4NXMM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxmM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxmM02
1Q3BA 3JR4A 5ITXA 2UUBM 5ITXE 4CISA 3U6SA 4X62M 3GPUA 3U6DA 2UUCM 4JI1M 4JI2M 2EA0A 2E5LM 3U6OA 1IBMM 2F4VM 1Z5BA 4LFAM 4MB7A 1EE8A 1HNXM 4JI5M 1FJGM 1Z5AA 3GPXA 4G4RA 3JAMS 4G4QA 4JYAM 3TWKA 1N33M 5BR8M 3SBJA 3J81S 4DV7M 1K3WA 1R2YA 4DV5M 4G4OA 1XMOM 3SAWA 4NXMM 1Q3CA 2XZUA 2F5NA 4DR1M 3J7AS 2UUAM 2ZBKB 1NNJA 4LF4M 1L1ZA 1TDZA 3DOAA 1J5EM 4LF6M 4DR6M 4AQYM 1N36M 1K82A 2HKJA 4GKKM 3A42A 3GO8A 5IT9S 2VQEM 4NRVA 2UU9M 3GQ3A 3W0FA 2XZFA 2F5SA 4LF7M 1HR0M 4JV5M 3GPPA 4B3TM 1XC8A 3VK7A 4LF9M 3T1HM 3TWLA 3GPYA 4DV0M 3SASA 4LFBM 4X64M 4ITQA 1XNRM 4YHHM 4PD2A 3GQ5A 5ITQA 3VK8A 2OQ4A 4JI0M 4PDGA 4DR2M 3T1YM 1XMQM 3U6PA 1HNZM 4KHPM 3U6QA 4JI3M 1TDHA 2F5OA 4DR4M 1HNWM 5LMUM 3U6CA 1Z5CA 1L2BA 4DR3M 1L2CA 4B3SM 2UXDM 4JI6M 4LF8M 1R2ZA 1MX0A 1IBLM 1XNQM 4DR7M 2UXBM 3SARA 1MU5A 1Q39A 4DR5M 2HHHM 4B3RM 5ITRA 5ITTA 2Q2EB 1I94M 5ITYA 3U6EA 3OTOM 5LMNM 4YY3M 1Z59A 2ZM6M 4X66M 1PM5A 1N32M 5IWAM 4LFCM 4LF5M 1PJIA 3GQ4A 3JR5A 1K3XA 4GKJM 4NXNM 4B3MM 1N34M 4DUYM 4PCZA 4DV3M 4G4NA 4JI8M 3SATA 2OPFA 1IBKM 4DUZM 2VQFM 3A45A 3TWMA 4DV2M 3U6LA 3J80S 2F5QA 5A2QS 3SAVA 1PJJA 1L1TA 3U6MA 5FLXS 4NRWA 1L2DA 4JI4M 3A46A 4DV1M 3C58A 3SAUA 4JI7M 2UXCM 4DV6M 2F5PA 1KFVA 4DV4M 4PDIA 4K0KM 4X65M 4OX9M 3GP1A 5ITUA
chains in the Genus database with same CATH superfamily
3JR4A 2ZAOA 1MN3A 5ITXA 4EIWA 5FSWA 5ITXE 3KS4A 2UUBM 4JN6A 4CISA 1JB0F 4HEOA 4IIWA 3U6SA 4D81A 2JWSA 4X62M 2DENA 4AZFA 3GPUA 4JI1M 3SYKA 3V76A 1L8QA 1ZAEA 2EA0A 2EJSA 4JI2M 4AKHA 4LJ7A 1S3SA 3UMMA 4LFAM 1HNXM 1SXJD 1Z5AA 1QAOA 1WGLA 3FKEA 3H4MA 3HJ8A 4ANRA 3JAMS 2QENA 4G4QA 3B7NA 3ZCBB 1A5TA 4II7A 4XBOA 5BPVA 2YFQA 3FE3A 2JY7A 5DYIA 4R3DA 3VKGA 1GL7A 2H1RA 3MHVC 2CE7A 2DVWB 2EO2A 1TH3A 3FYCA 3FTDA 4ZPXA 3LQRA 4B08A 4NXMM 2XSZA 2DZOB 4FWGA 1NNUC 1QVRA 2J5YA 4FCWA 1ZV1A 2F5NA 1DO2A 1AUAA 2UUAM 2KNZA 1NNJA 1GO5A 4WW0A 1TDZA 3KOYE 4LJ8A 1J5EM 3B7QA 1VQ1A 2MGWA 2YQZA 4L15A 5F3WA 2Z8YM 2M60A 4GKKM 2DI0A 3GO8A 2L09A 4HL4A 3SHFA 5H37D 2M5ZA 4NRVA 4WP2A 2F5SA 5L8RF 2DAEA 1GVNA 1QANA 1NY5A 2QP9X 4LF7M 2KA6B 2CEAA 3RFWA 3M7GA 2N35A 4LGYA 3B9PA 3HJSA 3TWLA 1NY6A 2L4FA 2NQ8C 3MMPA 4YHHM 4PD2A 3EIHA 1KSFX 4Y28F 4IBGA 2I7NA 3VK8A 2OQ4A 2JA2A 1QYRA 3W68A 3LVWA 4M0WA 1HNZM 1DGFA 5JI2E 2F5OA 4DR4M 3LVVA 5FTJA 2BWBA 3KVWA 4KODA 2JXNA 3BBZA 1T43A 2D7EA 2UXDM 3HU3A 4LF8M 1BVSA 5EXXA 4KLNA 4OU7A 1R2ZA 2JP7A 1HT1E 3QYEA 1IBLM 2UXBM 5KQDA 4IJFA 4FVMA 1I4WA 1OJLA 4MH0E 4XGIA 1D0KA 1MU5A 1DV0A 4UN2B 3VLFB 4XK8F 1YSYA 3NBIA 5ITRA 3OTOM 3B74A 1V33A 5IWAM 4LFCM 3NBXX 3GQ4A 1QDRA 3M6AA 1OAOC 1SXJB 2Y21A 3H4JA 1TR8A 4B3MM 1E32A 4DUYM 4PCZA 4GHAA 1VDLA 2LH0A 5KQ8A 4G4NA 3L25A 2KNAA 1PJQA 3SATA 2DNAA 1IFYA 1C7YA 3U5ZB 3NWLA 3RGPA 4IBEA 4I4LA 3RE8A 4GEWA 1LV7A 2KZSA 3TWMA 5FTLA 3Q8XA 3J27B 2GQFA 1PJTA 2JUJA 3L26A 5IZ7D 2XLJA 3HX3A 2F5QA 4LRTA 4WURA 4FCVA 4REZA 2Y20A 5JI3E 5EP3A 1TH2A 2DWNA 3VDUA 2WSEF 4AG6A 2WSFF 3KS8A 4TUWA 3SAUA 2OOAA 2R0IA 3FTCA 4I8OA 4JI7M 2XFSA 4DV6M 1WR1B 2LVNC 2Z4SA 4OVZB 5KPZA 2DAKA 4OX9M 4FWHA 1LTMA 3FUVA 2XFTA 1OAIA 1SXJE 3FTFA 1QUTA 2OO9A 2WZJA 5DYGA 4QNMA 3U6DA 2HWJA 3L27A 3L2AA 3E4RA 3Q8GA 3U5ZA 3GRUA 1Z5BA 4MB7A 4LGMA 1FJGM 2MROB 4LRSA 2D7GA 2R18A 4JYAM 4NL4H 3AL0C 3MJ5A 4QOZC 3W0LB 1GABA 3F92A 1N33M 3LW5F 2OOBA 1OQYA 2G8LA 2KNVA 1K3WA 3A98B 4B7HA 2HCBA 3HHWA 3UK6A 1XHBA 4OVZA 1G3IA 1PJSA 1VDDA 3K8ZA 3HY5A 1OIZA 3QYBA 4LJAA 4Q7JA 2LVAA 2ZBKB 4Z8XA 1VG5A 3DOAA 2ZTDA 1NV9A 2LXEA 2R6FA 1N36M 1IQPA 2VF8A 3D8BA 2QPAA 2XEPA 4IBKA 5FTKA 5IT9S 2LVOC 3AOEA 4B7GA 2QCUA 5E6JA 2A5YB 2RGHA 3BOSA 2L2DA 4A3VB 3PFIA 3W0FA 3K9PA 1XXHB 2XZFA 3E46A 1HR0M 4BLCA 1D2NA 3L28A 1TH4A 3QAUA 3PVSA 3HJQA 8CATA 2VF7A 4P16A 1HQYE 3ZC7B 3J2PB 1MJGM 2JY6B 1E94E 3IECA 4DV0M 5FTNA 1XNRM 1JQJC 3DA1A 3PXGA 3GQ5A 1R7RA 2LNHC 3CF2A 4JI0M 