4NXUA

Crystal structure of the cytosolic domain of human mid51
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
331
structure length
327
Chain Sequence
RMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 327
sequence length 331
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxuA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxuA02
4NXWA 4K96A 4K9AA 4O68A 4LEWA 4K98A 4OAIZ 4NXVA 4AT9B 4O6AA 4AT8B 4KB6A 4NXXA 4NXUA 4MKPA 4ATBA 4LEVA 4K99A 4JLXA 4JLZA 4O67A 4AT9A 4OAFA 4AT8A 4LEYA 4K97A 4ATBB 4O69A 4AT7B 4K8VA 4K9BA 4KM5A 4OAHA 4WOYA 4LEZA 4OAGA 4NXTA 4AT7A
chains in the Genus database with same CATH superfamily
5J2AA 7ICHA 4RWNA 4PHEA 4UB4A 5J2IA 4DOCA 3WFRE 3C18A 4GXKA 4Z6DA 4DOBA 5DB9A 1HUZA 4AT9B 4WCWA 9ICIA 4XJEA 8ICZA 4I2CA 9ICVA 4K99A 1MIYA 4X4QA 4XA5A 1NO5A 4KLFA 2DR5A 4JWMA 4K9BA 3JCFA 4XUSA 5J0OA 8ICCA 9ICQA 5IINA 1RZTA 4KLGA 4QZ9A 4KLMA 4X4UA 1OU5A 9ICLA 1R8CA 4R65A 8ICUA 7ICGA 4X4NA 4E80A 5J0XA 9ICPA 4PGQA 2DRAA 2PFNA 4LEVA 5DBCA 5B3QA 4NM2A 3JPPA 3UPSA 4S3NA 7ICQA 4WC0A 3OWGA 4FO6A 4XRHA 8ICJA 5BOMA 1PX5A 2BCQA 8ICNA 3ER9B 1Q78A 4KLDA 4UD4A 3H37A 3RH5A 7ICEA 2B56A 2BCRA 4NXTA 1R8BA 3UXNA 4UB5A 5J2GA 4LEWA 4EEDA 1MQ3A 1ZQKA 3OUYA 4OAIZ 4UBCA 1XSNA 5HREA 4FO1A 5DB6A 1ZQMA 1KEJA 4F5QA 2GAFD 5HHHA 1XSPA 2DVIA 1ZQXA 1MIWA 4NKUA 3HW8A 2ZH5A 5J2JA 7ICJA 1ZQAA 4RQ0A 3NKUA 1ZQDA 4AT7A 1F5AA 4YMOA 1TVAA 4I2EA 4KLTA 5DECA 5CFSA 4UAZA 3C2LA 2M2TA 4YD1A 5J2DA 3CK6A 3GDXA 4JLXA 4UAYA 3AQLA 8ICWA 3C66A 4AT8A 4NLNA 4I2JA 4M47A 2RFFA 4RQ3A 4UB3A 4PGXA 5J2HA 4WQKA 5CP2A 5J29A 4PHDA 5J2EA 4X5VA 1ZQZA 4ATBA 2BPCA 5J0UA 4KLJA 4X4RA 4P4MA 5HRDA 4M9NA 5J0YA 1JN3A 1ZQQA 5DDYA 4MF2A 4IQWA 4I2IA 1UETA 1YLQA 1ZJNA 5D4BA 4FHVA 2ZH2A 5IIOA 2BBHA 5B3PA 1NOMA 1BPDA 1RPLA 9ICUA 5HR9A 4OAGA 3HIYA 4KLIA 3OUYB 3WFOA 4K4HA 2IHOA 4M9GA 4RPZA 5DBBA 3MDCA 2FMSA 8ICRA 4WC5A 2DR8A 4I28A 1FA0A 4NXXA 4YMNA 2M2WA 4NXUA 4R63A 2O5AA 3RJEA 