4NXUA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
327
Chain Sequence
b'RMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 327
sequence length 331
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxuA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxuA02
4OAIZ 4NXXA 4ATBA 4AT7B 4NXUA 4O68A 4K96A 4WOYA 4K8VA 4AT9B 4K98A 4O69A 4AT7A 4OAGA 4OAFA 4MKPA 4KM5A 4NXWA 4AT8B 4OAHA 4NXVA 4O6AA 4ATBB 4KB6A 4K99A 4JLXA 4AT9A 4LEYA 4LEZA 4NXTA 4LEVA 4JLZA 4K9BA 4K9AA 4LEWA 4AT8A 4O67A 4K97A
chains in the Genus database with same CATH superfamily
4MFAA 3WFSC 3EF2A 4FHPA 5CHEA 2DR7A 4NXUA 2EWRA 3MDAA 3AUOA 3CK6A 4EBKA 5CFUA 4QZGA 8ICGA 5DDMA 3OVAA 8ICIA 3UXPA 2I9GA 1YLQA 3JPOA 7ICTA 4P2HA 5J0TA 4RQ6A 1JN3A 4X0BA 3JPPA 4MF2A 4RPZA 4X4UA 4RQ7A 4NXTA 5HRHA 5J0WA 2B56A 4LEWA 4HX0A 2DR8A 3AQMA 8ICOA 1JQRA 3V7KA 5HC9A 8ICSA 4WC3A 5J2JA 2BE3A 4I2AA 4RWOA 4RT3A 1ZQTA 3MDCA 3RJJA 2HN1A 3ERCC 1Q78A 4PGQA 1ZQRA 3V7JA 4F5OA 5DBAA 4TUPA 4MKPA 1V4AA 2ZH2A 4UBBA 4I2JA 1ZJNA 4AT9A 3C5FA 9ICNA 4X4PA 4NM1A 2ZHBA 2FCLA 4N7RA 3K75D 4Z6DA 4FO6A 5J0UA 2IHOA 4UD5A 4F5PA 4QZBA 2M2UA 5CP2A 2ZH7A 4OAFA 3MGIA 1UEVA 4O6AA 4IQTA 7ICGA 4I2FA 4DOCA 4ATBB 3NVOA 4EBJA 4M0AA 4FHWA 2GA9D 5J2GA 5B3QA 5EOZA 4LEVA 3RJKA 1BPBA 9ICOA 5IINA 1ZQEA 2BCVA 5B3PA 4PGYA 2VANA 3ISBA 5D61A 3UXNA 8ICBA 4TUSA 4KLTA 4FO1A 3H39A 4PH5A 4EEBA 2DRBA 4I28A 3RH4A 4O5EA 7ICRA 4FHYA 5BOLA 4RQ4A 2FMPA 4XUSA 5CB1A 4NXZA 1JMSA 1R89A 3JPSA 4LEZA 5HRBA 4JLZA 4K9BA 3LQCB 4QZCA 4XQ7A 4RWPA 4PHDA 4K97A 2Q66A 1TV9A 9ICGA 9ICBA 3OVSA 5HHIA 5J0PA 1HUOA 5DBCA 2FMQA 3HIYA 2B51A 4NKTA 5J2FA 3ISCA 1TVAA 1BPYA 4WC0A 1MIVA 9ICPA 2BCQA 1RZTA 5J0OA 2ZH3A 4RQ1A 3PHZA 8ICEA 4JLXA 1ZQJA 1OU5A 4EP7A 4Z6CA 3RH6A 5J0RA 4LZGA 1TFWA 2PFOA 3UQ2A 4EEDA 1ZJMA 9ICCA 3K7DA 4WC4A 4QZ9A 8ICPA 4WH5A 5DB9A 1UETA 1XSPA 8ICRA 3NYBA 2DR9A 5CA7A 4AT8B 3RH5A 3MGHA 5HRKA 5J2CA 4PHEA 9ICWA 3WFQE 4K4GA 2ID1A 