1R4GA 5DFLA 2DWLA 2P5TA 1XMQM 3KDSE 3T15A 2DAMA 1NSFA 5LMUM 5EP4A 1Z5CA 3KOXE 2ZAMA 3CTWB 3T6PA 3UGJA 5DNYA 4IJEA 4NSOB 4DR3M 2X49A 2YR0A 1G59A 1ZMVA 2C98A 2Z3XA 2B3TA 2ZTCA 1TF0B 4DR7M 3T38A 2K47A 2V6ZM 3GLGB 4MGZE 4DR5M 1XXHE 5ITTA 2R65A 1P3QQ 3HU1A 1IN7A 2KRKA 1W5SA 1Z59A 3R9XB 1N32M 2VDBB 3JR5A 1RU3A 2BJWA 2G5GX 3SC3A 3AKZA 1G41A 3TL4X 4QHTA 1IN5A 4GC9A 2QBYB 3TPZA 1OTRA 4QOSA 4DV3M 4LCBA 2H5XA 5GKNA 4L8RC 4DUZM 2VIIA 2FE8A 2VQFM 3TQSA 2DAGA 3BXWA 4DV2M 1DGHB 1DO0A 2R62A 4Z6YA 3C3EA 3CF0A 1UFZA 4KT0F 4NC6A 3U60B 1PJJA 3U6MA 1L2DA 3HU2A 2WSCF 2KHHA 4RNAA 3A46A 4DV1M 3KW6A 4LJ6A 3HHYA 2CV1A 2DKLA 3GLGA 2DZLA 3GLGE 2UXCM 3FTEA 2DWZB 5FTMA 5EXTA 2R4EA 2X8AA 4IBCA 4R7GA 2JY5A 4X65M 3CGWA 3U61B 2V1UA 4NOOB 1IN8A 4RKUF 1Q3BA 1N78A 2L4EA 2W82A 5E26A 2QBYA 3SHGB 2E5LM 1V34A 1IBMM 2F4VM 3R8FA 4MGYE 1HQCA 1EE8A 3KOWE 2CRUA 4JI5M 2DWMA 1T3TA 1EFUB 3MK6A 1DGHA 1GKIA 4AI6A 2LWXA 2LVPC 1EIJA 4KO8A 1NJFA 3U60A 4AKIA 1QZMA 4GITA 2JNHA 4LZJA 2AHMA 1OFHA 2Y0QA 5IREB 1WHCA 5C18A 2KRUA 2CHGA 4OW0A 4R71A 4DV5M 4G4OA 1IM2A 1QDTA 4IBJA 1XMOM 2CV2A 3U61A 2I7PA 2L6OA 2XF3A 3C9PA 1Q3CA 2XZUA 4DR1M 3KFUG 3J7AS 3KP1E 4G6ZA 1SXJA 4FWDA 4IBBA 4L78A 3EIEA 3LQQA 4LF6M 1D0LA 3K92A 4NSRA 3FUTA 4DR6M 1JR3D 3UZUA 4AQYM 1K82A 1NJGA 2HKJA 5EQTA 5EJCA 2C5RA 5KPRA 3PNVA 2CFOA 1J09A 4AKGA 3UJNA 3GRYA 3GQ3A 1CUKA 2DHRA 3HGIA 1J7KA 2EKKA 1IXRC 2BWEA 1SG9A 2KDLA 2APLA 3TE6A 3GPPA 4B3TM 1XC8A 3VK7A 4LF9M 3DZDA 3SASA 4LFBM 4ITQA 1DGBA 1NV8A 2O25A 3SFZA 4MM3B 1WGNA 2R45A 3K2LA 2LHGA 3VFDA 4PDGA 4LJ4A 3D8LA 4DR2M 3T1YM 2K6BA 3KP0E 3THGA 1GL6A 1G4AE 2KW0A 1TDHA 4JI3M 3W67A 2KZUA 4BB9A 7CATA 3K1JA 3U6CA 1HNWM 4LG2A 1XB2B 3E9SA 3L29A 4LY6A 1L2BA 2LTUA 1T6OA 2EUCA 1L2CA 4B3SM 4JI6M 3CF6E 1E9SA 3C3DA 1GJSA 1FNNA 1MX0A 2MR9A 2R4JA 3IG8A 4M0DA 1XNQM 1QAQA 4L4UA 1NVMA 3I51A 4B3RM 1ORYB 1QQWA 3U6EA 2MH8A 4I81A 1UM8A 4YY3M 5C1BA 2G3QA 5EP2A 4X66M 1PM5A 4LJ5A 4F2LA 4LF5M 2X4AA 1PJIA 1HJPA 1K3XA 4GKJM 4NXNM 3HHXA 2FH0A 4CHTB 3I4VA 4AW4A 2CP8A 2CHVA 4JI8M 1VEJA 1QUSA 4RF1A 3AOGA 4MGKE 2OPFA 3HWSA 1VEKA 2LHCA 2ERCA 3AFHA 4GH9A 3B7ZA 4GHLA 1IY0A 1N75A 2FS1A 2JZ1A 2KEBA 2QHOB 3GRRA 4B7FA 2FFJA 3SAVA 1L1TA 3ILKA 4W5WA 4NRWA 1YLAA 3I01M 2O01F 1ZMUA 3C58A 4LJ9A 1IXZA 3QWLA 2EKFA 1XXHA 2KXEA 5EXPA 2F5PA 3WHKA 1KFVA 4PDIA 3GLIB 4LZZA 5FLXS 3GP1A 2DHYA 5ITUA 1DGGA 2JZ0A 2RKOA 4FCTA 2C9OA 2CHQA 4IBFA 2LBCA 3I04M 1OIPA 3FUUA 2QQ8A 2UUCM 1OFIA 1VEGA 3LCVB 1YUBA 3U6OA 2L7HA 2CV0A 4MGIE 1HT2E 1WXQA 1G71A 2J7OA 1NHWC 2R44A 1XWIA 4S12A 1IXSB 3GPXA 4G4RA 2FOIC 1TGUA 3FUWA 2XH9A 2DZNB 1GJTA 2YNMD 3E21A 2QNJA 2HAKA 3AJIB 3TWKA 5BR8M 1QZEA 4RF0A 1NO1A 4P17A 1IN4A 3J81S 2JY8A 3GRVA 1H6UA 4DV7M 3SBJA 4QNRA 2Z4RA 3B89A 3I4YA 3VDPA 4GC5A 1R2YA 2Y0TA 1YE9A 3GLIA 3SAWA 1JR3A 3GLIE 1JR3E 3KXEC 2C96A 4JXJA 1E9RA 3SMPA 1PRBA 1V92A 1Z6TA 4LF4M 3KSJA 1L1ZA 2CWBA 2R46A 3GLFB 5KO3A 1X37A 1D0MA 1SXJC 2XSZD 4FD2A 4CJ6A 3A42A 2DAIA 3VKHA 1PGYA 4I5SA 4FW9A 3FRHA 3GLHB 2VQEM 1IXSA 2BNKA 2UU9M 1IN6A 4M9SA 4JV5M 1OKSA 1GLNA 2K0BX 1ZMWA 4G3OA 2GNOA 4CIZA 4MGHA 4AG5A 4CGYB 3T1HM 4PT5A 4QHSA 3GPYA 4X64M 2BJVA 4GRIA 5EXSA 3HHZA 2C99A 2RGOA 4M9XA 5ITQA 1KYIA 1IY1A 2V1CA 3U6PA 4KHPM 3U6QA 1N77A 1C1KA 1G8PA 3ZH9B 3GLFA 3LCUA 3GLFE 3KSXA 2K9DA 4L16A 3IHPA 3KOZE 3GLHA 3AV0A 3GLHE 3DFZA 1R5LA 3SARA 1Q39A 4HLQA 2C9CA 3AOEC 2HHHM 2Q2EB 2HL7A 1I94M 3M0EA 5ITYA 3SMSA 5LMNM 2ZM6M 3PNYA 1TTEA 2CUZA 2QZ4A 1NHGC 1ZQ9A 3HKPA 2J7NA 1Y8GA 4IBIA 3RGSA 2MJ5B 1N34M 4L6V6 2XGNA 1Q02A 3FYDA 3HZJA 3LMMA 2RRUA 2L7IA 3FD9A 1AIPC 1IBKM 2LVQD 5EP1A 3IG5A 3K9OA 1R6BX 1WIVA 3FRIA 4DBGB 3A45A 4IBDA 3WHLA 3J7BA 4GMQA 4F1IA 5KPTA 2FNAA 2QSFX 2Z7JA 3U6LA 2O5RA 3J80S 5A2QS 1W5TA 1QAMA 1F4IA 4JI4M 1IY2A 1WJ7A 2ZANA 3FUXA 4M9ZA 4GIPA 4D80A 4BBAA 4DV4M 2D7HA 4D82A 4K0KM 2DXIA 3SYLA 3ZQJA
chains in the Genus database with same CATH topology
