4NYFA

Hiv integrase in complex with inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
149
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACDWAGIKQEPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Discovery of BI 224436, a Noncatalytic Site Integrase Inhibitor (NCINI) of HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 55
structure length 149
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4nyfA00
3TANA 1EKEA 4H4MA 4CGGA 2WONA 5HRRA 3NGZA 1QE1A 3V9UA 4CEEA 4ELVA 2HHVA 1REVA 1EXQA 3V9SA 2Y1JA 1CZ9A 1BCOA 1KCFA 3ZSWA 1TAQA 3T1AA 1QHTA 4DS4A 4FLZA 3RMAA 2OYQA 2HMIA 1HYSA 4FZXC 4EP4A 1KVAA 1TK8A 4RW7A 3IAYA 1LWFA 1XHXA 4AHRA 1BCMA 1UOCA 1S1VA 4CGIA 2YKNA 2IAJA 2VG7A 3HM9A 2HVHA 4CGDA 5CYQA 3OYCA 3MEGA 3AVGA 3M8QA 3OJUA 4BACA 1BIZA 1IKXA 3I0RA 1NOYA 4AHVA 1NK4A 4K8ZA 4CEFA 4CJ4A 3ZT4A 4CFBA 4FM2A 2KQ2A 3NGYA 3H08A 1IKVA 2JGUA 1U4BA 4KI6A 3QEVA 3D45A 1QTMA 4CJTA 4DQPA 3AV9A 1YTUA 3S3OA 1CXUA 1T7PA 3HT3A 4LSLA 1LWEA 4BDZA 3QEWA 4HCCA 1QSYA 4FJIA 2JLEA 1N5YA 4M42A 2OPSA 3SUPA 4CGFA 3TAMA 1RDAA 2XY5A 1U04A 1A5WA 4N5SA 1RILA 4IKFA 4AHTA 3ZT1A 1LAWA 3CG7A 1SL2A 3WNFA 4LD0A 4CJKA 4KHSA 4KRFA 4O55A 1UWBA 3AVMA 4LSNA 3KD1E 1IKWA 2YNHA 3RWUA 1WSFA 4CFDA 3ZT0A 4CHZA 3LP0A 3S3NA 2YNFA 4Z4GA 3QNOA 2WOMA 2GBZA 2HNDA 2FBXA 4OKJA 3OS2A 4BE0A 4CCHA 3DRPA 4M3YA 1XWLA 5J2NA 4DTRA 4AILC 3CM6A 3QEPA 4BWJA 2NUBA 3VN5A 3OYDA 2XHBA 1WAFA 4AH9A 1TKTA 3QNNA 3PX4A 4B9NA 4FJMA 3SYZA 4YFUA 3FFIA 2BDPA 2X78A 4PWDA 1XC9A 3G10A 4Z4CA 5E41A 2KFZA 3IRXA 1J9AA 1KVCA 3VQAA 4DQIA 3ZSQA 1HQEA 4FXDA 4EZ6A 3PX0A 4YNQA 3S9HA 3AVJA 3V9XA 5CY4A 1JLAA 1I3AA 1S5JA 3LWLA 1WN7A 1A5VA 4CJ3A 3SQ2A 1Y97A 4M3WA 1WSGA 2OZSA 4HVJA 3DI6A 4QAGA 3TARA 2I5JA 3DRSA 4KHQA 2ZD1A 1Q9YA 1RTJA 1RTHA 3LP3A 1RBRA 2OPPA 3L8BA 5C42A 2D0BA 2W42A 2VWKA 4Z0UA 3OJSA 3P83D 1HJRA 4KTZA 1C0TA 1T03A 1L3UA 5FRMA 1TKZA 2DFFA 2YKMA 4CIGA 1S1UA 3HXMA 4FM0A 1NKCA 4E0DA 5FRNA 1NK0A 2F96A 1FKPA 1U47A 1WSIA 3DMJA 3V81A 1VRUA 1C0MA 3LDSA 4GW6A 1ZBIA 1B9FA 2RPIA 4B8AB 2ITGA 1KRPA 3K5OA 1VSLA 3DLEA 4Q5VA 4JS4A 2P51A 4CHNA 2OA8A 1JLBA 3OYEA 2EHGA 2D0CA 4NCBA 4CFAA 3QIPA 4CF9A 4DTXA 1U48A 4N47A 3PO4A 3AVIA 2IGIA 4IBNA 4IDKA 4B08A 3KLEA 1L3SA 3TWHA 4CJEA 1SKSA 3SCXA 1JXEA 4DF4A 1U49A 1G15A 2KZMA 3ZSXA 1JLCA 1IG9A 2RF2A 1NKBA 4FJGA 4CJFA 4KFBA 2HHQA 1S1TA 3HVTA 4KTQA 1LW0A 3IG1A 4NYNA 3SPYA 1VSJA 3KJVA 3TI0A 3SQ1A 5HRNA 3NAEA 4RW8A 3TAPA 2GV9A 3RMCA 1NJZA 3O3GA 4EP5A 1ASVA 3WNGA 1RTIA 3RTVA 2G8IA 2R7YA 3LAMA 4B8CA 1QS4A 1YVUA 4F3TA 2HW3A 1HYVA 4IFYA 4W5RA 1TK0A 4KPYA 1Q8IA 3QESA 2XY6A 4CJVA 4FJ7A 4DTJA 4NYFA 4C8MA 1C6VA 2FBTA 3AO2A 3BDPA 4KKOA 3AA4A 4FK4A 3DLRA 4OJRA 4CJWA 1LW2A 1QSSA 2HHSA 4W5TA 4Z4FA 1JLGA 1RT2A 1GOCA 4FJ5A 3QEIA 1C0UA 2XY7A 4I2PA 4DMNA 3NH0A 1HNVA 1RT4A 2HHUA 3V1OA 1XI1A 2X6SA 4CFCA 3K57A 4DSLA 3M8SA 1S1XA 3OYGA 1RT5A 1J53A 2LSNA 1VSDA 2BE2A 3KKSA 5SWMA 5KRSA 4DU3A 4RG8A 5HP1A 2DTUA 4W5OA 3KK2A 3DRRA 3IS9A 3ZSOA 3SV3A 4MFBA 1ZBHA 4ZTJA 4PUOA 4W5NA 4DSJA 4FLXA 1HQUA 4O5BA 2G8VA 4DQSA 3QERA 5DK5A 3KLIA 4KV8A 1NJYA 3OVNA 4OLBA 1TV6A 3O3FA 4ZHRA 3K59A 1L3VA 4KB0A 4O4GA 3U3GA 5C24A 3HPHA 3KLGA 4CF2A 2KW4A 4B9LA 1NK9A 4C8NA 3ZCMA 3TAGA 5KI6A 1JLQA 3V9WA 2XRIA 3DYAA 3JYTA 4DLGA 1UA0A 1N6QA 3C6UA 2FC0A 4CK1A 3OYMA 4ID1A 4E7LA 1D5AA 4Y1CA 4E1NA 4CHYA 1WNSA 3ASMA 3QINA 4JRQA 1R0AA 3KTQA 4DF8A 2AJQA 1WAJA 3AO3A 2F8SA 1HRHA 3ZT2A 2Z1GA 4E19A 4ELUA 1X9SA 2HNYA 4CE9A 3CYMA 3OYAA 4PA1A 4FJHA 2OPRA 4FVMA 2BANA 1HNIA 3HPGA 3HP9A 3K5NA 2E6MA 1YT3A 1NOZA 4DU4A 1T8EA 1RTDA 4GVMA 3LP2A 1HMVA 3DLHA 3VQ8A 5T7BA 1RBVA 4B3OA 3LAKA 4O0JA 2O4IA 4CK2A 3AVHA 1EETA 5KGWA 4BWMA 1NK6A 1K6YA 3LPUA 5HBMA 1WSEA 1SUQA 3V1RA 1JLEA 4IG0A 2XO7A 4E89A 3SI6A 2HB5A 1VSIA 1TGOA 3HSTB 1W9HA 5J1EA 2HHXA 1SKWA 1I39A 4DWIA 1Q9XA 2GUIA 4CEBA 1QSLA 1SL1A 2E4LA 1B92A 3QLHA 3AVAA 3DLGA 1X9MA 4FK2A 2HHWA 3AVNA 3KIOA 4FLYA 3AVLA 2RN2A 1SL0A 4KB1A 1VSMA 1CXQA 2OPQA 4FLUA 2HNZA 3KKRA 5CYMA 4AHUA 4KHYA 3C6TA 4OGEA 1BQMA 4JRPA 4KREA 3NBPA 3B6OA 3VQ9A 3QETA 4PY5A 1C1BA 3L2UA 3AA2A 4CECA 4HHTA 3TAEA 1DTQA 1RBUA 3T19A 3SNNA 4M3ZA 3P1GA 2VWJA 1C1AA 4DFMA 1FK9A 3E01A 5SZTA 4FZYA 4LY7A 1RT7A 3U3YA 2KFNA 4NCGA 5FDLA 3EY1A 1XHZA 2PY5A 4FJJA 2YHBA 4N41A 1JL1A 3AVBA 1QQCA 2A1RA 3OYNA 3THVA 3DLBA 4DG1A 4B9TA 1IKYA 1VSFA 1DLOA 2QK9A 4ID5A 3C95A 1D9FA 2P5GA 2FBVA 1EX4A 4N56A 2G8HA 3NCIA 4FJ9A 4BE2A 1L5UA 3OS0A 4N76A 1BI4B 1FXXA 3KLHA 4KI4A 1GOAA 1BISA 1JL2A 4H8KA 3ZT3A 1TKDA 4FLWA 2OZMA 4JLHA 3V1QA 1TL3A 4M3RA 4M3UA 4F3OA 2DFHA 4CIEA 3RMBA 1RT3A 3CM5A 3SJJA 1BI4A 3K5MA 2PZSA 1KFSA 4DTNA 5HLFA 3JSMA 4FLTA 1LV5A 4CJPA 3MXIA 1JLFA 2P5OA 4CHPA 3CFOA 1KTQA 4M3XA 4PQUA 2ATQA 1RDBA 4CIFA 3M8RA 5KRTA 3LZJA 4H4OA 5KTQA 1RT1A 1RCHA 4B9UA 1HPZA 4IFVA 4M45A 4DTSA 4DTUA 2Y1IA 1ZBLA 4KAZA 3EYZA 1SV5A 3MEDA 4CEDA 4EZ9A 3VQBA 4RW6A 2X74A 3OYFA 1WSHA 3HJFA 3DLKA 3WNHA 1W0HA 3S3MA 3VQ6A 4I9LA 4RW4A 1ASWA 4DQQA 3NF9A 4HUEA 4FJXA 3M8PA 3AVKA 4XIUA 3F9KA 4KO0A 4JS5A 5D3GA 3C94A 3QO9A 3OYLA 3AA5X 2IOCA 3L2WA 1RBTA 3PV8A 4HUGA 3O4QA 4CEOA 5DMRA 3TR8A 2YHAA 4DLEA 3DOKA 3HYFA 1KVBA 5HRSA 4E1MA 3OYIA 3MEEA 4CJLA 4BE1A 3F73A 2YNIA 4OVLA 4OPJA 4HTUA 2B4JA 3ITHA 2IC3A 1B9DA 3AA3A 4MQ3A 4B9VA 4M3TA 3SZ2A 5J2MA 2KTQA 3LPTA 3PO5A 1S9EA 3EZ5A 3NH1A 4CF0A 2QXFA 4NCAA 3AO4A 4G1QA 3G0ZA 3VQQA 5CZ1A 4W5QA 4FW2A 4BDPA 3L2VA 3UIQA 3ZSRA 4E7IA 4CK3A 1RDDA 1EP4A 4R5PA 3B6PA 3TAQA 3KK1A 2D0AA 2G8FA 1LWCA 1VSHA 4HCBA 4DQRA 3NH2A 4DS5A 3L2QA 3AVFA 4DSIA 4Z4IA 3HO1A 4IG3A 2QKKA 2EX3A 4CGHA 1X9WA 3MXJA 3PX6A 2IS3A 2KZZA 4CJRA 4RW9A 2D5RA 4DTMA 3VQEA 4LH4A 2RKIA 1NKEA 4J2AA 1KFDA 5J2QA 1NK8A 3VQCA 1ZBUA 4ICLA 4E3SA 1WLJA 2F8TA 4O0IA 5I42A 1RNHA 2PYJA 2O4GA 4K8XA 3NE6A 5FROA 4CF8A 3LANA 2FBYA 1FKOA 3VQ7A 4CHQA 3DM2A 4FYDA 4OKKA 4AHCA 1S9GA 2XY8A 3SUOA 4AHSA 5KGXA 3K58A 4DSFA 3SUQA 1IH7A 2DY4A 1ITGA 2YV0X 3ULDA 3RR7A 5CZ2A 4DSEA 2VG5A 5JS1A 4Z4HA 4M41A 4DFJA 3NF6A 4GMJB 5I3UA 4DTOA 1ASUA 2YNGA 3HP6A 2ZQBA 2Z1JA 3ISNC 1RBSA 5EU7A 3ZSVA 4CERA 3O3HA 1NK5A 1S6QA 2DFEA 1BHLA 4ELTA 3HL8A 1F21A 2QKBA 3I8DA 1WSJA 3MAQA 1NJWA 5K14A 1LAVA 3PUFA 1KLMA 3KLFA 3CQ8A 5C25A 3V4IA 3SQ4A 2Z1IA 1CZBA 1C1CA 4ZTFA 4Z4EA 2Z1HA 1TL1A 3NFAA 3V6DA 1TKXA 2Q3SA 4CHOA 3NHGA 3OYKA 3TABA 1HYZA 3L2RA 4LH5A 1UA1A 2HHTA 3VQ5A 4I7FA 3LALA 5JS2A 3KD5E 1IO2A 3VQDA 1S1WA 4DSKA 3NF7A 4Y1DA 1Z26A 4L8RB 4TSXA 1BQNA 3O4NA 3RRHA 1D9DA 4I9QA 3MECA 3WNEA 3OYBA 1J5OA 1L3TA 3L3VA 4B9SA 4OLAA 4FW1A 3ZSZA 3MXMA 3DOLA 3QEXA 3I0SA 2ZE2A 4BDYA 1J54A 3OY9A 3AO5A 1TAUA 1BIUA 2E6LA 4KHNA 3CFPA 2IDOA 3AO1A 3HPOA 1YTAA 4FJNA 4FK0A 1NJXA 3K2PA 4CJUA 3SV4A 4DFKA 1VK0A 1VRTA 1S6PA 4CGJA 3HVRA 1KSPA 4E7JA 1MU2A 3A2FA 3ZSYA 3PY8A 3NDKA 4J2DA 1BL3A 2B6AA 2G8WA 4FZZA 3LZIA 1ZYQA 4J2BA 1RDCA 4CJSA 3SPZA 1A5XA 4FM1A 2VG6A 3VA0A 2G8UA 4OPKA 3L3UA 3RMDA 4F8RA 3VQPA 5HRPA 4C8KA 3RRGA 4QOZB 4QCLA 4F4KA 3V9ZA 3K5LA 3NGIA 3VA3A 3RR8A 3SUNA 4I2QA 1BGXT 1D8YA 3SQ0A 4CEQA 3OYHA 4DTPA 4KHUA 4KHWA 4FJLA 4B9MA 2X6NA 3OYJA 3T3FA 4C8OA 4DU1A 3HK2A 3VQ4A 2PYLA 3LP1A 4CJQA 4F2SA 1Z25A 3QIOA 3KK3A 4CJ5A 4FLVA 1U45A 1KLNA 1O1WA 3P5JA 2HVIA 4OKEA 1GOBA 1UAXA 4HUFA 4O44A 3CFRA 4CEZA 1ZBFA 4J2EA 1JKHA 2G8KA 3NF8A 4DFPA 2B5JA 4E7KA 1DTTA 4Q0BA 5J2PA 1VSKA 1NK7A 5HROA 4FJKA 1T05A 3OS1A 2BGGA 4F2RA 2A1SA 1RT6A 4CEAA 4CESA 4UQGA 1CLQA 4FJ8A 3LWMA 4C8LA 3TAFA 4E7HA 3D0PA 1TK5A 1SKRA 4OGCA 1X1PA 4KTWA 4CF1A 4FCYA 3BGRA 2P1JA 3ALYA 3AVCA 4WE1A 3U6FA 2ETJA 1JXBA 1VSEA 1TVRA
