4NXMM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxmM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxmM02
4JI3M 3JAMS 2UUAM 1IBMM 5IT9S 4B3TM 1Z59A 3GQ3A 4PDGA 1TDHA 4DV2M 4DV4M 3SAWA 1HNXM 4JI1M 3GPPA 1HNZM 4X62M 5ITQA 2F5QA 2VQEM 5LMNM 4G4NA 2F5PA 5ITTA 3GQ4A 1PJJA 5ITYA 3U6OA 3U6PA 2Q2EB 4LF8M 3A42A 4MB7A 4DUZM 1XNQM 4DV0M 2UUBM 3W0FA 3U6DA 3U6LA 3J81S 3SARA 2OQ4A 4G4RA 2HHHM 1KFVA 3U6QA 1K3XA 4NXNM 1XMQM 4X65M 1N32M 4DR4M 4X64M 4DV3M 4DR3M 4JI5M 4PDIA 1EE8A 3U6MA 1I94M 3A45A 1L2BA 3SATA 4LF9M 2UXCM 5BR8M 3J7AS 1MX0A 2ZM6M 4DR6M 2UUCM 3OTOM 4DV6M 3GP1A 2XZUA 3U6CA 4YHHM 1Z5AA 5ITXA 1HR0M 3GO8A 3DOAA 4LFAM 4G4OA 1Q3BA 3GPYA 1Q3CA 4JI0M 3TWLA 1Z5BA 2F5SA 4DR5M 1XNRM 1N34M 1L1ZA 4DR2M 3T1YM 4YY3M 3SASA 2UU9M 3TWKA 1XC8A 1N36M 4B3MM 4GKKM 4LFBM 4X66M 4NRWA 3T1HM 2UXDM 1R2YA 4JI4M 3JR4A 2VQFM 3VK8A 4LF7M 2EA0A 1J5EM 3A46A 2HKJA 1R2ZA 4GKJM 5LMUM 2F5OA 4JI8M 4JI7M 3GQ5A 1FJGM 2OPFA 4NXMM 4AQYM 3U6EA 3U6SA 1HNWM 1XMOM 4JYAM 4DV1M 5A2QS 5FLXS 4DR1M 4DR7M 3SAUA 1IBLM 4K0KM 5IWAM 3J80S 4OX9M 4KHPM 2F5NA 1PJIA 4LF6M 4B3SM 4DV5M 4JI6M 2XZFA 1K82A 2UXBM 4DUYM 3TWMA 4LF4M 4ITQA 4CISA 2ZBKB 4PD2A 4JI2M 1N33M 1L2DA 3JR5A 3GPXA 3GPUA 5ITRA 4LFCM 3C58A 1IBKM 4B3RM 4LF5M 2E5LM 1TDZA 3SBJA 1L1TA 1NNJA 2F4VM 5ITUA 1PM5A 4JV5M 1Z5CA 3VK7A 4G4QA 4NRVA 4PCZA 1K3WA 1Q39A 1MU5A 3SAVA 1L2CA 4DV7M 5ITXE
chains in the Genus database with same CATH superfamily
1NV8A 1P3QQ 1R5LA 2RGOA 1D0MA 4B7FA 3GQ3A 2Y21A 4PDGA 1TDHA 5FSWA 4DV2M 3SAWA 3FTCA 3B7NA 4NOOB 2KA6B 1SG9A 3T15A 1XWIA 4JN6A 2JWSA 1UFZA 3HHYA 3AJIB 3LVVA 1J7KA 3I4YA 4LJ6A 1TTEA 3CTWB 5EP2A 2DNAA 3U6OA 4RKUF 1RU3A 2FE8A 1IXSA 3UZUA 3A42A 3C3DA 1D0LA 4R3DA 2EKKA 4DUZM 1XNQM 2DZOB 4CJ6A 3FTFA 3IHPA 3EIHA 3W0FA 3U6DA 3AV0A 3U6LA 2LBCA 2K0BX 2LVOC 2WSFF 3SARA 1IN8A 4AZFA 4GC9A 1KFVA 1PGYA 3GLHA 2DWMA 2RGHA 1IN4A 1NJFA 2BJWA 1E9SA 2D7GA 3AOEA 2DXIA 2J7NA 2ZAOA 3HHZA 3ILKA 4DR4M 1N32M 4ANRA 3B7QA 4LGYA 1GABA 3B7ZA 3U60B 3L2AA 4RF0A 2LTUA 3C9PA 4WP2A 1TF0B 4BLCA 4LF9M 3M6AA 2UXCM 3VKHA 2QP9X 5BR8M 3VKGA 2ZM6M 4L6V6 2I7NA 1JQJC 4NL4H 1QUTA 4QNMA 5FTJA 3U6CA 2K6BA 4IBDA 2V1CA 5ITXA 2C5RA 4LJ5A 4IBEA 3HGIA 4G4OA 1Q3BA 2YFQA 1HT2E 1Q3CA 5GKNA 2CHQA 2XFSA 2ZTCA 2LWXA 4Z6YA 1QYRA 1HJPA 2EJSA 1XNRM 2I7PA 1DGHA 1N34M 1IXRC 2L7HA 3J27B 5EP3A 4FCVA 5KQDA 5E6JA 1R2YA 4JI4M 3JR4A 2VQFM 3VK8A 2MR9A 3KSJA 3V76A 2MGWA 4PT5A 3U61B 3GLIB 1R2ZA 3GLFA 2Z4RA 2LH0A 4TUWA 4B08A 5KPTA 3GQ5A 2FOIC 1OAOC 3GRRA 2R46A 4OVZA 1V92A 4JYAM 5A2QS 1XXHE 3FYDA 4DR1M 3HU3A 3K1JA 1G8PA 2H5XA 2L4EA 1UM8A 4KHPM 2F5NA 3TQSA 4LF6M 1IN5A 2APLA 3K92A 3HZJA 1J09A 4M9XA 2XZFA 2M5ZA 4RF1A 3SHGB 4B3SM 4JI6M 2UXBM 1GJTA 4DUYM 3CGWA 2XSZD 4CIZA 1WIVA 2QCUA 3SC3A 4PD2A 4AG6A 3JR5A 4B7GA 1TGUA 1IFYA 3FD9A 1QZMA 3TE6A 5DFLA 1IY0A 5ITRA 3C58A 1IBKM 3KP0E 3QWLA 4GIPA 4LF5M 4ZPXA 4HL4A 1LTMA 3MK6A 3Q8GA 4DBGB 5DNYA 1DGFA 1JB0F 2C9OA 1TDZA 4D82A 1NNJA 3MHVC 2QBYB 2LXEA 2VDBB 2R4EA 3T6PA 4NRVA 2KEBA 2VF8A 1K3WA 5L8RF 1I4WA 1QAQA 4DV7M 5ITXE 3RGPA 2G3QA 2UUAM 3JAMS 3PNVA 2EUCA 3GLGE 1Z59A 2QPAA 4LJ8A 4JI1M 4DV4M 3L29A 4CHTB 4R7GA 5ITQA 4I81A 2QENA 2Z8YM 1OJLA 4QOSA 5ITTA 1QZEA 3HJ8A 4LJAA 3WHKA 1NSFA 4L4UA 1IN6A 3KVWA 2DZNB 2DAMA 3RGSA 3U6PA 4GH9A 2FS1A 3KP1E 3FYCA 2ZTDA 3HHWA 4LGMA 3ZQJA 1OTRA 3GLFE 2O5RA 4AKIA 2JY6B 4G4RA 1MN3A 3NBIA 4IJEA 4FVMA 1EFUB 3E4RA 2YNMD 2HHHM 3BBZA 4HLQA 5EJCA 2H1RA 3FUTA 2BNKA 4X65M 1XMQM 2CUZA 3FTDA 2DAIA 4MGHA 3R9XB 1OFHA 4DV3M 2YQZA 8CATA 3GLHB 1HT1E 2KHHA 3CF2A 5FTNA 1EIJA 3A45A 2DHRA 2JUJA 4LJ9A 1VEKA 1XHBA 2CV0A 2KNVA 1E32A 2UUCM 1SXJA 3OTOM 4DV6M 1IQPA 1XXHA 3FUWA 1Z5AA 2QHOB 4Q7JA 2FFJA 2JY8A 3SMSA 2DENA 2NQ8C 3DOAA 1G59A 1R7RA 3T38A 1VDDA 3GPYA 2X49A 2V6ZM 2JP7A 3D8BA 2JY5A 4M0WA 4AW4A 3TWLA 3RE8A 1IY2A 3WHLA 4KO8A 4R71A 1L1ZA 2BWBA 4DR2M 4YY3M 3HJSA 3SMPA 2UU9M 2ERCA 3UGJA 5DYIA 1OKSA 4B3MM 4GKKM 5EXTA 5KO3A 4OW0A 1ZMWA 4AG5A 4X66M 3H4MA 2UXDM 5FTMA 3UK6A 5KPZA 4XGIA 3A46A 1HQYE 1AUAA 2KRKA 3I51A 2F5OA 2MJ5B 1FJGM 3IG5A 3GLGA 3M0EA 1G3IA 1KYIA 3SHFA 1HNWM 1SXJD 5FTLA 2G8LA 1TH3A 2M60A 4WURA 1GKIA 1T43A 4DR7M 1TH2A 3SAUA 2CHVA 2HL7A 2DKLA 4G3OA 2XSZA 2LVNC 3I01M 1YUBA 4OX9M 2DWNA 4UN2B 2XF3A 3K9PA 1PJIA 2C9CA 2DVWB 3H4JA 1G71A 1CUKA 2QQ8A 4GMQA 1K82A 3I04M 1YLAA 1N77A 4LF4M 3LQRA 2G5GX 2MH8A 4I8OA 4LZJA 4P16A 4A3VB 4ITQA 2L2DA 3HY5A 2XLJA 4JI2M 2R4JA 3ZC7B 1WR1B 3FTEA 1FNNA 3GPUA 4QHSA 4F2LA 5EP1A 4CGYB 2EKFA 2LVPC 3LW5F 4FCTA 4LZZA 2HCBA 3LQQA 2CHGA 1PM5A 1GLNA 2F4VM 2FNAA 3CF6E 5EP4A 1IM2A 3VDPA 1S3SA 3LVWA 1SXJE 3NWLA 2EO2A 2ZANA 3KS8A 4B3TM 4GITA 3DZDA 4JI3M 2BWEA 1IBMM 1T6OA 5IT9S 3ZCBB 4REZA 1TR8A 1WXQA 2OOAA 1VDLA 4B7HA 1HNXM 1PJQA 2AHMA 1HNZM 4X62M 2F5QA 2KXEA 3PXGA 4GHLA 3KFUG 1OQYA 2XH9A 4G4NA 2F5PA 5IREB 1PJJA 2Y20A 4LJ7A 5ITYA 1DGBA 1W5SA 3LCVB 3GRUA 3KOZE 3U5ZB 3K8ZA 3F92A 4W5WA 2DI0A 2L4FA 3UJNA 4MB7A 2J7OA 3AOGA 2O25A 1Y8GA 5KQ8A 4DV0M 2UUBM 4D80A 2A5YB 4FWHA 3FKEA 2KRUA 2KDLA 3BXWA 3J81S 1IY1A 1NVMA 2L7IA 2RRUA 3K2LA 4BB9A 2OQ4A 1E94E 3R8FA 1KSFX 1DV0A 3U6QA 1K3XA 1E9RA 2P5TA 2CE7A 3U61A 2OOBA 4X64M 4IBFA 3TPZA 4JI5M 1QANA 1ZMUA 2R6FA 4PDIA 1EE8A 2Z3XA 3M7GA 1L2BA 3SATA 4EIWA 1MX0A 3KS4A 4L78A 1MJGM 1YE9A 4GRIA 1D0KA 3L28A 4YHHM 4IJFA 1HR0M 2KNZA 4LFAM 1L8QA 1XB2B 2W82A 4JI0M 2GQFA 2C99A 1NJGA 1OIPA 1XXHB 1Z5BA 4Y28F 1YSYA 2CV2A 3SFZA 1HQCA 1JR3A 3QYEA 1IXSB 2XEPA 3T1YM 2N35A 4QHTA 2D7HA 3TWKA 1XC8A 1N36M 4LFBM 4XK8F 4NRWA 1QAMA 3T1HM 1IN7A 1GVNA 4IBKA 4L15A 2JY7A 2QBYA 3D8LA 4LF7M 2R65A 3LMMA 2EA0A 2FH0A 1PJTA 4FW9A 2HKJA 1X37A 1GL7A 2VF7A 5C18A 5LMUM 2V1UA 2R44A 3E46A 2CFOA 4MGZE 1R6BX 3IECA 1T3TA 1C7YA 4JI7M 4JI8M 4NXMM 4AQYM 4LJ4A 2B3TA 5E26A 3U6SA 1NHWC 3NBXX 1V34A 2XGNA 3FUUA 4DV1M 4G6ZA 2KW0A 2JZ0A 1IBLM 4AI6A 3GLGB 3VFDA 2X8AA 3AOEC 3TL4X 2GNOA 5EQTA 2LVQD 4II7A 4DV5M 1OFIA 5EXXA 1LV7A 4WW0A 1JR3D 3AKZA 3TWMA 3W67A 1DGHB 4CISA 3QAUA 1QQWA 1ZQ9A 5JI3E 4QOZC 2DAKA 2Y0TA 1N33M 2L09A 3FRHA 1AIPC 3W68A 3GLIE 1WGNA 5DYGA 4LFCM 3PVSA 1GO5A 5BPVA 4B3RM 3BOSA 2E5LM 3B89A 4MGKE 3AFHA 3AL0C 2Y0QA 3KSXA 2LVAA 4IBBA 3SBJA 1L1TA 1OIZA 4IBJA 4G4QA 2C98A 3GLFB 3KW6A 3HX3A 2WZJA 3SAVA 4KODA 2DAEA 2LNHC 1VQ1A 2K47A 3FE3A 4NC6A 4OVZB 4L16A 2QZ4A 4L8RC 4I5SA 3GPPA 2DWZB 2DZLA 3KXEC 4FWDA 1JR3E 2DAGA 2VQEM 5LMNM 1ORYB 5F3WA 1VEGA 3J7BA 1QVRA 4Z8XA 3UMMA 3B74A 3GQ4A 2LHCA 1NV9A 3KOWE 4MGIE 3SYKA 4MM3B 2Q2EB 3PFIA 4HEOA 4LF8M 4LCBA 1GJSA 2DWLA 1R4GA 1ZMVA 1NY5A 3HHXA 2D7EA 4D81A 4FCWA 4LRSA 1QAOA 4MH0E 3HKPA 2O01F 1WJ7A 1N75A 1QDTA 2JXNA 2X4AA 3SYLA 3U60A 1F4IA 4NXNM 2JNHA 3DFZA 1NNUC 3L25A 2CWBA 3DA1A 4KT0F 2R45A 3KOYE 1DGGA 3A98B 1NHGC 3K9OA 4DR3M 3U6MA 1I94M 2Z7JA 3J7AS 4DR6M 1PJSA 2CP8A 3HJQA 3KDSE 3GP1A 2XZUA 2OO9A 3J2PB 1IXZA 1QDRA 3GO8A 5EXSA 1C1KA 1Z6TA 2VIIA 1W5TA 3MMPA 2J5YA 2JA2A 4RNAA 4F1IA 2F5SA 2HAKA 3I4VA 4NSOB 4DR5M 1NO1A 1QUSA 1Q02A 1G4AE 4M0DA 1D2NA 4LRTA 3SASA 4BBAA 2KZSA 2LHGA 1VG5A 1WGLA 1ZAEA 3MJ5A 3GLIA 4M9ZA 1V33A 1VEJA 3E9SA 5EXPA 5C1BA 4OU7A 4JXJA 3GLHE 3L27A 2MROB 3FUXA 4MGYE 3VDUA 4IBCA 3FUVA 2BJVA 3CF0A 3PNYA 1BVSA 3HWSA 1J5EM 3KOXE 1G41A 2WSCF 4GEWA 4S12A 3RFWA 4GKJM 4AKGA 4P17A 2RKOA 3FRIA 1N78A 2R18A 2DHYA 4FD2A 3W0LB 1GL6A 2OPFA 2KNAA 3U6EA 4IBGA 4M9SA 3QYBA 3E21A 5H37D 2YR0A 1SXJB 1XMOM 1OAIA 5FLXS 5FTKA 1WHCA 2QSFX 4K0KM 2XFTA 2R0IA 5IWAM 3J80S 5KPRA 1TH4A 2K9DA 1DO2A 1ZV1A 4IIWA 2JZ1A 2KZUA 3U5ZA 2CEAA 1NY6A 4GC5A 1DO0A 4LY6A 4AKHA 3HU1A 4KLNA 5IZ7D 2ZBKB 2CRUA 1L2DA 2C96A 1H6UA 2R62A 2WSEF 3GPXA 3HU2A 3IG8A 2HWJA 3ZH9B 1SXJC 3C3EA 1PRBA 3LCUA 1A5TA 3Q8XA 4FWGA 3VLFB 4QNRA 4GHAA 3EIEA 3GRVA 5JI2E 2Z4SA 3THGA 4I4LA 2QNJA 5ITUA 4XBOA 1Z5CA 3VK7A 2CV1A 4JV5M 2ZAMA 4PCZA 3L26A 4NSRA 4IBIA 1Q39A 3B9PA 3GRYA 7CATA 1MU5A 1L2CA 4LG2A 2L6OA
chains in the Genus database with same CATH topology