3JR4A 2ZAOA 5ITXA 5FSWA 4EIWA 5ITXE 2UUBM 3KS4A 4JN6A 4CISA 4IIWA 3U6SA 4D81A 4X62M 3GPUA 4AZFA 4JI1M 3SYKA 2EA0A 1L8QA 1ZAEA 4JI2M 4AKHA 4LJ7A 1S3SA 3UMMA 4LFAM 1HNXM 1SXJD 1Z5AA 1QAOA 3FKEA 3H4MA 3HJ8A 3JAMS 2QENA 4G4QA 3ZCBB 4II7A 4XBOA 5BPVA 2YFQA 5DYIA 4R3DA 3VKGA 1GL7A 2H1RA 3MHVC 2CE7A 2DVWB 2EO2A 1TH3A 3FYCA 3FTDA 4ZPXA 3LQRA 4B08A 4NXMM 2XSZA 2DZOB 4FWGA 1NNUC 1QVRA 4FCWA 2F5NA 1DO2A 2UUAM 1NNJA 4WW0A 1TDZA 3KOYE 4LJ8A 1J5EM 2YQZA 4L15A 5F3WA 2M60A 4GKKM 3GO8A 2L09A 4HL4A 3SHFA 5H37D 2M5ZA 4NRVA 2F5SA 4LF7M 1GVNA 1QANA 1NY5A 2QP9X 2KA6B 2CEAA 3RFWA 3M7GA 4LGYA 3B9PA 3HJSA 3TWLA 1NY6A 2NQ8C 4YHHM 4PD2A 3EIHA 1KSFX 4IBGA 2I7NA 3VK8A 2OQ4A 2JA2A 1QYRA 3LVWA 4M0WA 1HNZM 1DGFA 5JI2E 2F5OA 4DR4M 3LVVA 5FTJA 4KODA 3KVWA 2D7EA 2UXDM 3HU3A 4LF8M 5EXXA 4KLNA 4OU7A 1R2ZA 1IBLM 1HT1E 2UXBM 5KQDA 4IJFA 4FVMA 1I4WA 1OJLA 4MH0E 4XGIA 1MU5A 3VLFB 5ITRA 1YSYA 3NBIA 3OTOM 5IWAM 4LFCM 3GQ4A 3M6AA 1SXJB 2Y21A 4B3MM 4GHAA 1E32A 4DUYM 4PCZA 2LH0A 5KQ8A 4G4NA 3L25A 3SATA 3U5ZB 3NWLA 3RGPA 4IBEA 4I4LA 3RE8A 1LV7A 2KZSA 3TWMA 5FTLA 3Q8XA 3J27B 3L26A 5IZ7D 2XLJA 2F5QA 4LRTA 4WURA 4FCVA 4REZA 2Y20A 5JI3E 5EP3A 1TH2A 2DWNA 3VDUA 4TUWA 4AG6A 3KS8A 3SAUA 4JI7M 3FTCA 4I8OA 2XFSA 4DV6M 2Z4SA 4OVZB 5KPZA 4OX9M 4FWHA 3FUVA 2XFTA 1SXJE 3FTFA 5DYGA 4QNMA 3U6DA 3L27A 3L2AA 3E4RA 3U5ZA 3GRUA 1Z5BA 4MB7A 4LGMA 1FJGM 4LRSA 2D7GA 2R18A 4JYAM 4NL4H 3AL0C 3MJ5A 4QOZC 3W0LB 1N33M 2G8LA 1K3WA 3A98B 4B7HA 2HCBA 3HHWA 3UK6A 1XHBA 4OVZA 1G3IA 1VDDA 3K8ZA 4LJAA 2ZBKB 4Z8XA 3DOAA 2LXEA 1N36M 1IQPA 3D8BA 2QPAA 2XEPA 4IBKA 5FTKA 5IT9S 3AOEA 4B7GA 2QCUA 5E6JA 2A5YB 2RGHA 3BOSA 4A3VB 3PFIA 3W0FA 2XZFA 1XXHB 1HR0M 4BLCA 1D2NA 3L28A 1TH4A 3QAUA 3PVSA 3HJQA 8CATA 4P16A 1HQYE 3ZC7B 3J2PB 1E94E 4DV0M 5FTNA 1XNRM 1JQJC 3DA1A 3PXGA 3GQ5A 1R7RA 2LNHC 3CF2A 4JI0M 2DWLA 2P5TA 1XMQM 3KDSE 3T15A 1NSFA 5LMUM 5EP4A 1Z5CA 3KOXE 2ZAMA 3CTWB 3UGJA 5DNYA 4IJEA 4NSOB 4DR3M 2X49A 2YR0A 1G59A 2C98A 2Z3XA 4DR7M 3T38A 2K47A 2V6ZM 3GLGB 4MGZE 4DR5M 5ITTA 2R65A 3HU1A 1IN7A 2KRKA 1W5SA 1Z59A 3R9XB 1N32M 3JR5A 2G5GX 2BJWA 3SC3A 3AKZA 1G41A 3TL4X 4QHTA 1IN5A 4GC9A 2QBYB 3TPZA 4QOSA 4DV3M 4LCBA 5GKNA 4L8RC 4DUZM 2VIIA 2FE8A 2VQFM 3TQSA 4DV2M 1DGHB 1DO0A 2R62A 4Z6YA 3CF0A 3U60B 1PJJA 3U6MA 1L2DA 3HU2A 4RNAA 3A46A 4DV1M 3KW6A 4LJ6A 3HHYA 2CV1A 3GLGA 2UXCM 3FTEA 2DWZB 5FTMA 5EXTA 2R4EA 2X8AA 4IBCA 4R7GA 3U61B 4X65M 2V1UA 4NOOB 1IN8A 1Q3BA 1N78A 2W82A 5E26A 2QBYA 3SHGB 2E5LM 1IBMM 2F4VM 3R8FA 4MGYE 1HQCA 1EE8A 3KOWE 4JI5M 2DWMA 1T3TA 3MK6A 1DGHA 1GKIA 4AI6A 2LWXA 4KO8A 1NJFA 3U60A 4AKIA 1QZMA 4GITA 4LZJA 2AHMA 1OFHA 2Y0QA 5IREB 5C18A 2KRUA 2CHGA 4OW0A 4DV5M 4G4OA 1IM2A 4IBJA 1XMOM 2CV2A 3U61A 2I7PA 2L6OA 2XF3A 1Q3CA 2XZUA 4DR1M 3KFUG 3J7AS 3KP1E 4G6ZA 1SXJA 4FWDA 4IBBA 4L78A 3EIEA 3LQQA 4LF6M 3K92A 4NSRA 3FUTA 4DR6M 1JR3D 3UZUA 4AQYM 1K82A 1NJGA 2HKJA 5EQTA 5EJCA 2C5RA 5KPRA 3PNVA 2CFOA 1J09A 4AKGA 3UJNA 3GRYA 3GQ3A 2DHRA 3HGIA 1J7KA 1IXRC 3TE6A 3GPPA 4B3TM 1XC8A 3VK7A 4LF9M 3DZDA 3SASA 4LFBM 4ITQA 1DGBA 3SFZA 4MM3B 2R45A 3K2LA 3VFDA 4PDGA 4LJ4A 3D8LA 4DR2M 3T1YM 3THGA 3KP0E 1GL6A 1G4AE 2KW0A 1TDHA 4JI3M 4BB9A 2KZUA 7CATA 3U6CA 3K1JA 1HNWM 4LG2A 1L2BA 3E9SA 3L29A 4LY6A 1L2CA 4B3SM 2EUCA 4JI6M 3CF6E 1E9SA 1FNNA 1MX0A 3IG8A 2R4JA 1XNQM 4M0DA 1QAQA 4L4UA 1NVMA 3I51A 4B3RM 1ORYB 1QQWA 3U6EA 4I81A 1UM8A 4YY3M 5C1BA 5EP2A 4X66M 1PM5A 4LJ5A 4LF5M 2X4AA 1PJIA 1K3XA 4GKJM 4NXNM 3HHXA 4CHTB 3I4VA 4AW4A 2CHVA 4JI8M 4RF1A 3AOGA 4MGKE 2OPFA 3HWSA 2ERCA 3AFHA 4GH9A 4GHLA 1IY0A 1N75A 3GRRA 2KEBA 4B7FA 2FFJA 3SAVA 1L1TA 3ILKA 4W5WA 4NRWA 3C58A 4LJ9A 1IXZA 3QWLA 1XXHA 2KXEA 5EXPA 2F5PA 3WHKA 1KFVA 4PDIA 3GLIB 4LZZA 5FLXS 3GP1A 5ITUA 1DGGA 2RKOA 4FCTA 2C9OA 2CHQA 4IBFA 3FUUA 2UUCM 1OFIA 1YUBA 3U6OA 2L7HA 2CV0A 4MGIE 1HT2E 1WXQA 2J7OA 1NHWC 1XWIA 4S12A 1IXSB 3GPXA 4G4RA 2FOIC 1TGUA 3FUWA 2XH9A 2DZNB 2YNMD 3TWKA 3AJIB 5BR8M 4RF0A 1IN4A 3J81S 3GRVA 3SBJA 1H6UA 4DV7M 