QA4 G;  1RAA B;  2NUU G;  1WAC A;  1S6Q B;  3CXC R;  3NNA A;  1QAY A;  3OUY B;  3OPK A;  1ZM2 A;  2MQP A;  1CPZ A;  5KFC A;  4D3H A;  3IAM 9;  4QOT A;  2YNI B;  3I4P A;  4JI0 F;  3V6D A;  4OYI A;  1HW8 A;  5KFV A;  3GYG A;  2MKJ A;  3SCJ E;  2PEH A;  2W8L A;  4X4U A;  4J7C A;  3WC2 A;  3ENA A;  3T1H J;  3KNG A;  1HHQ A;  3LGM A;  3SSR A;  3NBP A;  2Q3P A;  2V50 A;  3G8T A;  1VJQ A;  4ZLL A;  4ZVU B;  1PC5 A;  2BE2 B;  2O66 A;  2B43 A;  1GXT A;  4AUK A;  3OR2 A;  3CC4 S;  4FF1 A;  3LTO A;  4P9S A;  3M9N B;  1HNV B;  2M88 A;  2WSE C;  2IAJ B;  3WQP A;  1WSR A;  2MZR A;  5KFG A;  2ZZM A;  2DXE A;  2ZBP A;  1T8E A;  2IPO B;  4ECU A;  1VK3 A;  2VC0 A;  3CIM A;  1TKZ A;  3OVA A;  2CA9 A;  3LPE A;  4WTY A;  1EJ7 L;  2ZUG A;  4Q5V A;  3QJJ A;  1XR7 A;  4NLX A;  3C2P A;  1VQY A;  3BYP A;  4USH A;  4C3L A;  1Z2Z A;  4K4S A;  3CW2 C;  5KT3 A;  4PYD A;  4MYU A;  3G6X A;  3EMT A;  2K8G A;  5CAB A;  3PIO Q;  1XIQ A;  1F1B B;  2OGU A;  5A2Q U;  3ZTS A;  3L4B C;  1VBX A;  4ZVH A;  2P6T A;  3OBI A;  4CTA B;  2LQJ A;  2OD6 A;  1L3S A;  4EWT A;  4IG3 B;  4QR0 A;  2XLK A;  1HBM A;  3I0R B;  4KYZ A;  1FXD A;  1FNX H;  1CJT A;  2JL9 A;  3HHL A;  4KGZ B;  2W24 A;  4Q44 A;  3NOC A;  1X0F A;  2IJR A;  4EK2 A;  3ZTR A;  1XQI A;  1SC3 B;  1Q4R A;  3IRX A;  4FXD A;  3QID A;  3SSQ A;  3HM9 A;  3FNN A;  2MTL A;  2UV8 A;  4O44 A;  5G4D A;  2RUG A;  2VOO A;  2QLF B;  2R8K A;  1Y0H A;  4A46 A;  2AIR B;  2E5I A;  4GC7 A;  4KFB B;  2MHN A;  3G6E S;  3FCW A;  2KG1 A;  1FD8 A;  2HWT A;  1SKS A;  4NE9 C;  5IC4 B;  5F0W A;  2QFJ A;  5JXS A;  2EK6 A;  4USW A;  4WFZ A;  5L1I A;  4NEZ A;  1I3O B;  1H7X A;  5F8J A;  3TZW A;  3IP0 A;  3B8H A;  4B9T A;  3OVB A;  5E33 A;  4V19 X;  1CUL A;  2W2N P;  1RA6 A;  5EWG A;  2CJQ A;  4MTP A;  3MR3 A;  3MEC B;  4P2F A;  2CG8 A;  3SZ2 A;  3HD1 A;  3GPA A;  3M8S A;  3OFG A;  2XBP A;  4RNN A;  5MLC V;  2KZZ A;  4UST A;  3L7U A;  4U95 A;  1KDN A;  2XLJ A;  1VRT A;  5JVG Q;  3MD3 A;  6FDR A;  3WZ0 A;  5A8R B;  1H73 A;  2RKI A;  2GMH A;  4ZPV R;  3KLH B;  4Q43 A;  2DR6 A;  3KKF A;  1FNO A;  3PIP Q;  3HCX A;  2QSF A;  2BW2 A;  2UXB F;  3FMB A;  4OIX A;  2BX6 A;  1Q7L B;  3GG1 A;  2UUA J;  4Y2I A;  3B82 A;  1HW9 A;  2XSJ B;  3H4D A;  3AA8 A;  4DJB A;  5CQG A;  2R2T A;  3SMZ A;  2IDE A;  5HRO B;  4PWU A;  1AUD A;  4FS1 A;  1PAE X;  2YPY A;  4TU8 A;  3CWJ A;  4KHR A;  5IWA J;  2K7J A;  4RO0 A;  2FY1 A;  3ZZY A;  1NM2 A;  2OLW A;  1S9G B;  3ZZO A;  2ZNZ A;  3W66 A;  3DOM A;  1LQ9 A;  5J2N A;  1TU0 B;  2BRL A;  4NL5 A;  3R6L B;  4DHV A;  4KHP F;  4DFK A;  1RLC L;  1H98 A;  5D8H B;  2CJB A;  2VFV A;  4IDK B;  2QA1 A;  1BMQ B;  2ZHO A;  4LR7 A;  3C19 A;  4DX8 H;  4OYP A;  1Q81 T;  2IYI A;  2MKC A;  1N4L A;  2JLF A;  2XUL A;  2WTF A;  4NCA A;  2W2O P;  4KGV B;  4CH1 A;  3ITH A;  1H74 A;  3MMA A;  1NK8 A;  3DNC A;  1HMV A;  4O3P A;  2IRX A;  1UVI A;  2MQL A;  3JYT A;  2LFV A;  3DDK A;  1RAI B;  3ELH A;  3D2W A;  4RW8 B;  4G3I A;  2EFN A;  3MPV A;  2ZBQ A;  3KLF B;  2WON A;  3HP6 A;  2R7T A;  3HKZ D;  2B9Y A;  3O8W A;  2P9G A;  3SSS A;  5LMU J;  3JXO A;  3W2W A;  3DGV A;  5C42 B;  1IKY A;  4WF9 Q;  2COL A;  2W4D A;  4TLQ A;  1FKP B;  2E1M C;  3BR9 A;  1N56 A;  4U6P A;  3B4D A;  3H5S A;  1UVK A;  3D54 A;  5DGA A;  3UN3 A;  2AJ0 A;  3LOU A;  1N32 F;  3QT8 A;  4XPC A;  2Z30 B;  2ABY A;  3R7B B;  4A48 A;  1S1X A;  4KR0 B;  4OJG A;  4JI4 J;  3AY0 A;  4WU3 A;  3OTO J;  1RI7 A;  1X5P A;  1WOP A;  2XHW A;  1MG7 A;  4YR2 A;  4A8Y A;  1KON A;  5A6P A;  1QAI A;  1RUS A;  4LUB A;  2AQ4 A;  2QX0 A;  4DFJ A;  4DLE A;  3LO3 A;  1B70 B;  1FWP A;  3BGR A;  2NS1 B;  1EZZ B;  3NAH A;  1C1B B;  2ZZT A;  1U25 A;  4PG7 A;  4BHQ A;  2KFY A;  2FDN A;  5ETN A;  1WD6 A;  4FXV A;  1P6T A;  2F9D A;  3J7Y U;  4TQS A;  1X0P A;  2X51 A;  5LM7 E;  3J7Z T;  2D1C A;  1RT5 A;  3PNI A;  1MWY A;  1XMB A;  4KC5 A;  3UD4 P;  3I56 S;  2IVY A;  2GJ2 A;  1KHW A;  4ED7 A;  2KXN B;  1FXR A;  3MFH A;  2PO4 A;  5K8M A;  2V5H G;  3RRG A;  1QSY A;  2YWE A;  1IKV B;  3IM9 A;  4PUO A;  1FTC A;  5KG3 A;  5LOQ A;  4J5O A;  4BDP A;  2Z8Q A;  2XS5 A;  1TL1 B;  2R7X A;  5KT7 A;  4B3S F;  5D4L A;  1U7L A;  5A6W A;  2CJK A;  3PTW A;  4LVN P;  4I1T A;  3M9O B;  1TL5 A;  2BE9 B;  3ZXW A;  1TP7 A;  4QZV B;  1KRP A;  3MR5 A;  2AYE A;  1R31 A;  2OPQ B;  4OX8 A;  1R0B G;  3JQJ A;  5FJ4 A;  1URR A;  3MUM P;  5CAA A;  3M8P A;  5L39 A;  1UVJ A;  4O3O A;  4ZVE A;  1DY3 A;  2D9O A;  3PYG A;  1SC6 A;  1AZS B;  1E6V A;  3NS6 A;  1XTZ A;  3ILI A;  3PW4 A;  2L3M A;  2UUC J;  2W2Q P;  3HJF A;  1Q79 A;  5DDP C;  1HQE B;  2MY7 A;  4TQR A;  2IJN A;  2KRR A;  3RW7 A;  4B08 A;  5DRK A;  1RGV A;  2KXF A;  1Q0N A;  2D74 B;  4ZCK A;  3PO5 A;  1X5T A;  1KQK A;  1FDA A;  3MD1 A;  3W5X A;  4YQW A;  4P73 A;  1TMM A;  2GAG C;  3IA0 A;  3CGI A;  3OW2 R;  1R0A B;  5ETS A;  3OL9 A;  1DBD A;  3G6Y A;  1U1L A;  5ETT A;  5J1P A;  1S12 A;  3AOA A;  3D6H B;  4YEA A;  1BGX T;  3LP0 B;  2GNK A;  3G4S S;  2HZA A;  3UDC A;  3R5B A;  2ACY A;  1NME B;  3OSP A;  4USK A;  2Y1R I;  3CJ8 A;  2KU7 A;  2AX1 A;  3M8Q A;  2RHS B;  3CCZ A;  4CM2 A;  2HPU A;  3KG1 A;  4OHZ A;  2BKO A;  2OKQ A;  3SQG A;  1XMQ F;  4DG1 A;  2UVW A;  1NJY A;  1JJH A;  5ETP A;  4LSL B;  4C8O A;  3JSB A;  3M32 B;  4F4W A;  4X62 J;  4FNH A;  1DUR A;  3UD3 P;  3VAL A;  2N7Y A;  2HND A;  4BLG A;  4RR5 A;  1JLF B;  5C24 A;  4PWD B;  1HNW F;  2OPR B;  4DV1 F;  3AH6 A;  3M6V A;  4AL5 A;  1C0T A;  2YWG A;  3K0J A;  5FD1 A;  3UPF A;  3IC1 A;  3R8Y A;  4L72 B;  5JUM A;  4USU A;  4CLK A;  4FBT A;  4B3R F;  3KDO A;  1LWX A;  3H2L A;  1Z2L A;  4J91 A;  1MWZ A;  4X4T A;  