8ICMA 1ZQVA 3MCRA 5J0SA 8ICAA 4YMOA 4RT2A 1ZQCA 4IQWA 3OGUA 3JPQA 2PFNA 1PX5A 3JCFA 7ICVA 4KLGA 7ICHA 8ICQA 5DDYA 9ICTA 9ICQA 4K8VA 3V72A 3HJ1A 4K98A 8ICLA 1ZQAA 5J2KA 4NXWA 7ICEA 4NXVA 8ICKA 3JPRA 9ICUA 4M5DA 3HX0A 1KDHA 9ICEA 3ER8C 5DECA 5IILA 2BBHA 3OUYB 1TFYA 8ICFA 4I2GA 3OV7A 2NRKA 3PMLA 4AT7B 4WC1A 7ICFA 4JWNA 4DOAA 3WFPA 5J2EA 4WOYA 7ICUA 7ICPA 2PXIA 1ZQMA 7ICKA 4F5NA 5J2IA 4I2DA 3C2KA 4IQVA 8ICNA 4KM5A 5CHGA 4X4TA 4I2EA 3NWIA 1ZQFA 1ZQSA 5J2DA 5JTGA 5J0QA 1R8BA 4XJEA 5J2BA 4UB3A 4M04A 4M9GA 4YMMA 1VFGA 4GXIA 5D4BA 4KLDA 4DOBA 4E80A 2HN2A 4S3NA 2ZH9A 5HRGA 4TUQA 4KLEA 3C2LA 3UQ0A 4OAGA 4X4NA 1NOMA 5BOMA 4O5CA 4PPXA 4IQUA 2ISOA 1ZQIA 4X4VA 1F5AA 4UAZA 2GAFD 3H37A 3C2MA 3RJIA 4NY8A 4O9MA 5IIIA 4MFCA 4RWNA 3L9DA 3JPNA 8ICJA 9ICVA 2W9MA 4LZDA 4LVSA 3HWTA 4QZDA 4KLHA 9ICAA 4X4SA 4WC2A 3NKUA 7ICLA 8ICWA 4GXKA 2HHPA 3RJFA 5DB8A 2M2VA 5HRFA 5D49A 4YCXA 1Q79A 4P4MA 4AT9B 2B4VA 4P4OA 3LK9A 1KNYA 4KLLA 4I2BA 5HRDA 2O5AA 4KLSA 4X4QA 4UB1A 9ICKA 9ICXA 4QZEA 4FHXA 5CFSA 4QZ8A 4UAWA 2DRAA 4MF8A 7ICIA 5DBBA 4P4PA 3JPTA 3HW8A 5J2HA 4NM2A 3AQLA 3UPSA 4RQ3A 5D63A 1BPZA 4KLFA 4UBCA 1ZQDA 4I29A 4DO9A 4KLIA 5IIJA 4KLMA 4UD4A 5J2AA 9ICLA 4I2HA 2BCSA 3AQKA 4O69A 3JYYA 4M9HA 4XQ8A 5CWRA 4WBZA 1VJ7A 3RJEA 1ZQZA 4QZFA 4EV6A 4PHPA 4M9LA 4F5RA 3TFRA 4ATBA 4O67A 5D62A 4OAIZ 8ICYA 5J0YA 4QZIA 4WQKA 2M2WA 5CR0A 3WFRE 7ICNA 2FMSA 3B0XA 4GXJA 4M47A 2M2TA 4M9NA 2BBJA 4QZHA 4X4OA 5D46A 4WC7A 4NLZA 8ICXA 1ZQHA 9ICIA 2GWSA 4YMNA 5BPCA 3AQNA 3JZ0A 2ISPA 4K9AA 4RQ2A 2BCRA 4XRHA 3RJHA 1ZQOA 7ICOA 4UB5A 5HR9A 4NXXA 5F2VO 5IIMA 8ICVA 4NLNA 3RJGA 3UXOA 3UPQA 1HUZA 4JWMA 4K96A 4E7XA 4YN4A 2BCUA 3V7LA 9ICFA 2ZHAA 1NO5A 1FA0A 4FH3A 4KLOA 4F5QA 5HHHA 4EGWA 4OAHA 1ZQQA 2PFPA 4PHAA 4KB6A 4IG8A 4RQ8A 3ER9B 4PGXA 3OVBA 4YD2A 3AU6A 4E8FA 3MBYA 4RQ5A 1ZQBA 3PMNA 1MIWA 4WC6A 8ICZA 3AU2A 4O68A 1XSLA 4LT6A 3H3AA 4XA5A 4R66A 4YD1A 5TZVA 9ICJA 2BPCA 1ZQLA 4KLUA 