4QNRA 2Z4RA 3I4YA 3VDPA 4GC5A 1R2YA 2Y0TA 1YE9A 3GLIA 3SAWA 1JR3A 3KXEC 2C96A 4JXJA 1E9RA 3SMPA 1Z6TA 4LF4M 3KSJA 1L1ZA 2R46A 3GLFB 5KO3A 1X37A 1SXJC 2XSZD 4FD2A 3A42A 3VKHA 4I5SA 4FW9A 3GLHB 2VQEM 2BNKA 2UU9M 1IN6A 4M9SA 4JV5M 1GLNA 4MGHA 4AG5A 4CGYB 3T1HM 4PT5A 4QHSA 3GPYA 4X64M 2BJVA 4GRIA 5EXSA 3HHZA 2C99A 2RGOA 4M9XA 5ITQA 1KYIA 1IY1A 2V1CA 3U6PA 4KHPM 3U6QA 1N77A 1C1KA 1G8PA 3ZH9B 3GLFA 3KSXA 4L16A 3KOZE 3GLHA 3AV0A 3DFZA 3SARA 1Q39A 4HLQA 2C9CA 3AOEC 2HHHM 2Q2EB 2HL7A 1I94M 3M0EA 5ITYA 3SMSA 5LMNM 2ZM6M 3PNYA 2CUZA 2QZ4A 1NHGC 1ZQ9A 3HKPA 2J7NA 4IBIA 3RGSA 1N34M 2XGNA 3FYDA 3LMMA 2L7IA 3FD9A 1IBKM 5EP1A 3IG5A 1R6BX 3A45A 4IBDA 3WHLA 3J7BA 4GMQA 5KPTA 2FNAA 2Z7JA 3U6LA 2O5RA 3J80S 5A2QS 1W5TA 1QAMA 4JI4M 1IY2A 2ZANA 3FUXA 4M9ZA 4GIPA 4D80A 4BBAA 4DV4M 2D7HA 4D82A 4K0KM 2DXIA 3SYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3B A;  3JR4 A;  5ITX A;  2UUB M;  5ITX E;  4CIS A;  3U6S A;  4X62 M;  3GPU A;  3U6D A;  2UUC M;  4JI1 M;  4JI2 M;  2EA0 A;  2E5L M;  3U6O A;  1IBM M;  2F4V M;  1Z5B A;  4LFA M;  4MB7 A;  1EE8 A;  1HNX M;  4JI5 M;  1FJG M;  1Z5A A;  3GPX A;  4G4R A;  3JAM S;  4G4Q A;  4JYA M;  3TWK A;  1N33 M;  5BR8 M;  3SBJ A;  3J81 S;  4DV7 M;  1K3W A;  1R2Y A;  4DV5 M;  4G4O A;  1XMO M;  3SAW A;  4NXM M;  1Q3C A;  2XZU A;  2F5N A;  4DR1 M;  3J7A S;  2UUA M;  2ZBK B;  1NNJ A;  4LF4 M;  1L1Z A;  1TDZ A;  3DOA A;  1J5E M;  4LF6 M;  4DR6 M;  4AQY M;  1N36 M;  1K82 A;  2HKJ A;  4GKK M;  3A42 A;  3GO8 A;  5IT9 S;  2VQE M;  4NRV A;  2UU9 M;  3GQ3 A;  3W0F A;  2XZF A;  2F5S A;  4LF7 M;  1HR0 M;  4JV5 M;  3GPP A;  4B3T M;  1XC8 A;  3VK7 A;  4LF9 M;  3T1H M;  3TWL A;  3GPY A;  4DV0 M;  3SAS A;  4LFB M;  4X64 M;  4ITQ A;  1XNR M;  4YHH M;  4PD2 A;  3GQ5 A;  5ITQ A;  3VK8 A;  2OQ4 A;  4JI0 M;  4PDG A;  4DR2 M;  3T1Y M;  1XMQ M;  3U6P A;  1HNZ M;  4KHP M;  3U6Q A;  4JI3 M;  1TDH A;  2F5O A;  4DR4 M;  1HNW M;  5LMU M;  3U6C A;  1Z5C A;  1L2B A;  4DR3 M;  1L2C A;  4B3S M;  2UXD M;  4JI6 M;  4LF8 M;  1R2Z A;  1MX0 A;  1IBL M;  1XNQ M;  4DR7 M;  2UXB M;  3SAR A;  1MU5 A;  1Q39 A;  4DR5 M;  2HHH M;  4B3R M;  5ITR A;  5ITT A;  2Q2E B;  1I94 M;  5ITY A;  3U6E A;  3OTO M;  5LMN M;  4YY3 M;  1Z59 A;  2ZM6 M;  4X66 M;  1PM5 A;  1N32 M;  5IWA M;  4LFC M;  4LF5 M;  1PJI A;  3GQ4 A;  3JR5 A;  1K3X A;  4GKJ M;  4NXN M;  4B3M M;  1N34 M;  4DUY M;  4PCZ A;  4DV3 M;  4G4N A;  4JI8 M;  3SAT A;  2OPF A;  1IBK M;  4DUZ M;  2VQF M;  3A45 A;  3TWM A;  4DV2 M;  3U6L A;  3J80 S;  2F5Q A;  5A2Q S;  3SAV A;  1PJJ A;  1L1T A;  3U6M A;  5FLX S;  4NRW A;  1L2D A;  4JI4 M;  3A46 A;  4DV1 M;  3C58 A;  3SAU A;  4JI7 M;  2UXC M;  4DV6 M;  2F5P A;  1KFV A;  4DV4 M;  4PDI A;  4K0K M;  4X65 M;  4OX9 M;  3GP1 A;  5ITU A; 
#chains in the Genus database with same CATH topology
 3JR4 A;  2ZAO A;  1MN3 A;  5ITX A;  4EIW A;  5FSW A;  5ITX E;  3KS4 A;  2UUB M;  4JN6 A;  4CIS A;  1JB0 F;  4HEO A;  4IIW A;  3U6S A;  4D81 A;  2JWS A;  4X62 M;  2DEN A;  4AZF A;  3GPU A;  4JI1 M;  3SYK A;  3V76 A;  1L8Q A;  1ZAE A;  2EA0 A;  2EJS A;  4JI2 M;  4AKH A;  4LJ7 A;  1S3S A;  3UMM A;  4LFA M;  1HNX M;  1SXJ D;  1Z5A A;  1QAO A;  1WGL A;  3FKE A;  3H4M A;  3HJ8 A;  4ANR A;  3JAM S;  2QEN A;  4G4Q A;  3B7N A;  3ZCB B;  1A5T A;  4II7 A;  4XBO A;  5BPV A;  2YFQ A;  3FE3 A;  2JY7 A;  5DYI A;  4R3D A;  3VKG A;  1GL7 A;  2H1R A;  3MHV C;  2CE7 A;  2DVW B;  2EO2 A;  1TH3 A;  3FYC A;  3FTD A;  4ZPX A;  3LQR A;  4B08 A;  4NXM M;  2XSZ A;  2DZO B;  4FWG A;  1NNU C;  1QVR A;  2J5Y A;  4FCW A;  1ZV1 A;  2F5N A;  1DO2 A;  1AUA A;  2UUA M;  2KNZ A;  1NNJ A;  1GO5 A;  4WW0 A;  1TDZ A;  3KOY E;  4LJ8 A;  1J5E M;  3B7Q A;  1VQ1 A;  2MGW A;  2YQZ A;  4L15 A;  5F3W A;  2Z8Y M;  2M60 A;  4GKK M;  2DI0 A;  3GO8 A;  2L09 A;  4HL4 A;  3SHF A;  5H37 D;  2M5Z A;  4NRV A;  4WP2 A;  2F5S A;  5L8R F;  2DAE A;  1GVN A;  