chains in the Genus database with same CATH superfamily
2WONA 4CEEA 4ELVA 2Y1JA 3ULEA 2ZJPL 1BCOA 2NRXA 3C6AA 2WFBA 3IAYA 1LWFA 4AHRA 5BN8A 4CGIA 2YKNA 1V4TA 2HVHA 1HNZK 1WBBA 2VQEK 2P9PA 4BACA 3I0RA 4LF4K 4AHVA 1NK4A 4K8ZA 4CEFA 4CJ4A 4JK9A 5LJWA 1IKVA 3D45A 1CXUA 3H3OB 4LSLA 1NGEA 2VGMA 3QEWA 3VTHA 2JLEA 2E2QA 4CGFA 4DR4K 3TAMA 3ZETB 5TKWA 2NZTA 4IKFA 3ZT1A 5AFUA 1LAWA 3WNFA 4LF5K 4KRFA 4O55A 4CJ7A 2YNHA 1WSFA 2WOMA 4O5FA 2FBXA 4LFCK 1HNWK 3NVMA 1VQ8N 3OYDA 2XHBA 2AP1A 1TKTA 3QNNA 4B9NA 4FJMA 3SYZA 4YFUA 1NGGA 2P9KA 4PWDA 3CERA 4CZLA 4Z4CA 1XC9A 4B3MK 4B1VA 1J9AA 3VQAA 4FXDA 3AVJA 4M63C 3KWIA 2FF3B 1A5VA 3SQ2A 4M3WA 2I5JA 4B3TK 5EVZA 2ZD1A 1Q9YA 1RTJA 3LP3A 4XH4A 3AARA 2VWKA 4Z0UA 1HJRA 4KTZA 1C0TA 4K43A 5FRMA 2HSTA 4CIGA 1HKCA 5EXWA 3D6RA 1CZAN 4B8AB 3A5OC 1KRPA 3K5OA 3EZWA 4Q5VA 1QHAA 2P51A 4H5TA 3OYEA 4CFAA 3QIPA 3PO4A 2OANA 1TUYA 4RWTA 4CJEA 3KZBA 1NGFA 4K0KK 5AQWA 4DF4A 1U49A 1XUPO 4H0OA 1NKBA 1BWFO 1OH8A 1S1TA 3HVTA 1LW0A 4NYNA 1VSJA 1OVQA 3O9UA 5CE3A 4BVOA 3D2EA 1RTIA 2QWRA 3RTVA 1QS4A 2HW3A 4KBOA 3VEWA 4KPYA 2XY6A 4B1UB 4FJ7A 4C8MA 4JI0K 1JCEA 4KKOA 1N32K 1E3MA 4FK4A 4H0PA 4YOYA 2HHSA 4W5TA 3M3ZA 1JLGA 1GOCA 3E1YA 3QEIA 2GUPA 4EHUA 1C0UA 4BRQA 4I2PA 4DMNA 4YOWA 1VHXA 1OKJA 3K57A 1J53A 5SWMA 2BE2A 5HP1A 3CCQN 2QWLA 1GLBG 3ZSOA 1ZBHA 4CVNE 1GLAG 4ZTJA 5AQNA 4FLXA 2Q2RA 4CW7B 3VF4A 1TV6A 1L3VA 4CF2A 1NK9A 5CR4A 3DYAA 3JYTA 4DLGA 1K8KB 2FC0A 1BO5O 4CK1A 3OYMA 4ID1A 4BRPA 1D5AA 5AQYA 4DUZK 4DKWA 5JVHL 4DF8A 1WAJA 2QTDA 2W40A 3SBGA 4CE9A 4FVMA 3HPGA 4FPBA 1RTDA 3LP2A 3DLHA 3VQ8A 3I55N 3LAKA 2V7ZA 3AVHA 4I6MA 3MWPA 4BWMA 1NK6A 4LF6K 1K6YA 1SUQA 2ITMA 3THWB 1JLEA 2XO7A 2CH6A 3LL3A 2QXLA 3VEOA 4DV4K 2HHXA 1QSLA 1SL1A 4RTFD 3N4QA 5C15A 3JAMO 1P90A 1VSMA 2OPQA 3KKRA 3NBPA 4DR7K 3QETA 3L2UA 3TU5A 4BRNA 5I9EB 4CECA 3THYB 3TAEA 4XH5A 4M3ZA 3WXMB 2D0PA 2OTJN 3E01A 1RT7A 3I33A 5FDLA 1WB9A 3TSPA 2PY5A 1QQCA 3DLBA 2HMPA 3THXB 4B9TA 4DQ8A 4LFAK 3D7EO 1VSFA 1DLOA 2O8DB 3C95A 2O8CA 2P5GA 1EX4A 2BUPA 3WEEB 4A5AA 3SAFA 4LFBK 4KI4A 3AY9A 4FLWA 4FWOA 2NNWA 1YI2N 4F3OA 3HI0A 1IBKK 1RT3A 3CM5A 2W6LA 1BI4A 3D2EB 3K5MA 2PZSA 3PLAA 4DTNA 5HLFA 3MXIA 3CFOA 1KTQA 4XH1A 1RDBA 3VF2A 1RT1A 5E84A 1VQ5N 1NGBA 4DTUA 1ZBLA 4OO1J 4FO0A 1YUWA 3VQBA 2IVOA 1QQOA 3WNHA 4I9LA 1ASWA 3W0LA 4XIUA 4JS5A 5D3GA 1RDWX 1TYQB 1MDUB 3O4QA 4B3SK 4YY3K 3LM9A 4BG8A 3CC2N 3B8AX 3ITHA 3U4LA 4B9VA 3FR0A 3LPTA 3U9DA 1S9EA 3EZ5A 3NH1A 3BZCA 4NCAA 1FW6A 1SQKA 3L2VA 1T6CA 3EN9A 4E7IA 4BR5A 4JI2K 3B6PA 4A61A 1LWCA 3NH2A 3HO1A 1BG3A 3VF6A 3L2QA 3FFKB 5AQTA 4RW9A 2D5RA 4DTMA 4LH4A 5E26A 1KFDA 3C7NA 4EIAA 3IUCA 3VQCA 2WUSA 3UKRA 4BR2A 4KH6A 3LDPA 4K8XA 1YITN 3VQ7A 1FKOA 5AFUH 1GLEG 2YHYA 1VQ9N 3SUOA 3K58A 5IWAK 5JVGL 1S22A 4MLHA 3ULDA 4EHTA 3NF6A 1YF5L 4JNEA 5I3UA 3MCAB 2YNGA 3WQUA 4OPAA 3LDNA 5EU7A 1RBSA 2HHHK 2P9SA 3GE1A 1BHLA 4E1JA 1KLMA 3KLFA 3CQ8A 2JWKA 2E20A 3SQ4A 2Z1IA 1CZBA 1C1CA 4ZTFA 4Z4EA 1TL1A 3NFAA 4V19S 5AZIB 2QWOA 4I7FA 1QZ5A 4ISEA 4BC5A 3NF7A 4IEEA 4AM6A 3RRHA 3WNEA 3OYBA 5AQZA 4NXNK 1GLDG 4FW1A 3QBXA 2QWMA 2O8CB 3DOLA 3TSQA 3K9JA 1J54A 2O8FB 1JCGA 1HUXA 1DKGD 1YTAA 4FJNA 1NJXA 3DXMA 4X62K 4DFKA 3SLCA 2HBKA 2HBJA 4YORA 1RDCA 4MLEA 4WQ4C 4F9OA 5BR9A 4FM1A 1KAZA 3VA0A 1IV0A 2G8UA 2UXBK 5LL6Z 3RMDA 5HRPA 4FWMA 3CC7N 3V9ZA 4FWLA 3RR8A 1VQNN 1VQMN 2X6NA 1IBMK 3H1VX 4JKDA 4DU1A 2PYLA 1Z25A 1VQLN 1C0FA 4FLVA 2YHWA 1KLNA 3CQXA 1GOBA 4CD1A 4BQZA 4DR5K 3VENA 2HF4A 1DT9A 2BGGA 4F2RA 2A1SA 1EQYA 3D0PA 1SAZA 1TK5A 2HBLA 1X1PA 3BGRA 3ALYA 4WE1A 1VSEA 3EKUA 4CGGA 5AQJA 2RHKA 5HRRA 3V9UA 3ZYYX 1REVA 1EXQA 3V9SA 1CZ9A 3EE9A 1KCFA 3MN7A 3EKSA 4FLZA 3RMAA 2HMIA 4FZXC 1TK8A 3BF3A 3R1XA 1XHXA 5BPMA 1Q18A 2AA4A 4JKAA 4WQ4A 5CYQA 3OJUA 1NOYA 4PKIA 1QVFM 5KPRA 3CHWA 2D1KA 2KQ2A 3NGYA 4JKHA 5FPDA 2JGUA 4KI6A 1BOTO 3AV9A 3S3OA 1LWEA 4LF8K 2P9SB 3HM8A 2FSNA 3CG7A 1C0GA 1SL2A 3D2FB 4BGBA 3CCUN 1ZBSA 4WQ5C 3ZETA 3KD1E 3RWUA 3ZT0A 4CHZA 3S3NA 1EWRA 2HNDA 4K41A 3O1WA 3G71N 4BE0A 4CCHA 2Q36A 1XWLA 5J2NA 3CM6A 5GINA 4BWJA 3VN5A 2ZJRL 3PX4A 3ZX2A 3FFIA 2BDPA 2X78A 3G10A 1IJJA 2HBMA 5E41A 4JYAK 5HL7L 2GEMA 1GLCG 4DQIA 1Z05A 3ZSQA 4EZ6A 4YNQA 3S9HA 3CJAA 1JLAA 1I3AA 1E4FT 3M1FA 2OZSA 4KHQA 4HVJA 3VEVA 3DRSA 4PL8A 3L8BA 5AQOA 3I56N 2A41A 4H5RA 3OJSA 5JLHA 1YXQA 2YKMA 5FRNA 1KXPA 4RCHA 1WSIA 3DMJA 1VRUA 5BRFA 1ZBIA 4GW6A 2F9TA 1B9FA 3O08A 5EX5A 3DLEA 3MN9A 4JS4A 2OA8A 1JLBA 2EHGA 4NCBA 4DTXA 1XNRK 2FSKA 4B08A 4BRHA 3JS6A 3KLEA 3SCXA 4BREA 5MLCQ 2DPNA 4WQ5A 1QQNA 4FVUA 1JLCA 2RF2A 3H1QA 5AR0A 2HF3A 4CJFA 4HWIA 2HHQA 4BROA 3SPYA 2GTDA 3SK3A 3SQ1A 3NAEA 1Q82O 5AQQA 3WNGA 5AQUA 3MK6A 3LAMA 2IIRA 1YVUA 4B8CA 4HTLA 1HYVA 3QESA 4NYFA 3AO2A 3BDPA 3QICA 1U2VB 5C12A 2Q31A 2IVNA 3ENHA 1GLLO 4Z4FA 4H03B 1Q81O 4FJ5A 4M7YA 5KPZA 4Y0WA 5AQHA 5GAEP 4JI7K 1LOTB 1XI1A 2UUAK 3A8YA 1S1XA 3OYGA 4U7BA 2LSNA 1VSDA 4DR1K 2UUCK 3LDLA 5KRSA 4DU3A 2DTUA 2PFUA 3IS9A 3SV3A 1SS6A 3G25A 4PUOA 4IXCA 3KLIA 4KV8A 2VYPA 4BRGA 3O3FA 4ZHRA 3K59A 3U3GA 2KW4A 3CCVN 3ZCMA 3TAGA 5KI6A 2F7TA 2XRIA 4YOTA 1N6QA 5AZJB 4DV6K 4PHTX 4Y1CA 4E1NA 4CHYA 1WNSA 3QINA 4JRQA 1R0AA 1GLFO 2EWSA 1YVNA 4BC4A 1HRHA 1T44A 2Z1GA 1K8KA 4H5NA 3ZT2A 1O13A 2FXUA 3CYMA 3K5NA 4X65K 1ILYA 4X64K 3ID8A 2E5LK 4B3OA 4O0JA 4CK2A 2J4RA 3LPUA 3MN6A 5HBMA 2IVPA 1WSEA 4NO7A 3V1RA 4IG0A 4E89A 3LDQA 3J7AP 2GUIA 2E4LA 5M1OA 1B92A 3QLHA 3UKUB 3DLGA 3THWA 3AVNA 1SL0A 4KB1A 2YX6A 4FWRA 1S3XA 4FLUA 1W97L 3C6TA 4JD2B 4OGEA 4KREA 4PY5A 1YHQN 4IDHA 3SNNA 1RBUA 3P1GA 4WFBL 2VWJA 5SZTA 3WXIA 2KFNA 3EY1A 4FJJA 3THYA 4N41A 3AVBA 3WUHA 3THVA 3CJBA 4K42A 2QK9A 5CHIA 1NMDA 2KLAA 4FJ9A 4BE2A 1L5UA 3OS0A 2ZGYA 3THXA 1KAYA 3KLHA 4N76A 3EE8A 1JL2A 2O8DA 2OZMA 4JLHA 2NRRA 1HX1A 3WEEA 4CJPA 1JLFA 3CJ7A 