4R65A 5J0XA 2ZH1A 3H38A 4RPYA 4UAYA 1RPLA 3C5GA 2ZH6A 3ISDA 1R8AA 2P66A 1MQ3A 3WFOA 4LEYA 4UB4A 1R8CA 8ICCA 1BPXA 4I27A 4Z6FA 1UEUA 3C18A 4WQLA 4AT8A 4R63A 8ICHA 2ZH5A 3GDXA 9ICSA 4KLJA 4QZAA 2IHMA 1WOTA 4X5VA 3TFSA 4K4IA 1MQ2A 4R64A 3C66A 2BPFA 4RWQA 8ICUA 4FH5A 4MFFA 2DVIA 1KEJA 4WC5A 9ICMA 5HRIA 4I2CA 1ZQXA 4WBYA 1XSNA 1GPJA 1ZQYA 7ICJA 1ZQUA 5HREA 4NLKA 5CFTA 1BPEA 4K99A 3PNCA 5DKWA 5DEDA 7ICQA 9ICHA 4NKUA 4M9JA 3HJ4A 4UB2A 3OWGA 4X4RA 8ICTA 4X0AA 9ICRA 1ZQNA 1ZQWA 2DR5A 2PFQA 4Z6EA 5DB6A 3OUYA 7ICSA 2ZH4A 4I2IA 2IUBA 4I0UA 2ZH8A 4O5KA 5CJ7A 4AT7A 5IIOA 5HRLA 1MIYA 1JAJA 2O1PA 4FHVA 4M2YA 4WCWA 5J29A 3B0YA 4TURA 1ZQPA 4RQ0A 4KLQA 5DB7A 2BPGA 1BPDA 1ZQGA 5IIKA 7ICMA 2RFFA 4K4HA 1ZQKA 2PBEA 4RPXA
chains in the Genus database with same CATH topology
2Q66A 3EF2A 4FHPA 5CHEA 4NXXA 2DR7A 3OVSA 4E80A 4NXUA 2ZH9A 2EWRA 3HIYA 2B51A 4E7XA 4K96A 4NKTA 5CFUA 3OVAA 2ZHAA 1FA0A 4FH3A 4OAGA 4X4NA 4OAHA 4X4VA 1F5AA 2GAFD 4KB6A 2ZH3A 3PHZA 4X4UA 4JLXA 3ER9B 4NXTA 3OVBA 4EP7A 2B56A 4LEWA 4E8FA 4HX0A 2DR8A 4X4SA 1TFWA 3NKUA 2HHPA 3K7DA 4O68A 4WH5A 4LT6A 1UETA 3ERCC 1Q78A 1Q79A 3NYBA 4AT9B 2B4VA 2DR9A 4MKPA 2ZH2A 4AT8B 2ZH1A 4X4QA 2ZH6A 1R8AA 4FHXA 5CFSA 4AT9A 4LEYA 1R8CA 2DRAA 1UEUA 3MCRA 4WQLA 4X4PA 4AT8A 2ZHBA 2FCLA 4N7RA 2ZH5A 5D63A 3C66A 2IHOA 4UD4A 4UD5A 4FH5A 2DVIA 4K8VA 3HJ1A 4K98A 4O69A 2ZH7A 4OAFA 4NXWA 1GPJA 4NXVA 1UEVA 4O6AA 5CFTA 4ATBB 4M5DA 4K99A 3ER8C 4FHWA 2GA9D 5B3QA 4NKUA 4LEVA 3HJ4A 3OUYB 3OWGA 4X4RA 1TFYA 4ATBA 4O67A 5D62A 4OAIZ 3OV7A 5B3PA 2DR5A 4WQKA 4AT7B 5D61A 3OUYA 2ZH4A 4WOYA 4FO1A 2DRBA 2ZH8A 4X4OA 4AT7A 4FHYA 2O1PA 4FHVA 4KM5A 4X4TA 1R89A 4LEZA 1R8BA 4XJEA 4JLZA 4K9BA 4K9AA 4K97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAI Z;  4NXX A;  4ATB A;  4AT7 B;  4NXU A;  4O68 A;  4K96 A;  4WOY A;  4K8V A;  4AT9 B;  4K98 A;  4O69 A;  4AT7 A;  4OAG A;  4OAF A;  4MKP A;  4KM5 A;  4NXW A;  4AT8 B;  4OAH A;  4NXV A;  4O6A A;  4ATB B;  4KB6 A;  4K99 A;  4JLX A;  4AT9 A;  4LEY A;  4LEZ A;  4NXT A;  4LEV A;  4JLZ A;  4K9B A;  4K9A A;  4LEW A;  4AT8 A;  4O67 A;  4K97 A; 