2RGOA 4B7FA 3GQ3A 2Y21A 4PDGA 1TDHA 5FSWA 4DV2M 3SAWA 3FTCA 4NOOB 2KA6B 3T15A 1XWIA 4JN6A 3HHYA 3AJIB 3LVVA 1J7KA 3I4YA 4LJ6A 3CTWB 5EP2A 3U6OA 2FE8A 3UZUA 3A42A 4DUZM 1XNQM 4R3DA 3FTFA 2DZOB 3EIHA 3W0FA 3U6DA 3AV0A 3U6LA 3SARA 1IN8A 4AZFA 4GC9A 1KFVA 2DWMA 3GLHA 2RGHA 1IN4A 1NJFA 2BJWA 1E9SA 2D7GA 3AOEA 2DXIA 2J7NA 2ZAOA 3HHZA 3ILKA 4DR4M 1N32M 4LGYA 3U60B 3L2AA 4RF0A 4BLCA 4LF9M 3M6AA 2UXCM 3VKHA 2QP9X 5BR8M 3VKGA 2ZM6M 2I7NA 1JQJC 4NL4H 4QNMA 5FTJA 3U6CA 4IBDA 2V1CA 5ITXA 2C5RA 4LJ5A 4IBEA 3HGIA 4G4OA 1Q3BA 2YFQA 1HT2E 1Q3CA 5GKNA 2CHQA 2XFSA 2LWXA 4Z6YA 1QYRA 1XNRM 2I7PA 1DGHA 1N34M 1IXRC 2L7HA 3J27B 5EP3A 4FCVA 5KQDA 5E6JA 1R2YA 4JI4M 3JR4A 2VQFM 3VK8A 3KSJA 4PT5A 3U61B 3GLIB 1R2ZA 3GLFA 2Z4RA 2LH0A 4TUWA 4B08A 5KPTA 3GQ5A 2FOIC 3GRRA 2R46A 4OVZA 4JYAM 5A2QS 3FYDA 4DR1M 3HU3A 3K1JA 1G8PA 1UM8A 4KHPM 2F5NA 3TQSA 4LF6M 1IN5A 3K92A 4M9XA 1J09A 4B3SM 2XZFA 2M5ZA 4RF1A 3SHGB 4JI6M 2UXBM 4DUYM 2XSZD 2QCUA 3SC3A 4PD2A 4AG6A 3JR5A 4B7GA 1TGUA 3FD9A 1QZMA 3TE6A 1IY0A 5ITRA 3C58A 1IBKM 3KP0E 3QWLA 4GIPA 4LF5M 4ZPXA 4HL4A 5DNYA 3MK6A 1TDZA 2QBYB 1DGFA 2C9OA 1NNJA 4D82A 3MHVC 2LXEA 2R4EA 4NRVA 2KEBA 1K3WA 1I4WA 1QAQA 4DV7M 5ITXE 3RGPA 2UUAM 3JAMS 3PNVA 2EUCA 1Z59A 2QPAA 4LJ8A 4JI1M 4DV4M 3L29A 4CHTB 4R7GA 5ITQA 4I81A 2QENA 1OJLA 4QOSA 5ITTA 3HJ8A 4LJAA 3WHKA 1NSFA 4L4UA 1IN6A 3KVWA 2DZNB 3RGSA 3U6PA 4GH9A 3KP1E 3FYCA 3HHWA 4LGMA 2O5RA 4AKIA 4G4RA 3NBIA 4IJEA 2HHHM 4FVMA 3E4RA 2YNMD 4HLQA 5EJCA 2H1RA 3FUTA 2BNKA 4X65M 1XMQM 2CUZA 3FTDA 4MGHA 3R9XB 1OFHA 4DV3M 2YQZA 8CATA 3GLHB 1HT1E 5FTNA 3CF2A 3A45A 2DHRA 4LJ9A 1XHBA 2CV0A 1E32A 2UUCM 1SXJA 3OTOM 4DV6M 1IQPA 1XXHA 3FUWA 1Z5AA 2FFJA 3SMSA 3DOAA 2NQ8C 1G59A 1R7RA 3T38A 1VDDA 3GPYA 2X49A 2V6ZM 3D8BA 4M0WA 4AW4A 3TWLA 3RE8A 1IY2A 3WHLA 4KO8A 1L1ZA 4DR2M 4YY3M 3HJSA 3SMPA 2UU9M 2ERCA 3UGJA 5DYIA 4B3MM 4GKKM 5EXTA 5KO3A 4OW0A 4AG5A 4X66M 3H4MA 2UXDM 5FTMA 3UK6A 5KPZA 4XGIA 3A46A 1HQYE 2KRKA 3I51A 2F5OA 1FJGM 3IG5A 3GLGA 3M0EA 1G3IA 1KYIA 3SHFA 1HNWM 1SXJD 5FTLA 2G8LA 1TH3A 2M60A 4WURA 1GKIA 4DR7M 1TH2A 3SAUA 2CHVA 2HL7A 2XSZA 4OX9M 1YUBA 2DWNA 2XF3A 1PJIA 2C9CA 2DVWB 4GMQA 1K82A 1N77A 4LF4M 3LQRA 2G5GX 4LZJA 4I8OA 4P16A 4A3VB 4ITQA 4JI2M 2XLJA 2R4JA 3ZC7B 3FTEA 1FNNA 3GPUA 4QHSA 5EP1A 4CGYB 4FCTA 4LZZA 2HCBA 3LQQA 2CHGA 1PM5A 1GLNA 2F4VM 2FNAA 3CF6E 5EP4A 1IM2A 3VDPA 1S3SA 3LVWA 1SXJE 3NWLA 2EO2A 2ZANA 3KS8A 4B3TM 4GITA 3DZDA 4JI3M 1IBMM 5IT9S 3ZCBB 4REZA 1WXQA 1HNXM 4B7HA 2AHMA 1HNZM 4X62M 2F5QA 2KXEA 3PXGA 4GHLA 3KFUG 4G4NA 2XH9A 2F5PA 5IREB 1PJJA 2Y20A 4LJ7A 5ITYA 1DGBA 1W5SA 3GRUA 3KOZE 3U5ZB 3K8ZA 4W5WA 3UJNA 4MB7A 2J7OA 3AOGA 4DV0M 5KQ8A 2UUBM 4D80A 2A5YB 4FWHA 3FKEA 2KRUA 3J81S 1IY1A 1NVMA 2L7IA 4BB9A 3K2LA 2OQ4A 3R8FA 1E94E 1KSFX 3U6QA 1K3XA 1E9RA 2P5TA 2CE7A 3U61A 4X64M 4IBFA 3TPZA 4JI5M 1QANA 4PDIA 1EE8A 2Z3XA 3M7GA 1L2BA 3SATA 4EIWA 1MX0A 3KS4A 4L78A 1YE9A 4GRIA 3L28A 4YHHM 4IJFA 1HR0M 4LFAM 1L8QA 2W82A 4JI0M 2C99A 1NJGA 1XXHB 1Z5BA 1YSYA 2CV2A 3SFZA 1HQCA 1JR3A 1IXSB 2XEPA 3T1YM 4QHTA 2D7HA 3TWKA 1XC8A 1N36M 4LFBM 4NRWA 1QAMA 3T1HM 1IN7A 1GVNA 4IBKA 4L15A 2QBYA 3D8LA 4LF7M 2R65A 3LMMA 2EA0A 4FW9A 2HKJA 1X37A 1GL7A 5C18A 5LMUM 2V1UA 2CFOA 4MGZE 1R6BX 4JI8M 1T3TA 4JI7M 4NXMM 4AQYM 4LJ4A 5E26A 3U6SA 1NHWC 3FUUA 2XGNA 4DV1M 4G6ZA 2KW0A 4AI6A 1IBLM 3GLGB 3VFDA 2X8AA 3AOEC 3TL4X 5EQTA 4II7A 4DV5M 1OFIA 5EXXA 1LV7A 4WW0A 1JR3D 3AKZA 3TWMA 1DGHB 4CISA 3QAUA 1QQWA 1ZQ9A 5JI3E 4QOZC 2Y0TA 1N33M 2L09A 5DYGA 4LFCM 3PVSA 5BPVA 4B3RM 3BOSA 2E5LM 4MGKE 3AFHA 3AL0C 2Y0QA 3KSXA 4IBBA 3SBJA 1L1TA 4IBJA 4G4QA 2C98A 3GLFB 3KW6A 3SAVA 4KODA 2LNHC 2K47A 4OVZB 4L16A 2QZ4A 4L8RC 4I5SA 3GPPA 2DWZB 3KXEC 4FWDA 2VQEM 5LMNM 1ORYB 5F3WA 3J7BA 1QVRA 4Z8XA 3UMMA 3GQ4A 3KOWE 4MGIE 3SYKA 4MM3B 2Q2EB 3PFIA 4LF8M 4LCBA 2DWLA 1NY5A 3HHXA 2D7EA 4D81A 4FCWA 4LRSA 1QAOA 4MH0E 3HKPA 1N75A 3SYLA 3U60A 2X4AA 4NXNM 3DFZA 1NNUC 3L25A 3DA1A 2R45A 3KOYE 1DGGA 3A98B 