3HX0A 1ZQTA 4RWOA 4KLLA 4KLEA 5HRFA 4AT7B 4QZHA 2ISOA 4OAHA 2HN1A 1VJ7A 3RJIA 2PXIA 5J0TA 3JPRA 3EF2A 4RQ1A 2M2UA 4QZIA 2HN2A 8ICBA 5J2FA 4X0BA 4QZFA 1GPJA 3RH4A 3PMLA 4M9JA 5CJ7A 5CWRA 4O6AA 4AT8B 1XSLA 8ICHA 2ZH3A 1ZQJA 1VFGA 3V7JA 4P4OA 5TZVA 4FHPA 5CFUA 4F5PA 5J0RA 4WQLA 2BPGA 4ATBB 1HUOA 1ZQGA 2BE3A 2ZH8A 5HRKA 3AU6A 5HRIA 4FHYA 3L9DA 1UEUA 3ISCA 3C5FA 3AQKA 3JPQA 3LQCB 7ICNA 4KLQA 7ICUA 8ICVA 4Z6CA 4KLUA 4NXWA 5IIJA 4WBZA 9ICGA 3JPNA 2I9GA 8ICPA 4UAWA 2EWRA 3UQ2A 4MFFA 3TFSA 2IHMA 2ZH6A 4I27A 4NM1A 4NKTA 4MF8A 3UXPA 4O5EA 4NLKA 2B51A 4WC3A 7ICIA 1ZQOA 4X4PA 2W9MA 9ICXA 3C2KA 1KDHA 2BCSA 9ICBA 5J0WA 1V4AA 4FHXA 2FMPA 3RJJA 4TUPA 4KB6A 1ZQBA 4M2YA 8ICYA 4O9MA 5J0PA 2PFOA 7ICOA 4E7XA 3RJKA 4M9HA 4FH3A 4X4TA 1R89A 1BPXA 1ZQPA 3AUOA 4QZGA 4PHPA 1R8AA 4MFAA 9ICSA 4RPXA 4K97A 5F2VO 3LK9A 4KM5A 9ICMA 5HRLA 2NRKA 4YN4A 4DO9A 1Q79A 5D63A 8ICLA 4WC7A 8ICSA 4IG8A 1KNYA 3NWIA 3RJFA 9ICTA 4RQ6A 4LT6A 4EP7A 5CHEA 3UPQA 2BCUA 4I0UA 4X4VA 3PMNA 1ZQVA 1UEVA 3AQNA 4RT3A 2BBJA 2DR9A 3ISBA 3RJGA 4O67A 7ICPA 3V7KA 1ZQRA 5DKWA 1ZQFA 2FCLA 3V72A 1MIVA 4F5OA 3OVSA 4I2AA 4PH5A 8ICAA 4WOYA 4LEZA 1WOTA 3MCRA 4TURA 4R64A 4M0AA 4F5RA 4LZDA 4IQVA 3ISDA 4F5NA 7ICRA 2ID1A 4RWQA 5DB7A 5IIKA 4K98A 3K75D 1TFYA 4NXZA 5J0QA 3MGHA 5D62A 4NLZA 1MQ2A 7ICVA 4WC1A 3HJ4A 5BPCA 4WH5A 4X4SA 4NY8A 3JYYA 4MKPA 4XQ8A 2FMQA 2O1PA 5HC9A 9ICAA 1JQRA 4O5KA 3MDAA 4QZDA 4DOAA 1ZQHA 4RQ7A 9ICJA 3JPTA 2GWSA 2B4VA 2ZHBA 2HHPA 3HWTA 4PPXA 4YCXA 4FHWA 3RJHA 7ICKA 4YD2A 4QZCA 4M04A 8ICOA 4QZAA 9ICOA 4UB2A 5CHGA 4TUQA 4XQ7A 4I2BA 1BPZA 1ZQSA 9ICCA 1ZQEA 8ICIA 2ZH7A 1ZQUA 5IIIA 4IQTA 3H38A 1ZQCA 5BOLA 4I2DA 2ISPA 4KLHA 5J2KA 8ICQA 5IILA 4JLZA 3WFQE 4WC2A 1BPBA 4JWNA 4O69A 3WFPA 4EEBA 7ICFA 7ICTA 7ICLA 3ERCC 4PHAA 5JTGA 4RQ2A 9ICNA 4QZEA 4I2GA 4EGWA 5CFTA 4O68A 4QZ8A 5D49A 5HRHA 1JAJA 5J0SA 4N7RA 1TFWA 4I2FA 7ICSA 4UBBA 2M2VA 3OVAA 3C5GA 5CB1A 4Z6EA 3HJ1A 8ICKA 3OV7A 4OAFA 5HRGA 