#chains in the Genus database with same CATH topology
 4MFA A;  3WFS C;  3EF2 A;  4FHP A;  5CHE A;  2DR7 A;  4NXU A;  2EWR A;  3MDA A;  3AUO A;  3CK6 A;  4EBK A;  5CFU A;  4QZG A;  8ICG A;  5DDM A;  3OVA A;  8ICI A;  3UXP A;  2I9G A;  1YLQ A;  3JPO A;  7ICT A;  4P2H A;  5J0T A;  4RQ6 A;  1JN3 A;  4X0B A;  3JPP A;  4MF2 A;  4RPZ A;  4X4U A;  4RQ7 A;  4NXT A;  5HRH A;  5J0W A;  2B56 A;  4LEW A;  4HX0 A;  2DR8 A;  3AQM A;  8ICO A;  1JQR A;  3V7K A;  5HC9 A;  8ICS A;  4WC3 A;  5J2J A;  2BE3 A;  4I2A A;  4RWO A;  4RT3 A;  1ZQT A;  3MDC A;  3RJJ A;  2HN1 A;  3ERC C;  1Q78 A;  4PGQ A;  1ZQR A;  3V7J A;  4F5O A;  5DBA A;  4TUP A;  4MKP A;  1V4A A;  2ZH2 A;  4UBB A;  4I2J A;  1ZJN A;  4AT9 A;  3C5F A;  9ICN A;  4X4P A;  4NM1 A;  2ZHB A;  2FCL A;  4N7R A;  3K75 D;  4Z6D A;  4FO6 A;  5J0U A;  2IHO A;  4UD5 A;  4F5P A;  4QZB A;  2M2U A;  5CP2 A;  2ZH7 A;  4OAF A;  3MGI A;  1UEV A;  4O6A A;  4IQT A;  7ICG A;  4I2F A;  4DOC A;  4ATB B;  3NVO A;  4EBJ A;  4M0A A;  4FHW A;  2GA9 D;  5J2G A;  5B3Q A;  5EOZ A;  4LEV A;  3RJK A;  1BPB A;  9ICO A;  5IIN A;  1ZQE A;  2BCV A;  5B3P A;  4PGY A;  2VAN A;  3ISB A;  5D61 A;  3UXN A;  8ICB A;  4TUS A;  4KLT A;  4FO1 A;  3H39 A;  4PH5 A;  4EEB A;  2DRB A;  4I28 A;  3RH4 A;  4O5E A;  7ICR A;  4FHY A;  5BOL A;  4RQ4 A;  2FMP A;  4XUS A;  5CB1 A;  4NXZ A;  1JMS A;  1R89 A;  3JPS A;  4LEZ A;  5HRB A;  4JLZ A;  4K9B A;  3LQC B;  4QZC A;  4XQ7 A;  4RWP A;  4PHD A;  4K97 A;  2Q66 A;  1TV9 A;  9ICG A;  9ICB A;  3OVS A;  5HHI A;  5J0P A;  1HUO A;  5DBC A;  2FMQ A;  3HIY A;  2B51 A;  4NKT A;  5J2F A;  3ISC A;  1TVA A;  1BPY A;  4WC0 A;  1MIV A;  9ICP A;  2BCQ A;  1RZT A;  5J0O A;  2ZH3 A;  4RQ1 A;  3PHZ A;  8ICE A;  4JLX A;  1ZQJ A;  1OU5 A;  4EP7 A;  4Z6C A;  3RH6 A;  5J0R A;  4LZG A;  1TFW A;  2PFO A;  3UQ2 A;  4EED A;  1ZJM A;  9ICC A;  3K7D A;  4WC4 A;  4QZ9 A;  8ICP A;  4WH5 A;  5DB9 A;  1UET A;  1XSP A;  8ICR A;  3NYB A;  2DR9 A;  5CA7 A;  4AT8 B;  3RH5 A;  3MGH A;  5HRK A;  5J2C A;  4PHE A;  9ICW A;  3WFQ E;  4K4G A;  2ID1 A;  8ICM A;  1ZQV A;  3MCR A;  5J0S A;  8ICA A;  4YMO A;  4RT2 A;  1ZQC A;  4IQW A;  3OGU A;  3JPQ A;  2PFN A;  1PX5 A;  3JCF A;  7ICV A;  4KLG A;  7ICH A;  8ICQ A;  5DDY A;  9ICT A;  9ICQ A;  4K8V A;  3V72 A;  3HJ1 A;  4K98 A;  8ICL A;  1ZQA A;  5J2K A;  4NXW A;  7ICE A;  4NXV A;  8ICK A;  3JPR A;  9ICU A;  4M5D A;  3HX0 A;  1KDH A;  9ICE A;  3ER8 C;  5DEC A;  5IIL A;  2BBH A;  3OUY B;  1TFY A;  8ICF A;  4I2G A;  3OV7 A;  2NRK A;  3PML A;  4AT7 B;  4WC1 A;  7ICF A;  4JWN A;  4DOA A;  3WFP A;  5J2E A;  4WOY A;  7ICU A;  7ICP A;  2PXI A;  1ZQM A;  7ICK A;  4F5N A;  5J2I A;  4I2D A;  3C2K A;  4IQV A;  8ICN A;  4KM5 A;  5CHG A;  4X4T A;  4I2E A;  3NWI A;  1ZQF A;  1ZQS A;  5J2D A;  5JTG A;  5J0Q A;  1R8B A;  4XJE A;  5J2B A;  4UB3 A;  4M04 A;  4M9G A;  4YMM A;  1VFG A;  4GXI A;  5D4B A;  4KLD A;  4DOB A;  4E80 A;  2HN2 A;  4S3N A;  2ZH9 A;  5HRG A;  4TUQ A;  4KLE A;  3C2L A;  3UQ0 A;  4OAG A;  4X4N A;  1NOM A;  5BOM A;  4O5C A;  4PPX A;  4IQU A;  2ISO A;  1ZQI A;  4X4V A;  1F5A A;  4UAZ A;  2GAF D;  3H37 A;  3C2M A;  3RJI A;  4NY8 A;  4O9M A;  5III A;  4MFC A;  4RWN A;  3L9D A;  3JPN A;  8ICJ A;  9ICV A;  2W9M A;  4LZD A;  4LVS A;  3HWT A;  4QZD A;  4KLH A;  9ICA A;  4X4S A;  4WC2 A;  3NKU A;  7ICL A;  8ICW A;  4GXK A;  2HHP A;  3RJF A;  5DB8 A;  2M2V A;  5HRF A;  5D49 A;  4YCX A;  1Q79 A;  4P4M A;  4AT9 B;  2B4V A;  4P4O A;  3LK9 A;  1KNY A;  4KLL A;  4I2B A;  5HRD A;  2O5A A;  4KLS A;  4X4Q A;  4UB1 A;  9ICK A;  9ICX A;  4QZE A;  4FHX A;  5CFS A;  4QZ8 A;  4UAW A;  2DRA A;  4MF8 A;  7ICI A;  5DBB A;  4P4P A;  3JPT