1HNXK 3M8RA 5KRTA 4H4OA 5KTQA 2OTLN 4B9UA 4M45A 3C65A 1W2BM 3MEDA 3CF5L 4EZ9A 4RW6A 3SBTA 3VERA 4CI6A 3KVGA 2UU9K 3CMAN 1W0HA 3S3MA 3VQ6A 3TTCA 3M8PA 3C94A 3OYLA 1ATSA 3TR8A 5HRSA 4FOEA 4CJLA 2NRZA 3F73A 4OVLA 2UUBK 4GV6A 3F9MA 1TYQA 2KTQA 2NRHA 5H1SQ 4A5BA 4CF0A 3G0ZA 3VQQA 5CZ1A 4JI3K 4W5QA 4BDPA 2GELA 1EP4A 4CZEA 3KK1A 2D0AA 1M90O 1T6DA 3AVFA 2KZZA 3QFUA 4BRFA 3MX5A 1NLVA 2RKIA 2Q0RA 1BA0A 4DUYK 1ZBUA 2BTFA 4ICLA 4DV1K 2F8TA 5I42A 3NMUA 2WTUA 1RNHA 2PYJA 1KQSM 2E1ZA 2XY8A 3A5MC 3SUQA 4JI1K 1IH7A 2YV0X 3RVCA 4DSEA 1J5EK 1N33K 4FPAA 1ZC6A 5JS1A 4DFJA 3Q7CA 3OTOK 3ISNC 3ZSVA 4CERA 5BR8K 1S6QA 1BDGA 1N8RO 1WSJA 3AAPA 5K14A 2YCHA 3PUFA 5C2DA 3V4IA 4IOCL 3V6DA 1TKXA 4CHOA 1HYZA 3FLCO 5AQPA 4JN4A 5KQDA 5AQSA 3KD5E 1BU6O 3CCRN 3KK7A 4MDBA 4BRCA 4TSXA 5AZIA 3BEXA 1K73O 5AQGA 4B9SA 4WYBA 3AGKA 1RFQA 5HOOA 4B1XB 3K9KA 3BP8A 3QMLA 1BIUA 3CFPA 3TTDA 3R6MA 3SJHA 2ZM6K 3K2PA 2O8FA 4CGJA 3HVRA 3PY8A 3FZKA 1MU2A 4E7JA 3NDKA 2G8WA 2B6AA 3LZIA 1ZYQA 5BPLA 4JI6K 4CJSA 4KHPK 3OW2M 2CH5A 2E2NA 3F5TA 4OPKA 4CZKA 3CD6N 4C23A 4YOVA 4QCLA 4F4KA 3VA3A 3CCLN 3SQ0A 3OYHA 4KHWA 4KHUA 4FJLA 4B9MA 4C8OA 3HK2A 3LP1A 4F2SA 1VQPN 1U45A 1O1WA 3RSEB 4OKEA 1UAXA 3SMSA 1ZBFA 3FZLA 1JKHA 2P9UB 2QWPA 3NF8A 4DFPA 2B5JA 1NK7A 1V4SA 4UQGA 1CLQA 5ELZA 3TAFA 2YHXA 3WQTA 1XQSC 3OBWA 4FCYA 3U6FA 4BRIA 4GVEA 1HPMA 1EKEA 3NGZA 1QE1A 2HHVA 1X9JA 4GKJK 4BC3A 1Q7YO 4EP4A 1KVAA 3QB0A 4RW7A 5GAGP 1BCMA 2BH1A 1S1VA 2NLXA 2IAJA 4CBWA 3OYCA 3MEGA 3AVGA 1BIZA 1XNQK 5AQVA 4FM2A 3MDQA 1U4BA 5C0YA 4YOXA 1QTMA 1T7PA 3HT3A 1D4XA 1EO1A 1QSYA 4M42A 2OPSA 4H5VA 3SUPA 2P9IB 3CPEA 1A5WA 1BUPA 1LCUA 4N5SA 1NBWA 1RILA 4AHTA 4CJKA 5M1NA 2ASOA 3CMEN 4JI8K 1UWBA 3JXUA 1IKWA 2ZF5O 3LP0A 3QNOA 3DAWA 3VESA 2GBZA 4OKJA 3OS2A 3D2FA 2PAVA 4JKEA 1HKBA 1EWQA 3DWLA 3SMPA 1WAFA 3QFPA 3O9RA 4AH9A 4DV0K 3VTIA 3O8MA 2KFZA 4NB4A 4CBXA 1KVCA 4DV3K 4CJ3A 4IFEA 1WSGA 3TARA 4QS9A 1RTHA 1JCFA 1RBRA 4KH4A 3P83D 1L3UA 4JK8A 3VOVA 3HXMA 1S1UA 4FM0A 3QBWA 3GOIA 1FKPA 1NG9A 1C0MA 3LDSA 4A59A 5C10A 2RPIA 4CBUA 3VGLA 5M1PA 4WFNL 3MX2A 2F4VK 2A3ZA 1HJOA 1U48A 2IGIA 1L3SA 3TWHA 1SKSA 1YIJN 3M6GA 4NXMK 4BG9A 1IG9A 4FJGA 4ILJA 1ATNA 3ZEUB 5DM7L 5KQ8A 2GWJA 4RW8A 2GV9A 4JI5K 4WCEL 3T7ZA 1OH6A 4FWNA 5BRDA 2R7YA 2RE2A 1Q86O 3CJ9A 2WBNA 4W5RA 1Q8IA 1HLUA 2JWLA 1QZ6A 5AJ3K 3C6HA 4OJRA 4CJWA 1LW2A 1QSSA 3J7YP 1RT2A 4JHDB 3ENBA 1S72N 3ID6A 4G9ZA 2XY7A 1U2VA 4FWSA 3NH0A 4OPHA 1HNVA 5EY4A 2HHUA 3V1OA 4LC9B 4DSLA 4BRAA 5FPMA 3TPQA 4W5OA 3KK2A 3P4IA 4W5NA 1NGJA 1HQUA 3PSFA 2QM1A 1NJYA 4OLBA 4O4GA 4CZHA 4B9LA 2I7NA 1JLQA 1UA0A 4A57A 3ASMA 4AQYK 2F9WA 3KTQA 4E19A 4ELUA 5AZJA 2HNYA 4IO8A 4PA1A 2OPRA 3R9PA 3WT0A 2BANA 1HNIA 3HP9A 1DGKN 2O8BA 1T8EA 1NOZA 4O8UA 4GVMA 1T3VA 1I94K 1RBVA 3QDKA 3K0SA 3PIOL 1EETA 2V7YA 3GG4A 5KGWA 2O8EB 1H1VA 5B8HA 1TGOA 1W9HA 4JAXA 5BPNA 1I39A 4DWIA 1VQ6N 1Q9XA 1WOQA 3FZHA 1X9MA 1CXQA 4BR7A 2HNZA 1BQMA 4JRPA 3B6OA 3VQ9A 3AA2A 3UKUA 4HHTA 1DTQA 3H6EA 1VQ7N 3DXKB 1OH5A 1FK9A 4JD2A 4AF1A 1QQMA 4GV9A 5LJVA 4DV7K 1KAXA 2A1RA 3OYNA 4DG1A 4BRDA 1IKYA 3P39A 4BR9A 2E1YA 2D0OA 2G8HA 4YDUC 3NCIA 2VWBA 1N36K 1FXXA 1GOAA 3ZT3A 4H5WA 3V1QA 4M3RA 4CIEA 2P9LA 2V51B 1SZ2A 3H46O 3Q7BA 1DEJA 3JSMA 4FLTA 4ISFA 2P5OA 3FE1A 4CHPA 2ATQA 2OCEA 4CIFA 3LZJA 1IG8A 3PSIA 3VEZA 1U6ZA 2Y1IA 1G99A 3EYZA 3OYFA 1WSHA 1WBDA 3HJFA 3DLKA 4RW4A 4QS8A 4DQQA 3NF9A 4A2AA 3AVKA 3H3NO 4KO0A 2ZGZA 3QO9A 3AA5X 2IOCA 1X3NA 3FZFA 3L2WA 4HUGA 4IWVA 5DMRA 2YHAA 3O80A 3DOKA 4DLEA 2YJFA 3MEEA 1HR0K 4BE1A 4HTUA 4OPJA 2B4JA 4NLBA 2IC3A 1B9DA 3AA3A 4MQ3A 4FSVA 5J2MA 4JKFA 4FWQA 3PO5A 2H3GX 4CD3A 4G1QA 1NJIO 4DV5K 3ZSRA 1RDDA 4R5PA 3TAQA 4YDUA 4HCBA 4DQRA 2P9NB 2QWQA 4DS5A 4DSIA 4Z4IA 4IG3A 2EX3A 3MXJA 2IS3A 2E2OA 3SAHA 3VQEA 1NKEA 1NGIA 4A2BA 1NK8A 4EAHD 1WLJA 1VQKN 4JKCA 4O0IA 2GX9A 2O8BB 4C1NI 3NE6A 3HZ6A 1VQON 3O9TA 4CF8A 1J6ZA 4FYDA 1R59O 4DV2K 1ATRA 5LY3A 3G6EN 3NVKA 3RR7A 5CZ2A 4ISGA 2VG5A 4DTOA 1ASUA 5DM6L 3ATVA 4IEIA 2ZQBA 4GNIA 2DFEA 3HL8A 1F21A 3LDOA 1NJWA 1LAVA 1NU0A 3L4QA 3HSCA 2Q3SA 3NHGA 1UA1A 3L2RA 2HHTA 4LH5A 5JS2A 3VEYA 3IKMA 1S1WA 1Z26A 1D9DA 3MECA 4QS7A 3CIPA 1BA1A 1L3TA 3L3VA 3I0SA 2A40A 1ESVA 2ZE2A 4BDYA 3AO5A 2YJEA 2E6LA 3E9PA 3AO1A 1RDUA 1OH7A 4FK0A 4JKGB 3SV4A 1VK0A 3VGMA 3VETA 4J2DA 1KSPA 2P9LB 3A2FA 1KD1O 4FZZA 3KWGA 4BRKA 3ATUA 3ZLJA 3N4PA 1TUUA 2A42A 2VG6A 3OHRA 2VQFK 1NGAA 4GY2B 5BRHA 3L3UA 3VQPA 4C8KA 4QOZB 3K5LA 3NGIA 3SUNA 1BGXT 4DTPA 1MWMA 1MA9B 3QIOA 5LMNK 3M5RA 3P5JA 4MO4A 4CEZA 3VEXA 4J2EA 2G8KA 1NGCA 4E7KA 4DR6K 1DTTA 3RSEA 3OS1A 4PKHA 4CEAA 4CESA 1NGDA 2P9UA 4C8LA 2NRWA 3A5LC 4E7HA 4NLCA 4OGCA 1OVYA 4KTWA 4CF1A 3AVCA 3ULEB 1JXBA 1TVRA 3BF1A 2W41A 5JICA 4FL9A 3TANA 4H4MA 5AQIA 1NNEA 1FJGK 4FOIA 3CXCM 4U67L 2Q97A 3ZSWA 1TAQA 3T1AA 1QHTA 4JEPA 4DS4A 3P38A 2OYQA 2P9PB 2ASPA 1HYSA 1WUAA 4BC2A 1UOCA 2QW9A 2VG7A 3HM9A 3ZX3A 4CGDA 3M8QA 3MWTA 1IKXA 4CFBA 2A6AA 3ZT4A 4R79A 3OBYA 3H08A 3QEVA 4CJTA 4DQPA 1YTUA 3J8AA 4BDZA 4HCCA 4FJIA 5LMUK 1ZXOA 1N5YA 1Y64A 1X3MA 1RDAA 4JKBA 4B3RK 3UE5A 3A5NC 2XY5A 1U04A 4C1NK 4LD0A 4KHSA 4DB3A 4LSNA 2P9IA 3AVMA 5BN9A 1VQ4N 4CFDA 4Z4GA 2YNFA 4B9QA 4OX9K 2P9KB 5JMVA 4M3YA 3DRPA 4DTRA 4AILC 3QEPA 2NUBA 4ILHA 3J7ZO 3IRXA 3P31A 5AQLA 2UXDK 5M1FA 1HQEA 3PX0A 3V9XA 3T1HK 3AAQA 5CY4A 4BY9C 1S5JA 2CGJA 3LWLA 2KHOA 1WN7A 1Y97A 2QWNA 3DI6A 4QAGA 3TTFA 3KHYA 4BGAA 2OPPA 5C42A 2D0BA 2W42A 2Q0UA 1N34K 1YJ9N 1W7AA 5ADXA 1T03A 1TKZA 2DFFA 1NKCA 4A62A 4E0DA 3GDQA 1NK0A 2F96A 3DLLL 1U47A 3V81A 2ITGA 4IOXA 1XMQK 3LM2A 1VSLA 4IOAL 2UXCK 4CHNA 2FSJA 4H0YB 2D0CA 2ASMA 3O4WA 5F2RA 4BQLA 4CF9A 4N47A 3AVIA 4IBNA 2ZWHA 4IDKA 2NRTA 3CC4N 3CJCA 1JXEA 1G15A 2KZMA 3ZSXA 5GADP 2NRVA 2QEXN 4KFBA 1P8ZA 4UY8O 4KTQA 3IG1A 3KJVA 3TI0A 3CPWM 3WXJA 5HRNA 5F1XA 5AQKA 3TAPA 3O5BA 3RMCA 1NJZA 3O3GA 4EP5A 1ASVA 2UYTA 3J80O 2G8IA 3AGRA 1GLJO 4YOUA 3E66A 5C2FA 1IBLK 3E9OA 3OA9A 4PKGA 3ZEUA 4F3TA 4IFYA 1TK0A 4CJVA 2A5XA 4DCHA 4DTJA 3U8XA 5BREA 1C6VA 1Z6RA 2FBTA 4CZJA 3AA4A 4MO5A 4CZGA 3DLRA 5F0XA 5EOYA 4WF9L 3WXKA 4XEIA 3EL2A 2W6KA 3IMXA 2E2PA 1RT4A 2I7PA 2X6SA 4CFCA 4JHDA 3M8SA 2FLOA 1RT5A 3KKSA 4GV3A 4RG8A 3O6WA 3DRRA 4MFBA 3W3DA 3CJ1A 4H0XB 4DSJA 1NMNA 4O5BA 2G8VA 1XC3A 3CCMN 4DQSA 3QERA 5DK5A 3BY5A 5GAHP 3OVNA 5IT9O 5FLXO 4KB0A 5C24A 3HPHA 3KLGA 5M1QA 3T69A 4C8NA 3V9WA 1K8AO 4PL7A 3C6UA 3R8EA 4E7LA 2PBDA 3CETA 3ENOA 2AJQA 3AO3A 2F8SA 4FJHA 5AQXA 2VCPA 4B1WB 3OYAA 1X9SA 2V52B 4I6MB 3F2KA 3UB5A 1XMOK 2E6MA 1YT3A 4DU4A 1QVGM 2ZJQL 2HOEA 1HMVA 5T7BA 3HOTA 2O4IA 3HTVA 3CCSN 5FPEA 5AQRA 3SI6A 2HB5A 1VSIA 3HSTB 4LF9K 1SKWA 4IO9L 4DR3K 2O8EA 4CEBA 