1NHGC 4DR3M 3U6MA 1I94M 2Z7JA 3J7AS 4DR6M 3HJQA 3KDSE 3GP1A 2XZUA 3J2PB 1IXZA 3GO8A 5EXSA 1C1KA 1Z6TA 2VIIA 1W5TA 2JA2A 4RNAA 2F5SA 3I4VA 4DR5M 4NSOB 1G4AE 4M0DA 1D2NA 4LRTA 3SASA 4BBAA 2KZSA 1ZAEA 3MJ5A 3GLIA 4M9ZA 3E9SA 5EXPA 5C1BA 4OU7A 4JXJA 3L27A 3FUXA 4MGYE 3VDUA 4IBCA 3FUVA 2BJVA 3CF0A 3PNYA 3HWSA 1J5EM 3KOXE 1G41A 4S12A 3RFWA 4GKJM 4AKGA 2RKOA 1N78A 2R18A 4FD2A 3W0LB 2OPFA 1GL6A 3U6EA 4IBGA 4M9SA 5H37D 2YR0A 1SXJB 1XMOM 5FLXS 5FTKA 4K0KM 2XFTA 5IWAM 3J80S 5KPRA 1TH4A 1DO2A 4IIWA 2KZUA 3U5ZA 2CEAA 1NY6A 4GC5A 1DO0A 4LY6A 4AKHA 3HU1A 4KLNA 5IZ7D 2ZBKB 1L2DA 2C96A 1H6UA 2R62A 3GPXA 3HU2A 3IG8A 3ZH9B 1SXJC 3Q8XA 4FWGA 3VLFB 4QNRA 4GHAA 3EIEA 3GRVA 5JI2E 2Z4SA 3THGA 4I4LA 5ITUA 4XBOA 1Z5CA 3VK7A 2CV1A 4JV5M 2ZAMA 4PCZA 3L26A 4NSRA 4IBIA 1Q39A 3B9PA 3GRYA 7CATA 1MU5A 1L2CA 4LG2A 2L6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 M;  3JAM S;  2UUA M;  1IBM M;  5IT9 S;  4B3T M;  1Z59 A;  3GQ3 A;  4PDG A;  1TDH A;  4DV2 M;  4DV4 M;  3SAW A;  1HNX M;  4JI1 M;  3GPP A;  1HNZ M;  4X62 M;  5ITQ A;  2F5Q A;  2VQE M;  5LMN M;  4G4N A;  2F5P A;  5ITT A;  3GQ4 A;  1PJJ A;  5ITY A;  3U6O A;  3U6P A;  2Q2E B;  4LF8 M;  3A42 A;  4MB7 A;  4DUZ M;  1XNQ M;  4DV0 M;  2UUB M;  3W0F A;  3U6D A;  3U6L A;  3J81 S;  3SAR A;  2OQ4 A;  4G4R A;  2HHH M;  1KFV A;  3U6Q A;  1K3X A;  4NXN M;  1XMQ M;  4X65 M;  1N32 M;  4DR4 M;  4X64 M;  4DV3 M;  4DR3 M;  4JI5 M;  4PDI A;  1EE8 A;  3U6M A;  1I94 M;  3A45 A;  1L2B A;  3SAT A;  4LF9 M;  2UXC M;  5BR8 M;  3J7A S;  1MX0 A;  2ZM6 M;  4DR6 M;  2UUC M;  3OTO M;  4DV6 M;  3GP1 A;  2XZU A;  3U6C A;  4YHH M;  1Z5A A;  5ITX A;  1HR0 M;  3GO8 A;  3DOA A;  4LFA M;  4G4O A;  1Q3B A;  3GPY A;  1Q3C A;  4JI0 M;  3TWL A;  1Z5B A;  2F5S A;  4DR5 M;  1XNR M;  1N34 M;  1L1Z A;  4DR2 M;  3T1Y M;  4YY3 M;  3SAS A;  2UU9 M;  3TWK A;  1XC8 A;  1N36 M;  4B3M M;  4GKK M;  4LFB M;  4X66 M;  4NRW A;  3T1H M;  2UXD M;  1R2Y A;  4JI4 M;  3JR4 A;  2VQF M;  3VK8 A;  4LF7 M;  2EA0 A;  1J5E M;  3A46 A;  2HKJ A;  1R2Z A;  4GKJ M;  5LMU M;  2F5O A;  4JI8 M;  4JI7 M;  3GQ5 A;  1FJG M;  2OPF A;  4NXM M;  4AQY M;  3U6E A;  3U6S A;  1HNW M;  1XMO M;  4JYA M;  4DV1 M;  5A2Q S;  5FLX S;  4DR1 M;  4DR7 M;  3SAU A;  1IBL M;  4K0K M;  5IWA M;  3J80 S;  4OX9 M;  4KHP M;  2F5N A;  1PJI A;  4LF6 M;  4B3S M;  4DV5 M;  4JI6 M;  2XZF A;  1K82 A;  2UXB M;  4DUY M;  3TWM A;  4LF4 M;  4ITQ A;  4CIS A;  2ZBK B;  4PD2 A;  4JI2 M;  1N33 M;  1L2D A;  3JR5 A;  3GPX A;  3GPU A;  5ITR A;  4LFC M;  3C58 A;  1IBK M;  4B3R M;  4LF5 M;  2E5L M;  1TDZ A;  3SBJ A;  1L1T A;  1NNJ A;  2F4V M;  5ITU A;  1PM5 A;  4JV5 M;  1Z5C A;  3VK7 A;  4G4Q A;  4NRV A;  4PCZ A;  1K3W A;  1Q39 A;  1MU5 A;  3SAV A;  1L2C A;  4DV7 M;  5ITX E; 
#chains in the Genus database with same CATH topology
 1NV8 A;  1P3Q Q;  1R5L A;  2RGO A;  1D0M A;  4B7F A;  3GQ3 A;  2Y21 A;  4PDG A;  1TDH A;  5FSW A;  4DV2 M;  3SAW A;  3FTC A;  3B7N A;  4NOO B;  2KA6 B;  1SG9 A;  3T15 A;  1XWI A;  4JN6 A;  2JWS A;  1UFZ A;  3HHY A;  3AJI B;  3LVV A;  1J7K A;  3I4Y A;  4LJ6 A;  1TTE A;  3CTW B;  5EP2 A;  2DNA A;  3U6O A;  4RKU F;  1RU3 A;  2FE8 A;  1IXS A;  3UZU A;  3A42 A;  3C3D A;  1D0L A;  4R3D A;  2EKK A;  4DUZ M;  1XNQ M;  2DZO B;  4CJ6 A;  3FTF A;  3IHP A;  3EIH A;  3W0F A;  3U6D A;  3AV0 A;  3U6L A;  2LBC A;  2K0B X;  2LVO C;  2WSF F;  3SAR A;  1IN8 A;  4AZF A;  4GC9 A;  1KFV A;  1PGY A;  3GLH A;  2DWM A;  2RGH A;  1IN4 A;  1NJF A;  2BJW A;  1E9S A;  2D7G A;  3AOE A;  2DXI A;  2J7N A;  2ZAO A;  3HHZ A;  3ILK A;  4DR4 M;  1N32 M;  4ANR A;  3B7Q A;  4LGY A;  1GAB A;  3B7Z A;  3U60 B;  3L2A A;  4RF0 A;  2LTU A;  3C9P A;  4WP2 A;  1TF0 B;  4BLC A;  4LF9 M;  3M6A A;  2UXC M;  3VKH A;  2QP9 X;  5BR8 M;  3VKG A;  2ZM6 M;  4L6V 6;  2I7N A;  1JQJ C;  4NL4 H;  1QUT A;  4QNM A;  5FTJ A;  3U6C A;  2K6B A;  4IBD A;  2V1C A;  