2AZ1 A;  3V5R A;  4ID5 B;  4OLO A;  3KUG A;  4DR1 J;  1JLB A;  3R5G A;  2J0X A;  4Y2A A;  5KFT A;  1FRK A;  3ZZZ A;  3J80 Y;  3FZ2 A;  1WKJ A;  4FYW B;  1KS2 A;  3MPU B;  5HMW A;  2UVV A;  5HMY A;  1FWK A;  2VG7 A;  3BH7 B;  3PR5 B;  5KT2 A;  2CPI A;  1SQF A;  1CJV B;  1WJ9 A;  1VQ7 S;  4KGM A;  1VJW A;  2OPP A;  2LYV A;  2C2R A;  1UCN A;  2ZC3 A;  2DIT A;  3MM7 B;  3R1H A;  2XB2 D;  3TA0 A;  1PCA A;  3D0H E;  4KT0 C;  4LIW A;  4WFA Q;  3KWM A;  2J9E A;  2H5E A;  3G71 S;  3C6T B;  3HVA A;  5CZX A;  4NAS A;  4FKY A;  5MAO A;  4K4Z A;  4L3N A;  4ED2 A;  4OZ2 A;  3PRB A;  3CJ0 A;  4WJB A;  3N6L A;  4Y34 A;  3GFX A;  1UZH A;  2P5V A;  4F4X A;  1ZZF A;  3LWL A;  4EBD A;  1SJQ A;  4TY8 B;  1Q16 B;  3LGH A;  4C8M A;  5KFX A;  3NCR A;  4K5R A;  4DR2 J;  4NLQ A;  1UZD A;  4IO1 A;  3WC0 A;  3ZNJ 1;  1C4A A;  4UT4 A;  1Q8K A;  4OL8 A;  4Z37 A;  2B8P A;  4OI2 A;  1HI8 A;  4ZVQ B;  3OFH A;  3OL7 A;  3I87 A;  1F9F A;  3NGT A;  3BS9 A;  4HAC B;  2AMC B;  2DPI A;  2VZ9 A;  4QIG A;  1S76 D;  3KLG B;  1E6Y B;  1ELO A;  1U2F A;  2XI3 A;  2UUB J;  5FDL B;  2NSC A;  4O0N A;  5EWE A;  4OYA A;  4OZ1 A;  3CMA S;  3LP2 B;  3PO4 A;  4URQ U;  8RUC A;  4NRT A;  1NJW A;  3HX9 A;  2W9A A;  2VA2 A;  5LSR A;  3TZZ A;  3O2I A;  1TUW A;  2DCU B;  1REG X;  3Q8S B;  1FO1 A;  4LRA A;  2DXD A;  1RHM B;  1IR2 A;  3QT5 A;  2DHG A;  1PAU B;  3MM9 B;  5T7L A;  4LF9 J;  4R0J A;  1LFP A;  2IM0 A;  3D3B J;  4K50 A;  5HN0 A;  3CC2 S;  4KIA A;  1NDC A;  2K1R A;  1FKO A;  4D3G A;  1ZAV A;  4CO2 A;  5EWF A;  4RNM A;  3PX0 A;  5E3C A;  5SZT A;  3G8S A;  3MED A;  5J2P B;  2MST A;  4DF4 A;  3MI7 X;  3MAA A;  2F3J A;  2ALZ A;  1U09 A;  5DLG A;  4RZR A;  3SYZ A;  4K0K F;  4N8O A;  3DU5 A;  5FII A;  4RKU C;  2HK2 A;  1XBW A;  1WI8 A;  4CLT A;  2C28 A;  1WDT A;  4WP8 A;  1EQM A;  3R7N B;  1GNK A;  1LFW A;  3A12 A;  2OFH X;  1MN7 A;  2P9E A;  2LU2 A;  2W8K A;  2Y1J A;  4FPR A;  1IKW A;  1HYS B;  2YWF A;  2CQ2 A;  4M8L A;  4BWJ A;  4OV6 A;  2BQ3 A;  2HWH A;  5K5M A;  5B08 A;  2IC3 A;  4JOU A;  2UXB J;  1JJ4 A;  4QQB A;  4ZPD A;  4M5J A;  1F2H A;  2J5A A;  5KG6 A;  1SB6 A;  4KRW A;  2I38 A;  4CP5 A;  2HQD A;  3NP5 A;  2E5G A;  2YNH A;  2KM8 C;  1YJU A;  2VF3 A;  1S9E B;  3ZC4 A;  4DOZ A;  1PGZ A;  2PI4 A;  3TR5 A;  1T3N A;  4FP9 A;  2DH8 A;  4LQ3 A;  3DOK A;  1CJU B;  1FES A;  2L9W A;  3QRQ A;  3GP9 A;  2ZHB A;  2OTL S;  4KE5 A;  2RF2 A;  4WZQ A;  2DHX A;  4KHP J;  1QE1 A;  3THV A;  3DI6 B;  4G1P A;  1RWO B;  1NK4 A;  1RTH A;  4EU0 A;  4PRF A;  1WC3 A;  3T5H A;  3OR1 B;  3H2U B;  2HNY B;  5JJB A;  5EHH A;  1S77 D;  1NJX A;  1Q95 G;  1VRU A;  3M2R B;  2E9Z A;  4OZ5 A;  4HHU A;  2V8G A;  1C4C A;  2CVI A;  5U47 A;  4FF3 A;  1NJI T;  2I5J B;  5A76 A;  1U47 A;  5HP1 A;  5KT6 A;  3GIM A;  2MYF A;  3G2X A;  3GIR A;  4HKQ A;  5DZ7 A;  1RWN B;  4I56 A;  1N34 F;  3C6U B;  2IMW P;  1N33 F;  3RGI A;  2XI2 A;  5KFJ A;  4YP3 A;  4F4Y A;  3LAL A;  4QIF A;  5D3G B;  4B3O A;  1WF1 A;  4NLW A;  2BJD A;  3L95 X;  2J0S D;  2AJF E;  1MRO A;  4DL6 A;  2VPZ B;  4MMO A;  1K0T A;  4DBQ A;  3CCM S;  3QQC D;  5BYS A;  1UWB A;  2UUW A;  2V4R A;  2KKH A;  2HHT A;  4DR7 F;  5EGY A;  3I6P A;  2DGU A;  5E41 A;  5B0B A;  1F5B A;  1S1U B;  3RB6 A;  1CS4 B;  4H4O A;  1JWW A;  5HJX A;  3CCT A;  4KKO B;  2CAJ A;  2KRB A;  5KFF A;  4O4G B;  3A3N B;  2GS8 A;  5DZ6 A;  2YNF B;  4FYV B;  4F04 B;  5H9F J;  3MXH P;  5HMX A;  2XCA A;  1VIX A;  3TO8 A;  4ES3 A;  2V8H A;  2PGC A;  4I69 A;  1MU2 A;  3EPG A;  4QU6 A;  3ZZU A;  4YDX A;  1HNI A;  1R3N A;  1CVJ A;  4H54 A;  2BMB A;  5IQ6 A;  3TUP A;  1ZET A;  1X4C A;  1SV5 B;  2ZH2 A;  2I6W A;  4I7F B;  3JAM U;  1UL3 A;  4P74 A;  2B6A A;  4ZLP A;  4Q7A A;  5KFU A;  4DR3 F;  4JI3 J;  1JX4 A;  2VOD A;  3OJS A;  4ALZ A;  1B0P A;  1RAG B;  3A13 A;  3BQ2 A;  1RAO A;  3KTQ A;  1T9U A;  3QRR A;  4UOH A;  3ONQ A;  3DDN A;  5DS7 A;  1M0S A;  3VQT A;  3MOJ B;  2AJ1 A;  4B3S J;  5IT4 A;  2Z0G A;  1ULR A;  1JLA A;  3R1L A;  2KG0 A;  1K8A T;  4B02 A;  2BAN A;  3G82 A;  3DRS A;  2QO3 A;  3VHQ A;  2RU9 A;  4DQS A;  2HFN A;  4P52 A;  4MKB A;  2Y1I A;  1TAU A;  5LT5 A;  5GAH U;  3UNY A;  1FRH A;  3K89 A;  1JLQ B;  3T3F A;  1RTJ B;  5ETK A;  3B6B A;  1V3R A;  3S8S A;  1RWX B;  3FQL A;  2Y8Y A;  2FZG B;  1TVR B;  3DRY A;  1F9H A;  3HD2 A;  3ISN C;  2RDJ A;  4A8Q A;  2B56 A;  1WI6 A;  4N5S A;  1T05 B;  2HBZ B;  1IM4 A;  4NYZ A;  3CJ3 A;  1ARO P;  5F8G A;  3MMB A;  2CQB A;  3JS9 A;  3GCX P;  2AJ2 A;  4CRJ A;  1FKA F;  3S7R A;  1Y7P A;  4LF2 A;  2UV8 G;  3A1Y G;  3OL8 A;  3EIC A;  2RIJ A;  2LXI A;  1RTI B;  5KG7 A;  2OEM A;  3RB4 A;  3R2C J;  3BRE A;  4X2B A;  1OPI A;  3KNA A;  4HI2 A;  1YKW A;  2WHO A;  2C2M B;  2KXH A;  4RLE A;  4FVM A;  4P2X A;  3BJY A;  4ZPA A;  2HUR A;  2I9S A;  4ZIV A;  4RNF A;  1XMQ J;  4OMF G;  2NXJ A;  2HZV A;  4G1Q A;  2XMA A;  2WB1 D;  1MML A;  2JOQ A;  5JVH Q;  1PIL A;  1L3V A;  1B3T A;  2J8A A;  3RBZ A;  2PE8 A;  4OJ1 A;  1N6Q A;  1HNW J;  1AB8 A;  1NAQ A;  5KOX A;  3OFE A;  4LIR A;  1H38 A;  4QPX A;  3EGV A;  2G0I A;  3Q8R B;  3JSY A;  4YUD A;  1AFJ A;  1M5S A;  1KTQ A;  2HQI A;  1DJ0 A;  3G6V A;  2R7R A;  3QJP A;  3T5K A;  1N5S A;  4AXI A;  4PKD B;  1LWE A;  5AXM A;  2ZE2 A;  2HGL A;  3H2V E;  4AFF A;  5KOW A;  4YB5 A;  5KFE A;  1GT8 A;  1J2V A;  4MFB B;  4FS2 A;  4XDC A;  4K4W A;  3F0N A;  1QVG R;  4LFA J;  3HT3 A;  2JH3 A;  5ETQ A;  1HNX F;  1BUX A;  3FEX B;  5LJ5 Y;  2HMI B;  1CC7 A;  2WVB A;  4HYK A;  2F8M A;  2F65 A;  1P9Y A;  5DLF A;  1WOO A;  3MMJ A;  5H9E K;  3HO1 A;  1PKU A;  1S1U A;  1MW7 A;  3PFE A;  4F02 A;  4ID8 A;  3T1Y J;  1S1W A;  1FX2 A;  