3AVAA 4CZIA 2HHWA 2E8AA 3KIOA 3AVLA 2RN2A 4FLYA 4DR2K 4KHYA 4AHUA 5CYMA 4ILGB 1C1BA 3GBTA 3CCEN 3T19A 1M1KO 1C1AA 4IJAA 4DFMA 4FZYA 1E4GT 3HRGA 4LY7A 3U3YA 4NCGA 1XHZA 2YHBA 3EEQA 1JL1A 3CI5A 2CGLA 3DXKA 3SAGA 4ID5A 1JJ2M 1D9FA 2FBVA 5JLFA 4N56A 1NGHA 3MMVA 1BI4B 4H8KA 1BISA 1TKDA 4BRMA 4O8KA 1TL3A 3G4SN 4M3UA 2DFHA 3RMBA 3MN5A 3SJJA 1KFSA 5M1KA 1LV5A 4BRLA 4M3XA 4PQUA 1HKGA 3CQYA 1RCHA 4YHHK 1HPZA 4IFVA 4DTSA 4KAZA 4B1YB 1SV5A 4CEDA 2FF6A 2GWKA 3L6QA 2X74A 3C0BA 4BR0A 2VGNA 4HUEA 4FJXA 3F9KA 4H0TB 3R3LA 1RGIA 1RBTA 3PV8A 4FWKA 4CEOA 3I8BA 3HOSA 3HYFA 1KVBA 5TKYA 4E1MA 3OYIA 2YNIA 3BZKA 3BUZB 3O9QA 3H45C 4M3TA 3GL1A 3SZ2A 4KH5A 4IJNA 3CCJN 2QXFA 4CZFA 3AO4A 3E9LA 2QA4N 4FW2A 3UIQA 4CK3A 4JI4K 2G8FA 2KKZA 4J8FA 1VSHA 3VGKA 4M7XA 3C7NB 3VPZA 2QKKA 1X9WA 4CGHA 3PX6A 5FPNA 4JK7A 3UKRB 4CJRA 1KC8O 4J2AA 2P9NA 5J2QA 4MDAA 4E3SA 2O4GA 4K25A 5AQFA 5FROA 3LANA 3IDHA 2FBYA 4CHQA 1YJWN 3DM2A 4LF7K 3J81O 4OKKA 4AHCA 4Z94A 1NWKA 1S9GA 4AHSA 5KGXA 2D4WA 4DSFA 2DY4A 1ITGA 2YI1A 4Z4HA 4M41A 4GMJB 4L3QA 4BVPA 3HP6A 3O3HA 2Z1JA 1NK5A 3HBTA 4FWPA 4ELTA 2QKBA 3I8DA 3MAQA 3VMFB 5GIOA 3FZMA 4FK2A 5GIPA 5C25A 4B1ZA 2Z1HA 3TABA 3OYKA 3TSUA 3VQ5A 3LALA 5A2QO 1IO2A 3WXLA 3VQDA 4DSKA 4Y1DA 4L8RB 3U9ZA 1BQNA 3O4NA 4I9QA 4WFAL 3O9SA 1J5OA 2CGKA 4OLAA 3ZSZA 3MXMA 3QEXA 3PIPL 5ADXH 3EO3A 4H0VB 3DXMB 3IFRA 3OY9A 1TAUA 4KHNA 2IDOA 4GKKK 3HPOA 1YAGA 4CJUA 1VRTA 1S6PA 3ZSYA 4X66K 1BL3A 3T1YK 4J2BA 3SPZA 3A0IX 4JKGA 1A5XA 5KPTA 2WC9A 4F8RA 3RRGA 4CZMA 4JV5K 3L0QA 3ZX0A 4I2QA 4AM7A 1D8YA 3FGUA 4CEQA 3OYJA 3T3FA 2E88A 3VQ4A 4CJQA 3MCPA 3KK3A 4CJ5A 1YJNN 2HVIA 1VAZA 4HUFA 4O44A 3CFRA 3DJCA 1K9MO 4Q0BA 4BR4A 5J2PA 1VSKA 5HROA 4FJKA 1T05A 2Q1NA 3L4IA 1RT6A 1NM1A 4FJ8A 3LWMA 5AQMA 4IZ9A 4DHYA 2QI2A 3O1BA 1SKRA 1MWKA 3S41A 2P1JA 2ETJA 5J1EA 4EFHA
chains in the Genus database with same CATH topology
3TANA 1EKEA 4H4MA 4CGGA 2WONA 5HRRA 3NGZA 1QE1A 3V9UA 4CEEA 4ELVA 2HHVA 1REVA 1EXQA 3V9SA 2Y1JA 1CZ9A 1BCOA 1KCFA 3ZSWA 1TAQA 3T1AA 1QHTA 4DS4A 4FLZA 3RMAA 2OYQA 2HMIA 1HYSA 4FZXC 4EP4A 1KVAA 1TK8A 4RW7A 3IAYA 1LWFA 1XHXA 4AHRA 1BCMA 1UOCA 1S1VA 4CGIA 2YKNA 2IAJA 2VG7A 3HM9A 2HVHA 4CGDA 5CYQA 3OYCA 3MEGA 3AVGA 3M8QA 3OJUA 4BACA 1BIZA 1IKXA 3I0RA 1NOYA 4AHVA 1NK4A 4K8ZA 4CEFA 4CJ4A 3ZT4A 4CFBA 4FM2A 2KQ2A 3NGYA 3H08A 1IKVA 2JGUA 1U4BA 4KI6A 3QEVA 3D45A 1QTMA 4CJTA 4DQPA 3AV9A 1YTUA 3S3OA 1CXUA 1T7PA 3HT3A 4LSLA 1LWEA 4BDZA 3QEWA 4HCCA 1QSYA 4FJIA 2JLEA 1N5YA 4M42A 2OPSA 3SUPA 4CGFA 3TAMA 1RDAA 2XY5A 1U04A 1A5WA 4N5SA 1RILA 4IKFA 4AHTA 3ZT1A 1LAWA 3CG7A 1SL2A 3WNFA 4LD0A 4CJKA 4KHSA 4KRFA 4O55A 1UWBA 3AVMA 4LSNA 3KD1E 1IKWA 2YNHA 3RWUA 1WSFA 4CFDA 3ZT0A 4CHZA 3LP0A 3S3NA 2YNFA 4Z4GA 3QNOA 2WOMA 2GBZA 2HNDA 2FBXA 4OKJA 3OS2A 4BE0A 4CCHA 3DRPA 4M3YA 1XWLA 5J2NA 4DTRA 4AILC 3CM6A 3QEPA 4BWJA 2NUBA 3VN5A 3OYDA 2XHBA 1WAFA 4AH9A 1TKTA 3QNNA 3PX4A 4B9NA 4FJMA 3SYZA 4YFUA 3FFIA 2BDPA 2X78A 4PWDA 1XC9A 3G10A 4Z4CA 5E41A 2KFZA 3IRXA 1J9AA 1KVCA 3VQAA 4DQIA 3ZSQA 1HQEA 4FXDA 4EZ6A 3PX0A 4YNQA 3S9HA 3AVJA 3V9XA 5CY4A 1JLAA 1I3AA 1S5JA 3LWLA 1WN7A 1A5VA 4CJ3A 3SQ2A 1Y97A 4M3WA 1WSGA 2OZSA 4HVJA 3DI6A 4QAGA 3TARA 2I5JA 3DRSA 4KHQA 2ZD1A 1Q9YA 1RTJA 1RTHA 3LP3A 1RBRA 2OPPA 3L8BA 5C42A 2D0BA 2W42A 2VWKA 4Z0UA 3OJSA 3P83D 1HJRA 4KTZA 1C0TA 1T03A 1L3UA 5FRMA 1TKZA 2DFFA 2YKMA 4CIGA 1S1UA 3HXMA 4FM0A 1NKCA 4E0DA 5FRNA 1NK0A 2F96A 1FKPA 1U47A 1WSIA 3DMJA 3V81A 1VRUA 1C0MA 3LDSA 4GW6A 1ZBIA 1B9FA 2RPIA 4B8AB 2ITGA 1KRPA 3K5OA 1VSLA 3DLEA 4Q5VA 4JS4A 2P51A 4CHNA 2OA8A 1JLBA 3OYEA 2EHGA 2D0CA 4NCBA 4CFAA 3QIPA 4CF9A 4DTXA 1U48A 4N47A 3PO4A 3AVIA 2IGIA 4IBNA 4IDKA 4B08A 3KLEA 1L3SA 3TWHA 4CJEA 1SKSA 3SCXA 1JXEA 4DF4A 1U49A 1G15A 2KZMA 3ZSXA 1JLCA 1IG9A 2RF2A 1NKBA 4FJGA 4CJFA 4KFBA 2HHQA 1S1TA 3HVTA 4KTQA 1LW0A 3IG1A 4NYNA 3SPYA 1VSJA 3KJVA 3TI0A 3SQ1A 5HRNA 3NAEA 4RW8A 3TAPA 2GV9A 3RMCA 1NJZA 3O3GA 4EP5A 1ASVA 3WNGA 1RTIA 3RTVA 2G8IA 2R7YA 3LAMA 4B8CA 1QS4A 1YVUA 4F3TA 2HW3A 1HYVA 4IFYA 4W5RA 1TK0A 4KPYA 1Q8IA 3QESA 2XY6A 4CJVA 4FJ7A 4DTJA 4NYFA 4C8MA 1C6VA 2FBTA 3AO2A 3BDPA 4KKOA 3AA4A 4FK4A 3DLRA 4OJRA 4CJWA 1LW2A 1QSSA 2HHSA 4W5TA 4Z4FA 1JLGA 1RT2A 1GOCA 4FJ5A 3QEIA 1C0UA 2XY7A 4I2PA 4DMNA 3NH0A 1HNVA 1RT4A 2HHUA 3V1OA 1XI1A 2X6SA 4CFCA 3K57A 4DSLA 3M8SA 1S1XA 3OYGA 1RT5A 1J53A 2LSNA 1VSDA 2BE2A 3KKSA 5SWMA 5KRSA 4DU3A 4RG8A 5HP1A 2DTUA 4W5OA 3KK2A 3DRRA 3IS9A 3ZSOA 3SV3A 4MFBA 1ZBHA 4ZTJA 4PUOA 4W5NA 4DSJA 4FLXA 1HQUA 4O5BA 2G8VA 4DQSA 3QERA 5DK5A 3KLIA 4KV8A 1NJYA 3OVNA 4OLBA 1TV6A 3O3FA 4ZHRA 3K59A 1L3VA 4KB0A 4O4GA 3U3GA 5C24A 3HPHA 3KLGA 4CF2A 2KW4A 4B9LA 1NK9A 4C8NA 3ZCMA 3TAGA 5KI6A 1JLQA 3V9WA 2XRIA 3DYAA 3JYTA 4DLGA 1UA0A 1N6QA 3C6UA 2FC0A 4CK1A 3OYMA 4ID1A 4E7LA 1D5AA 4Y1CA 4E1NA 4CHYA 1WNSA 3ASMA 3QINA 4JRQA 1R0AA 3KTQA 4DF8A 2AJQA 1WAJA 3AO3A 2F8SA 1HRHA 3ZT2A 2Z1GA 4E19A 4ELUA 1X9SA 2HNYA 4CE9A 3CYMA 3OYAA 4PA1A 4FJHA 2OPRA 4FVMA 2BANA 1HNIA 3HPGA 3HP9A 3K5NA 2E6MA 1YT3A 1NOZA 4DU4A 1T8EA 1RTDA 4GVMA 3LP2A 1HMVA 3DLHA 3VQ8A 5T7BA 1RBVA 4B3OA 3LAKA 4O0JA 2O4IA 4CK2A 3AVHA 1EETA 5KGWA 4BWMA 1NK6A 1K6YA 3LPUA 5HBMA 1WSEA 1SUQA 3V1RA 1JLEA 4IG0A 2XO7A 4E89A 3SI6A 2HB5A 1VSIA 1TGOA 3HSTB 1W9HA 5J1EA 2HHXA 1SKWA 1I39A 4DWIA 1Q9XA 2GUIA 4CEBA 1QSLA 1SL1A 2E4LA 1B92A 3QLHA 3AVAA 3DLGA 1X9MA 4FK2A 2HHWA 3AVNA 3KIOA 4FLYA 3AVLA 2RN2A 1SL0A 4KB1A 1VSMA 1CXQA 2OPQA 4FLUA 2HNZA 3KKRA 5CYMA 4AHUA 4KHYA 3C6TA 4OGEA 1BQMA 4JRPA 4KREA 3NBPA 3B6OA 3VQ9A 3QETA 4PY5A 1C1BA 3L2UA 3AA2A 4CECA 4HHTA 3TAEA 1DTQA 1RBUA 3T19A 3SNNA 4M3ZA 3P1GA 2VWJA 1C1AA 4DFMA 1FK9A 3E01A 5SZTA 4FZYA 4LY7A 1RT7A 3U3YA 2KFNA 4NCGA 5FDLA 3EY1A 1XHZA 2PY5A 4FJJA 2YHBA 4N41A 1JL1A 3AVBA 1QQCA 2A1RA 3OYNA 3THVA 3DLBA 4DG1A 4B9TA 1IKYA 1VSFA 1DLOA 2QK9A 4ID5A 3C95A 1D9FA 2P5GA 2FBVA 1EX4A 4N56A 2G8HA 3NCIA 4FJ9A 4BE2A 1L5UA 3OS0A 4N76A 1BI4B 1FXXA 3KLHA 4KI4A 1GOAA 1BISA 1JL2A 4H8KA 3ZT3A 1TKDA 4FLWA 2OZMA 4JLHA 3V1QA 1TL3A 4M3RA 4M3UA 4F3OA 2DFHA 4CIEA 3RMBA 1RT3A 3CM5A 3SJJA 1BI4A 3K5MA 2PZSA 1KFSA 4DTNA 5HLFA 3JSMA 4FLTA 1LV5A 4CJPA 3MXIA 1JLFA 2P5OA 4CHPA 3CFOA 1KTQA 4M3XA 4PQUA 2ATQA 1RDBA 4CIFA 3M8RA 5KRTA 3LZJA 4H4OA 5KTQA 1RT1A 1RCHA 4B9UA 1HPZA 4IFVA 4M45A 4DTSA 4DTUA 2Y1IA 1ZBLA 4KAZA 3EYZA 1SV5A 3MEDA 4CEDA 4EZ9A 3VQBA 4RW6A 2X74A 3OYFA 1WSHA 3HJFA 3DLKA 3WNHA 1W0HA 3S3MA 3VQ6A 4I9LA 4RW4A 1ASWA 4DQQA 3NF9A 4HUEA 4FJXA 3M8PA 3AVKA 4XIUA 3F9KA 4KO0A 4JS5A 5D3GA 3C94A 3QO9A 3OYLA 3AA5X 2IOCA 3L2WA 1RBTA 3PV8A 4HUGA 3O4QA 4CEOA 5DMRA 3TR8A 2YHAA 4DLEA 3DOKA 3HYFA 1KVBA 5HRSA 4E1MA 3OYIA 3MEEA 4CJLA 4BE1A 3F73A 2YNIA 