5ITX A;  2C5R A;  4LJ5 A;  4IBE A;  3HGI A;  4G4O A;  1Q3B A;  2YFQ A;  1HT2 E;  1Q3C A;  5GKN A;  2CHQ A;  2XFS A;  2ZTC A;  2LWX A;  4Z6Y A;  1QYR A;  1HJP A;  2EJS A;  1XNR M;  2I7P A;  1DGH A;  1N34 M;  1IXR C;  2L7H A;  3J27 B;  5EP3 A;  4FCV A;  5KQD A;  5E6J A;  1R2Y A;  4JI4 M;  3JR4 A;  2VQF M;  3VK8 A;  2MR9 A;  3KSJ A;  3V76 A;  2MGW A;  4PT5 A;  3U61 B;  3GLI B;  1R2Z A;  3GLF A;  2Z4R A;  2LH0 A;  4TUW A;  4B08 A;  5KPT A;  3GQ5 A;  2FOI C;  1OAO C;  3GRR A;  2R46 A;  4OVZ A;  1V92 A;  4JYA M;  5A2Q S;  1XXH E;  3FYD A;  4DR1 M;  3HU3 A;  3K1J A;  1G8P A;  2H5X A;  2L4E A;  1UM8 A;  4KHP M;  2F5N A;  3TQS A;  4LF6 M;  1IN5 A;  2APL A;  3K92 A;  3HZJ A;  1J09 A;  4M9X A;  2XZF A;  2M5Z A;  4RF1 A;  3SHG B;  4B3S M;  4JI6 M;  2UXB M;  1GJT A;  4DUY M;  3CGW A;  2XSZ D;  4CIZ A;  1WIV A;  2QCU A;  3SC3 A;  4PD2 A;  4AG6 A;  3JR5 A;  4B7G A;  1TGU A;  1IFY A;  3FD9 A;  1QZM A;  3TE6 A;  5DFL A;  1IY0 A;  5ITR A;  3C58 A;  1IBK M;  3KP0 E;  3QWL A;  4GIP A;  4LF5 M;  4ZPX A;  4HL4 A;  1LTM A;  3MK6 A;  3Q8G A;  4DBG B;  5DNY A;  1DGF A;  1JB0 F;  2C9O A;  1TDZ A;  4D82 A;  1NNJ A;  3MHV C;  2QBY B;  2LXE A;  2VDB B;  2R4E A;  3T6P A;  4NRV A;  2KEB A;  2VF8 A;  1K3W A;  5L8R F;  1I4W A;  1QAQ A;  4DV7 M;  5ITX E;  3RGP A;  2G3Q A;  2UUA M;  3JAM S;  3PNV A;  2EUC A;  3GLG E;  1Z59 A;  2QPA A;  4LJ8 A;  4JI1 M;  4DV4 M;  3L29 A;  4CHT B;  4R7G A;  5ITQ A;  4I81 A;  2QEN A;  2Z8Y M;  1OJL A;  4QOS A;  5ITT A;  1QZE A;  3HJ8 A;  4LJA A;  3WHK A;  1NSF A;  4L4U A;  1IN6 A;  3KVW A;  2DZN B;  2DAM A;  3RGS A;  3U6P A;  4GH9 A;  2FS1 A;  3KP1 E;  3FYC A;  2ZTD A;  3HHW A;  4LGM A;  3ZQJ A;  1OTR A;  3GLF E;  2O5R A;  4AKI A;  2JY6 B;  4G4R A;  1MN3 A;  3NBI A;  4IJE A;  4FVM A;  1EFU B;  3E4R A;  2YNM D;  2HHH M;  3BBZ A;  4HLQ A;  5EJC A;  2H1R A;  3FUT A;  2BNK A;  4X65 M;  1XMQ M;  2CUZ A;  3FTD A;  2DAI A;  4MGH A;  3R9X B;  1OFH A;  4DV3 M;  2YQZ A;  8CAT A;  3GLH B;  1HT1 E;  2KHH A;  3CF2 A;  5FTN A;  1EIJ A;  3A45 A;  2DHR A;  2JUJ A;  4LJ9 A;  1VEK A;  1XHB A;  2CV0 A;  2KNV A;  1E32 A;  2UUC M;  1SXJ A;  3OTO M;  4DV6 M;  1IQP A;  1XXH A;  3FUW A;  1Z5A A;  2QHO B;  4Q7J A;  2FFJ A;  2JY8 A;  3SMS A;  2DEN A;  2NQ8 C;  3DOA A;  1G59 A;  1R7R A;  3T38 A;  1VDD A;  3GPY A;  2X49 A;  2V6Z M;  2JP7 A;  3D8B A;  2JY5 A;  4M0W A;  4AW4 A;  3TWL A;  3RE8 A;  1IY2 A;  3WHL A;  4KO8 A;  4R71 A;  1L1Z A;  2BWB A;  4DR2 M;  4YY3 M;  3HJS A;  3SMP A;  2UU9 M;  2ERC A;  3UGJ A;  5DYI A;  1OKS A;  4B3M M;  4GKK M;  5EXT A;  5KO3 A;  4OW0 A;  1ZMW A;  4AG5 A;  4X66 M;  3H4M A;  2UXD M;  5FTM A;  3UK6 A;  5KPZ A;  4XGI A;  3A46 A;  1HQY E;  1AUA A;  2KRK A;  3I51 A;  2F5O A;  2MJ5 B;  1FJG M;  3IG5 A;  3GLG A;  3M0E A;  1G3I A;  1KYI A;  3SHF A;  1HNW M;  1SXJ D;  5FTL A;  2G8L A;  1TH3 A;  2M60 A;  4WUR A;  1GKI A;  1T43 A;  4DR7 M;  1TH2 A;  3SAU A;  2CHV A;  2HL7 A;  2DKL A;  4G3O A;  2XSZ A;  2LVN C;  3I01 M;  1YUB A;  4OX9 M;  2DWN A;  4UN2 B;  2XF3 A;  3K9P A;  1PJI A;  2C9C A;  2DVW B;  3H4J A;  1G71 A;  1CUK A;  2QQ8 A;  4GMQ A;  1K82 A;  3I04 M;  1YLA A;  1N77 A;  4LF4 M;  3LQR A;  2G5G X;  2MH8 A;  4I8O A;  4LZJ A;  4P16 A;  4A3V B;  4ITQ A;  2L2D A;  3HY5 A;  2XLJ A;  4JI2 M;  2R4J A;  3ZC7 B;  1WR1 B;  3FTE A;  1FNN A;  3GPU A;  4QHS A;  4F2L A;  5EP1 A;  4CGY B;  2EKF A;  2LVP C;  3LW5 F;  4FCT A;  4LZZ A;  2HCB A;  3LQQ A;  2CHG A;  1PM5 A;  1GLN A;  2F4V M;  2FNA A;  3CF6 E;  5EP4 A;  1IM2 A;  3VDP A;  1S3S A;  3LVW A;  1SXJ E;  3NWL A;  2EO2 A;  2ZAN A;  3KS8 A;  4B3T M;  4GIT A;  3DZD A;  4JI3 M;  2BWE A;  1IBM M;  1T6O A;  5IT9 S;  3ZCB B;  4REZ A;  1TR8 A;  1WXQ A;  2OOA A;  1VDL A;  4B7H A;  1HNX M;  1PJQ A;  2AHM A;  1HNZ M;  4X62 M;  2F5Q A;  2KXE A;  3PXG A;  4GHL A;  3KFU G;  1OQY A;  2XH9 A;  4G4N A;  2F5P A;  5IRE B;  