4DV7 F;  2V2Z A;  4WFX A;  2MZ1 A;  1R27 B;  2R7U A;  4KBI A;  3QRP A;  3GQC A;  3MM8 B;  4RNO A;  4K59 A;  2QMW A;  3K57 A;  5HLF B;  4J37 A;  1FRL A;  2M4M A;  2XYP B;  4WXO A;  1C1C B;  1VCT A;  4LF7 F;  4ZCM A;  1OIA A;  3TVZ A;  5RUB A;  5K20 B;  4KY3 A;  3X1L B;  1YJW S;  3KLI A;  4NLR A;  1HPZ B;  4MKA A;  1AW0 A;  4RPF A;  3LGN A;  2VC1 A;  3MM5 B;  4O3Q A;  2HFO A;  3PKM A;  2DIS A;  1IQZ A;  2FQQ B;  1I5O B;  2HFV A;  2JVO A;  5HI7 A;  1RAC B;  4FZV A;  3SBM A;  1K9M T;  4R0E A;  3DGP A;  1RT1 B;  2VA3 A;  1R8P A;  1YDL A;  1URN A;  1TQL A;  4M5K A;  4DX7 A;  2B5J A;  2VBZ A;  4YR3 A;  4WK1 A;  1BQN B;  1FFS B;  3POT B;  2YKN B;  1RHK B;  4LBP A;  2ZD1 A;  1IR0 A;  2XG8 A;  3C15 B;  4ICL A;  1WKK A;  4C0O C;  2MQQ A;  1GFW B;  1W7W A;  1N5Y A;  1BQM A;  1VR6 A;  1X4D A;  5B7W A;  4PPD A;  4NLD A;  2JJ4 D;  1YIJ S;  4IFY B;  1S6P A;  3AXK A;  2N82 B;  4UZC A;  1SUQ A;  3S1T A;  3EZU A;  3I9V 9;  1HA1 A;  2DNO A;  4M5D A;  2ADB A;  5ETM A;  3L7P A;  3EGZ A;  1ITP A;  3H90 A;  1IJE B;  2VAS A;  2DVI A;  5D4O A;  3V81 B;  2E7W A;  1CBK A;  1BLU A;  3VAF A;  2ASD A;  1R6Y A;  1REV B;  5DG8 A;  2RQK A;  1S1V A;  3RB3 A;  4WE1 B;  1FF2 A;  1VQS A;  4DV0 F;  2DEJ A;  4PG8 A;  1KEK A;  1RIS A;  2R2S A;  4IFV B;  1Z1Z A;  1Y9O A;  1RWU A;  1TEL A;  3Q8Y A;  5DO2 A;  3FUY A;  1DQA A;  1B0V A;  4KO0 A;  2HBY B;  2V8D A;  2GV1 A;  2HBR B;  1YWX A;  3KDN A;  5KFQ A;  3NWR A;  2B7C B;  2ASY A;  3HVR A;  4NMX A;  4AXJ A;  1K1Q A;  2JC0 A;  5C25 B;  4K0K J;  4DSL A;  4Q0B A;  1JK9 B;  3E8O A;  1X4H A;  4I68 A;  3E51 A;  4O4R A;  2BZ2 A;  4AD6 A;  1J5E F;  1Q86 T;  2JHE A;  1HHT P;  1PO6 A;  2HRY A;  3R7S B;  3CDU A;  2IIH A;  4RBV A;  5IC6 B;  1IBK F;  1HQU A;  3MMC A;  3OQ2 A;  1IBL F;  4N47 A;  1M90 T;  1M1H A;  3KLE B;  2QV6 A;  3QGP A;  4B9V A;  3EWG A;  1IKX B;  3LP1 B;  4EUV A;  7AT1 B;  2JRS A;  3KK1 B;  5GAE U;  2DNK A;  3KK2 B;  3PJW A;  3FEZ A;  2KVQ E;  2NYI A;  3D9B A;  1TKX A;  3S01 A;  4FYX B;  4DCP B;  1UA0 A;  4FDF A;  4E8U A;  2XO7 A;  2V63 A;  2Y0B B;  4OX6 A;  2OD4 A;  1KC8 T;  2BE7 D;  2XM3 A;  1NB2 A;  1QLN A;  3I31 A;  2XMW A;  3PEJ A;  2N4C A;  4JP8 A;  1A9N B;  4I2Q B;  1X31 C;  1JJ2 R;  1YJN S;  2GIR A;  2M7S A;  1VS3 A;  4ZKA A;  3KUE A;  1U45 A;  1SIW B;  4ECZ A;  4ZA1 A;  3MUV P;  1DTQ B;  4LJM A;  5KFH A;  1JJC B;  5J1E B;  2DNM A;  2V4Q A;  3MAQ A;  1TL7 A;  1XK8 A;  4MKY A;  4QR2 A;  4WPA A;  3MDF A;  2HQ3 A;  4X65 F;  3UQS A;  3AD9 C;  2NZ4 A;  1FNM A;  4J9L A;  1NLK L;  2FC9 A;  3DXB A;  4H4M B;  2GGP B;  1UEK A;  4ZPW R;  3GSD A;  1VIO A;  2BJ7 A;  4DV3 J;  1Y5N B;  1VLY A;  2EFQ A;  1HAR A;  3MCN A;  3VAJ A;  2XGQ A;  2YWH A;  5J2M A;  4DN9 A;  3OXF A;  4ATN A;  4F50 A;  3BBB A;  2MZS A;  4LRE A;  1UFL A;  4P7V A;  3E2E A;  3IGN A;  1N33 J;  3QWP A;  5BYQ A;  2HBQ B;  1NUE A;  2FLL A;  3OLB A;  1IVZ A;  2JEF A;  1RWW B;  4X64 F;  4M5M A;  2M2B A;  1HBU A;  1Q5V A;  4R8U A;  3GJR B;  4NLY A;  4DR7 J;  2AW0 A;  4JV0 A;  1EKS A;  1FK9 A;  3MAH A;  3CME S;  2MB0 B;  3TAM B;  2GA7 A;  5HSP A;  4JI7 F;  1K47 A;  1GMU A;  4PR6 A;  2YQ1 A;  4LF5 F;  3QPI A;  2GVZ A;  1VBK A;  2GCF A;  1VIS A;  4YR0 A;  4F0H A;  2H1Y A;  4CLY A;  4RW9 B;  3DLG B;  1RBA A;  1CJK A;  1S9F A;  3I82 A;  3D1O A;  3QSI A;  3N01 A;  4JV1 A;  2QC3 A;  5I42 A;  2YH0 A;  1X9M A;  3MFI A;  2V69 A;  3NS7 B;  4NX9 A;  2D3O 1;  3K5N A;  4NI2 B;  3QIP B;  3IWX A;  4KH0 B;  3DLJ A;  3P96 A;  4A47 A;  2ZZN A;  4LF4 J;  3UE2 A;  1B7Y B;  4DR3 J;  4K4U A;  2ADC A;  4EZ9 A;  2WK4 A;  1JLE A;  4ZP8 A;  3KLV A;  4QWD A;  2DR5 A;  1KOO A;  4M5L A;  2MLZ A;  4WKR A;  2VHG A;  4N56 A;  3HXM A;  2O1P A;  1MLA A;  2XMK A;  3SV3 A;  3IWN C;  1EP4 B;  3HFK A;  4NCG B;  3NGD A;  7FD1 A;  3MOZ A;  3JSM A;  5IV4 A;  2O5D A;  1GX6 A;  3DLH A;  3QJL A;  4ZPB A;  2ZOM A;  5G0R B;  2UVR A;  2FHM A;  2G2Y A;  1RQ0 A;  3BSN A;  5DJB A;  4UOC A;  1W2I A;  3ENW A;  4GKJ F;  1X4G A;  5CYJ A;  1XR5 A;  2N4D A;  1PC4 A;  2E7X A;  3G8Q A;  4IRD A;  1FJG J;  4HHH A;  2R3V A;  1FHT A;  3G9C A;  3PYD A;  2C2Z B;  2A0F B;  4C3M A;  4Q8E A;  3K5O A;  4A8K A;  3TAP A;  2Z2Z A;  4IR9 A;  2GHW A;  3Q89 A;  2GC8 A;  1KKH A;  5AXL A;  1LW0 A;  1U1O A;  2WOM B;  2ZUA A;  2LQ8 A;  2H65 B;  2DGT A;  2DTJ A;  1Y5L B;  2VBW A;  4WKY A;  4FVC A;  4NLO A;  1J5O A;  4JI8 J;  1YRT A;  3N0V A;  3LQV A;  4F3O A;  2DGO A;  1M1G A;  3BF4 A;  1T11 A;  2KDO A;  1QVF R;  3U1L A;  1W25 A;  4DUZ J;  4EEY A;  3ADA C;  5DET A;  2EI5 A;  3PYE A;  1GH8 A;  1FRI A;  3C14 B;  2WVF A;  3MM6 A;  2CPX A;  2VIC A;  4IRC A;  4ZHR B;  4IOB A;  4GMK A;  1RYR A;  2J7K A;  1RT4 A;  1EB0 A;  2QRR A;  4PYA A;  2QLW A;  3E01 A;  1KVK A;  2JEI A;  5DM6 Q;  4JI6 J;  2LU1 A;  5CYQ B;  2F4V J;  4CLL A;  3IGV A;  2FVR A;  4TLR A;  4LMZ A;  1G6B A;  1GMV A;  3D6T B;  4LSN B;  3FMW A;  3VAH A;  2OML A;  3DN9 A;  2HHH F;  1XNQ J;  1N48 A;  1G1X A;  3PHE A;  2IRU A;  2RQC A;  4NLU A;  2R7O A;  1GMW D;  2MKY A;  5A8K B;  1R8B A;  2VIH A;  3RTV A;  4J9Q A;  5I3P A;  2BJ9 A;  4C0H A;  4R5P A;  1VRQ C;  3K5M A;  4LRC A;  1YTY A;  3GFH A;  5AJ3 J;  3QO9 B;  3T19 A;  4CNY A;  3MPD A;  2WBM A;  2CXE A;  1XEZ A;  3DYA A;  4KV8 B;  4OLP A;  5B0A A;  2DHA A;  3RR8 A;  5DG9 A;  3CCJ S;  3MEE A;  1F2G A;  4OZ0 A;  4DEZ A;  1TTH B;  4X4R A;  4RW7 B;  2HHW A;  4MIB A;  3OSN A;  1B99 A;  3ENQ A;  2PI5 A;  4KAI A;  4MJK A;  1Q8L A;  3H40 A;  2DBB A;  2ZWO A;  4OJ3 A;  4YY3 F;  3DMJ A;  3CCL S;  1P9Q C;  4ILL A;  1FRX A;  4X84 A;  4LF7 J;  1VC5 A;  1RAD B;  1U2C A;  4J9N A;  1ZH5 A;  1UVL A;  1RAB B;  2CDQ A;  1ZAX A;  