4OVLA 4OPJA 4HTUA 2B4JA 3ITHA 2IC3A 1B9DA 3AA3A 4MQ3A 4B9VA 4M3TA 3SZ2A 5J2MA 2KTQA 3LPTA 3PO5A 1S9EA 3EZ5A 3NH1A 4CF0A 2QXFA 4NCAA 3AO4A 4G1QA 3G0ZA 3VQQA 5CZ1A 4W5QA 4FW2A 4BDPA 3L2VA 3UIQA 3ZSRA 4E7IA 4CK3A 1RDDA 1EP4A 4R5PA 3B6PA 3TAQA 3KK1A 2D0AA 2G8FA 1LWCA 1VSHA 4HCBA 4DQRA 3NH2A 4DS5A 3L2QA 3AVFA 4DSIA 4Z4IA 3HO1A 4IG3A 2QKKA 2EX3A 4CGHA 1X9WA 3MXJA 3PX6A 2IS3A 2KZZA 4CJRA 4RW9A 2D5RA 4DTMA 3VQEA 4LH4A 2RKIA 1NKEA 4J2AA 1KFDA 5J2QA 1NK8A 3VQCA 1ZBUA 4ICLA 4E3SA 1WLJA 2F8TA 4O0IA 5I42A 1RNHA 2PYJA 2O4GA 4K8XA 3NE6A 5FROA 4CF8A 3LANA 2FBYA 1FKOA 3VQ7A 4CHQA 3DM2A 4FYDA 4OKKA 4AHCA 1S9GA 2XY8A 3SUOA 4AHSA 5KGXA 3K58A 4DSFA 3SUQA 1IH7A 2DY4A 1ITGA 2YV0X 3ULDA 3RR7A 5CZ2A 4DSEA 2VG5A 5JS1A 4Z4HA 4M41A 4DFJA 3NF6A 4GMJB 5I3UA 4DTOA 1ASUA 2YNGA 3HP6A 2ZQBA 2Z1JA 3ISNC 1RBSA 5EU7A 3ZSVA 4CERA 3O3HA 1NK5A 1S6QA 2DFEA 1BHLA 4ELTA 3HL8A 1F21A 2QKBA 3I8DA 1WSJA 3MAQA 1NJWA 5K14A 1LAVA 3PUFA 1KLMA 3KLFA 3CQ8A 5C25A 3V4IA 3SQ4A 2Z1IA 1CZBA 1C1CA 4ZTFA 4Z4EA 2Z1HA 1TL1A 3NFAA 3V6DA 1TKXA 2Q3SA 4CHOA 3NHGA 3OYKA 3TABA 1HYZA 3L2RA 4LH5A 1UA1A 2HHTA 3VQ5A 4I7FA 3LALA 5JS2A 3KD5E 1IO2A 3VQDA 1S1WA 4DSKA 3NF7A 4Y1DA 1Z26A 4L8RB 4TSXA 1BQNA 3O4NA 3RRHA 1D9DA 4I9QA 3MECA 3WNEA 3OYBA 1J5OA 1L3TA 3L3VA 4B9SA 4OLAA 4FW1A 3ZSZA 3MXMA 3DOLA 3QEXA 3I0SA 2ZE2A 4BDYA 1J54A 3OY9A 3AO5A 1TAUA 1BIUA 2E6LA 4KHNA 3CFPA 2IDOA 3AO1A 3HPOA 1YTAA 4FJNA 4FK0A 1NJXA 3K2PA 4CJUA 3SV4A 4DFKA 1VK0A 1VRTA 1S6PA 4CGJA 3HVRA 1KSPA 4E7JA 1MU2A 3A2FA 3ZSYA 3PY8A 3NDKA 4J2DA 1BL3A 2B6AA 2G8WA 4FZZA 3LZIA 1ZYQA 4J2BA 1RDCA 4CJSA 3SPZA 1A5XA 4FM1A 2VG6A 3VA0A 2G8UA 4OPKA 3L3UA 3RMDA 4F8RA 3VQPA 5HRPA 4C8KA 3RRGA 4QOZB 4QCLA 4F4KA 3V9ZA 3K5LA 3NGIA 3VA3A 3RR8A 3SUNA 4I2QA 1BGXT 1D8YA 3SQ0A 4CEQA 3OYHA 4DTPA 4KHUA 4KHWA 4FJLA 4B9MA 2X6NA 3OYJA 3T3FA 4C8OA 4DU1A 3HK2A 3VQ4A 2PYLA 3LP1A 4CJQA 4F2SA 1Z25A 3QIOA 3KK3A 4CJ5A 4FLVA 1U45A 1KLNA 1O1WA 3P5JA 2HVIA 4OKEA 1GOBA 1UAXA 4HUFA 4O44A 3CFRA 4CEZA 1ZBFA 4J2EA 1JKHA 2G8KA 3NF8A 4DFPA 2B5JA 4E7KA 1DTTA 4Q0BA 5J2PA 1VSKA 1NK7A 5HROA 4FJKA 1T05A 3OS1A 2BGGA 4F2RA 2A1SA 1RT6A 4CEAA 4CESA 4UQGA 1CLQA 4FJ8A 3LWMA 4C8LA 3TAFA 4E7HA 3D0PA 1TK5A 1SKRA 4OGCA 1X1PA 4KTWA 4CF1A 4FCYA 3BGRA 2P1JA 3ALYA 3AVCA 4WE1A 3U6FA 2ETJA 1JXBA 1VSEA 1TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAN A;  1EKE A;  4H4M A;  4CGG A;  2WON A;  5HRR A;  3NGZ A;  1QE1 A;  3V9U A;  4CEE A;  4ELV A;  2HHV A;  1REV A;  1EXQ A;  3V9S A;  2Y1J A;  1CZ9 A;  1BCO A;  1KCF A;  3ZSW A;  1TAQ A;  3T1A A;  1QHT A;  4DS4 A;  4FLZ A;  3RMA A;  2OYQ A;  2HMI A;  1HYS A;  4FZX C;  4EP4 A;  1KVA A;  1TK8 A;  4RW7 A;  3IAY A;  1LWF A;  1XHX A;  4AHR A;  1BCM A;  1UOC A;  1S1V A;  4CGI A;  2YKN A;  2IAJ A;  2VG7 A;  3HM9 A;  2HVH A;  4CGD A;  5CYQ A;  3OYC A;  3MEG A;  3AVG A;  3M8Q A;  3OJU A;  4BAC A;  1BIZ A;  1IKX A;  3I0R A;  1NOY A;  4AHV A;  1NK4 A;  4K8Z A;  4CEF A;  4CJ4 A;  3ZT4 A;  4CFB A;  4FM2 A;  2KQ2 A;  3NGY A;  3H08 A;  1IKV A;  2JGU A;  1U4B A;  4KI6 A;  3QEV A;  3D45 A;  1QTM A;  4CJT A;  4DQP A;  3AV9 A;  1YTU A;  3S3O A;  1CXU A;  1T7P A;  3HT3 A;  4LSL A;  1LWE A;  4BDZ A;  3QEW A;  4HCC A;  1QSY A;  4FJI A;  2JLE A;  1N5Y A;  4M42 A;  2OPS A;  3SUP A;  4CGF A;  3TAM A;  1RDA A;  2XY5 A;  1U04 A;  1A5W A;  4N5S A;  1RIL A;  4IKF A;  4AHT A;  3ZT1 A;  1LAW A;  3CG7 A;  1SL2 A;  3WNF A;  4LD0 A;  4CJK A;  4KHS A;  4KRF A;  4O55 A;  1UWB A;  3AVM A;  4LSN A;  3KD1 E;  1IKW A;  2YNH A;  3RWU A;  1WSF A;  4CFD A;  3ZT0 A;  4CHZ A;  3LP0 A;  3S3N A;  2YNF A;  4Z4G A;  3QNO A;  2WOM A;  2GBZ A;  2HND A;  2FBX A;  4OKJ A;  3OS2 A;  4BE0 A;  4CCH A;  3DRP A;  4M3Y A;  1XWL A;  5J2N A;  4DTR A;  4AIL C;  3CM6 A;  3QEP A;  4BWJ A;  2NUB A;  3VN5 A;  3OYD A;  2XHB A;  1WAF A;  4AH9 A;  1TKT A;  3QNN A;  3PX4 A;  4B9N A;  4FJM A;  3SYZ A;  4YFU A;  3FFI A;  2BDP A;  2X78 A;  4PWD A;  1XC9 A;  3G10 A;  4Z4C A;  5E41 A;  2KFZ A;  3IRX A;  1J9A A;  1KVC A;  3VQA A;  4DQI A;  3ZSQ A;  1HQE A;  4FXD A;  4EZ6 A;  3PX0 A;  4YNQ A;  3S9H A;  3AVJ A;  3V9X A;  5CY4 A;  1JLA A;  1I3A A;  1S5J A;  3LWL A;  1WN7 A;  1A5V A;  4CJ3 A;  3SQ2 A;  1Y97 A;  4M3W A;  1WSG A;  2OZS A;  4HVJ A;  3DI6 A;  4QAG A;  3TAR A;  2I5J A;  3DRS A;  4KHQ A;  2ZD1 A;  1Q9Y A;  1RTJ A;  1RTH A;  3LP3 A;  1RBR A;  2OPP A;  3L8B A;  5C42 A;  2D0B A;  2W42 A;  2VWK A;  4Z0U A;  3OJS A;  3P83 D;  1HJR A;  4KTZ A;  1C0T A;  1T03 A;  1L3U A;  5FRM A;  1TKZ A;  2DFF A;  2YKM A;  4CIG A;  1S1U A;  3HXM A;  4FM0 A;  1NKC A;  4E0D A;  5FRN A;  1NK0 A;  2F96 A;  1FKP A;  1U47 A;  1WSI A;  3DMJ A;  3V81 A;  1VRU A;  1C0M A;  3LDS A;  4GW6 A;  1ZBI A;  1B9F A;  2RPI A;  4B8A B;  2ITG A;  1KRP A;  3K5O A;  1VSL A;  3DLE A;  4Q5V A;  4JS4 A;  2P51 A;  4CHN A;  2OA8 A;  1JLB A;  3OYE A;  2EHG A;  2D0C A;  4NCB A;  4CFA A;  3QIP A;  4CF9 A;  4DTX A;  1U48 A;  4N47 A;  3PO4 A;  3AVI A;  2IGI A;  4IBN A;  4IDK A;  4B08 A;  3KLE A;  1L3S A;  3TWH A;  4CJE A;  1SKS A;  3SCX A;  1JXE A;  4DF4 A;  1U49 A;  1G15 A;  2KZM A;  3ZSX A;  1JLC A;  1IG9 A;  2RF2 A;  1NKB A;  4FJG A;  4CJF A;  4KFB A;  2HHQ A;  1S1T A;  3HVT A;  4KTQ A;  1LW0 A;  3IG1 A;  4NYN A;  3SPY A;  1VSJ A;  3KJV A;  3TI0 A;  3SQ1 A;  5HRN A;  3NAE A;  4RW8 A;  3TAP A;  2GV9 A;  3RMC A;  1NJZ A;  3O3G A;  4EP5 A;  1ASV A;  3WNG A;  1RTI A;  3RTV A;  2G8I A;  2R7Y A;  3LAM A;  4B8C A;  1QS4 A;  1YVU A;  4F3T A;  2HW3 A;  1HYV A;  4IFY A;  4W5R A;  1TK0 A;  4KPY A;  1Q8I A;  3QES A;  2XY6 A;  4CJV A;  4FJ7 A;  4DTJ A;  4NYF A;  4C8M A;  1C6V A;  2FBT A;  3AO2 A;  3BDP A;  4KKO A;  3AA4 A;  4FK4 A;  3DLR A;  4OJR A;  4CJW A;  1LW2 A;  1QSS A;  2HHS A;  4W5T A;  4Z4F A;  1JLG A;  1RT2 A;  1GOC A;  4FJ5 A;  3QEI A;  1C0U A;  2XY7 A;  4I2P A;  4DMN A;  3NH0 A;  1HNV A;  1RT4 A;  2HHU A;  3V1O A;  1XI1 A;  2X6S A;  4CFC A;  3K57 A;  4DSL A;  3M8S A;  1S1X A;  3OYG A;  1RT5 A;  1J53 A;  2LSN A;  1VSD A;  2BE2 A;  3KKS A;  5SWM A;  5KRS A;  4DU3 A;  4RG8 A;  5HP1 A;  2DTU A;  4W5O A;  3KK2 A;  3DRR A;  3IS9 A;  3ZSO A;  3SV3 A;  4MFB A;  1ZBH A;  4ZTJ A;  4PUO A;  4W5N A;  4DSJ A;  4FLX A;  1HQU A;  4O5B A;  2G8V A;  4DQS A;  3QER A;  5DK5 A;  3KLI A;  4KV8 A;  1NJY A;  3OVN A;  4OLB A;  1TV6 A;  3O3F A;  4ZHR A;  3K59 A;  1L3V A;  4KB0 A;  4O4G A;  3U3G A;  5C24 A;  3HPH A;  3KLG A;  4CF2 A;  2KW4 A;  4B9L A;  1NK9 A;  4C8N A;  3ZCM A;  3TAG A;  5KI6 A;  1JLQ A;  3V9W A;  2XRI A;  3DYA A;  3JYT A;  4DLG A;  1UA0 A;  1N6Q A;  3C6U A;  2FC0 A;  4CK1 