1PJJ A;  2Y20 A;  4LJ7 A;  5ITY A;  1DGB A;  1W5S A;  3LCV B;  3GRU A;  3KOZ E;  3U5Z B;  3K8Z A;  3F92 A;  4W5W A;  2DI0 A;  2L4F A;  3UJN A;  4MB7 A;  2J7O A;  3AOG A;  2O25 A;  1Y8G A;  5KQ8 A;  4DV0 M;  2UUB M;  4D80 A;  2A5Y B;  4FWH A;  3FKE A;  2KRU A;  2KDL A;  3BXW A;  3J81 S;  1IY1 A;  1NVM A;  2L7I A;  2RRU A;  3K2L A;  4BB9 A;  2OQ4 A;  1E94 E;  3R8F A;  1KSF X;  1DV0 A;  3U6Q A;  1K3X A;  1E9R A;  2P5T A;  2CE7 A;  3U61 A;  2OOB A;  4X64 M;  4IBF A;  3TPZ A;  4JI5 M;  1QAN A;  1ZMU A;  2R6F A;  4PDI A;  1EE8 A;  2Z3X A;  3M7G A;  1L2B A;  3SAT A;  4EIW A;  1MX0 A;  3KS4 A;  4L78 A;  1MJG M;  1YE9 A;  4GRI A;  1D0K A;  3L28 A;  4YHH M;  4IJF A;  1HR0 M;  2KNZ A;  4LFA M;  1L8Q A;  1XB2 B;  2W82 A;  4JI0 M;  2GQF A;  2C99 A;  1NJG A;  1OIP A;  1XXH B;  1Z5B A;  4Y28 F;  1YSY A;  2CV2 A;  3SFZ A;  1HQC A;  1JR3 A;  3QYE A;  1IXS B;  2XEP A;  3T1Y M;  2N35 A;  4QHT A;  2D7H A;  3TWK A;  1XC8 A;  1N36 M;  4LFB M;  4XK8 F;  4NRW A;  1QAM A;  3T1H M;  1IN7 A;  1GVN A;  4IBK A;  4L15 A;  2JY7 A;  2QBY A;  3D8L A;  4LF7 M;  2R65 A;  3LMM A;  2EA0 A;  2FH0 A;  1PJT A;  4FW9 A;  2HKJ A;  1X37 A;  1GL7 A;  2VF7 A;  5C18 A;  5LMU M;  2V1U A;  2R44 A;  3E46 A;  2CFO A;  4MGZ E;  1R6B X;  3IEC A;  1T3T A;  1C7Y A;  4JI7 M;  4JI8 M;  4NXM M;  4AQY M;  4LJ4 A;  2B3T A;  5E26 A;  3U6S A;  1NHW C;  3NBX X;  1V34 A;  2XGN A;  3FUU A;  4DV1 M;  4G6Z A;  2KW0 A;  2JZ0 A;  1IBL M;  4AI6 A;  3GLG B;  3VFD A;  2X8A A;  3AOE C;  3TL4 X;  2GNO A;  5EQT A;  2LVQ D;  4II7 A;  4DV5 M;  1OFI A;  5EXX A;  1LV7 A;  4WW0 A;  1JR3 D;  3AKZ A;  3TWM A;  3W67 A;  1DGH B;  4CIS A;  3QAU A;  1QQW A;  1ZQ9 A;  5JI3 E;  4QOZ C;  2DAK A;  2Y0T A;  1N33 M;  2L09 A;  3FRH A;  1AIP C;  3W68 A;  3GLI E;  1WGN A;  5DYG A;  4LFC M;  3PVS A;  1GO5 A;  5BPV A;  4B3R M;  3BOS A;  2E5L M;  3B89 A;  4MGK E;  3AFH A;  3AL0 C;  2Y0Q A;  3KSX A;  2LVA A;  4IBB A;  3SBJ A;  1L1T A;  1OIZ A;  4IBJ A;  4G4Q A;  2C98 A;  3GLF B;  3KW6 A;  3HX3 A;  2WZJ A;  3SAV A;  4KOD A;  2DAE A;  2LNH C;  1VQ1 A;  2K47 A;  3FE3 A;  4NC6 A;  4OVZ B;  4L16 A;  2QZ4 A;  4L8R C;  4I5S A;  3GPP A;  2DWZ B;  2DZL A;  3KXE C;  4FWD A;  1JR3 E;  2DAG A;  2VQE M;  5LMN M;  1ORY B;  5F3W A;  1VEG A;  3J7B A;  1QVR A;  4Z8X A;  3UMM A;  3B74 A;  3GQ4 A;  2LHC A;  1NV9 A;  3KOW E;  4MGI E;  3SYK A;  4MM3 B;  2Q2E B;  3PFI A;  4HEO A;  4LF8 M;  4LCB A;  1GJS A;  2DWL A;  1R4G A;  1ZMV A;  1NY5 A;  3HHX A;  2D7E A;  4D81 A;  4FCW A;  4LRS A;  1QAO A;  4MH0 E;  3HKP A;  2O01 F;  1WJ7 A;  1N75 A;  1QDT A;  2JXN A;  2X4A A;  3SYL A;  3U60 A;  1F4I A;  4NXN M;  2JNH A;  3DFZ A;  1NNU C;  3L25 A;  2CWB A;  3DA1 A;  4KT0 F;  2R45 A;  3KOY E;  1DGG A;  3A98 B;  1NHG C;  3K9O A;  4DR3 M;  3U6M A;  1I94 M;  2Z7J A;  3J7A S;  4DR6 M;  1PJS A;  2CP8 A;  3HJQ A;  3KDS E;  3GP1 A;  2XZU A;  2OO9 A;  3J2P B;  1IXZ A;  1QDR A;  3GO8 A;  5EXS A;  1C1K A;  1Z6T A;  2VII A;  1W5T A;  3MMP A;  2J5Y A;  2JA2 A;  4RNA A;  4F1I A;  2F5S A;  2HAK A;  3I4V A;  4NSO B;  4DR5 M;  1NO1 A;  1QUS A;  1Q02 A;  1G4A E;  4M0D A;  1D2N A;  4LRT A;  3SAS A;  4BBA A;  2KZS A;  2LHG A;  1VG5 A;  1WGL A;  1ZAE A;  3MJ5 A;  3GLI A;  4M9Z A;  1V33 A;  1VEJ A;  3E9S A;  5EXP A;  5C1B A;  4OU7 A;  4JXJ A;  3GLH E;  3L27 A;  2MRO B;  3FUX A;  4MGY E;  3VDU A;  4IBC A;  3FUV A;  2BJV A;  3CF0 A;  3PNY A;  1BVS A;  3HWS A;  1J5E M;  3KOX E;  1G41 A;  2WSC F;  4GEW A;  4S12 A;  3RFW A;  4GKJ M;  4AKG A;  4P17 A;  2RKO A;  3FRI A;  1N78 A;  2R18 A;  2DHY A;  4FD2 A;  3W0L B;  1GL6 A;  2OPF A;  2KNA A;  3U6E A;  4IBG A;  4M9S A;  3QYB A;  3E21 A;  5H37 D;  2YR0 A;  1SXJ B;  1XMO M;  1OAI A;  5FLX S;  5FTK A;  1WHC A;  2QSF X;  4K0K M;  2XFT A;  2R0I A;  5IWA M;  3J80 S;  5KPR A;  1TH4 A;  2K9D A;  1DO2 A;  1ZV1 A;  4IIW A;  2JZ1 A;  2KZU A;  3U5Z A;  2CEA A;  1NY6 A;  4GC5 A;  1DO0 A;  4LY6 A;  4AKH A;  3HU1 A;  4KLN A;  5IZ7 D;  2ZBK B;  2CRU A;  1L2D A;  2C96 A;  1H6U A;  2R62 A;  2WSE F;  3GPX A;  3HU2 A;  3IG8 A;  2HWJ A;  3ZH9 B;  1SXJ C;  3C3E A;  1PRB A;  3LCU A;  1A5T A;  3Q8X A;  4FWG A;  3VLF B;  4QNR A;  4GHA A;  3EIE A;  3GRV A;  5JI2 E;  2Z4S A;  3THG A;  4I4L A;  2QNJ A;  5ITU A;  4XBO A;  1Z5C A;  3VK7 A;  2CV1 A;  4JV5 M;  2ZAM A;  4PCZ A;  3L26 A;  4NSR A;  4IBI A;  1Q39 A;  3B9P A;  3GRY A;  7CAT A;  1MU5 A;  1L2C A;  4LG2 A;  2L6O A; 