5LL6 d;  3C46 A;  3JQK A;  2YWW A;  1RLD A;  4DSJ A;  4PG4 A;  4YHH J;  4F4K A;  3PM9 A;  5IT0 A;  4DPU A;  3BM7 A;  3J7Y I;  1S97 A;  3TOQ A;  4EO6 A;  1S79 A;  4M95 A;  3CJQ A;  5ADZ A;  3FRY A;  3WIU A;  3CDW A;  2P9C A;  1D8Y A;  2DNG A;  3V4I A;  2IYG A;  1RCO B;  4DCO B;  3KHL A;  3ZFV A;  4CZC A;  1M5V C;  1UFK A;  3ZTQ A;  2JEG A;  1ZAW A;  3I5A A;  3DOL B;  1HBO B;  4Y00 A;  1FT8 A;  5H1S V;  4E2F B;  1N5Q A;  3T1A A;  3KK3 B;  4WFN Q;  4A8S A;  2YNG B;  1HD0 A;  4UUW A;  1TKT B;  4PXC A;  2H48 B;  3CJ2 A;  2HYI B;  3B4M A;  1NSQ A;  3S6E A;  2BAB A;  2Z2L A;  3M30 B;  1ICE B;  1LW2 B;  1R8C A;  3N28 A;  3LF0 A;  1U2R A;  2MMY A;  3WHI A;  1JIH A;  4TNO A;  4YME A;  2XS2 A;  1WG1 A;  2HHU A;  1QAJ A;  1RT2 A;  2DKO B;  4RW6 B;  3KJV B;  5M2R A;  1YZ7 A;  4DL7 A;  4XDD A;  4WYL A;  3HHL C;  5HBM B;  2FIU A;  1HIY A;  4ZP7 A;  4YDD B;  2CQ1 A;  1DTT A;  1ZM4 A;  1CSJ A;  2JFD A;  2CJA A;  1LEO A;  4OHY A;  5DDQ C;  2W25 A;  5KT4 A;  3RBE A;  4CLU A;  5KG1 A;  3HHK A;  2C1E B;  3K17 A;  3SQO P;  1S7H A;  4CO1 A;  1N8R T;  1NSA A;  2OPS A;  3HVT B;  4LSZ B;  1N54 B;  2LXF A;  1EAY C;  1TK0 A;  4X4S A;  2KYZ A;  3FRZ A;  1VQ8 S;  4PQU A;  1A7G E;  4L75 A;  4OX7 A;  4WFB Q;  2DNQ A;  1JKH A;  3DC2 A;  2F4F A;  2UXC J;  4ZJL A;  2J9D E;  1S48 A;  2AYM A;  4A4J A;  2MZQ A;  4ECX A;  1SJ4 P;  1RTD A;  2PN6 A;  1QDU B;  1NK9 A;  2ZVI A;  2ASL A;  2DNN A;  3MEK A;  3QWU A;  5AE3 A;  1DLO B;  1T9T A;  2XCP A;  1KLM A;  5D77 A;  4LQ9 A;  4RW4 A;  3DM2 A;  5F9N A;  5J2Q A;  9ATC B;  3DLK A;  2LEA A;  3AJ1 A;  1ZPW X;  2EW9 A;  2XMU A;  5KFN A;  3KMS A;  1B7F A;  3M2V A;  2W9B A;  4QWB A;  3SXL A;  4H4K C;  4LFB J;  1QM9 A;  1R8A A;  2FZC B;  3M1V A;  4UUX A;  2OUG A;  3I9Z A;  3W65 A;  2FHJ D;  2AEM A;  4TY9 A;  4XIU A;  1FER A;  3CCQ S;  2VDI A;  3BN7 A;  3ETO A;  2AP6 A;  2OH2 A;  3A8I A;  1GTE A;  4X65 J;  5EDW A;  4PXD A;  1RT3 B;  4TU9 A;  4K4T A;  2B8Q A;  3M7V A;  2BXJ A;  1RU1 A;  4DF8 A;  2V9W A;  1GK8 A;  4OQJ A;  3UN2 A;  4DV5 J;  2CPF A;  3AB4 B;  1SC4 B;  2MXY A;  4DPO A;  3SEO A;  4DV4 F;  1KFD A;  3RRK A;  2BUN A;  3UVJ A;  2BRK A;  1BE4 A;  5B0F A;  4DSK A;  2X3G A;  4DU7 A;  5A8W A;  1U26 A;  3D4J A;  4TU7 A;  4ZLJ A;  2B3T B;  4ZVO B;  3CUN A;  1NDK A;  2H3E B;  1KP6 A;  2ROE A;  3TW0 A;  1RHQ B;  2QYG A;  2G1H A;  2MGZ B;  3FZB A;  2XO6 A;  1O0P A;  3MEG B;  1CG2 A;  3HVW A;  5F0U A;  1WC0 A;  3ET6 B;  4BCA A;  1KD1 T;  2CPJ A;  2YKM B;  4W4M A;  4J9K A;  3O3L A;  1RT7 B;  3CNQ P;  2MSS A;  4ANC A;  2ASJ A;  3CCW A;  2YPZ A;  4OZ3 A;  3W9J A;  2QJ3 A;  4RWW A;  2VB6 A;  4CLP A;  3GJQ B;  4UZB A;  4URG A;  4KGK A;  2HSE B;  4QWA A;  2ZJR Q;  1B4S A;  1LWC B;  1APS A;  2X1G A;  1P1T A;  4NPO A;  5K14 B;  3Q22 A;  3TAR A;  4GVB A;  2DO0 A;  3L3C A;  4OV1 A;  1H7W A;  4PAB A;  2FC8 A;  4BC9 A;  1TL3 A;  2IA6 A;  1JLC B;  1UTA A;  4DR4 F;  1PYS B;  3DRR B;  1LXN A;  3QGG A;  3NL0 A;  1CC8 A;  2BW7 A;  2B4V A;  4IRK A;  4G1I A;  4KGX B;  3SFU A;  3I0S B;  1M5P C;  1Q7Y T;  2NUH A;  3PXG a;  2HGM A;  1ZTT A;  2I8E A;  1Y4Z B;  2W2P P;  2DNH A;  2OFG X;  2AWZ A;  4NA1 A;  4A8X A;  3IS9 A;  3IBW A;  3TA1 A;  5H9F K;  3RUB L;  3BN4 A;  3W9I A;  1HWL A;  4CIO A;  3NCQ A;  1U0H B;  3N79 A;  2KFZ A;  1TUV A;  5C5J A;  1GEH A;  1WC6 A;  4X4V A;  2YTC A;  3NEK A;  2BV3 A;  3C3L A;  3D7S B;  1NHV A;  3T9Z A;  4I6Y A;  3MCS A;  3W5Y A;  1SIZ A;  4JI2 J;  1UW9 A;  3JTN A;  3UFC X;  3K5L A;  2RRB A;  3DU6 A;  1NJZ A;  3Q2S C;  5KG2 A;  2BOA A;  2GIF A;  2KO1 A;  2E5L F;  1DQ8 A;  1YHQ S;  1JLG B;  1SH0 A;  3AJ2 A;  4JI5 F;  2CQD A;  5HAO A;  5D4P A;  4W92 B;  2HHQ A;  4RU2 A;  4F26 A;  6AT1 B;  4PG5 A;  2L48 A;  2F40 A;  5A2Q Y;  2AGQ A;  1I6J A;  3DLE B;  1YG0 A;  4X66 J;  4QWE A;  4NOH A;  1PSD A;  1T9X A;  2BJ3 A;  2EVZ A;  2VUG A;  2X7I A;  2CZ9 A;  4IQX A;  1WHW A;  3I96 A;  2BEF A;  4X4P A;  5CHC B;  2CNN B;  5IFM A;  2W1B A;  2G1D A;  1M5K C;  5GME A;  2AYG A;  4PCQ A;  2K7K A;  3FQK A;  2XHC A;  4CYU A;  2QL5 B;  3D6F B;  5F3T A;  1YVF A;  3PX4 A;  1T03 B;  1RBO B;  5E3A A;  1S1T A;  3TVK A;  4DZD A;  1EHW A;  2C2E A;  2UVU A;  3NNC A;  3DCA A;  3EXC X;  4DL0 C;  4JYA F;  4ECW A;  3EE3 A;  3IG1 B;  2HHH J;  2LP4 A;  2RD5 C;  4YN3 B;  1GTH A;  3DLB A;  1BY9 A;  2HNZ B;  4U7U K;  1R43 A;  4H4K A;  1IM6 A;  3PR4 A;  3IR5 B;  3A8E A;  5C2C A;  4DFP A;  2EBG A;  1HNZ J;  3CJS A;  1T9Y A;  3O44 A;  4NZ6 A;  1SKU B;  3CD7 A;  3PEH A;  3DRP B;  4RNH A;  2KN4 A;  2KJW A;  4N7T A;  3NG8 A;  3C16 B;  5I3U B;  1C0U B;  3LWM A;  2FJD B;  2RNE A;  4N77 A;  2E66 A;  2KTQ A;  2QT7 A;  3NGS A;  5CA5 A;  2M5Y A;  4KSE B;  4FYY B;  2HVI A;  1S59 A;  1S6Q A;  4UTG A;  5HK4 A;  3OUY A;  1JXV A;  1LNQ A;  4C48 A;  3MUT P;  3BSC A;  2J7U A;  2GQ2 A;  3HPO A;  2XLI A;  2YNI A;  4FYD A;  3TYT A;  3BQ0 A;  1YGY A;  2W4C A;  2R8G A;  4O3S A;  3BGU A;  4B9S A;  1XR6 A;  3WX4 A;  1O6X A;  2XZD B;  2VG5 B;  4DS5 A;  3F44 A;  2JX2 A;  3QFH A;  4ZVF A;  5EN1 A;  3NLC A;  4WXW A;  1OQ6 A;  2A6M A;  4J9S A;  3HZE A;  3UN5 A;  2W7O A;  2BE2 A;  3KHR A;  1TK5 A;  3W62 A;  3NS5 A;  2IBK A;  5M2U A;  3CD5 A;  2ZOF A;  1DHM A;  5F41 A;  4B9M A;  3K8V A;  3M2U B;  2B9W A;  2DGW A;  3KJN B;  3ISN D;  1HNV A;  1Q1K A;  2VJV A;  2ATL A;  2IAJ A;  3OTC A;  2AV5 A;  2NXC A;  5KFZ A;  1VLO A;  4C4W A;  4AYB D;  1TV6 B;  4JI1 F;  3HKW A;  2CG4 A;  3IR6 B;  3FVY A;  4WYW A;  2QTW A;  4ZLN A;  4HH1 A;  3MPY A;  4NZ0 A;  3N6N A;  2VL1 A;  3GWC A;  4ETX A;  3PKY A;  4LF8 J;  5KFD A;  3FBE A;  5CYM B;  1D1U A;  4JBC A;  2DYA A;  3FBC A;  2LQB A;  3ILL A;  