1QAN A;  1NY5 A;  2QP9 X;  4LF7 M;  2KA6 B;  2CEA A;  3RFW A;  3M7G A;  2N35 A;  4LGY A;  3B9P A;  3HJS A;  3TWL A;  1NY6 A;  2L4F A;  2NQ8 C;  3MMP A;  4YHH M;  4PD2 A;  3EIH A;  1KSF X;  4Y28 F;  4IBG A;  2I7N A;  3VK8 A;  2OQ4 A;  2JA2 A;  1QYR A;  3W68 A;  3LVW A;  4M0W A;  1HNZ M;  1DGF A;  5JI2 E;  2F5O A;  4DR4 M;  3LVV A;  5FTJ A;  2BWB A;  3KVW A;  4KOD A;  2JXN A;  3BBZ A;  1T43 A;  2D7E A;  2UXD M;  3HU3 A;  4LF8 M;  1BVS A;  5EXX A;  4KLN A;  4OU7 A;  1R2Z A;  2JP7 A;  1HT1 E;  3QYE A;  1IBL M;  2UXB M;  5KQD A;  4IJF A;  4FVM A;  1I4W A;  1OJL A;  4MH0 E;  4XGI A;  1D0K A;  1MU5 A;  1DV0 A;  4UN2 B;  3VLF B;  4XK8 F;  1YSY A;  3NBI A;  5ITR A;  3OTO M;  3B74 A;  1V33 A;  5IWA M;  4LFC M;  3NBX X;  3GQ4 A;  1QDR A;  3M6A A;  1OAO C;  1SXJ B;  2Y21 A;  3H4J A;  1TR8 A;  4B3M M;  1E32 A;  4DUY M;  4PCZ A;  4GHA A;  1VDL A;  2LH0 A;  5KQ8 A;  4G4N A;  3L25 A;  2KNA A;  1PJQ A;  3SAT A;  2DNA A;  1IFY A;  1C7Y A;  3U5Z B;  3NWL A;  3RGP A;  4IBE A;  4I4L A;  3RE8 A;  4GEW A;  1LV7 A;  2KZS A;  3TWM A;  5FTL A;  3Q8X A;  3J27 B;  2GQF A;  1PJT A;  2JUJ A;  3L26 A;  5IZ7 D;  2XLJ A;  3HX3 A;  2F5Q A;  4LRT A;  4WUR A;  4FCV A;  4REZ A;  2Y20 A;  5JI3 E;  5EP3 A;  1TH2 A;  2DWN A;  3VDU A;  2WSE F;  4AG6 A;  2WSF F;  3KS8 A;  4TUW A;  3SAU A;  2OOA A;  2R0I A;  3FTC A;  4I8O A;  4JI7 M;  2XFS A;  4DV6 M;  1WR1 B;  2LVN C;  2Z4S A;  4OVZ B;  5KPZ A;  2DAK A;  4OX9 M;  4FWH A;  1LTM A;  3FUV A;  2XFT A;  1OAI A;  1SXJ E;  3FTF A;  1QUT A;  2OO9 A;  2WZJ A;  5DYG A;  4QNM A;  3U6D A;  2HWJ A;  3L27 A;  3L2A A;  3E4R A;  3Q8G A;  3U5Z A;  3GRU A;  1Z5B A;  4MB7 A;  4LGM A;  1FJG M;  2MRO B;  4LRS A;  2D7G A;  2R18 A;  4JYA M;  4NL4 H;  3AL0 C;  3MJ5 A;  4QOZ C;  3W0L B;  1GAB A;  3F92 A;  1N33 M;  3LW5 F;  2OOB A;  1OQY A;  2G8L A;  2KNV A;  1K3W A;  3A98 B;  4B7H A;  2HCB A;  3HHW A;  3UK6 A;  1XHB A;  4OVZ A;  1G3I A;  1PJS A;  1VDD A;  3K8Z A;  3HY5 A;  1OIZ A;  3QYB A;  4LJA A;  4Q7J A;  2LVA A;  2ZBK B;  4Z8X A;  1VG5 A;  3DOA A;  2ZTD A;  1NV9 A;  2LXE A;  2R6F A;  1N36 M;  1IQP A;  2VF8 A;  3D8B A;  2QPA A;  2XEP A;  4IBK A;  5FTK A;  5IT9 S;  2LVO C;  3AOE A;  4B7G A;  2QCU A;  5E6J A;  2A5Y B;  2RGH A;  3BOS A;  2L2D A;  4A3V B;  3PFI A;  3W0F A;  3K9P A;  1XXH B;  2XZF A;  3E46 A;  1HR0 M;  4BLC A;  1D2N A;  3L28 A;  1TH4 A;  3QAU A;  3PVS A;  3HJQ A;  8CAT A;  2VF7 A;  4P16 A;  1HQY E;  3ZC7 B;  3J2P B;  1MJG M;  2JY6 B;  1E94 E;  3IEC A;  4DV0 M;  5FTN A;  1XNR M;  1JQJ C;  3DA1 A;  3PXG A;  3GQ5 A;  1R7R A;  2LNH C;  3CF2 A;  4JI0 M;  1R4G A;  5DFL A;  2DWL A;  2P5T A;  1XMQ M;  3KDS E;  3T15 A;  2DAM A;  1NSF A;  5LMU M;  5EP4 A;  1Z5C A;  3KOX E;  2ZAM A;  3CTW B;  3T6P A;  3UGJ A;  5DNY A;  4IJE A;  4NSO B;  4DR3 M;  2X49 A;  2YR0 A;  1G59 A;  1ZMV A;  2C98 A;  2Z3X A;  2B3T A;  2ZTC A;  1TF0 B;  4DR7 M;  3T38 A;  2K47 A;  2V6Z M;  3GLG B;  4MGZ E;  4DR5 M;  1XXH E;  5ITT A;  2R65 A;  1P3Q Q;  3HU1 A;  1IN7 A;  2KRK A;  1W5S A;  1Z59 A;  3R9X B;  1N32 M;  2VDB B;  3JR5 A;  1RU3 A;  2BJW A;  2G5G X;  3SC3 A;  3AKZ A;  1G41 A;  3TL4 X;  4QHT A;  1IN5 A;  4GC9 A;  2QBY B;  3TPZ A;  1OTR A;  4QOS A;  4DV3 M;  4LCB A;  2H5X A;  5GKN A;  4L8R C;  4DUZ M;  2VII A;  2FE8 A;  2VQF M;  3TQS A;  2DAG A;  3BXW A;  4DV2 M;  1DGH B;  1DO0 A;  2R62 A;  4Z6Y A;  3C3E A;  3CF0 A;  1UFZ A;  4KT0 F;  4NC6 A;  3U60 B;  1PJJ A;  3U6M A;  1L2D A;  3HU2 A;  2WSC F;  2KHH A;  4RNA A;  3A46 A;  4DV1 M;  3KW6 A;  4LJ6 A;  3HHY A;  2CV1 A;  2DKL A;  3GLG A;  2DZL A;  3GLG E;  2UXC M;  3FTE A;  2DWZ B;  5FTM A;  5EXT A;  2R4E A;  2X8A A;  4IBC A;  4R7G A;  2JY5 A;  4X65 M;  3CGW A;  3U61 B;  2V1U A;  4NOO B;  1IN8 A;  4RKU F;  1Q3B A;  1N78 A;  2L4E A;  2W82 A;  5E26 A;  2QBY A;  3SHG B;  2E5L M;  1V34 A;  1IBM M;  2F4V M;  3R8F A;  4MGY E;  1HQC A;  