A;  3OYM A;  4ID1 A;  4E7L A;  1D5A A;  4Y1C A;  4E1N A;  4CHY A;  1WNS A;  3ASM A;  3QIN A;  4JRQ A;  1R0A A;  3KTQ A;  4DF8 A;  2AJQ A;  1WAJ A;  3AO3 A;  2F8S A;  1HRH A;  3ZT2 A;  2Z1G A;  4E19 A;  4ELU A;  1X9S A;  2HNY A;  4CE9 A;  3CYM A;  3OYA A;  4PA1 A;  4FJH A;  2OPR A;  4FVM A;  2BAN A;  1HNI A;  3HPG A;  3HP9 A;  3K5N A;  2E6M A;  1YT3 A;  1NOZ A;  4DU4 A;  1T8E A;  1RTD A;  4GVM A;  3LP2 A;  1HMV A;  3DLH A;  3VQ8 A;  5T7B A;  1RBV A;  4B3O A;  3LAK A;  4O0J A;  2O4I A;  4CK2 A;  3AVH A;  1EET A;  5KGW A;  4BWM A;  1NK6 A;  1K6Y A;  3LPU A;  5HBM A;  1WSE A;  1SUQ A;  3V1R A;  1JLE A;  4IG0 A;  2XO7 A;  4E89 A;  3SI6 A;  2HB5 A;  1VSI A;  1TGO A;  3HST B;  1W9H A;  5J1E A;  2HHX A;  1SKW A;  1I39 A;  4DWI A;  1Q9X A;  2GUI A;  4CEB A;  1QSL A;  1SL1 A;  2E4L A;  1B92 A;  3QLH A;  3AVA A;  3DLG A;  1X9M A;  4FK2 A;  2HHW A;  3AVN A;  3KIO A;  4FLY A;  3AVL A;  2RN2 A;  1SL0 A;  4KB1 A;  1VSM A;  1CXQ A;  2OPQ A;  4FLU A;  2HNZ A;  3KKR A;  5CYM A;  4AHU A;  4KHY A;  3C6T A;  4OGE A;  1BQM A;  4JRP A;  4KRE A;  3NBP A;  3B6O A;  3VQ9 A;  3QET A;  4PY5 A;  1C1B A;  3L2U A;  3AA2 A;  4CEC A;  4HHT A;  3TAE A;  1DTQ A;  1RBU A;  3T19 A;  3SNN A;  4M3Z A;  3P1G A;  2VWJ A;  1C1A A;  4DFM A;  1FK9 A;  3E01 A;  5SZT A;  4FZY A;  4LY7 A;  1RT7 A;  3U3Y A;  2KFN A;  4NCG A;  5FDL A;  3EY1 A;  1XHZ A;  2PY5 A;  4FJJ A;  2YHB A;  4N41 A;  1JL1 A;  3AVB A;  1QQC A;  2A1R A;  3OYN A;  3THV A;  3DLB A;  4DG1 A;  4B9T A;  1IKY A;  1VSF A;  1DLO A;  2QK9 A;  4ID5 A;  3C95 A;  1D9F A;  2P5G A;  2FBV A;  1EX4 A;  4N56 A;  2G8H A;  3NCI A;  4FJ9 A;  4BE2 A;  1L5U A;  3OS0 A;  4N76 A;  1BI4 B;  1FXX A;  3KLH A;  4KI4 A;  1GOA A;  1BIS A;  1JL2 A;  4H8K A;  3ZT3 A;  1TKD A;  4FLW A;  2OZM A;  4JLH A;  3V1Q A;  1TL3 A;  4M3R A;  4M3U A;  4F3O A;  2DFH A;  4CIE A;  3RMB A;  1RT3 A;  3CM5 A;  3SJJ A;  1BI4 A;  3K5M A;  2PZS A;  1KFS A;  4DTN A;  5HLF A;  3JSM A;  4FLT A;  1LV5 A;  4CJP A;  3MXI A;  1JLF A;  2P5O A;  4CHP A;  3CFO A;  1KTQ A;  4M3X A;  4PQU A;  2ATQ A;  1RDB A;  4CIF A;  3M8R A;  5KRT A;  3LZJ A;  4H4O A;  5KTQ A;  1RT1 A;  1RCH A;  4B9U A;  1HPZ A;  4IFV A;  4M45 A;  4DTS A;  4DTU A;  2Y1I A;  1ZBL A;  4KAZ A;  3EYZ A;  1SV5 A;  3MED A;  4CED A;  4EZ9 A;  3VQB A;  4RW6 A;  2X74 A;  3OYF A;  1WSH A;  3HJF A;  3DLK A;  3WNH A;  1W0H A;  3S3M A;  3VQ6 A;  4I9L A;  4RW4 A;  1ASW A;  4DQQ A;  3NF9 A;  4HUE A;  4FJX A;  3M8P A;  3AVK A;  4XIU A;  3F9K A;  4KO0 A;  4JS5 A;  5D3G A;  3C94 A;  3QO9 A;  3OYL A;  3AA5 X;  2IOC A;  3L2W A;  1RBT A;  3PV8 A;  4HUG A;  3O4Q A;  4CEO A;  5DMR A;  3TR8 A;  2YHA A;  4DLE A;  3DOK A;  3HYF A;  1KVB A;  5HRS A;  4E1M A;  3OYI A;  3MEE A;  4CJL A;  4BE1 A;  3F73 A;  2YNI A;  4OVL A;  4OPJ A;  4HTU A;  2B4J A;  3ITH A;  2IC3 A;  1B9D A;  3AA3 A;  4MQ3 A;  4B9V A;  4M3T A;  3SZ2 A;  5J2M A;  2KTQ A;  3LPT A;  3PO5 A;  1S9E A;  3EZ5 A;  3NH1 A;  4CF0 A;  2QXF A;  4NCA A;  3AO4 A;  4G1Q A;  3G0Z A;  3VQQ A;  5CZ1 A;  4W5Q A;  4FW2 A;  4BDP A;  3L2V A;  3UIQ A;  3ZSR A;  4E7I A;  4CK3 A;  1RDD A;  1EP4 A;  4R5P A;  3B6P A;  3TAQ A;  3KK1 A;  2D0A A;  2G8F A;  1LWC A;  1VSH A;  4HCB A;  4DQR A;  3NH2 A;  4DS5 A;  3L2Q A;  3AVF A;  4DSI A;  4Z4I A;  3HO1 A;  4IG3 A;  2QKK A;  2EX3 A;  4CGH A;  1X9W A;  3MXJ A;  3PX6 A;  2IS3 A;  2KZZ A;  4CJR A;  4RW9 A;  2D5R A;  4DTM A;  3VQE A;  4LH4 A;  2RKI A;  1NKE A;  4J2A A;  1KFD A;  5J2Q A;  1NK8 A;  3VQC A;  1ZBU A;  4ICL A;  4E3S A;  1WLJ A;  2F8T A;  4O0I A;  5I42 A;  1RNH A;  2PYJ A;  2O4G A;  4K8X A;  3NE6 A;  5FRO A;  4CF8 A;  3LAN A;  2FBY A;  1FKO A;  3VQ7 A;  4CHQ A;  3DM2 A;  4FYD A;  4OKK A;  4AHC A;  1S9G A;  2XY8 A;  3SUO A;  4AHS A;  5KGX A;  3K58 A;  4DSF A;  3SUQ A;  1IH7 A;  2DY4 A;  1ITG A;  2YV0 X;  3ULD A;  3RR7 A;  5CZ2 A;  4DSE A;  2VG5 A;  5JS1 A;  4Z4H A;  4M41 A;  4DFJ A;  3NF6 A;  4GMJ B;  5I3U A;  4DTO A;  1ASU A;  2YNG A;  3HP6 A;  2ZQB A;  2Z1J A;  3ISN C;  1RBS A;  5EU7 A;  3ZSV A;  4CER A;  3O3H A;  1NK5 A;  1S6Q A;  2DFE A;  1BHL A;  4ELT A;  3HL8 A;  1F21 A;  2QKB A;  3I8D A;  1WSJ A;  3MAQ A;  1NJW A;  5K14 A;  1LAV A;  3PUF A;  1KLM A;  3KLF A;  3CQ8 A;  5C25 A;  3V4I A;  3SQ4 A;  2Z1I A;  1CZB A;  1C1C A;  4ZTF A;  4Z4E A;  2Z1H A;  1TL1 A;  3NFA A;  3V6D A;  1TKX A;  2Q3S A;  4CHO A;  3NHG A;  3OYK A;  3TAB A;  1HYZ A;  3L2R A;  4LH5 A;  1UA1 A;  2HHT A;  3VQ5 A;  4I7F A;  3LAL A;  5JS2 A;  3KD5 E;  1IO2 A;  3VQD A;  1S1W A;  4DSK A;  3NF7 A;  4Y1D A;  1Z26 A;  4L8R B;  4TSX A;  1BQN A;  3O4N A;  3RRH A;  1D9D A;  4I9Q A;  3MEC A;  3WNE A;  3OYB A;  1J5O A;  1L3T A;  3L3V A;  4B9S A;  4OLA A;  4FW1 A;  3ZSZ A;  3MXM A;  3DOL A;  3QEX A;  3I0S A;  2ZE2 A;  4BDY A;  1J54 A;  3OY9 A;  3AO5 A;  1TAU A;  1BIU A;  2E6L A;  4KHN A;  3CFP A;  2IDO A;  3AO1 A;  3HPO A;  1YTA A;  4FJN A;  4FK0 A;  1NJX A;  3K2P A;  4CJU A;  3SV4 A;  4DFK A;  1VK0 A;  1VRT A;  1S6P A;  4CGJ A;  3HVR A;  1KSP A;  4E7J A;  1MU2 A;  3A2F A;  3ZSY A;  3PY8 A;  3NDK A;  4J2D A;  1BL3 A;  2B6A A;  2G8W A;  4FZZ A;  3LZI A;  1ZYQ A;  4J2B A;  1RDC A;  4CJS A;  3SPZ A;  1A5X A;  4FM1 A;  2VG6 A;  3VA0 A;  2G8U A;  4OPK A;  3L3U A;  3RMD A;  4F8R A;  3VQP A;  5HRP A;  4C8K A;  3RRG A;  4QOZ B;  4QCL A;  4F4K A;  3V9Z A;  3K5L A;  3NGI A;  3VA3 A;  3RR8 A;  3SUN A;  4I2Q A;  1BGX T;  1D8Y A;  3SQ0 A;  4CEQ A;  3OYH A;  4DTP A;  4KHU A;  4KHW A;  4FJL A;  4B9M A;  2X6N A;  3OYJ A;  3T3F A;  4C8O A;  4DU1 A;  3HK2 A;  3VQ4 A;  2PYL A;  3LP1 A;  4CJQ A;  4F2S A;  1Z25 A;  3QIO A;  3KK3 A;  4CJ5 A;  4FLV A;  1U45 A;  1KLN A;  1O1W A;  3P5J A;  2HVI A;  4OKE A;  1GOB A;  1UAX A;  4HUF A;  4O44 A;  3CFR A;  4CEZ A;  1ZBF A;  4J2E A;  1JKH A;  2G8K A;  3NF8 A;  4DFP A;  2B5J A;  4E7K A;  1DTT A;  4Q0B A;  5J2P A;  1VSK A;  1NK7 A;  5HRO A;  4FJK A;  1T05 A;  3OS1 A;  2BGG A;  4F2R A;  2A1S A;  1RT6 A;  4CEA A;  4CES A;  4UQG A;  1CLQ A;  4FJ8 A;  3LWM A;  4C8L A;  3TAF A;  4E7H A;  3D0P A;  1TK5 A;  1SKR A;  4OGC A;  1X1P A;  4KTW A;  4CF1 A;  4FCY A;  3BGR A;  2P1J A;  3ALY A;  3AVC A;  4WE1 A;  3U6F A;  2ETJ A;  1JXB A;  1VSE A;  1TVR A; 
#chains in the Genus database with same CATH topology