4MFCA 4LEYA 3JPSA 8ICMA 4K4GA 4UD5A 5DDMA 4UB1A 4E8FA 4EBKA 5J2CA 1BPEA 4R66A 3C2MA 4RQ4A 2BPFA 4RPYA 4P2HA 4IQUA 4RWPA 7ICMA 2P66A 2PFQA 9ICKA 4X0AA 3OVBA 1JMSA 3B0YA 4NXVA 9ICFA 1ZQIA 3V7LA 9ICRA 1ZQYA 4QZBA 2PFPA 4RQ8A 5HRBA 4AT9A 5D61A 4I29A 5J2BA 4EBJA 4KLOA 4LZGA 3MBYA 3RH6A 9ICWA 2ZH4A 4PGYA 8ICGA 5DB8A 5DBAA 3UQ0A 3AU2A 1TV9A 3B0XA 8ICXA 9ICHA 4YMMA 5IIMA 3JPOA 3JZ0A 4RT2A 2BCVA 4HX0A 4Z6FA 4K9AA 1BPYA 3PNCA 2IUBA 5CA7A 4WC4A 4K4IA 3NYBA 2ZHAA 2Q66A 2PBEA 4GXIA 3K7DA 4P4PA 9ICEA 2DR7A 4K8VA 4GXJA 4X4OA 3OGUA 5D46A 2VANA 3H39A 4LVSA 8ICTA 4WBYA 1ZQLA 4K96A 1ZJMA 4EV6A 3AQMA 2GA9D 3H3AA 4FH5A 2ZH1A 2ZH9A 3MGIA 4O5CA 5EOZA 3UXOA 4M5DA 2DRBA 3ER8C 4TUSA 3PHZA 4WC6A 4KLSA 4RQ5A 5HHIA 8ICEA 3NVOA 1ZQWA 4I2HA 1ZQNA 8ICFA 5DEDA 4M9LA 3WFSC 5CR0A 3TFRA
chains in the Genus database with same CATH topology
5CFTA 4X4RA 4O68A 4N7RA 1TFWA 4FHXA 4AT9B 4KB6A 4XJEA 1UETA 3OVAA 4FHVA 4E7XA 4K99A 3HJ1A 2ZH2A 3OV7A 4FH3A 4OAFA 4X4TA 1R89A 4X4QA 4LEYA 1R8AA 5B3PA 4K97A 2DR5A 4UD5A 4K9BA 4KM5A 4OAGA 3HIYA 4E8FA 3OUYB 4X4UA 1Q79A 2IHOA 5D63A 3OVBA 1R8CA 4LT6A 4X4NA 4EP7A 5CHEA 4NXVA 4E80A 2DR8A 4X4VA 1FA0A 4NXXA 4NXUA 2DRAA 1UEVA 4LEVA 5B3QA 2DR9A 4AT9A 4O67A 5D61A 3OWGA 2ZH4A 2FCLA 3ER9B 1Q78A 4AT7B 4UD4A 3OVSA 4OAHA 4WOYA 4LEZA 3MCRA 3EF2A 2B56A 4NXTA 1R8BA 4HX0A 1GPJA 4K9AA 4LEWA 4K98A 3OUYA 1TFYA 4OAIZ 5D62A 4O6AA 4AT8B 3HJ4A 3NYBA 4FO1A 4WH5A 2ZH3A 4X4SA 4MKPA 2ZHAA 2O1PA 2GAFD 2Q66A 4FHPA 2DVIA 5CFUA 4WQLA 4NKUA 3K7DA 4ATBB 2DR7A 4K8VA 2ZH8A 2ZH5A 4X4OA 4FHYA 1UEUA 2B4VA 2ZHBA 2HHPA 3NKUA 4FHWA 4AT7A 1F5AA 4NXWA 4K96A 2EWRA 2GA9D 4FH5A 2ZH1A 2ZH9A 5CFSA 2ZH7A 4M5DA 2DRBA 2ZH6A 3ER8C 4JLXA 4JLZA 4NKTA 3C66A 4AT8A 3PHZA 2B51A 4O69A 4WQKA 3ERCC 4X4PA 4ATBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXW A;  4K96 A;  4K9A A;  4O68 A;  4LEW A;  4K98 A;  4OAI Z;  4NXV A;  4AT9 B;  4O6A A;  4AT8 B;  4KB6 A;  4NXX A;  4NXU A;  4MKP A;  4ATB A;  4LEV A;  4K99 A;  4JLX A;  4JLZ A;  4O67 A;  4AT9 A;  4OAF A;  4AT8 A;  4LEY A;  4K97 A;  4ATB B;  4O69 A;  4AT7 B;  4K8V A;  4K9B A;  4KM5 A;  4OAH A;  4WOY A;  4LEZ A;  4OAG A;  4NXT A;  4AT7 A; 