4RL1 A;  3KXD A;  3PW0 A;  1IBC B;  3HK2 A;  4IUF A;  4CTA A;  3QYY A;  1P1L A;  1MWQ A;  4IG3 A;  4ES2 A;  3GCW P;  3I0R A;  2OSR A;  5GAH I;  4ED3 A;  3QGH A;  4LF6 F;  1K44 A;  3H98 A;  2J6U A;  1K0V A;  4MK9 A;  1RAF B;  2LLZ A;  4NA2 A;  1PBA A;  1NDL A;  2B4P A;  2VBX A;  4WFY A;  1LWF B;  4GO5 X;  1QSS A;  1FRJ A;  3Q83 A;  3CB4 A;  3AOC A;  1OYD A;  1SBR A;  4J90 A;  3QAE A;  2W9C B;  5LJ3 Y;  2C2O B;  1BD6 A;  1WKL A;  4KFB A;  4OI1 A;  1SI9 A;  3FSI A;  5B0D A;  2PMZ D;  1HL6 A;  2ZC4 A;  4OHW A;  3HT0 A;  3HJV A;  1QTN B;  2V4J B;  5J1N A;  4F67 A;  3HI9 A;  4OX9 J;  1PIE A;  2I0X A;  1ZA2 B;  3V6H A;  2C2K B;  1YBU A;  1HD1 A;  4C9D A;  4QJV A;  4FKX A;  5IM0 B;  3GON A;  3CJK B;  3D1H A;  3R27 A;  2LKZ A;  2MQM A;  3MEC A;  2DR7 A;  1N0U A;  1PJ7 A;  2RML A;  2FJA B;  1S6O A;  4DV6 F;  5L46 A;  2BQU A;  2VQF F;  3I32 A;  1JB0 C;  1UP1 A;  3MGJ A;  3TJA A;  4A8F A;  3QLH B;  2BJ1 A;  2J76 E;  1QD1 A;  5A8R A;  1UW4 A;  4M5I A;  3OTE A;  2GVD B;  3MF5 A;  3KLH A;  3QAT A;  4CO4 A;  3VAM A;  2MQO A;  3PDN A;  2UUA F;  5BJR A;  2WCX A;  4QIV A;  1GAO A;  2KT2 A;  1WDD A;  2XSJ A;  1KQG B;  5KFW A;  5L8R C;  2Z4P A;  2OI2 A;  4AQY J;  3FFI B;  4UY8 5;  5L1L A;  5HRO A;  4DQI A;  2CVE A;  4BWM A;  1WHV A;  2CQI A;  4MIA A;  4EI2 A;  4DUY J;  3VGU A;  1HBN B;  4QWC A;  3P6Y C;  5A0Y B;  2QMU B;  3M8Y A;  2AYB A;  1S9G A;  1SXL A;  1YQH A;  3UNG C;  5K8N A;  4DU8 A;  4KTQ A;  1RT6 B;  3TNV A;  1IQT A;  3EXY A;  3GV5 B;  4QBU A;  3SDE B;  3OL6 A;  4IDK A;  1D9A A;  3OFF A;  4C11 B;  4HDH A;  1YLX A;  1NPK A;  3J81 U;  2DGX A;  4DV4 J;  3BSO A;  2HRU A;  4I2P B;  2MKI A;  3RAX A;  3SI8 A;  1B0T A;  2J0W A;  1WC1 A;  3KYL A;  1RKI A;  4B17 A;  2EKY A;  1SJ3 P;  3KJQ B;  3PAC A;  1VQO S;  1D9F A;  2VG6 B;  2CQ3 A;  4Z7Y A;  4M5N A;  2PMW A;  1UKU A;  5BR8 F;  1V5I B;  2BR0 A;  4IG0 B;  4RW8 A;  3TQ1 A;  5HQM A;  3W2V B;  1FXL A;  3PRV A;  1BHN A;  3KLF A;  3IN5 A;  3PW2 A;  4U67 Q;  4LFC J;  1WEX A;  3Q0A A;  2RJZ A;  4RWX A;  1FCA A;  5C42 A;  3GIK A;  2LQ5 A;  2YVS A;  3W63 A;  1FKP A;  2IRY A;  2YY3 A;  4TYB A;  2APO A;  2MJU A;  2D41 A;  2XZT B;  5HAN A;  2V8P A;  1YRU A;  2CQG A;  4WTO B;  3V6D B;  2BQR A;  3I5B A;  1FJC A;  4B9N A;  2HHS A;  4JI0 J;  1HWK A;  1RYS A;  1UJ5 A;  4DLG A;  3TZX A;  4HEA 9;  4Y2C A;  4K8R A;  3NBP B;  4KHM A;  1FDD A;  1RJJ A;  3K8W A;  2VPW B;  3NRB A;  2R4F A;  3KOA A;  1C1B A;  2FJE B;  4O3N A;  1S4E A;  5HO4 A;  3OR2 B;  3TJ8 A;  4DPT A;  3ZNU A;  1ZM9 A;  1TUG B;  2DR8 A;  1WG5 A;  2XY5 A;  1FTR A;  1FDB A;  2EWH A;  4FNI A;  3HSJ A;  4LRB A;  5KFY A;  1TKZ B;  5B09 A;  4DS4 A;  2HG4 A;  3BBC A;  1DAX A;  1XWL A;  3TQE A;  2A18 A;  1IKV A;  2BKN A;  4OYX A;  2R7V A;  3NCP A;  2CPZ A;  3G96 A;  2GO9 A;  1TL1 A;  2Y9H A;  2X1B A;  5GVQ A;  5KFP A;  4TKT A;  2Z58 B;  2AKW B;  2JFK A;  2CQP A;  5KTQ A;  5M2P A;  2OPQ A;  2LA4 A;  4V19 J;  3GU0 A;  1UVM A;  4NLT A;  3VAK A;  1HBM B;  4OYB A;  2HHX A;  2A3J A;  8AT1 B;  1CJT B;  3HHL B;  2B4O A;  2CAD A;  1RA7 A;  3M6U A;  5KFS A;  2HWI A;  2RQ4 A;  1AZS A;  2UUC F;  2VKZ G;  3M9M B;  3IRX B;  1S10 A;  3THT A;  4CT9 A;  3JTP A;  1HQE A;  1U1M A;  3BKT A;  4O44 B;  1XNR F;  2B51 A;  3TAN A;  3EZ5 A;  1IWG A;  3CDA A;  5GAE I;  2G13 A;  5KAK A;  4HR2 A;  3P4U B;  5E3R A;  3AAW B;  4I67 A;  3GFZ A;  3LAM A;  1R0A A;  1SQE A;  1EIY B;  2H5J B;  3RBD A;  3AD8 C;  1UVN A;  3LP0 A;  2MKS A;  2DNZ A;  4UQG A;  3VV2 B;  1WC4 A;  1T0T V;  3QBC A;  3T5L A;  4GVL A;  4WII A;  4CI0 B;  2MLX A;  1CUL B;  2E1A A;  3Q24 A;  1NPR A;  3TZY A;  4X62 F;  1EAR A;  2HQG A;  5GAD U;  2DT9 A;  4MK7 A;  4LSL A;  3M32 A;  4XPE A;  3OHB A;  1SPB P;  1VRT B;  2E1R A;  2AJ4 A;  4P7T A;  3LPY A;  4JYA J;  1JLF A;  3BO4 A;  2VBY A;  4PWD A;  2RU3 A;  4C0B A;  2OPR A;  2RKI B;  4F4Z A;  1SL1 A;  5HVG A;  3V6K A;  1RKJ A;  2R42 A;  1CQM A;  3CPW R;  3N5F A;  5DDO C;  2MLY A;  2G9O A;  2Z2M A;  4Q2M A;  3ZTO A;  2PII A;  1Y11 A;  2L9D A;  4M1K A;  5BXI A;  3LA0 A;  3W7B A;  2IM3 A;  2F9J A;  3QMQ A;  5E2Q A;  4DR1 F;  3NNH A;  2ZIT A;  4Y0F A;  3IO1 A;  4ID5 A;  2YH1 A;  3B78 A;  1IN0 A;  3JB9 k;  1IBM F;  2VV5 A;  2Z2Y B;  4OJH A;  2FLP A;  4P72 A;  3VGV A;  4K2J A;  2C2N A;  2DH7 A;  2J6S A;  3P5T L;  3PHT A;  3OTD A;  4BBY A;  1D9D A;  3DOM B;  1FJ7 A;  5J2N B;  2WVD A;  2R8H A;  1PG5 B;  1CJV A;  1WSV A;  1V3Z A;  1Q82 T;  3CED A;  4MAK A;  5DQH A;  3RB0 A;  2B4U A;  4PG6 A;  5EX0 A;  3MM7 A;  4DUT A;  1AFI A;  5B0G A;  1S6U A;  3CE8 A;  2KH9 A;  4GKK F;  3QSY B;  2BAC A;  2YKA A;  4NXM F;  1Y10 A;  1UEV A;  3I5C A;  3CCE S;  5L38 A;  1EKR A;  2RAQ A;  2LDY A;  1FI4 A;  1AXQ A;  3C6T A;  3ITH B;  4MYT A;  1PYO B;  3MMA B;  1HMV B;  2XC9 A;  2I1R A;  1XJW B;  3CT9 A;  1R0C B;  3Q8U A;  3JYT B;  4YFU A;  2LMI A;  3UR3 C;  4DL2 A;  2DNY A;  2J6T A;  4XO0 A;  2WON B;  4ECT A;  4NRU A;  1GX5 A;  5CD4 H;  3TUZ C;  3R5J B;  2PSZ A;  4TY8 A;  1RHU B;  3N5B A;  1NPP A;  4DR2 F;  2FUG 9;  3W2W B;  3O1L A;  2LVW A;  1IKY B;  4JI1 J;  1NK6 A;  4TYA A;  3RR7 A;  2KB2 A;  1Q5Y A;  2WB4 A;  1VBZ A;  1UPP A;  5GAG U;  1N32 J;  1S1X B;  2LDI A;  2VFT A;  2CWK A;  1SVD A;  2YKP A;  2MZT A;  4HAC A;  2UUB F;  5KG5 A;  1FDN A;  4PPZ A;  3KLG A;  1E6Y A;  3FBF A;  5CZV A;  4WZM A;  3BGR B;  2XYG B;  5FDL A;  4ECS A;  4WWS A;  1NCL A;  3GLJ A;  3IFE A;  4KB7 A;  2DD8 S;  1BQX A;  3EVW A;  2V2Q A;  2BDP A;  1CEZ A;  2E1P A;  4LF6 J;  3LP2 A;  3H59 A;  1H0H B;  3P5B P;  2PT0 A;  4WU2 A;  4DZ6 A;  2E1C A;  1HWU A;  2YBV A;  1RT5 B;  3ZZP A;  3IXQ A;  4DV2 F;  2XMT A;  5EX3 A;  