 2WON A;  4CEE A;  4ELV A;  2Y1J A;  3ULE A;  2ZJP L;  1BCO A;  2NRX A;  3C6A A;  2WFB A;  3IAY A;  1LWF A;  4AHR A;  5BN8 A;  4CGI A;  2YKN A;  1V4T A;  2HVH A;  1HNZ K;  1WBB A;  2VQE K;  2P9P A;  4BAC A;  3I0R A;  4LF4 K;  4AHV A;  1NK4 A;  4K8Z A;  4CEF A;  4CJ4 A;  4JK9 A;  5LJW A;  1IKV A;  3D45 A;  1CXU A;  3H3O B;  4LSL A;  1NGE A;  2VGM A;  3QEW A;  3VTH A;  2JLE A;  2E2Q A;  4CGF A;  4DR4 K;  3TAM A;  3ZET B;  5TKW A;  2NZT A;  4IKF A;  3ZT1 A;  5AFU A;  1LAW A;  3WNF A;  4LF5 K;  4KRF A;  4O55 A;  4CJ7 A;  2YNH A;  1WSF A;  2WOM A;  4O5F A;  2FBX A;  4LFC K;  1HNW K;  3NVM A;  1VQ8 N;  3OYD A;  2XHB A;  2AP1 A;  1TKT A;  3QNN A;  4B9N A;  4FJM A;  3SYZ A;  4YFU A;  1NGG A;  2P9K A;  4PWD A;  3CER A;  4CZL A;  4Z4C A;  1XC9 A;  4B3M K;  4B1V A;  1J9A A;  3VQA A;  4FXD A;  3AVJ A;  4M63 C;  3KWI A;  2FF3 B;  1A5V A;  3SQ2 A;  4M3W A;  2I5J A;  4B3T K;  5EVZ A;  2ZD1 A;  1Q9Y A;  1RTJ A;  3LP3 A;  4XH4 A;  3AAR A;  2VWK A;  4Z0U A;  1HJR A;  4KTZ A;  1C0T A;  4K43 A;  5FRM A;  2HST A;  4CIG A;  1HKC A;  5EXW A;  3D6R A;  1CZA N;  4B8A B;  3A5O C;  1KRP A;  3K5O A;  3EZW A;  4Q5V A;  1QHA A;  2P51 A;  4H5T A;  3OYE A;  4CFA A;  3QIP A;  3PO4 A;  2OAN A;  1TUY A;  4RWT A;  4CJE A;  3KZB A;  1NGF A;  4K0K K;  5AQW A;  4DF4 A;  1U49 A;  1XUP O;  4H0O A;  1NKB A;  1BWF O;  1OH8 A;  1S1T A;  3HVT A;  1LW0 A;  4NYN A;  1VSJ A;  1OVQ A;  3O9U A;  5CE3 A;  4BVO A;  3D2E A;  1RTI A;  2QWR A;  3RTV A;  1QS4 A;  2HW3 A;  4KBO A;  3VEW A;  4KPY A;  2XY6 A;  4B1U B;  4FJ7 A;  4C8M A;  4JI0 K;  1JCE A;  4KKO A;  1N32 K;  1E3M A;  4FK4 A;  4H0P A;  4YOY A;  2HHS A;  4W5T A;  3M3Z A;  1JLG A;  1GOC A;  3E1Y A;  3QEI A;  2GUP A;  4EHU A;  1C0U A;  4BRQ A;  4I2P A;  4DMN A;  4YOW A;  1VHX A;  1OKJ A;  3K57 A;  1J53 A;  5SWM A;  2BE2 A;  5HP1 A;  3CCQ N;  2QWL A;  1GLB G;  3ZSO A;  1ZBH A;  4CVN E;  1GLA G;  4ZTJ A;  5AQN A;  4FLX A;  2Q2R A;  4CW7 B;  3VF4 A;  1TV6 A;  1L3V A;  4CF2 A;  1NK9 A;  5CR4 A;  3DYA A;  3JYT A;  4DLG A;  1K8K B;  2FC0 A;  1BO5 O;  4CK1 A;  3OYM A;  4ID1 A;  4BRP A;  1D5A A;  5AQY A;  4DUZ K;  4DKW A;  5JVH L;  4DF8 A;  1WAJ A;  2QTD A;  2W40 A;  3SBG A;  4CE9 A;  4FVM A;  3HPG A;  4FPB A;  1RTD A;  3LP2 A;  3DLH A;  3VQ8 A;  3I55 N;  3LAK A;  2V7Z A;  3AVH A;  4I6M A;  3MWP A;  4BWM A;  1NK6 A;  4LF6 K;  1K6Y A;  1SUQ A;  2ITM A;  3THW B;  1JLE A;  2XO7 A;  2CH6 A;  3LL3 A;  2QXL A;  3VEO A;  4DV4 K;  2HHX A;  1QSL A;  1SL1 A;  4RTF D;  3N4Q A;  5C15 A;  3JAM O;  1P90 A;  1VSM A;  2OPQ A;  3KKR A;  3NBP A;  4DR7 K;  3QET A;  3L2U A;  3TU5 A;  4BRN A;  5I9E B;  4CEC A;  3THY B;  3TAE A;  4XH5 A;  4M3Z A;  3WXM B;  2D0P A;  2OTJ N;  3E01 A;  1RT7 A;  3I33 A;  5FDL A;  1WB9 A;  3TSP A;  2PY5 A;  1QQC A;  3DLB A;  2HMP A;  3THX B;  4B9T A;  4DQ8 A;  4LFA K;  3D7E O;  1VSF A;  1DLO A;  2O8D B;  3C95 A;  2O8C A;  2P5G A;  1EX4 A;  2BUP A;  3WEE B;  4A5A A;  3SAF A;  4LFB K;  4KI4 A;  3AY9 A;  4FLW A;  4FWO A;  2NNW A;  1YI2 N;  4F3O A;  3HI0 A;  1IBK K;  1RT3 A;  3CM5 A;  2W6L A;  1BI4 A;  3D2E B;  3K5M A;  2PZS A;  3PLA A;  4DTN A;  5HLF A;  3MXI A;  3CFO A;  1KTQ A;  4XH1 A;  1RDB A;  3VF2 A;  1RT1 A;  5E84 A;  1VQ5 N;  1NGB A;  4DTU A;  1ZBL A;  4OO1 J;  4FO0 A;  1YUW A;  3VQB A;  2IVO A;  1QQO A;  3WNH A;  4I9L A;  1ASW A;  3W0L A;  4XIU A;  4JS5 A;  5D3G A;  1RDW X;  1TYQ B;  1MDU B;  3O4Q A;  4B3S K;  4YY3 K;  3LM9 A;  4BG8 A;  3CC2 N;  3B8A X;  3ITH A;  3U4L A;  4B9V A;  3FR0 A;  3LPT A;  3U9D A;  1S9E A;  3EZ5 A;  3NH1 A;  3BZC A;  4NCA A;  1FW6 A;  1SQK A;  3L2V A;  1T6C A;  3EN9 A;  4E7I A;  4BR5 A;  4JI2 K;  3B6P A;  4A61 A;  1LWC A;  3NH2 A;  3HO1 A;  1BG3 A;  3VF6 A;  3L2Q A;  3FFK B;  5AQT A;  4RW9 A;  2D5R A;  4DTM A;  4LH4 A;  5E26 A;  1KFD A;  3C7N A;  4EIA A;  3IUC A;  3VQC A;  2WUS A;  3UKR A;  4BR2 A;  4KH6 A;  3LDP A;  4K8X A;  1YIT N;  3VQ7 A;  1FKO A;  5AFU H;  1GLE G;  2YHY A;  1VQ9 N;  3SUO A;  3K58 A;  5IWA K;  5JVG L;  1S22 A;  4MLH A;  3ULD A;  4EHT A;  3NF6 A;  1YF5 L;  4JNE A;  5I3U A;  3MCA B;  2YNG A;  3WQU A;  4OPA A;  3LDN A;  5EU7 A;  1RBS A;  2HHH K;  2P9S A;  3GE1 A;  1BHL A;  4E1J A;  1KLM A;  3KLF A;  3CQ8 A;  2JWK A;  2E20 A;  3SQ4 A;  2Z1I A;  1CZB A;  1C1C A;  4ZTF A;  4Z4E A;  1TL1 A;  3NFA A;  4V19 S;  5AZI B;  2QWO A;  4I7F A;  1QZ5 A;  4ISE A;  4BC5 A;  3NF7 A;  4IEE A;  4AM6 A;  3RRH A;  3WNE A;  3OYB A;  5AQZ A;  4NXN K;  1GLD G;  4FW1 A;  3QBX A;  2QWM A;  2O8C B;  3DOL A;  3TSQ A;  3K9J A;  1J54 A;  2O8F B;  1JCG A;  1HUX A;  1DKG D;  1YTA A;  4FJN A;  1NJX A;  3DXM A;  4X62 K;  4DFK A;  3SLC A;  2HBK A;  2HBJ A;  4YOR A;  1RDC A;  4MLE A;  4WQ4 C;  4F9O A;  5BR9 A;  4FM1 A;  1KAZ A;  3VA0 A;  1IV0 A;  2G8U A;  2UXB K;  5LL6 Z;  3RMD A;  5HRP A;  4FWM A;  3CC7 N;  3V9Z A;  4FWL A;  3RR8 A;  1VQN N;  1VQM N;  2X6N A;  1IBM K;  3H1V X;  4JKD A;  4DU1 A;  2PYL A;  1Z25 A;  1VQL N;  1C0F A;  4FLV A;  2YHW A;  1KLN A;  3CQX A;  1GOB A;  4CD1 A;  4BQZ A;  4DR5 K;  3VEN A;  2HF4 A;  1DT9 A;  2BGG A;  4F2R A;  2A1S A;  1EQY A;  3D0P A;  1SAZ A;  1TK5 A;  2HBL A;  1X1P A;  3BGR A;  3ALY A;  4WE1 A;  1VSE A;  3EKU A;  4CGG A;  5AQJ A;  2RHK A;  5HRR A;  3V9U A;  3ZYY X;  1REV A;  1EXQ A;  3V9S A;  1CZ9 A;  3EE9 A;  1KCF A;  3MN7 A;  3EKS A;  4FLZ A;  3RMA A;  2HMI A;  4FZX C;  1TK8 A;  3BF3 A;  3R1X A;  1XHX A;  5BPM A;  1Q18 A;  2AA4 A;  4JKA A;  4WQ4 A;  5CYQ A;  3OJU A;  1NOY A;  4PKI A;  1QVF M;  5KPR A;  3CHW A;  2D1K A;  2KQ2 A;  3NGY A;  4JKH A;  5FPD A;  2JGU A;  4KI6 A;  1BOT O;  3AV9 A;  3S3O A;  1LWE A;  4LF8 K;  2P9S B;  3HM8 A;  2FSN A;  3CG7 A;  1C0G A;  1SL2 A;  3D2F B;  4BGB A;  3CCU N;  1ZBS A;  4WQ5 C;  3ZET A;  3KD1 E;  3RWU A;  3ZT0 A;  4CHZ A;  3S3N A;  1EWR A;  2HND A;  4K41 A;  3O1W A;  3G71 N;  4BE0 A;  4CCH A;  2Q36 A;  1XWL A;  5J2N A;  3CM6 A;  5GIN A;  4BWJ A;  3VN5 A;  2ZJR L;  3PX4 A;  3ZX2 A;  3FFI A;  2BDP A;  2X78 A;  3G10 A;  1IJJ A;  2HBM A;  5E41 A;  4JYA K;  5HL7 L;  2GEM A;  1GLC G;  4DQI A;  1Z05 A;  3ZSQ A;  4EZ6 A;  4YNQ A;  3S9H A;  3CJA A;  1JLA A;  1I3A A;  1E4F T;  3M1F A;  2OZS A;  4KHQ A;  4HVJ A;  3VEV A;  3DRS A;  4PL8 A;  3L8B A;  5AQO A;  3I56 N;  2A41 A;  4H5R A;  3OJS A;  5JLH A;  1YXQ A;  2YKM A;  5FRN A;  1KXP A;  4RCH A;  1WSI A;  3DMJ A;  1VRU A;  5BRF A;  1ZBI A;  4GW6 A;  2F9T A;  1B9F A;  3O08 A;  5EX5 A;  3DLE A;  3MN9 A;  4JS4 A;  2OA8 A;  1JLB A;  2EHG A;  4NCB A;  4DTX A;  1XNR K;  2FSK A;  4B08 A;  4BRH A;  3JS6 A;  3KLE A;  3SCX A;  4BRE A;  5MLC Q;  2DPN A;  4WQ5 A;  1QQN A;  4FVU A;  1JLC A;  2RF2 A;  3H1Q A;  5AR0 A;  2HF3 A;  4CJF A;  4HWI A;  2HHQ A;  4BRO A;  3SPY A;  2GTD A;  3SK3 A;  3SQ1 A;  3NAE A;  1Q82 O;  5AQQ A;  3WNG A;  5AQU A;  3MK6 A;  3LAM A;  2IIR