#chains in the Genus database with same CATH topology
 5J2A A;  7ICH A;  4RWN A;  4PHE A;  4UB4 A;  5J2I A;  4DOC A;  3WFR E;  3C18 A;  4GXK A;  4Z6D A;  4DOB A;  5DB9 A;  1HUZ A;  4AT9 B;  4WCW A;  9ICI A;  4XJE A;  8ICZ A;  4I2C A;  9ICV A;  4K99 A;  1MIY A;  4X4Q A;  4XA5 A;  1NO5 A;  4KLF A;  2DR5 A;  4JWM A;  4K9B A;  3JCF A;  4XUS A;  5J0O A;  8ICC A;  9ICQ A;  5IIN A;  1RZT A;  4KLG A;  4QZ9 A;  4KLM A;  4X4U A;  1OU5 A;  9ICL A;  1R8C A;  4R65 A;  8ICU A;  7ICG A;  4X4N A;  4E80 A;  5J0X A;  9ICP A;  4PGQ A;  2DRA A;  2PFN A;  4LEV A;  5DBC A;  5B3Q A;  4NM2 A;  3JPP A;  3UPS A;  4S3N A;  7ICQ A;  4WC0 A;  3OWG A;  4FO6 A;  4XRH A;  8ICJ A;  5BOM A;  1PX5 A;  2BCQ A;  8ICN A;  3ER9 B;  1Q78 A;  4KLD A;  4UD4 A;  3H37 A;  3RH5 A;  7ICE A;  2B56 A;  2BCR A;  4NXT A;  1R8B A;  3UXN A;  4UB5 A;  5J2G A;  4LEW A;  4EED A;  1MQ3 A;  1ZQK A;  3OUY A;  4OAI Z;  4UBC A;  1XSN A;  5HRE A;  4FO1 A;  5DB6 A;  1ZQM A;  1KEJ A;  4F5Q A;  2GAF D;  5HHH A;  1XSP A;  2DVI A;  1ZQX A;  1MIW A;  4NKU A;  3HW8 A;  2ZH5 A;  5J2J A;  7ICJ A;  1ZQA A;  4RQ0 A;  3NKU A;  1ZQD A;  4AT7 A;  1F5A A;  4YMO A;  1TVA A;  4I2E A;  4KLT A;  5DEC A;  5CFS A;  4UAZ A;  3C2L A;  2M2T A;  4YD1 A;  5J2D A;  3CK6 A;  3GDX A;  4JLX A;  4UAY A;  3AQL A;  8ICW A;  3C66 A;  4AT8 A;  4NLN A;  4I2J A;  4M47 A;  2RFF A;  4RQ3 A;  4UB3 A;  4PGX A;  5J2H A;  4WQK A;  5CP2 A;  5J29 A;  4PHD A;  5J2E A;  4X5V A;  1ZQZ A;  4ATB A;  2BPC A;  5J0U A;  4KLJ A;  4X4R A;  4P4M A;  5HRD A;  4M9N A;  5J0Y A;  1JN3 A;  1ZQQ A;  5DDY A;  4MF2 A;  4IQW A;  4I2I A;  1UET A;  1YLQ A;  1ZJN A;  5D4B A;  4FHV A;  2ZH2 A;  5IIO A;  2BBH A;  5B3P A;  1NOM A;  1BPD A;  