A;  3HW8 A;  5J2H A;  4NM2 A;  3AQL A;  3UPS A;  4RQ3 A;  5D63 A;  1BPZ A;  4KLF A;  4UBC A;  1ZQD A;  4I29 A;  4DO9 A;  4KLI A;  5IIJ A;  4KLM A;  4UD4 A;  5J2A A;  9ICL A;  4I2H A;  2BCS A;  3AQK A;  4O69 A;  3JYY A;  4M9H A;  4XQ8 A;  5CWR A;  4WBZ A;  1VJ7 A;  3RJE A;  1ZQZ A;  4QZF A;  4EV6 A;  4PHP A;  4M9L A;  4F5R A;  3TFR A;  4ATB A;  4O67 A;  5D62 A;  4OAI Z;  8ICY A;  5J0Y A;  4QZI A;  4WQK A;  2M2W A;  5CR0 A;  3WFR E;  7ICN A;  2FMS A;  3B0X A;  4GXJ A;  4M47 A;  2M2T A;  4M9N A;  2BBJ A;  4QZH A;  4X4O A;  5D46 A;  4WC7 A;  4NLZ A;  8ICX A;  1ZQH A;  9ICI A;  2GWS A;  4YMN A;  5BPC A;  3AQN A;  3JZ0 A;  2ISP A;  4K9A A;  4RQ2 A;  2BCR A;  4XRH A;  3RJH A;  1ZQO A;  7ICO A;  4UB5 A;  5HR9 A;  4NXX A;  5F2V O;  5IIM A;  8ICV A;  4NLN A;  3RJG A;  3UXO A;  3UPQ A;  1HUZ A;  4JWM A;  4K96 A;  4E7X A;  4YN4 A;  2BCU A;  3V7L A;  9ICF A;  2ZHA A;  1NO5 A;  1FA0 A;  4FH3 A;  4KLO A;  4F5Q A;  5HHH A;  4EGW A;  4OAH A;  1ZQQ A;  2PFP A;  4PHA A;  4KB6 A;  4IG8 A;  4RQ8 A;  3ER9 B;  4PGX A;  3OVB A;  4YD2 A;  3AU6 A;  4E8F A;  3MBY A;  4RQ5 A;  1ZQB A;  3PMN A;  1MIW A;  4WC6 A;  8ICZ A;  3AU2 A;  4O68 A;  1XSL A;  4LT6 A;  3H3A A;  4XA5 A;  4R66 A;  4YD1 A;  5TZV A;  9ICJ A;  2BPC A;  1ZQL A;  4KLU A;  4R65 A;  5J0X A;  2ZH1 A;  3H38 A;  4RPY A;  4UAY A;  1RPL A;  3C5G A;  2ZH6 A;  3ISD A;  1R8A A;  2P66 A;  1MQ3 A;  3WFO A;  4LEY A;  4UB4 A;  1R8C A;  8ICC A;  1BPX A;  4I27 A;  4Z6F A;  1UEU A;  3C18 A;  4WQL A;  4AT8 A;  4R63 A;  8ICH A;  2ZH5 A;  3GDX A;  9ICS A;  4KLJ A;  4QZA A;  2IHM A;  1WOT A;  4X5V A;  3TFS A;  4K4I A;  1MQ2 A;  4R64 A;  3C66 A;  2BPF A;  4RWQ A;  8ICU A;  4FH5 A;  4MFF A;  2DVI A;  1KEJ A;  4WC5 A;  9ICM A;  5HRI A;  4I2C A;  1ZQX A;  4WBY A;  1XSN A;  1GPJ A;  1ZQY A;  7ICJ A;  1ZQU A;  5HRE A;  4NLK A;  5CFT A;  1BPE A;  4K99 A;  3PNC A;  5DKW A;  5DED A;  7ICQ A;  9ICH A;  