1EE8 A;  3KOW E;  2CRU A;  4JI5 M;  2DWM A;  1T3T A;  1EFU B;  3MK6 A;  1DGH A;  1GKI A;  4AI6 A;  2LWX A;  2LVP C;  1EIJ A;  4KO8 A;  1NJF A;  3U60 A;  4AKI A;  1QZM A;  4GIT A;  2JNH A;  4LZJ A;  2AHM A;  1OFH A;  2Y0Q A;  5IRE B;  1WHC A;  5C18 A;  2KRU A;  2CHG A;  4OW0 A;  4R71 A;  4DV5 M;  4G4O A;  1IM2 A;  1QDT A;  4IBJ A;  1XMO M;  2CV2 A;  3U61 A;  2I7P A;  2L6O A;  2XF3 A;  3C9P A;  1Q3C A;  2XZU A;  4DR1 M;  3KFU G;  3J7A S;  3KP1 E;  4G6Z A;  1SXJ A;  4FWD A;  4IBB A;  4L78 A;  3EIE A;  3LQQ A;  4LF6 M;  1D0L A;  3K92 A;  4NSR A;  3FUT A;  4DR6 M;  1JR3 D;  3UZU A;  4AQY M;  1K82 A;  1NJG A;  2HKJ A;  5EQT A;  5EJC A;  2C5R A;  5KPR A;  3PNV A;  2CFO A;  1J09 A;  4AKG A;  3UJN A;  3GRY A;  3GQ3 A;  1CUK A;  2DHR A;  3HGI A;  1J7K A;  2EKK A;  1IXR C;  2BWE A;  1SG9 A;  2KDL A;  2APL A;  3TE6 A;  3GPP A;  4B3T M;  1XC8 A;  3VK7 A;  4LF9 M;  3DZD A;  3SAS A;  4LFB M;  4ITQ A;  1DGB A;  1NV8 A;  2O25 A;  3SFZ A;  4MM3 B;  1WGN A;  2R45 A;  3K2L A;  2LHG A;  3VFD A;  4PDG A;  4LJ4 A;  3D8L A;  4DR2 M;  3T1Y M;  2K6B A;  3KP0 E;  3THG A;  1GL6 A;  1G4A E;  2KW0 A;  1TDH A;  4JI3 M;  3W67 A;  2KZU A;  4BB9 A;  7CAT A;  3K1J A;  3U6C A;  1HNW M;  4LG2 A;  1XB2 B;  3E9S A;  3L29 A;  4LY6 A;  1L2B A;  2LTU A;  1T6O A;  2EUC A;  1L2C A;  4B3S M;  4JI6 M;  3CF6 E;  1E9S A;  3C3D A;  1GJS A;  1FNN A;  1MX0 A;  2MR9 A;  2R4J A;  3IG8 A;  4M0D A;  1XNQ M;  1QAQ A;  4L4U A;  1NVM A;  3I51 A;  4B3R M;  1ORY B;  1QQW A;  3U6E A;  2MH8 A;  4I81 A;  1UM8 A;  4YY3 M;  5C1B A;  2G3Q A;  5EP2 A;  4X66 M;  1PM5 A;  4LJ5 A;  4F2L A;  4LF5 M;  2X4A A;  1PJI A;  1HJP A;  1K3X A;  4GKJ M;  4NXN M;  3HHX A;  2FH0 A;  4CHT B;  3I4V A;  4AW4 A;  2CP8 A;  2CHV A;  4JI8 M;  1VEJ A;  1QUS A;  4RF1 A;  3AOG A;  4MGK E;  2OPF A;  3HWS A;  1VEK A;  2LHC A;  2ERC A;  3AFH A;  4GH9 A;  3B7Z A;  4GHL A;  1IY0 A;  1N75 A;  2FS1 A;  2JZ1 A;  2KEB A;  2QHO B;  3GRR A;  4B7F A;  2FFJ A;  3SAV A;  1L1T A;  3ILK A;  4W5W A;  4NRW A;  1YLA A;  3I01 M;  2O01 F;  1ZMU A;  3C58 A;  4LJ9 A;  1IXZ A;  3QWL A;  2EKF A;  1XXH A;  2KXE A;  5EXP A;  2F5P A;  3WHK A;  1KFV A;  4PDI A;  3GLI B;  4LZZ A;  5FLX S;  3GP1 A;  2DHY A;  5ITU A;  1DGG A;  2JZ0 A;  2RKO A;  4FCT A;  2C9O A;  2CHQ A;  4IBF A;  2LBC A;  3I04 M;  1OIP A;  3FUU A;  2QQ8 A;  2UUC M;  1OFI A;  1VEG A;  3LCV B;  1YUB A;  3U6O A;  2L7H A;  2CV0 A;  4MGI E;  1HT2 E;  1WXQ A;  1G71 A;  2J7O A;  1NHW C;  2R44 A;  1XWI A;  4S12 A;  1IXS B;  3GPX A;  4G4R A;  2FOI C;  1TGU A;  3FUW A;  2XH9 A;  2DZN B;  1GJT A;  2YNM D;  3E21 A;  2QNJ A;  2HAK A;  3AJI B;  3TWK A;  5BR8 M;  1QZE A;  4RF0 A;  1NO1 A;  4P17 A;  1IN4 A;  3J81 S;  2JY8 A;  3GRV A;  1H6U A;  4DV7 M;  3SBJ A;  4QNR A;  2Z4R A;  3B89 A;  3I4Y A;  3VDP A;  4GC5 A;  1R2Y A;  2Y0T A;  1YE9 A;  3GLI A;  3SAW A;  1JR3 A;  3GLI E;  1JR3 E;  3KXE C;  2C96 A;  4JXJ A;  1E9R A;  3SMP A;  1PRB A;  1V92 A;  1Z6T A;  4LF4 M;  3KSJ A;  1L1Z A;  2CWB A;  2R46 A;  3GLF B;  5KO3 A;  1X37 A;  1D0M A;  1SXJ C;  2XSZ D;  4FD2 A;  4CJ6 A;  3A42 A;  2DAI A;  3VKH A;  1PGY A;  4I5S A;  4FW9 A;  3FRH A;  3GLH B;  2VQE M;  1IXS A;  2BNK A;  2UU9 M;  1IN6 A;  4M9S A;  4JV5 M;  1OKS A;  1GLN A;  2K0B X;  1ZMW A;  4G3O A;  2GNO A;  4CIZ A;  4MGH A;  4AG5 A;  4CGY B;  3T1H M;  4PT5 A;  4QHS A;  3GPY A;  4X64 M;  2BJV A;  4GRI A;  5EXS A;  3HHZ A;  2C99 A;  2RGO A;  4M9X A;  5ITQ A;  1KYI A;  1IY1 A;  2V1C A;  3U6P A;  4KHP M;  3U6Q A;  1N77 A;  1C1K A;  1G8P A;  3ZH9 B;  3GLF A;  3LCU A;  3GLF E;  3KSX A;  2K9D A;  4L16 A;  3IHP A;  3KOZ E;  3GLH A;  3AV0 A;  3GLH E;  3DFZ A;  1R5L A;  3SAR A;  1Q39 A;  4HLQ A;  2C9C A;  3AOE C;  2HHH M;  2Q2E B;  2HL7 A;  1I94 M;  3M0E A;  5ITY A;  3SMS A;  5LMN M;  2ZM6 M;  3PNY A;  1TTE A;  2CUZ A;  2QZ4 A;  1NHG C;  1ZQ9 A;  3HKP A;  2J7N A;  1Y8G A;  4IBI A;  3RGS A;  2MJ5 B;  1N34 M;  4L6V 6;  2XGN A;  1Q02 A;  3FYD A;  3HZJ A;  3LMM A;  2RRU A;  2L7I A;  3FD9 A;  1AIP C;  1IBK M;  2LVQ D;  5EP1 A;  3IG5 A;  3K9O A;  1R6B X;  1WIV A;  3FRI A;  4DBG B;  3A45 A;  4IBD A;  3WHL A;  3J7B A;  4GMQ A;  4F1I A;  5KPT A;  2FNA A;  2QSF X;  2Z7J A;  3U6L A;  2O5R A;  3J80 S;  5A2Q S;  1W5T A;  1QAM A;  1F4I A;  4JI4 M;  1IY2 A;  1WJ7 A;  2ZAN A;  3FUX A;  4M9Z A;  4GIP A;  4D80 A;  4BBA A;  4DV4 M;  2D7H A;  4D82 A;  4K0K M;  2DXI A;  3SYL A;  3ZQJ A; 