4LF9 F;  4UOG A;  4Q2L A;  3BZQ A;  3NWG A;  3MM9 A;  5D78 A;  2DNR A;  1D3W A;  2CPY A;  2HFU A;  2KT3 A;  3RG6 A;  4TN2 A;  3EYZ A;  1YSJ A;  4PUO B;  2W7A A;  4PAA A;  2EC2 A;  3LAK A;  3CSK A;  2ZJP Q;  2MJN A;  1T94 A;  1VC6 A;  2E5H A;  5J2P A;  1G4C A;  4G6V B;  3GYN A;  5ETO A;  1NKB A;  4NA3 A;  4ZOS A;  1HLW A;  4O23 A;  5HVF A;  2CJX B;  5KT5 A;  3M8P B;  2EK1 A;  2AZ3 A;  2FGO A;  2U2F A;  3JAM Y;  1MNE A;  4RU9 A;  1VQN S;  1R7I A;  2NQP A;  4DV6 J;  1E6V B;  2DB1 A;  2K06 A;  2VQF J;  1U8W A;  4NWB A;  4B3M F;  1SC1 B;  3WBZ A;  3H5U A;  1OPZ A;  3ETM A;  3TX0 A;  3RJM B;  1OY6 A;  4W98 A;  1HYS A;  2HKE A;  4OI6 A;  2Y8W A;  4F0K A;  3GV8 B;  3A8J A;  4QR1 A;  2GMJ A;  2WBR A;  3N6M A;  3T5J A;  3EVO A;  2ZH7 A;  4JV5 F;  2CDR B;  4KQZ A;  2XMV A;  3FJ2 A;  2IA0 A;  2F8H A;  2EFG A;  5FLX Y;  3A4T A;  2ROG A;  3UW1 A;  2ZKT A;  4EYH B;  2ZVS A;  3OXL A;  3IBF B;  3OD2 A;  3GFY A;  3PW5 A;  2XYH B;  3ISZ A;  2VU5 A;  2YX4 A;  4DMZ A;  3HHD A;  1S9E A;  4EO8 A;  4Y3C A;  3C8Y A;  3AXM A;  2VFR A;  2RUS A;  5IV3 A;  3M8Q B;  1CJU A;  4QYZ J;  1N5T A;  3BGF A;  3SQG B;  4DG1 B;  3LH2 S;  3HHN B;  4DSI A;  2VOP A;  3DI6 A;  2DJW A;  2QA4 S;  3OHA A;  4F25 A;  2HND B;  2Z57 B;  5F8I A;  5C24 B;  3U1M A;  5HVH A;  3OR1 A;  1SQG A;  3JTO A;  2HNY A;  1C0T B;  3M2R A;  1YJ9 S;  4C8N A;  4NML A;  1KHV A;  4DV1 J;  5L1J A;  1HI1 A;  1A0O B;  1UEU A;  2GO8 A;  3R2D J;  2I5J A;  4U7C A;  4HTI A;  4L76 A;  4GC6 A;  3J81 j;  4B3R J;  5BR8 J;  1VQP S;  4ELT A;  2JDJ A;  1NBE B;  3C6U A;  2AHO B;  1OO0 B;  4CWB A;  1JLB B;  6FD1 A;  2DK2 A;  3FKB A;  1VQ6 S;  3NAI A;  2M0G B;  1XMO F;  1KQS R;  1QJH A;  5D3G A;  3RBX A;  2C3Y A;  4N41 A;  2GW8 A;  2G4B A;  5DQI A;  2QE5 A;  2JC1 A;  2RS2 A;  2O3D A;  2VG7 B;  2Q6B A;  5C7P A;  3HHL D;  2MPU A;  3BSA A;  4KPY A;  1WUU A;  2VON A;  2OPP B;  3VZI A;  4Z2X A;  4PXB A;  2DHS A;  1A6L A;  1QY7 A;  1CS4 A;  4NEY A;  1ZYQ A;  2POK A;  1B64 A;  5ETV A;  4HVZ A;  4KKO A;  3D0I E;  4P10 A;  4O4G A;  1VK8 A;  4V1A k;  2YNF A;  1RE1 B;  2KJV A;  3BKF A;  1PJ6 A;  5IT9 Y;  4DX5 A;  3TEG A;  5F8N A;  3EPI A;  2IFX A;  4URS A;  2OAU A;  2RRN A;  5DG7 A;  2N3O A;  3T41 A;  4IH6 A;  4ZS6 A;  1Q8I A;  2FB0 A;  3UWT A;  3NMR A;  1QTM A;  2XMJ A;  3UCZ P;  1TMJ A;  2W7P A;  2HAF A;  2ZH9 A;  1IUJ A;  1SV5 A;  3G86 A;  4JI3 F;  1Y3K A;  4I7F A;  3GZ7 A;  4NLG A;  3ICL A;  4OI3 A;  1NHK L;  1OS5 A;  2V34 A;  2XZW A;  3UO0 A;  2DIV A;  3HZG A;  1SH2 A;  1U6B A;  4DFM A;  3SCL E;  3PJX A;  2IJF A;  3H7H B;  3W9H A;  2QLB B;  1VOM A;  4CH7 A;  2BJE A;  2WSF C;  4DSE A;  2BM1 A;  4LF1 A;  1GQE A;  1SL2 A;  2FJX A;  2KI2 A;  4OYM A;  2KVI A;  3R9L A;  1VQK S;  3AOD A;  4X4O A;  4ZVG A;  3KHH A;  2R8I A;  4C97 A;  2V67 A;  1JLQ A;  2DGQ A;  3R6G B;  1RTJ A;  2WW8 A;  4K7Q A;  3CCV S;  3BO2 A;  3E3X A;  2Y1L B;  1BWE A;  1XNR J;  2QIF A;  2FLO A;  1TVR A;  3UCU P;  5T7L B;  4CM0 A;  4K4Y A;  1QUP A;  3V2U C;  2CIM A;  4OYZ A;  5C2G A;  1T05 A;  4C8Z A;  1RP5 A;  1TZ0 A;  4Y2M A;  1N36 F;  4FN5 A;  1OY9 A;  4F3M A;  2K1R B;  3EUN A;  4J9V A;  1FKO B;  3ENV A;  5D15 A;  3HSZ A;  1I51 B;  3QZ7 A;  2NR0 A;  3MED B;  3FCV A;  4NLV A;  1RTI A;  4ZVT B;  3MAA B;  2ATC B;  1KN6 A;  1FE4 A;  3W60 A;  1UJ6 A;  3BPD A;  1FFG B;  1T9W A;  2OEL A;  4YB7 A;  1FJE B;  4C6A A;  1NRK A;  2PFD A;  3HUL A;  3M4X A;  4RBT A;  5HAT A;  1X4A A;  4PQA A;  1JQG A;  3J7A N;  3CDB A;  3TAQ A;  1YJT A;  2BM0 A;  2HEK A;  2NRE A;  2OP5 A;  3GE9 A;  1ZBT A;  4OI4 A;  3J80 U;  2J0Q D;  1WTB A;  1AT1 B;  3SCI E;  1FVS A;  4R25 A;  1NZ8 A;  2FPH X;  3TP2 A;  1WC5 A;  1IKW B;  3AJD A;  1YBA A;  1HWI A;  1RK8 A;  2O67 A;  3MHY A;  2DCL A;  2VQE F;  4GO7 X;  2IC3 B;  5D0H A;  1U49 A;  3CTR A;  3H42 A;  2QLX A;  1TKD A;  1GXU A;  2HVD A;  4CQ1 A;  3BGO P;  4C8Y A;  3P8B B;  1RDR A;  5HL7 Q;  1K1S A;  4MFB A;  3HF5 A;  4UQT A;  4LFA F;  1OY8 A;  2YNH B;  1IBM J;  2G2O A;  2DXF A;  3Q8Q B;  4AL6 A;  4B3T F;  3OV7 A;  1NND A;  2C42 A;  2FJW A;  1OYE A;  1G7C B;  3DOK B;  1UJ4 A;  2A1B A;  2HMI A;  1DAR A;  3T1Y F;  2AEJ A;  2RF2 B;  2GIQ A;  1QE1 B;  4LR9 A;  2B7B B;  4AE5 A;  1JMT A;  1RTH B;  3Q2T C;  4YOE A;  2D3U A;  1TR0 A;  2NZC A;  4GKK J;  1VRU B;  3DFE A;  1FE0 A;  3MM8 A;  2PEB A;  4NXM J;  4IYQ A;  2BVZ A;  5CH7 B;  5KFI A;  1RAH B;  5DQG A;  3Q8P B;  5HLF A;  3FDS A;  3KG4 A;  1G3O A;  5HP1 B;  1C1C A;  2QLJ B;  2DO4 A;  1VFJ A;  2HK3 A;  2LXU A;  1X9W A;  3GMG A;  5BYR A;  1RHR B;  1DFD A;  1X4E A;  3MCO A;  4DQP A;  2KL8 A;  5T14 A;  2EFP A;  1N34 J;  3MTK A;  3BB5 A;  1HPZ A;  1TAQ A;  1LV5 A;  2XTJ P;  2C22 A;  3PV8 A;  1VQ4 S;  2YX1 A;  4B3O B;  3MM5 A;  2IY5 B;  3D6M B;  1NSP A;  1MRO B;  1RCX B;  4AL7 A;  1TFY A;  5DGB A;  1WF0 A;  2DY9 A;  2V6A A;  1UWB B;  5D4N A;  2DEI A;  4DSF A;  3FCH A;  3IR7 B;  4H4O B;  1GMW A;  1RT1 A;  5CCL A;  2RQM A;  5DM7 Q;  5CCM A;  2HW3 A;  3MR2 A;  4RBU A;  4N8N A;  1BQN A;  3POT A;  2YKN A;  3CUL A;  3D5M A;  5KFK A;  3C15 A;  5L9N A;  2NYH A;  3V6J A;  4DL4 A;  2HS0 A;  2VPX B;  3A3P B;  2CNL B;  4K5S A;  2XGP A;  5F8M A;  4IFY A;  4ZIT A;  1MU2 B;  4HH0 A;  4AND A;  1HNI B;  5CXT A;  3CD6 S;  2D7S A;  1RSC A;  4DQR A;  4ZDN A;  4DV2 J;  3QZ8 A;  2H4W B;  2DNL A;  2M3D A;  2B6A B;  3NMA A;  5F3Z A;  3V81 A;  3BDP A;  3AQP A;  3VQS A;  4AT1 B;  3P49 B;  3ZZR A;  2FJB B;  1REV A;  4CLZ A;  1ACM B;  2QMX A;  5SUH A;  1F9E B;  4WE1 A;  3M05 A;  4HT7 A;  4CCH A;  2UUT A;  4USI A;  4OFZ A;  2M8D B;  1H3D A;  1HR0 F;  4IFV A;  2HVE A;  1S49 A;  2M8H A;  2UU9 F;  3AFG A;  3EZO A;  