1RPL A;  9ICU A;  5HR9 A;  4OAG A;  3HIY A;  4KLI A;  3OUY B;  3WFO A;  4K4H A;  2IHO A;  4M9G A;  4RPZ A;  5DBB A;  3MDC A;  2FMS A;  8ICR A;  4WC5 A;  2DR8 A;  4I28 A;  1FA0 A;  4NXX A;  4YMN A;  2M2W A;  4NXU A;  4R63 A;  2O5A A;  3RJE A;  3HX0 A;  1ZQT A;  4RWO A;  4KLL A;  4KLE A;  5HRF A;  4AT7 B;  4QZH A;  2ISO A;  4OAH A;  2HN1 A;  1VJ7 A;  3RJI A;  2PXI A;  5J0T A;  3JPR A;  3EF2 A;  4RQ1 A;  2M2U A;  4QZI A;  2HN2 A;  8ICB A;  5J2F A;  4X0B A;  4QZF A;  1GPJ A;  3RH4 A;  3PML A;  4M9J A;  5CJ7 A;  5CWR A;  4O6A A;  4AT8 B;  1XSL A;  8ICH A;  2ZH3 A;  1ZQJ A;  1VFG A;  3V7J A;  4P4O A;  5TZV A;  4FHP A;  5CFU A;  4F5P A;  5J0R A;  4WQL A;  2BPG A;  4ATB B;  1HUO A;  1ZQG A;  2BE3 A;  2ZH8 A;  5HRK A;  3AU6 A;  5HRI A;  4FHY A;  3L9D A;  1UEU A;  3ISC A;  3C5F A;  3AQK A;  3JPQ A;  3LQC B;  7ICN A;  4KLQ A;  7ICU A;  8ICV A;  4Z6C A;  4KLU A;  4NXW A;  5IIJ A;  4WBZ A;  9ICG A;  3JPN A;  2I9G A;  8ICP A;  4UAW A;  2EWR A;  3UQ2 A;  4MFF A;  3TFS A;  2IHM A;  2ZH6 A;  4I27 A;  4NM1 A;  4NKT A;  4MF8 A;  3UXP A;  4O5E A;  4NLK A;  2B51 A;  4WC3 A;  7ICI A;  1ZQO A;  4X4P A;  2W9M A;  9ICX A;  3C2K A;  1KDH A;  2BCS A;  9ICB A;  5J0W A;  1V4A A;  4FHX A;  2FMP A;  3RJJ A;  4TUP A;  4KB6 A;  1ZQB A;  4M2Y A;  8ICY A;  4O9M A;  5J0P A;  2PFO A;  7ICO A;  4E7X A;  3RJK A;  4M9H A;  4FH3 A;  4X4T A;  1R89 A;  1BPX A;  1ZQP A;  3AUO A;  4QZG A;  4PHP A;  1R8A A;  4MFA A;  9ICS A;  4RPX A;  4K97 A;  5F2V O;  3LK9 A;  4KM5 A;  9ICM A;  5HRL A;  2NRK A;  4YN4 A;  4DO9 A;  1Q79 A;  5D63 A;  8ICL A;  4WC7 A;  8ICS A;  4IG8 A;  1KNY A;  3NWI A;  3RJF A;  9ICT A;  4RQ6 A;  4LT6 A;  4EP7 A;  5CHE A;  3UPQ A;  2BCU A;  4I0U A;  4X4V A;  3PMN A;  1ZQV A;  1UEV A;  3AQN A;  4RT3 A;  2BBJ A;  2DR9 A;  3ISB A;  3RJG A;  4O67 A;  7ICP A;  3V7K A;  1ZQR A;  5DKW A;  1ZQF A;  2FCL A;  3V72 A;  1MIV A;  4F5O A;  3OVS A;  4I2A A;  4PH5 A;  