4NKU A;  4M9J A;  3HJ4 A;  4UB2 A;  3OWG A;  4X4R A;  8ICT A;  4X0A A;  9ICR A;  1ZQN A;  1ZQW A;  2DR5 A;  2PFQ A;  4Z6E A;  5DB6 A;  3OUY A;  7ICS A;  2ZH4 A;  4I2I A;  2IUB A;  4I0U A;  2ZH8 A;  4O5K A;  5CJ7 A;  4AT7 A;  5IIO A;  5HRL A;  1MIY A;  1JAJ A;  2O1P A;  4FHV A;  4M2Y A;  4WCW A;  5J29 A;  3B0Y A;  4TUR A;  1ZQP A;  4RQ0 A;  4KLQ A;  5DB7 A;  2BPG A;  1BPD A;  1ZQG A;  5IIK A;  7ICM A;  2RFF A;  4K4H A;  1ZQK A;  2PBE A;  4RPX A; 
#chains in the Genus database with same CATH homology
 2Q66 A;  3EF2 A;  4FHP A;  5CHE A;  4NXX A;  2DR7 A;  3OVS A;  4E80 A;  4NXU A;  2ZH9 A;  2EWR A;  3HIY A;  2B51 A;  4E7X A;  4K96 A;  4NKT A;  5CFU A;  3OVA A;  2ZHA A;  1FA0 A;  4FH3 A;  4OAG A;  4X4N A;  4OAH A;  4X4V A;  1F5A A;  2GAF D;  4KB6 A;  2ZH3 A;  3PHZ A;  4X4U A;  4JLX A;  3ER9 B;  4NXT A;  3OVB A;  4EP7 A;  2B56 A;  4LEW A;  4E8F A;  4HX0 A;  2DR8 A;  4X4S A;  1TFW A;  3NKU A;  2HHP A;  3K7D A;  4O68 A;  4WH5 A;  4LT6 A;  1UET A;  3ERC C;  1Q78 A;  1Q79 A;  3NYB A;  4AT9 B;  2B4V A;  2DR9 A;  4MKP A;  2ZH2 A;  4AT8 B;  2ZH1 A;  4X4Q A;  2ZH6 A;  1R8A A;  4FHX A;  5CFS A;  4AT9 A;  4LEY A;  1R8C A;  2DRA A;  1UEU A;  3MCR A;  4WQL A;  4X4P A;  4AT8 A;  2ZHB A;  2FCL A;  4N7R A;  2ZH5 A;  5D63 A;  3C66 A;  2IHO A;  4UD4 A;  4UD5 A;  4FH5 A;  2DVI A;  4K8V A;  3HJ1 A;  4K98 A;  4O69 A;  2ZH7 A;  4OAF A;  4NXW A;  1GPJ A;  4NXV A;  1UEV A;  4O6A A;  5CFT A;  4ATB B;  4M5D A;  4K99 A;  3ER8 C;  4FHW A;  2GA9 D;  5B3Q A;  4NKU A;  4LEV A;  3HJ4 A;  3OUY B;  3OWG A;  4X4R A;  1TFY A;  4ATB A;  4O67 A;  5D62 A;  4OAI Z;  3OV7 A;  5B3P A;  2DR5 A;  4WQK A;  4AT7 B;  5D61 A;  3OUY A;  2ZH4 A;  4WOY A;  4FO1 A;  2DRB A;  2ZH8 A;  4X4O A;  4AT7 A;  4FHY A;  2O1P A;  4FHV A;  4KM5 A;  4X4T A;  1R89 A;  4LEZ A;  1R8B A;  4XJE A;  4JLZ A;  4K9B A;  4K9A A;  4K97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...