1F5C A;  4QCL A;  4X4Q A;  5I3Q A;  3JQM A;  1JLA B;  4F2R A;  2J7W A;  2WVE A;  3OTB A;  3OVS A;  3BDE A;  2BAN B;  3G82 B;  3DRS B;  4U96 A;  5C25 A;  2PMH A;  3BV8 A;  4C98 A;  4ED6 A;  4P2M A;  1YK9 A;  2FYX A;  3U1N A;  5KG0 A;  2MY8 A;  5E0O A;  1S0M A;  4B3M J;  4OHX A;  2CUY A;  3KFW X;  1WEL A;  4PZV A;  1V5V A;  3C66 A;  3KLE A;  1UPM B;  1L5U A;  2WAQ D;  2DRB A;  1IKX A;  3LP1 A;  2DNP A;  3DDI A;  3KK1 A;  2VD3 A;  3KK2 A;  1WG4 A;  2D69 A;  4FXW A;  3AOB A;  2LEP A;  4W90 B;  3UDE A;  3MMB B;  2XSF A;  3R5D A;  4JV5 J;  3HFV A;  3BYR A;  4ANE A;  2H9Z A;  3Q8V A;  2CPE A;  4GRS A;  1NU4 A;  1O5J A;  1VHI A;  4OYW A;  1W26 A;  3H20 A;  5AXN A;  2DGS A;  4XTT A;  2HVZ A;  2Q66 A;  3HDS A;  2PC6 A;  2NXE A;  4I2Q A;  3THP A;  3H0P A;  1FRM A;  3GYX B;  2FVQ A;  2P6S A;  2ZEJ A;  2ZHA A;  3MZI A;  1F3F A;  2RS8 A;  1DTQ A;  1WEY A;  4EGL A;  5J1E A;  1ZS6 A;  1N5V A;  4CDI A;  4G1Q B;  3UDL A;  3GR0 A;  3PZP A;  2Q79 A;  4K4X A;  4RUB A;  1EX8 A;  2XNQ A;  4ED1 A;  1N6Q B;  1KBR A;  1NKE A;  2BJ8 A;  3AD7 C;  3KHG A;  2ZM6 F;  4DV3 F;  1KVI A;  2HAI A;  2J9C A;  4H4M A;  2GGP A;  5ETR A;  3QGI A;  1YI2 S;  3TA2 A;  2H54 B;  3ZO7 A;  1JNZ B;  2KM8 B;  2PDA A;  3T6J A;  2DR9 A;  1LWE B;  1D8Z A;  2ZE2 B;  3PVX A;  2FD2 A;  2HQF A;  3KUH A;  2RB7 A;  1ZA1 B;  2GHP A;  2NCK L;  1CLF A;  1RWP B;  2KHD A;  3FSY A;  3I4H X;  4FPI A;  4C2M A;  3RYL A;  1XMO J;  2H51 B;  2HZC A;  4P71 A;  5DDR C;  2LEC A;  1ZOT A;  3JSR A;  3D68 A;  3U02 A;  3VR1 A;  2HHV A;  4HTJ A;  3AT1 B;  2ZBR A;  2HRT A;  4C3K A;  2DPJ A;  3SCK E;  2ZWP A;  1P27 B;  3NY0 A;  3GB0 A;  2ZH6 A;  1HNX J;  1VQM S;  1DQ9 A;  4OZJ A;  2R8J A;  2G2Z A;  1FA0 A;  4NXN F;  1S1W B;  1RWV B;  1XC9 A;  3TAM A;  2FVS A;  3QAU A;  4NYP A;  2ZDO A;  1N52 B;  3CCS S;  3PX6 A;  3NKY A;  2X1F A;  2EFO A;  4OZL A;  2IHR 1;  4DV7 J;  4WP3 A;  1EET B;  4ZP6 A;  2HIQ A;  2LCW A;  4FF4 A;  4RW9 A;  4Y28 C;  3TUJ C;  4L6V 3;  3K58 A;  3DLG A;  1M5H A;  2W01 A;  2RVJ A;  3LAN A;  2ZJQ Q;  2QEX S;  4DDF A;  4I6W A;  3J7Z 5;  3FK4 A;  2QG9 B;  3HHE A;  2E5J A;  5IXU A;  5K8P A;  2FHJ A;  3VZH A;  2NXN A;  3TVY A;  3M8Z A;  4M63 A;  1X9S A;  3BO3 A;  2CZ4 A;  3KLI B;  4NI2 A;  2HIY A;  3QIP A;  3DHX A;  1R6V A;  4LF4 F;  4M94 A;  2B9X A;  1KWM A;  2MZJ A;  1R89 A;  2ROP A;  1VHF A;  2F5G A;  1VYA A;  5KFL A;  5HMZ A;  4U7U D;  4L3K A;  2WSC C;  3W1Y C;  3J7A 1;  3OXG A;  1ZTW A;  4ZPC A;  5F8H A;  3DGP B;  2DIU A;  2DRA A;  2BA9 A;  2B5J B;  1V3S A;  2ZH5 A;  2RSQ A;  1N0V C;  1EP4 A;  2ZD1 B;  3OT9 A;  5FLX U;  4XAK A;  4ICL B;  3CJ5 A;  1UET A;  4HT5 A;  1BQM B;  1N5Y B;  4NCG A;  2EXU A;  2OJ3 A;  1WOR A;  1NZA A;  4DQQ A;  1S6P B;  2FJV A;  1LOU A;  1SUQ B;  5G0R A;  3QFW A;  1T3O A;  4E0D A;  2YQ3 A;  1IWA A;  2ZKU A;  4DR6 F;  4M5D B;  2DRD A;  4EMD A;  2DHH A;  1RAJ A;  1RHJ B;  1FJG F;  1SCJ B;  2J9D A;  3FBB A;  3TRG A;  5L1K A;  1RBL A;  1M1K T;  2FY8 A;  3VAI A;  2FZK B;  5E5N A;  2JWN A;  3PFO A;  3PCO B;  1N36 J;  4F3Q A;  1HKA A;  2IM2 A;  3US5 A;  1S1V B;  3IBC B;  4ECV A;  4ED8 A;  1Y00 A;  3D66 A;  2EEY A;  1W2B R;  2VKR A;  2RT3 A;  2HQC A;  2C3M A;  1FD2 A;  2WOM A;  1MMN A;  4DV0 J;  4WP9 A;  4JI8 F;  3RW6 A;  1AUS L;  5EUH A;  2D9P A;  4KO0 B;  3K5P A;  4DUZ F;  3CJT A;  4KH1 B;  2OEK A;  1NEE A;  3OJU A;  1T9V A;  4Q0B B;  1WNE A;  4F7V A;  3GJS B;  2EG1 A;  2QYC A;  3RRH A;  2V2K A;  4F8R A;  3C14 A;  4QIW D;  2FTR A;  3W3S A;  4QW9 A;  2RDD A;  3K59 A;  2HFZ A;  2BBE A;  4ZHR A;  1I94 F;  1Z4U A;  4J9U E;  1J5E J;  3ULH A;  3L7O A;  1Y3J A;  2MEW A;  3CC7 S;  2CJY B;  4JI6 F;  3RZA A;  2DGV A;  4C8L A;  2WW4 A;  2F4V F;  1HQU B;  3MMC B;  2ZH8 A;  1QUV A;  2DY1 A;  1NB7 A;  2I2Y A;  5CYQ A;  4ELV A;  1JXE A;  1IBK J;  2L41 A;  1IBL J;  2AU0 A;  1WHX A;  1M5O C;  3DKD A;  1L3U A;  4LSN A;  1XNQ F;  2AGO A;  3CMQ A;  2VQE J;  2VJU A;  1TKX B;  5I4M A;  2A2D A;  3CJ4 A;  4HLB A;  5A8K A;  2HS4 A;  3BKU A;  2G0J A;  1S4F A;  1YJR A;  5IT9 U;  1IXK A;  4K4V A;  4I64 A;  1YX2 A;  5AJ3 F;  4FBU A;  4MT1 A;  1NHU A;  3QO9 A;  4B3T J;  2CZV C;  1WF2 A;  1H6K X;  2V0N A;  2A2C A;  4KV8 A;  3SFG A;  4LRF A;  2EG2 A;  1TL7 B;  5GMD A;  1C2P A;  5D0E A;  2ZBI A;  4RX6 A;  5LMN F;  1G2E A;  3FGV A;  2R7Q A;  4UY8 T;  2OHD A;  4RW7 A;  3DLL Q;  3W64 A;  4RUC A;  1RAE B;  5K9F A;  2IDL A;  4ED4 A;  1EET A;  2D3O R;  5GMK a;  2HLT A;  2JZ5 A;  5D0R A;  2YQ0 A;  3D0G E;  3MR6 A;  5KFA A;  4MKV A;  4CT8 A;  2V8V A;  5J2M B;  2G0C A;  4PWW A;  2XY6 A;  1Q78 A;  2JSX A;  2OMO A;  1NH7 A;  2CWX A;  4ED5 A;  3PG9 A;  4TVA B;  2OIH A;  4YHH F;  5L9X A;  2XEX A;  3DXS X;  2OO4 A;  3WIV A;  5KFO A;  5KG4 A;  1NDP A;  2C3O A;  2CKW A;  2H5I B;  3HSG A;  4Y6I A;  5IS2 A;  3AHP A;  4J9R A;  1HBU B;  3EJM A;  5HQL A;  3R5A A;  1U1N A;  1N88 A;  4WIQ A;  4IKA A;  3O6Q A;  4X64 J;  4R8U B;  1K73 T;  3D1Q A;  3MR7 A;  1FK9 B;  3I55 S;  4DXL A;  3CF5 Q;  1RB0 A;  2ZH3 A;  2M70 A;  4ZVS B;  2ERR A;  4ILM A;  2GVZ B;  1X60 A;  1F5A A;  2XS7 A;  4JI7 J;  4LF5 J;  2B9E A;  3D28 A;  3UR0 A;  5B0C A;  3KJF B;  1T95 A;  5ITH A;  2CPD A;  3AA9 A;  3DOL A;  2NPI A;  1HBO A;  1WTF A;  1HHS A;  3HMJ G;  2WRM A;  1U4B A;  1CJK B;  4YB1 P;  2V68 A;  3KK3 A;  2C3P A;  2LA6 A;  2YNG A;  1S0O A;  1TKT A;  1RTZ A;  5I42 B;  3DHW C;  4EYI B;  1VQ5 S;  3M30 A;  2CRL A;  1RWM B;  1LW2 A;  4ED0 A;  2L08 A;  3QT7 A;  4PEO A;  4USJ C;  1U1K A;  4O3R A;  3CCR S;  4HL9 A;  2VFS A;  1DRZ A;  1DZ5 A;  3BH6 B;  4B9L A;  3VGT A;  3N4W A;  3TJ9 A;  3PJ9 A;  4RW6 A;  4LT6 A;  1JLE B;  3KJV A;  4G65 A;  