#chains in the Genus database with same CATH homology
 3JR4 A;  2ZAO A;  5ITX A;  5FSW A;  4EIW A;  5ITX E;  2UUB M;  3KS4 A;  4JN6 A;  4CIS A;  4IIW A;  3U6S A;  4D81 A;  4X62 M;  3GPU A;  4AZF A;  4JI1 M;  3SYK A;  2EA0 A;  1L8Q A;  1ZAE A;  4JI2 M;  4AKH A;  4LJ7 A;  1S3S A;  3UMM A;  4LFA M;  1HNX M;  1SXJ D;  1Z5A A;  1QAO A;  3FKE A;  3H4M A;  3HJ8 A;  3JAM S;  2QEN A;  4G4Q A;  3ZCB B;  4II7 A;  4XBO A;  5BPV A;  2YFQ A;  5DYI A;  4R3D A;  3VKG A;  1GL7 A;  2H1R A;  3MHV C;  2CE7 A;  2DVW B;  2EO2 A;  1TH3 A;  3FYC A;  3FTD A;  4ZPX A;  3LQR A;  4B08 A;  4NXM M;  2XSZ A;  2DZO B;  4FWG A;  1NNU C;  1QVR A;  4FCW A;  2F5N A;  1DO2 A;  2UUA M;  1NNJ A;  4WW0 A;  1TDZ A;  3KOY E;  4LJ8 A;  1J5E M;  2YQZ A;  4L15 A;  5F3W A;  2M60 A;  4GKK M;  3GO8 A;  2L09 A;  4HL4 A;  3SHF A;  5H37 D;  2M5Z A;  4NRV A;  2F5S A;  4LF7 M;  1GVN A;  1QAN A;  1NY5 A;  2QP9 X;  2KA6 B;  2CEA A;  3RFW A;  3M7G A;  4LGY A;  3B9P A;  3HJS A;  3TWL A;  1NY6 A;  2NQ8 C;  4YHH M;  4PD2 A;  3EIH A;  1KSF X;  4IBG A;  2I7N A;  3VK8 A;  2OQ4 A;  2JA2 A;  1QYR A;  3LVW A;  4M0W A;  1HNZ M;  1DGF A;  5JI2 E;  2F5O A;  4DR4 M;  3LVV A;  5FTJ A;  4KOD A;  3KVW A;  2D7E A;  2UXD M;  3HU3 A;  4LF8 M;  5EXX A;  4KLN A;  4OU7 A;  1R2Z A;  1IBL M;  1HT1 E;  2UXB M;  5KQD A;  4IJF A;  4FVM A;  1I4W A;  1OJL A;  4MH0 E;  4XGI A;  1MU5 A;  3VLF B;  5ITR A;  1YSY A;  3NBI A;  3OTO M;  5IWA M;  4LFC M;  3GQ4 A;  3M6A A;  1SXJ B;  2Y21 A;  4B3M M;  4GHA A;  1E32 A;  4DUY M;  4PCZ A;  2LH0 A;  5KQ8 A;  4G4N A;  3L25 A;  3SAT A;  3U5Z B;  3NWL A;  3RGP A;  4IBE A;  4I4L A;  3RE8 A;  1LV7 A;  2KZS A;  3TWM A;  5FTL A;  3Q8X A;  3J27 B;  3L26 A;  5IZ7 D;  2XLJ A;  2F5Q A;  4LRT A;  4WUR A;  4FCV A;  4REZ A;  2Y20 A;  5JI3 E;  5EP3 A;  1TH2 A;  2DWN A;  3VDU A;  4TUW A;  4AG6 A;  3KS8 A;  3SAU A;  4JI7 M;  3FTC A;  4I8O A;  2XFS A;  4DV6 M;  2Z4S A;  4OVZ B;  5KPZ A;  4OX9 M;  4FWH A;  3FUV A;  2XFT A;  1SXJ E;  3FTF A;  5DYG A;  4QNM A;  3U6D A;  3L27 A;  3L2A A;  3E4R A;  3U5Z A;  3GRU A;  1Z5B A;  4MB7 A;  4LGM A;  1FJG M;  4LRS A;  2D7G A;  2R18 A;  4JYA M;  4NL4 H;  3AL0 C;  3MJ5 A;  4QOZ C;  3W0L B;  1N33 M;  2G8L A;  1K3W A;  3A98 B;  4B7H A;  2HCB A;  3HHW A;  3UK6 A;  1XHB A;  4OVZ A;  1G3I A;  1VDD A;  3K8Z A;  4LJA A;  2ZBK B;  4Z8X A;  3DOA A;  2LXE A;  1N36 M;  1IQP A;  3D8B A;  2QPA A;  2XEP A;  4IBK A;  5FTK A;  5IT9 S;  3AOE A;  4B7G A;  2QCU A;  5E6J A;  2A5Y B;  2RGH A;  3BOS A;  4A3V B;  3PFI A;  3W0F A;  2XZF A;  1XXH B;  1HR0 M;  4BLC A;  1D2N A;  3L28 A;  1TH4 A;  3QAU A;  3PVS A;  3HJQ A;  8CAT A;  4P16 A;  1HQY E;  3ZC7 B;  3J2P B;  1E94 E;  4DV0 M;  5FTN A;  1XNR M;  1JQJ C;  3DA1 A;  3PXG A;  3GQ5 A;  1R7R A;  2LNH C;  3CF2 A;  4JI0 M;  2DWL A;  2P5T A;  1XMQ M;  3KDS E;  3T15 A;  1NSF A;  5LMU M;  5EP4 A;  1Z5C A;  3KOX E;  2ZAM A;  3CTW B;  3UGJ A;  5DNY A;  4IJE A;  4NSO B;  4DR3 M;  2X49 A;  2YR0 A;  1G59 A;  2C98 A;  2Z3X A;  4DR7 M;  3T38 A;  2K47 A;  2V6Z M;  3GLG B;  4MGZ E;  4DR5 M;  5ITT A;  2R65 A;  3HU1 A;  1IN7 A;  2KRK A;  1W5S A;  1Z59 A;  3R9X B;  1N32 M;  3JR5 A;  2G5G X;  2BJW A;  3SC3 A;  3AKZ A;  1G41 A;  3TL4 X;  4QHT A;  1IN5 A;  4GC9 A;  2QBY B;  3TPZ A;  4QOS A;  4DV3 M;  4LCB A;  5GKN A;  4L8R C;  4DUZ M;  2VII A;  2FE8 A;  2VQF M;  3TQS