8ICA A;  4WOY A;  4LEZ A;  1WOT A;  3MCR A;  4TUR A;  4R64 A;  4M0A A;  4F5R A;  4LZD A;  4IQV A;  3ISD A;  4F5N A;  7ICR A;  2ID1 A;  4RWQ A;  5DB7 A;  5IIK A;  4K98 A;  3K75 D;  1TFY A;  4NXZ A;  5J0Q A;  3MGH A;  5D62 A;  4NLZ A;  1MQ2 A;  7ICV A;  4WC1 A;  3HJ4 A;  5BPC A;  4WH5 A;  4X4S A;  4NY8 A;  3JYY A;  4MKP A;  4XQ8 A;  2FMQ A;  2O1P A;  5HC9 A;  9ICA A;  1JQR A;  4O5K A;  3MDA A;  4QZD A;  4DOA A;  1ZQH A;  4RQ7 A;  9ICJ A;  3JPT A;  2GWS A;  2B4V A;  2ZHB A;  2HHP A;  3HWT A;  4PPX A;  4YCX A;  4FHW A;  3RJH A;  7ICK A;  4YD2 A;  4QZC A;  4M04 A;  8ICO A;  4QZA A;  9ICO A;  4UB2 A;  5CHG A;  4TUQ A;  4XQ7 A;  4I2B A;  1BPZ A;  1ZQS A;  9ICC A;  1ZQE A;  8ICI A;  2ZH7 A;  1ZQU A;  5III A;  4IQT A;  3H38 A;  1ZQC A;  5BOL A;  4I2D A;  2ISP A;  4KLH A;  5J2K A;  8ICQ A;  5IIL A;  4JLZ A;  3WFQ E;  4WC2 A;  1BPB A;  4JWN A;  4O69 A;  3WFP A;  4EEB A;  7ICF A;  7ICT A;  7ICL A;  3ERC C;  4PHA A;  5JTG A;  4RQ2 A;  9ICN A;  4QZE A;  4I2G A;  4EGW A;  5CFT A;  4O68 A;  4QZ8 A;  5D49 A;  5HRH A;  1JAJ A;  5J0S A;  4N7R A;  1TFW A;  4I2F A;  7ICS A;  4UBB A;  2M2V A;  3OVA A;  3C5G A;  5CB1 A;  4Z6E A;  3HJ1 A;  8ICK A;  3OV7 A;  4OAF A;  5HRG A;  4MFC A;  4LEY A;  3JPS A;  8ICM A;  4K4G A;  4UD5 A;  5DDM A;  4UB1 A;  4E8F A;  4EBK A;  5J2C A;  1BPE A;  4R66 A;  3C2M A;  4RQ4 A;  2BPF A;  4RPY A;  4P2H A;  4IQU A;  4RWP A;  7ICM A;  2P66 A;  2PFQ A;  9ICK A;  4X0A A;  3OVB A;  1JMS A;  3B0Y A;  4NXV A;  9ICF A;  1ZQI A;  3V7L A;  9ICR A;  1ZQY A;  4QZB A;  2PFP A;  4RQ8 A;  5HRB A;  4AT9 A;  5D61 A;  4I29 A;  5J2B A;  4EBJ A;  4KLO A;  4LZG A;  3MBY A;  3RH6 A;  9ICW A;  2ZH4 A;  4PGY A;  8ICG A;  5DB8 A;  5DBA A;  3UQ0 A;  3AU2 A;  1TV9 A;  3B0X A;  8ICX A;  9ICH A;  4YMM A;  5IIM A;  3JPO A;  3JZ0 A;  4RT2 A;  2BCV A;  4HX0 A;  4Z6F A;  4K9A A;  1BPY A;  3PNC A;  2IUB A;  5CA7 A;  4WC4 A;  4K4I A;  3NYB A;  2ZHA A;  