2IVM A;  3CCU S;  4CNZ A;  2RH3 A;  2MQ8 A;  1IR1 A;  1HR0 J;  3D67 A;  4IOC Q;  3H4B A;  4Q8F A;  2VFU A;  5HBM A;  2UU9 J;  2P8I A;  5KFM A;  4OYO A;  4DL5 A;  1I1G A;  4Y2K A;  1FX4 A;  4QYR A;  2H4Y B;  1O51 A;  2ZOG A;  2L9N A;  3GTY X;  3JSM B;  1V9O A;  2UXD F;  1S7I A;  3H8Y A;  3HVT A;  1H2U X;  3PRD A;  2MKH A;  3MCM A;  2XWX A;  2Z56 B;  3EM1 A;  1NXI A;  2VPY B;  2X3D A;  3GJT B;  2JEJ A;  3X3U A;  4OI0 A;  2UXC F;  4GKJ J;  1YJV A;  2N3L A;  4Y65 A;  3KMQ A;  5GAD I;  3HSD A;  1Y5I B;  2ILY A;  2V2V A;  4QIE A;  4F2S A;  2AEF A;  2GAH C;  5THW A;  5LXR A;  1DLO A;  1LW0 B;  2NSB A;  4JV2 A;  2K2P A;  1V6H A;  3EGW B;  4JB8 B;  2EKN A;  1VQ9 S;  1J5O B;  2IM1 A;  3K7R A;  4LFB F;  2OSQ A;  3FSX A;  3LUY A;  1U1Q A;  7FDR A;  3D3C J;  1SJ1 A;  1WHY A;  2YKQ A;  3L9Z A;  2KT5 A;  2V94 A;  1RXO B;  3MM6 B;  4DI6 A;  2R7S A;  4ECQ A;  1JNR B;  3OLA A;  3MUR P;  3IMQ J;  4DR5 F;  1RT4 B;  3ZZ0 A;  1MSW D;  3PYF A;  2UP1 A;  2ILZ A;  1U1R A;  3E01 B;  3VF0 B;  2CQH A;  3R5C A;  3TI0 A;  4S0M A;  1UWA A;  1RT3 A;  2CPH A;  2CYY A;  2IMO A;  3KG0 A;  4DV5 F;  3AB2 B;  4M5G A;  2JLG A;  2ZM6 J;  3GIJ A;  4E98 A;  5IZH A;  1WWH A;  1U48 A;  3UCG A;  2AD9 A;  2JNJ A;  2HGN A;  2GJI A;  4C8K A;  3U27 A;  4QU7 A;  2NXU A;  2AGP A;  4I4B A;  1KTV A;  3RAM A;  1X8D A;  3RAQ A;  2WVC A;  4CH0 S;  4R5P B;  5LXY A;  4IH5 A;  3NOG A;  1YIT S;  3W8P A;  4QYZ K;  2CJ9 A;  1LKZ A;  5E7O B;  4J9M A;  5CD4 A;  2MGZ A;  3DYA B;  4EZ6 A;  3MEG A;  1XN9 A;  4HHJ A;  3ET6 A;  2QSW A;  3MEE B;  1T7P A;  2YKM A;  2Q1L A;  3BBF A;  5B0E A;  4DPY A;  1RT7 A;  4NXN J;  1OSC A;  4B9U A;  4P6Q A;  1H2T Z;  2GQQ A;  5AE1 A;  4OHV A;  1CQN A;  4I0W A;  4NCB A;  1S5Z A;  3DMJ B;  1PBU A;  4BC7 A;  2CNO B;  4YY3 J;  2YKO A;  5GAG I;  4WCE Q;  1UA1 A;  1HFE L;  1NK7 A;  1S99 A;  1LWC A;  3T1H F;  3CO0 P;  3VVT A;  4ETZ A;  5K14 A;  3T9N A;  1UAW A;  1FEE A;  3WDO A;  1SH3 A;  2NPF A;  3CO9 A;  1JLC A;  4O0I A;  5D0G A;  2AX0 A;  3DRR A;  1FWL A;  2M9K A;  4NLS A;  2XMM A;  4I6A A;  2CQ0 A;  2ALY B;  2FVC A;  1SKW A;  5AXK A;  4ZVR B;  5LSO A;  2YX7 A;  4IH7 A;  3I0S A;  4U8V A;  1ZZN A;  4NLP A;  1WOS A;  4DPX A;  3V4I B;  3IRW P;  4RUH A;  1VQL S;  2F1F A;  3ZZT A;  3A8K A;  1U8S A;  3TEH B;  4OZN A;  3NXZ A;  2RRA A;  1VGY A;  2X1A A;  5HQ8 A;  2FVP A;  5E3P A;  1U0H A;  2FHO B;  3P3D A;  4RJV A;  4UF4 A;  3TX8 A;  2KHC A;  1NK0 A;  1OMS A;  3G87 A;  2GQC A;  3PY8 A;  1TFW A;  2GFF A;  2N7C A;  1WEZ A;  3B54 A;  4JI2 F;  1F0X A;  4DR6 J;  2XWY A;  2CNK B;  2GHV C;  1QAX A;  5E3Q A;  5F8L A;  3GSI A;  2EFV A;  2HVH A;  1KLN A;  4Z7C A;  4ZK7 M;  4Q45 A;  1YZ6 A;  4ECR A;  3H5X A;  1RT2 B;  2WZ1 A;  1Q53 A;  2RDI A;  4ZP9 A;  2AJQ A;  4J9O A;  1JLG A;  1KR4 A;  1ROF A;  2QL9 B;  3SV4 A;  2FGC A;  1DTT B;  1O8B A;  4X66 F;  1EQ0 A;  3F73 A;  1PYT A;  2Q6C A;  3DLE A;  2VDH A;  1X4B A;  1IJF B;  3VWS A;  1SL0 A;  4UOF A;  3M8W A;  4ZN3 A;  1AA1 B;  2K3I A;  2Y3Y A;  1VDH A;  4M5H A;  2E9T A;  2OPS B;  4L73 A;  4ER8 A;  4KJI A;  4P75 A;  4LRD A;  3IAS 9;  3H5Y A;  2KZM A;  3IM8 A;  3VTI A;  1I94 J;  2RHQ B;  3FC9 A;  2ZNY A;  1XER A;  2J8S A;  1YBT A;  4PQU B;  1U6Z A;  1HI0 P;  1U1P A;  3SIP B;  4ILR A;  1S72 S;  1T03 A;  1JKH B;  1QSL A;  5D6G A;  3Q86 A;  1P8G A;  1X5S A;  2F7V A;  4IO9 Q;  3CDE A;  2MHE A;  5ETL A;  1X7V A;  9RUB A;  1FVQ A;  1U24 A;  1RTD B;  1S0V A;  3CD0 A;  3M6W A;  3IG1 A;  2SXL A;  3ZTP A;  4ZPT R;  1LK5 A;  2CQ4 A;  3M6X A;  1J27 A;  1KLM B;  4ECY A;  2HNZ A;  4RW4 B;  3DM2 B;  1HNZ F;  5J2Q B;  4BS2 A;  2E44 A;  2F63 A;  3DLK B;  2OTJ S;  3WX8 A;  1KOH A;  3BPS P;  3BQ1 A;  1VC0 A;  4ZJQ A;  2C3U A;  3M2V B;  2W9B B;  3O5T B;  1FFW B;  2NLW A;  1MN9 A;  3DRP A;  2V9K A;  3C16 A;  3M1V B;  5I3U A;  1GXL A;  3GR1 A;  1C0U A;  2AF6 A;  1RWK B;  5IQQ A;  2YWK A;  3A3O B;  1HWJ A;  5IWA F;  4A8O A;  4UW2 A;  3W61 A;  5LMN J;  4KPC A;  1D09 B;  2ACM A;  4C7Q A;  1KQF B;  2GML A;  2GZO A;  5IOL A;  3BEG B;  5K8O A;  4FF2 A;  3MPW A;  1OWX A;  4ERD A;  2PA8 D;  4HI1 A;  2HFS A;  4LVO P;  4U9R A;  3NGK A;  5JMN A;  1UMJ A;  3VCD A;  1OSD A;  2K3K A;  2BKP A;  3UVJ B;  4X4N A;  4L74 A;  5F9L A;  5AE2 A;  1U02 A;  2VG5 A;  1VMB A;  3N9U C;  3GV7 B;  4TXS A;  1UFW A;  5A8W B;  2GJF A;  1F6T A;  3BR8 A;  4MH8 A;  2IVF B;  3QNW B;  1Q8B A;  1R8H A; 
#chains in the Genus database with same CATH homology
 4DV2 J;  4LF5 J;  2KL8 A;  4KYZ A;  3J81 U;  3OTO J;  2E5L J;  4JI3 J;  4DV4 J;  1N32 J;  1HNZ J;  1N34 J;  4KY3 A;  4NXN J;  4DV3 J;  3IMQ J;  4JI5 J;  1IBK J;  4X66 J;  4JI6 J;  1IBL J;  1IBM J;  4JV5 J;  2F4V J;  2KVQ E;  4JYA J;  4X62 J;  2MTL A;  3R2C J;  2VQE J;  4RJV A;  5LMN J;  4PWW A;  1FJG J;  4X65 J;  4GKJ J;  4B3S J;  4LFA J;  4NEY A;  1N36 J;  1XMO J;  2UUB J;  1I94 J;  1N33 J;  4YY3 J;  2ZM6 J;  4KHP J;  4DV6 J;  4LF7 J;  2UUC J;  1XNQ J;  2VQF J;  4LF6 J;  4LF4 J;  5LM7 E;  3J7A N;  4DR3 J;  4DR6 J;  4DV5 J;  2UUA J;  2UXD J;  2UXC J;  4V1A k;  4LFC J;  3W1Y C;  5IT9 U;  4DV0 J;  4DV1 J;  4DR5 J;  4AQY J;  1HNX J;  3J80 U;  3T1Y J;  4OX9 J;  4HHU A;  4YHH J;  5LMU J;  3R2D J;  1XMQ J;  4LF8 J;  4DUY J;  4GKK J;  4JI2 J;  4K0K J;  4NXM J;  4B3T J;  4DR7 J;  5IWA J;  4X64 J;  4JI8 J;  2MQ8 A;  4NEZ A;  1HR0 J;  4LF9 J;  5AJ3 J;  4B3R J;  1HNW J;  5BR8 J;  5FLX U;  1XNR J;  5A2Q U;  4DV7 J;  3D3B J;  2UU9 J;  4DR1 J;  4DUZ J;  2HHH J;  4JI1 J;  4DR2 J;  4B3M J;  2UXB J;  4LFB J;  3D3C J;  3T1H J;  4JI0 J;  4DR4 J;  1J5E J;  4JI7 J;  3JAM U;  2MEW A;  4JI4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...