A;  4DV2 M;  1DGH B;  1DO0 A;  2R62 A;  4Z6Y A;  3CF0 A;  3U60 B;  1PJJ A;  3U6M A;  1L2D A;  3HU2 A;  4RNA A;  3A46 A;  4DV1 M;  3KW6 A;  4LJ6 A;  3HHY A;  2CV1 A;  3GLG A;  2UXC M;  3FTE A;  2DWZ B;  5FTM A;  5EXT A;  2R4E A;  2X8A A;  4IBC A;  4R7G A;  3U61 B;  4X65 M;  2V1U A;  4NOO B;  1IN8 A;  1Q3B A;  1N78 A;  2W82 A;  5E26 A;  2QBY A;  3SHG B;  2E5L M;  1IBM M;  2F4V M;  3R8F A;  4MGY E;  1HQC A;  1EE8 A;  3KOW E;  4JI5 M;  2DWM A;  1T3T A;  3MK6 A;  1DGH A;  1GKI A;  4AI6 A;  2LWX A;  4KO8 A;  1NJF A;  3U60 A;  4AKI A;  1QZM A;  4GIT A;  4LZJ A;  2AHM A;  1OFH A;  2Y0Q A;  5IRE B;  5C18 A;  2KRU A;  2CHG A;  4OW0 A;  4DV5 M;  4G4O A;  1IM2 A;  4IBJ A;  1XMO M;  2CV2 A;  3U61 A;  2I7P A;  2L6O A;  2XF3 A;  1Q3C A;  2XZU A;  4DR1 M;  3KFU G;  3J7A S;  3KP1 E;  4G6Z A;  1SXJ A;  4FWD A;  4IBB A;  4L78 A;  3EIE A;  3LQQ A;  4LF6 M;  3K92 A;  4NSR A;  3FUT A;  4DR6 M;  1JR3 D;  3UZU A;  4AQY M;  1K82 A;  1NJG A;  2HKJ A;  5EQT A;  5EJC A;  2C5R A;  5KPR A;  3PNV A;  2CFO A;  1J09 A;  4AKG A;  3UJN A;  3GRY A;  3GQ3 A;  2DHR A;  3HGI A;  1J7K A;  1IXR C;  3TE6 A;  3GPP A;  4B3T M;  1XC8 A;  3VK7 A;  4LF9 M;  3DZD A;  3SAS A;  4LFB M;  4ITQ A;  1DGB A;  3SFZ A;  4MM3 B;  2R45 A;  3K2L A;  3VFD A;  4PDG A;  4LJ4 A;  3D8L A;  4DR2 M;  3T1Y M;  3THG A;  3KP0 E;  1GL6 A;  1G4A E;  2KW0 A;  1TDH A;  4JI3 M;  4BB9 A;  2KZU A;  7CAT A;  3U6C A;  3K1J A;  1HNW M;  4LG2 A;  1L2B A;  3E9S A;  3L29 A;  4LY6 A;  1L2C A;  4B3S M;  2EUC A;  4JI6 M;  3CF6 E;  1E9S A;  1FNN A;  1MX0 A;  3IG8 A;  2R4J A;  1XNQ M;  4M0D A;  1QAQ A;  4L4U A;  1NVM A;  3I51 A;  4B3R M;  1ORY B;  1QQW A;  3U6E A;  4I81 A;  1UM8 A;  4YY3 M;  5C1B A;  5EP2 A;  4X66 M;  1PM5 A;  4LJ5 A;  4LF5 M;  2X4A A;  1PJI A;  1K3X A;  4GKJ M;  4NXN M;  3HHX A;  4CHT B;  3I4V A;  4AW4 A;  2CHV A;  4JI8 M;  4RF1 A;  3AOG A;  4MGK E;  2OPF A;  3HWS A;  2ERC A;  3AFH A;  4GH9 A;  4GHL A;  1IY0 A;  1N75 A;  3GRR A;  2KEB A;  4B7F A;  2FFJ A;  3SAV A;  1L1T A;  3ILK A;  4W5W A;  4NRW A;  3C58 A;  4LJ9 A;  1IXZ A;  3QWL A;  1XXH A;  2KXE A;  5EXP A;  2F5P A;  3WHK A;  1KFV A;  4PDI A;  3GLI B;  4LZZ A;  5FLX S;  3GP1 A;  5ITU A;  1DGG A;  2RKO A;  4FCT A;  2C9O A;  2CHQ A;  4IBF A;  3FUU A;  2UUC M;  1OFI A;  1YUB A;  3U6O A;  2L7H A;  2CV0 A;  4MGI E;  1HT2 E;  1WXQ A;  2J7O A;  1NHW C;  1XWI A;  4S12 A;  1IXS B;  3GPX A;  4G4R A;  2FOI C;  1TGU A;  3FUW A;  2XH9 A;  2DZN B;  2YNM D;  3TWK A;  3AJI B;  5BR8 M;  4RF0 A;  1IN4 A;  3J81 S;  3GRV A;  3SBJ A;  1H6U A;  4DV7 M;  4QNR A;  2Z4R A;  3I4Y A;  3VDP A;  4GC5 A;  1R2Y A;  2Y0T A;  1YE9 A;  3GLI A;  3SAW A;  1JR3 A;  3KXE C;  2C96 A;  4JXJ A;  1E9R A;  3SMP A;  1Z6T A;  4LF4 M;  3KSJ A;  1L1Z A;  2R46 A;  3GLF B;  5KO3 A;  1X37 A;  1SXJ C;  2XSZ D;  4FD2 A;  3A42 A;  3VKH A;  4I5S A;  4FW9 A;  3GLH B;  2VQE M;  2BNK A;  2UU9 M;  1IN6 A;  4M9S A;  4JV5 M;  1GLN A;  4MGH A;  4AG5 A;  4CGY B;  3T1H M;  4PT5 A;  4QHS A;  3GPY A;  4X64 M;  2BJV A;  4GRI A;  5EXS A;  3HHZ A;  2C99 A;  2RGO A;  4M9X A;  5ITQ A;  1KYI A;  1IY1 A;  2V1C A;  3U6P A;  4KHP M;  3U6Q A;  1N77 A;  1C1K A;  1G8P A;  3ZH9 B;  3GLF A;  3KSX A;  4L16 A;  3KOZ E;  3GLH A;  3AV0 A;  3DFZ A;  3SAR A;  1Q39 A;  4HLQ A;  2C9C A;  3AOE C;  2HHH M;  2Q2E B;  2HL7 A;  1I94 M;  3M0E A;  5ITY A;  3SMS A;  5LMN M;  2ZM6 M;  3PNY A;  2CUZ A;  2QZ4 A;  1NHG C;  1ZQ9 A;  3HKP A;  2J7N A;  4IBI A;  3RGS A;  1N34 M;  2XGN A;  3FYD A;  3LMM A;  2L7I A;  3FD9 A;  1IBK M;  5EP1 A;  3IG5 A;  1R6B X;  3A45 A;  4IBD A;  3WHL A;  3J7B A;  4GMQ A;  5KPT A;  2FNA A;  2Z7J A;  3U6L A;  2O5R A;  3J80 S;  5A2Q S;  1W5T A;  1QAM A;  4JI4 M;  1IY2 A;  2ZAN A;  3FUX A;  4M9Z A;  4GIP A;  4D80 A;  4BBA A;  4DV4 M;  2D7H A;  4D82 A;  4K0K M;  2DXI A;  3SYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...