#chains in the Genus database with same CATH homology
 2RGO A;  4B7F A;  3GQ3 A;  2Y21 A;  4PDG A;  1TDH A;  5FSW A;  4DV2 M;  3SAW A;  3FTC A;  4NOO B;  2KA6 B;  3T15 A;  1XWI A;  4JN6 A;  3HHY A;  3AJI B;  3LVV A;  1J7K A;  3I4Y A;  4LJ6 A;  3CTW B;  5EP2 A;  3U6O A;  2FE8 A;  3UZU A;  3A42 A;  4DUZ M;  1XNQ M;  4R3D A;  3FTF A;  2DZO B;  3EIH A;  3W0F A;  3U6D A;  3AV0 A;  3U6L A;  3SAR A;  1IN8 A;  4AZF A;  4GC9 A;  1KFV A;  2DWM A;  3GLH A;  2RGH A;  1IN4 A;  1NJF A;  2BJW A;  1E9S A;  2D7G A;  3AOE A;  2DXI A;  2J7N A;  2ZAO A;  3HHZ A;  3ILK A;  4DR4 M;  1N32 M;  4LGY A;  3U60 B;  3L2A A;  4RF0 A;  4BLC A;  4LF9 M;  3M6A A;  2UXC M;  3VKH A;  2QP9 X;  5BR8 M;  3VKG A;  2ZM6 M;  2I7N A;  1JQJ C;  4NL4 H;  4QNM A;  5FTJ A;  3U6C A;  4IBD A;  2V1C A;  5ITX A;  2C5R A;  4LJ5 A;  4IBE A;  3HGI A;  4G4O A;  1Q3B A;  2YFQ A;  1HT2 E;  1Q3C A;  5GKN A;  2CHQ A;  2XFS A;  2LWX A;  4Z6Y A;  1QYR A;  1XNR M;  2I7P A;  1DGH A;  1N34 M;  1IXR C;  2L7H A;  3J27 B;  5EP3 A;  4FCV A;  5KQD A;  5E6J A;  1R2Y A;  4JI4 M;  3JR4 A;  2VQF M;  3VK8 A;  3KSJ A;  4PT5 A;  3U61 B;  3GLI B;  1R2Z A;  3GLF A;  2Z4R A;  2LH0 A;  4TUW A;  4B08 A;  5KPT A;  3GQ5 A;  2FOI C;  3GRR A;  2R46 A;  4OVZ A;  4JYA M;  5A2Q S;  3FYD A;  4DR1 M;  3HU3 A;  3K1J A;  1G8P A;  1UM8 A;  4KHP M;  2F5N A;  3TQS A;  4LF6 M;  1IN5 A;  3K92 A;  4M9X A;  1J09 A;  4B3S M;  2XZF A;  2M5Z A;  4RF1 A;  3SHG B;  4JI6 M;  2UXB M;  4DUY M;  2XSZ D;  2QCU A;  3SC3 A;  4PD2 A;  4AG6 A;  3JR5 A;  4B7G A;  1TGU A;  3FD9 A;  1QZM A;  3TE6 A;  1IY0 A;  5ITR A;  3C58 A;  1IBK M;  3KP0 E;  3QWL A;  4GIP A;  4LF5 M;  4ZPX A;  4HL4 A;  5DNY A;  3MK6 A;  1TDZ A;  2QBY B;  1DGF A;  2C9O A;  1NNJ A;  4D82 A;  3MHV C;  2LXE A;  2R4E A;  4NRV A;  2KEB A;  1K3W A;  1I4W A;  1QAQ A;  4DV7 M;  5ITX E;  3RGP A;  2UUA M;  3JAM S;  3PNV A;  2EUC A;  1Z59 A;  2QPA A;  4LJ8 A;  4JI1 M;  4DV4 M;  3L29 A;  4CHT B;  4R7G A;  5ITQ A;  4I81 A;  2QEN A;  1OJL A;  4QOS A;  5ITT A;  3HJ8 A;  4LJA A;  3WHK A;  1NSF A;  4L4U A;  1IN6 A;  3KVW A;  2DZN B;  3RGS A;  3U6P A;  4GH9 A;  3KP1 E;  3FYC A;  3HHW A;  4LGM A;  2O5R A;  4AKI A;  4G4R A;  3NBI A;  4IJE A;  2HHH M;  4FVM A;  3E4R A;  2YNM D;  4HLQ A;  5EJC A;  2H1R A;  3FUT A;  2BNK A;  4X65 M;  1XMQ M;  2CUZ A;  3FTD A;  4MGH A;  3R9X B;  1OFH A;  4DV3 M;  2YQZ A;  8CAT A;  3GLH B;  1HT1 E;  5FTN A;  3CF2 A;  3A45 A;  2DHR A;  4LJ9 A;  1XHB A;  2CV0 A;  1E32 A;  2UUC M;  1SXJ A;  3OTO M;  4DV6 M;  1IQP A;  1XXH A;  3FUW A;  1Z5A A;  2FFJ A;  3SMS A;  3DOA A;  2NQ8 C;  1G59 A;  1R7R A;  3T38 A;  1VDD A;  3GPY A;  2X49 A;  2V6Z M;  3D8B A;  4M0W A;  4AW4 A;  3TWL A;  3RE8 A;  1IY2 A;  3WHL A;  4KO8 A;  1L1Z A;  4DR2 M;  4YY3 M;  3HJS A;  3SMP A;  2UU9 M;  2ERC A;  3UGJ A;  5DYI A;  4B3M M;  4GKK M;  5EXT A;  5KO3 A;  4OW0 A;  4AG5 A;  4X66 M;  3H4M A;  2UXD M;  5FTM A;  3UK6 A;  5KPZ A;  4XGI A;  3A46 A;  1HQY E;  2KRK A;  3I51 A;  2F5O A;  1FJG M;  3IG5 A;  3GLG A;  3M0E A;  1G3I A;  1KYI A;  3SHF A;  1HNW M;  1SXJ D;  5FTL A;  2G8L A;  1TH3 A;  2M60 A;  4WUR A;  1GKI A;  4DR7 M;  1TH2 A;  3SAU A;  2CHV A;  2HL7 A;  2XSZ A;  4OX9 M;  1YUB A;  2DWN A;  2XF3 A;  1PJI A;  2C9C A;  2DVW B;  4GMQ A;  1K82 A;  1N77 A;  4LF4 M;  3LQR A;  2G5G X;  4LZJ A;  4I8O A;  4P16 A;  4A3V