2Q66 A;  2PBE A;  4GXI A;  3K7D A;  4P4P A;  9ICE A;  2DR7 A;  4K8V A;  4GXJ A;  4X4O A;  3OGU A;  5D46 A;  2VAN A;  3H39 A;  4LVS A;  8ICT A;  4WBY A;  1ZQL A;  4K96 A;  1ZJM A;  4EV6 A;  3AQM A;  2GA9 D;  3H3A A;  4FH5 A;  2ZH1 A;  2ZH9 A;  3MGI A;  4O5C A;  5EOZ A;  3UXO A;  4M5D A;  2DRB A;  3ER8 C;  4TUS A;  3PHZ A;  4WC6 A;  4KLS A;  4RQ5 A;  5HHI A;  8ICE A;  3NVO A;  1ZQW A;  4I2H A;  1ZQN A;  8ICF A;  5DED A;  4M9L A;  3WFS C;  5CR0 A;  3TFR A; 
#chains in the Genus database with same CATH homology
 5CFT A;  4X4R A;  4O68 A;  4N7R A;  1TFW A;  4FHX A;  4AT9 B;  4KB6 A;  4XJE A;  1UET A;  3OVA A;  4FHV A;  4E7X A;  4K99 A;  3HJ1 A;  2ZH2 A;  3OV7 A;  4FH3 A;  4OAF A;  4X4T A;  1R89 A;  4X4Q A;  4LEY A;  1R8A A;  5B3P A;  4K97 A;  2DR5 A;  4UD5 A;  4K9B A;  4KM5 A;  4OAG A;  3HIY A;  4E8F A;  3OUY B;  4X4U A;  1Q79 A;  2IHO A;  5D63 A;  3OVB A;  1R8C A;  4LT6 A;  4X4N A;  4EP7 A;  5CHE A;  4NXV A;  4E80 A;  2DR8 A;  4X4V A;  1FA0 A;  4NXX A;  4NXU A;  2DRA A;  1UEV A;  4LEV A;  5B3Q A;  2DR9 A;  4AT9 A;  4O67 A;  5D61 A;  3OWG A;  2ZH4 A;  2FCL A;  3ER9 B;  1Q78 A;  4AT7 B;  4UD4 A;  3OVS A;  4OAH A;  4WOY A;  4LEZ A;  3MCR A;  3EF2 A;  2B56 A;  4NXT A;  1R8B A;  4HX0 A;  1GPJ A;  4K9A A;  4LEW A;  4K98 A;  3OUY A;  1TFY A;  4OAI Z;  5D62 A;  4O6A A;  4AT8 B;  3HJ4 A;  3NYB A;  4FO1 A;  4WH5 A;  2ZH3 A;  4X4S A;  4MKP A;  2ZHA A;  2O1P A;  2GAF D;  2Q66 A;  4FHP A;  2DVI A;  5CFU A;  4WQL A;  4NKU A;  3K7D A;  4ATB B;  2DR7 A;  4K8V A;  2ZH8 A;  2ZH5 A;  4X4O A;  4FHY A;  1UEU A;  2B4V A;  2ZHB A;  2HHP A;  3NKU A;  4FHW A;  4AT7 A;  1F5A A;  4NXW A;  4K96 A;  2EWR A;  2GA9 D;  4FH5 A;  2ZH1 A;  2ZH9 A;  5CFS A;  2ZH7 A;  4M5D A;  2DRB A;  2ZH6 A;  3ER8 C;  4JLX A;  4JLZ A;  4NKT A;  3C66 A;  4AT8 A;  3PHZ A;  2B51 A;  4O69 A;  4WQK A;  3ERC C;  4X4P A;  4ATB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...