B;  4ITQ A;  4JI2 M;  2XLJ A;  2R4J A;  3ZC7 B;  3FTE A;  1FNN A;  3GPU A;  4QHS A;  5EP1 A;  4CGY B;  4FCT A;  4LZZ A;  2HCB A;  3LQQ A;  2CHG A;  1PM5 A;  1GLN A;  2F4V M;  2FNA A;  3CF6 E;  5EP4 A;  1IM2 A;  3VDP A;  1S3S A;  3LVW A;  1SXJ E;  3NWL A;  2EO2 A;  2ZAN A;  3KS8 A;  4B3T M;  4GIT A;  3DZD A;  4JI3 M;  1IBM M;  5IT9 S;  3ZCB B;  4REZ A;  1WXQ A;  1HNX M;  4B7H A;  2AHM A;  1HNZ M;  4X62 M;  2F5Q A;  2KXE A;  3PXG A;  4GHL A;  3KFU G;  4G4N A;  2XH9 A;  2F5P A;  5IRE B;  1PJJ A;  2Y20 A;  4LJ7 A;  5ITY A;  1DGB A;  1W5S A;  3GRU A;  3KOZ E;  3U5Z B;  3K8Z A;  4W5W A;  3UJN A;  4MB7 A;  2J7O A;  3AOG A;  4DV0 M;  5KQ8 A;  2UUB M;  4D80 A;  2A5Y B;  4FWH A;  3FKE A;  2KRU A;  3J81 S;  1IY1 A;  1NVM A;  2L7I A;  4BB9 A;  3K2L A;  2OQ4 A;  3R8F A;  1E94 E;  1KSF X;  3U6Q A;  1K3X A;  1E9R A;  2P5T A;  2CE7 A;  3U61 A;  4X64 M;  4IBF A;  3TPZ A;  4JI5 M;  1QAN A;  4PDI A;  1EE8 A;  2Z3X A;  3M7G A;  1L2B A;  3SAT A;  4EIW A;  1MX0 A;  3KS4 A;  4L78 A;  1YE9 A;  4GRI A;  3L28 A;  4YHH M;  4IJF A;  1HR0 M;  4LFA M;  1L8Q A;  2W82 A;  4JI0 M;  2C99 A;  1NJG A;  1XXH B;  1Z5B A;  1YSY A;  2CV2 A;  3SFZ A;  1HQC A;  1JR3 A;  1IXS B;  2XEP A;  3T1Y M;  4QHT A;  2D7H A;  3TWK A;  1XC8 A;  1N36 M;  4LFB M;  4NRW A;  1QAM A;  3T1H M;  1IN7 A;  1GVN A;  4IBK A;  4L15 A;  2QBY A;  3D8L A;  4LF7 M;  2R65 A;  3LMM A;  2EA0 A;  4FW9 A;  2HKJ A;  1X37 A;  1GL7 A;  5C18 A;  5LMU M;  2V1U A;  2CFO A;  4MGZ E;  1R6B X;  4JI8 M;  1T3T A;  4JI7 M;  4NXM M;  4AQY M;  4LJ4 A;  5E26 A;  3U6S A;  1NHW C;  3FUU A;  2XGN A;  4DV1 M;  4G6Z A;  2KW0 A;  4AI6 A;  1IBL M;  3GLG B;  3VFD A;  2X8A A;  3AOE C;  3TL4 X;  5EQT A;  4II7 A;  4DV5 M;  1OFI A;  5EXX A;  1LV7 A;  4WW0 A;  1JR3 D;  3AKZ A;  3TWM A;  1DGH B;  4CIS A;  3QAU A;  1QQW A;  1ZQ9 A;  5JI3 E;  4QOZ C;  2Y0T A;  1N33 M;  2L09 A;  5DYG A;  4LFC M;  3PVS A;  5BPV A;  4B3R M;  3BOS A;  2E5L M;  4MGK E;  3AFH A;  3AL0 C;  2Y0Q A;  3KSX A;  4IBB A;  3SBJ A;  1L1T A;  4IBJ A;  4G4Q A;  2C98 A;  3GLF B;  3KW6 A;  3SAV A;  4KOD A;  2LNH C;  2K47 A;  4OVZ B;  4L16 A;  2QZ4 A;  4L8R C;  4I5S A;  3GPP A;  2DWZ B;  3KXE C;  4FWD A;  2VQE M;  5LMN M;  1ORY B;  5F3W A;  3J7B A;  1QVR A;  4Z8X A;  3UMM A;  3GQ4 A;  3KOW E;  4MGI E;  3SYK A;  4MM3 B;  2Q2E B;  3PFI A;  4LF8 M;  4LCB A;  2DWL A;  1NY5 A;  3HHX A;  2D7E A;  4D81 A;  4FCW A;  4LRS A;  1QAO A;  4MH0 E;  3HKP A;  1N75 A;  3SYL A;  3U60 A;  2X4A A;  4NXN M;  3DFZ A;  1NNU C;  3L25 A;  3DA1 A;  2R45 A;  3KOY E;  1DGG A;  3A98 B;  1NHG C;  4DR3 M;  3U6M A;  1I94 M;  2Z7J A;  3J7A S;  4DR6 M;  3HJQ A;  3KDS E;  3GP1 A;  2XZU A;  3J2P B;  1IXZ A;  3GO8 A;  5EXS A;  1C1K A;  1Z6T A;  2VII A;  1W5T A;  2JA2 A;  4RNA A;  2F5S A;  3I4V A;  4DR5 M;  4NSO B;  1G4A E;  4M0D A;  1D2N A;  4LRT A;  3SAS A;  4BBA A;  2KZS A;  1ZAE A;  3MJ5 A;  3GLI A;  4M9Z A;  3E9S A;  5EXP A;  5C1B A;  4OU7 A;  4JXJ A;  3L27 A;  3FUX A;  4MGY E;  3VDU A;  4IBC A;  3FUV A;  2BJV A;  3CF0 A;  3PNY A;  3HWS A;  1J5E M;  3KOX E;  1G41 A;  4S12 A;  3RFW A;  4GKJ M;  4AKG A;  2RKO A;  1N78 A;  2R18 A;  4FD2 A;  3W0L B;  2OPF A;  1GL6 A;  3U6E A;  4IBG A;  4M9S A;  5H37 D;  2YR0 A;  1SXJ B;  1XMO M;  5FLX S;  5FTK A;  4K0K M;  2XFT A;  5IWA M;  3J80 S;  5KPR A;  1TH4 A;  1DO2 A;  4IIW A;  2KZU A;  3U5Z A;  2CEA A;  1NY6 A;  4GC5 A;  1DO0 A;  4LY6 A;  4AKH A;  3HU1 A;  4KLN A;  5IZ7 D;  2ZBK B;  1L2D A;  2C96 A;  1H6U A;  2R62 A;  3GPX A;  3HU2 A;  3IG8 A;  3ZH9 B;  1SXJ C;  3Q8X A;  4FWG A;  3VLF B;  4QNR A;  4GHA A;  3EIE A;  3GRV A;  5JI2 E;  2Z4S A;  3THG A;  4I4L A;  5ITU A;  4XBO A;  1Z5C A;  3VK7 A;  2CV1 A;  4JV5 M;  2ZAM A;  4PCZ A;  3L26 A;  4NSR A;  4IBI A;  1Q39 A;  3B9P A;  3GRY A;  7CAT A;  1MU5 A;  1L2C A;  4LG2 A;  2L6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...