A;  1YVU A;  4B8C A;  4HTL A;  1HYV A;  3QES A;  4NYF A;  3AO2 A;  3BDP A;  3QIC A;  1U2V B;  5C12 A;  2Q31 A;  2IVN A;  3ENH A;  1GLL O;  4Z4F A;  4H03 B;  1Q81 O;  4FJ5 A;  4M7Y A;  5KPZ A;  4Y0W A;  5AQH A;  5GAE P;  4JI7 K;  1LOT B;  1XI1 A;  2UUA K;  3A8Y A;  1S1X A;  3OYG A;  4U7B A;  2LSN A;  1VSD A;  4DR1 K;  2UUC K;  3LDL A;  5KRS A;  4DU3 A;  2DTU A;  2PFU A;  3IS9 A;  3SV3 A;  1SS6 A;  3G25 A;  4PUO A;  4IXC A;  3KLI A;  4KV8 A;  2VYP A;  4BRG A;  3O3F A;  4ZHR A;  3K59 A;  3U3G A;  2KW4 A;  3CCV N;  3ZCM A;  3TAG A;  5KI6 A;  2F7T A;  2XRI A;  4YOT A;  1N6Q A;  5AZJ B;  4DV6 K;  4PHT X;  4Y1C A;  4E1N A;  4CHY A;  1WNS A;  3QIN A;  4JRQ A;  1R0A A;  1GLF O;  2EWS A;  1YVN A;  4BC4 A;  1HRH A;  1T44 A;  2Z1G A;  1K8K A;  4H5N A;  3ZT2 A;  1O13 A;  2FXU A;  3CYM A;  3K5N A;  4X65 K;  1ILY A;  4X64 K;  3ID8 A;  2E5L K;  4B3O A;  4O0J A;  4CK2 A;  2J4R A;  3LPU A;  3MN6 A;  5HBM A;  2IVP A;  1WSE A;  4NO7 A;  3V1R A;  4IG0 A;  4E89 A;  3LDQ A;  3J7A P;  2GUI A;  2E4L A;  5M1O A;  1B92 A;  3QLH A;  3UKU B;  3DLG A;  3THW A;  3AVN A;  1SL0 A;  4KB1 A;  2YX6 A;  4FWR A;  1S3X A;  4FLU A;  1W97 L;  3C6T A;  4JD2 B;  4OGE A;  4KRE A;  4PY5 A;  1YHQ N;  4IDH A;  3SNN A;  1RBU A;  3P1G A;  4WFB L;  2VWJ A;  5SZT A;  3WXI A;  2KFN A;  3EY1 A;  4FJJ A;  3THY A;  4N41 A;  3AVB A;  3WUH A;  3THV A;  3CJB A;  4K42 A;  2QK9 A;  5CHI A;  1NMD A;  2KLA A;  4FJ9 A;  4BE2 A;  1L5U A;  3OS0 A;  2ZGY A;  3THX A;  1KAY A;  3KLH A;  4N76 A;  3EE8 A;  1JL2 A;  2O8D A;  2OZM A;  4JLH A;  2NRR A;  1HX1 A;  3WEE A;  4CJP A;  1JLF A;  3CJ7 A;  1HNX K;  3M8R A;  5KRT A;  4H4O A;  5KTQ A;  2OTL N;  4B9U A;  4M45 A;  3C65 A;  1W2B M;  3MED A;  3CF5 L;  4EZ9 A;  4RW6 A;  3SBT A;  3VER A;  4CI6 A;  3KVG A;  2UU9 K;  3CMA N;  1W0H A;  3S3M A;  3VQ6 A;  3TTC A;  3M8P A;  3C94 A;  3OYL A;  1ATS A;  3TR8 A;  5HRS A;  4FOE A;  4CJL A;  2NRZ A;  3F73 A;  4OVL A;  2UUB K;  4GV6 A;  3F9M A;  1TYQ A;  2KTQ A;  2NRH A;  5H1S Q;  4A5B A;  4CF0 A;  3G0Z A;  3VQQ A;  5CZ1 A;  4JI3 K;  4W5Q A;  4BDP A;  2GEL A;  1EP4 A;  4CZE A;  3KK1 A;  2D0A A;  1M90 O;  1T6D A;  3AVF A;  2KZZ A;  3QFU A;  4BRF A;  3MX5 A;  1NLV A;  2RKI A;  2Q0R A;  1BA0 A;  4DUY K;  1ZBU A;  2BTF A;  4ICL A;  4DV1 K;  2F8T A;  5I42 A;  3NMU A;  2WTU A;  1RNH A;  2PYJ A;  1KQS M;  2E1Z A;  2XY8 A;  3A5M C;  3SUQ A;  4JI1 K;  1IH7 A;  2YV0 X;  3RVC A;  4DSE A;  1J5E K;  1N33 K;  4FPA A;  1ZC6 A;  5JS1 A;  4DFJ A;  3Q7C A;  3OTO K;  3ISN C;  3ZSV A;  4CER A;  5BR8 K;  1S6Q A;  1BDG A;  1N8R O;  1WSJ A;  3AAP A;  5K14 A;  2YCH A;  3PUF A;  5C2D A;  3V4I A;  4IOC L;  3V6D A;  1TKX A;  4CHO A;  1HYZ A;  3FLC O;  5AQP A;  4JN4 A;  5KQD A;  5AQS A;  3KD5 E;  1BU6 O;  3CCR N;  3KK7 A;  4MDB A;  4BRC A;  4TSX A;  5AZI A;  3BEX A;  1K73 O;  5AQG A;  4B9S A;  4WYB A;  3AGK A;  1RFQ A;  5HOO A;  4B1X B;  3K9K A;  3BP8 A;  3QML A;  1BIU A;  3CFP A;  3TTD A;  3R6M A;  3SJH A;  2ZM6 K;  3K2P A;  2O8F A;  4CGJ A;  3HVR A;  3PY8 A;  3FZK A;  1MU2 A;  4E7J A;  3NDK A;  2G8W A;  2B6A A;  3LZI A;  1ZYQ A;  5BPL A;  4JI6 K;  4CJS A;  4KHP K;  3OW2 M;  2CH5 A;  2E2N A;  3F5T A;  4OPK A;  4CZK A;  3CD6 N;  4C23 A;  4YOV A;  4QCL A;  4F4K A;  3VA3 A;  3CCL N;  3SQ0 A;  3OYH A;  4KHW A;  4KHU A;  4FJL A;  4B9M A;  4C8O A;  3HK2 A;  3LP1 A;  4F2S A;  1VQP N;  1U45 A;  1O1W A;  3RSE B;  4OKE A;  1UAX A;  3SMS A;  1ZBF A;  3FZL A;  1JKH A;  2P9U B;  2QWP A;  3NF8 A;  4DFP A;  2B5J A;  1NK7 A;  1V4S A;  4UQG A;  1CLQ A;  5ELZ A;  3TAF A;  2YHX A;  3WQT A;  1XQS C;  3OBW A;  4FCY A;  3U6F A;  4BRI A;  4GVE A;  1HPM A;  1EKE A;  3NGZ A;  1QE1 A;  2HHV A;  1X9J A;  4GKJ K;  4BC3 A;  1Q7Y O;  4EP4 A;  1KVA A;  3QB0 A;  4RW7 A;  5GAG P;  1BCM A;  2BH1 A;  1S1V A;  2NLX A;  2IAJ A;  4CBW A;  3OYC A;  3MEG A;  3AVG A;  1BIZ A;  1XNQ K;  5AQV A;  4FM2 A;  3MDQ A;  1U4B A;  5C0Y A;  4YOX A;  1QTM A;  1T7P A;  3HT3 A;  1D4X A;  1EO1 A;  1QSY A;  4M42 A;  2OPS A;  4H5V A;  3SUP A;  2P9I B;  3CPE A;  1A5W A;  1BUP A;  1LCU A;  4N5S A;  1NBW A;  1RIL A;  4AHT A;  4CJK A;  5M1N A;  2ASO A;  3CME N;  4JI8 K;  1UWB A;  3JXU A;  1IKW A;  2ZF5 O;  3LP0 A;  3QNO A;  3DAW A;  3VES A;  2GBZ A;  4OKJ A;  3OS2 A;  3D2F A;  2PAV A;  4JKE A;  1HKB A;  1EWQ A;  3DWL A;  3SMP A;  1WAF A;  3QFP A;  3O9R A;  4AH9 A;  4DV0 K;  3VTI A;  3O8M A;  2KFZ A;  4NB4 A;  4CBX A;  1KVC A;  4DV3 K;  4CJ3 A;  4IFE A;  1WSG A;  3TAR A;  4QS9 A;  1RTH A;  1JCF A;  1RBR A;  4KH4 A;  3P83 D;  1L3U A;  4JK8 A;  3VOV A;  3HXM A;  1S1U A;  4FM0 A;  3QBW A;  3GOI A;  1FKP A;  1NG9 A;  1C0M A;  3LDS A;  4A59 A;  5C10 A;  2RPI A;  4CBU A;  3VGL A;  5M1P A;  4WFN L;  3MX2 A;  2F4V K;  2A3Z A;  1HJO A;  1U48 A;  2IGI A;  1L3S A;  3TWH A;  1SKS A;  1YIJ N;  3M6G A;  4NXM K;  4BG9 A;  1IG9 A;  4FJG A;  4ILJ A;  1ATN A;  3ZEU B;  5DM7 L;  5KQ8 A;  2GWJ A;  4RW8 A;  2GV9 A;  4JI5 K;  4WCE L;  3T7Z A;  1OH6 A;  4FWN A;  5BRD A;  2R7Y A;  2RE2 A;  1Q86 O;  3CJ9 A;  2WBN A;  4W5R A;  1Q8I A;  1HLU A;  2JWL A;  1QZ6 A;  5AJ3 K;  3C6H A;  4OJR A;  4CJW A;  1LW2 A;  1QSS A;  3J7Y P;  1RT2 A;  4JHD B;  3ENB A;  1S72 N;  3ID6 A;  4G9Z A;  2XY7 A;  1U2V A;  4FWS A;  3NH0 A;  4OPH A;  1HNV A;  5EY4 A;  2HHU A;  3V1O A;  4LC9 B;  4DSL A;  4BRA A;  5FPM A;  3TPQ A;  4W5O A;  3KK2 A;  3P4I A;  4W5N A;  1NGJ A;  1HQU A;  3PSF A;  2QM1 A;  1NJY A;  4OLB A;  4O4G A;  4CZH A;  4B9L A;  2I7N A;  1JLQ A;  1UA0 A;  4A57 A;  3ASM A;  4AQY K;  2F9W A;  3KTQ A;  4E19 A;  4ELU A;  5AZJ A;  2HNY A;  4IO8 A;  4PA1 A;  2OPR A;  3R9P A;  3WT0 A;  2BAN A;  1HNI A;  3HP9 A;  1DGK N;  2O8B A;  1T8E A;  1NOZ A;  4O8U A;  4GVM A;  1T3V A;  1I94 K;  1RBV A;  3QDK A;  3K0S A;  3PIO L;  1EET A;  2V7Y A;  3GG4 A;  5KGW A;  2O8E B;  1H1V A;  5B8H A;  1TGO A;  1W9H A;  4JAX A;  5BPN A;  1I39 A;  4DWI A;  1VQ6 N;  1Q9X A;  1WOQ A;  3FZH A;  1X9M A;  1CXQ A;  4BR7 A;  2HNZ A;  1BQM A;  4JRP A;  3B6O A;  3VQ9 A;  3AA2 A;  3UKU A;  4HHT A;  1DTQ A;  3H6E A;  1VQ7 N;  3DXK B;  1OH5 A;  1FK9 A;  4JD2 A;  4AF1 A;  1QQM A;  4GV9 A;  5LJV A;  4DV7 K;  1KAX A;  2A1R A;  3OYN A;  4DG1 A;  4BRD A;  1IKY A;  3P39 A;  4BR9 A;  2E1Y A;  2D0O A;  2G8H A;  4YDU C;  3NCI A;  2VWB A;  1N36 K;  1FXX A;  1GOA A;  3ZT3 A;  4H5W A;  3V1Q A;  4M3R A;  4CIE A;  2P9L A;  2V51 B;  1SZ2 A;  3H46 O;  3Q7B A;  1DEJ A;  3JSM A;  4FLT A;  4ISF A;  2P5O A;  3FE1 A;  4CHP A;  2ATQ A;  2OCE A;  4CIF A;  3LZJ A;  1IG8 A;  3PSI A;  3VEZ A;  1U6Z A;  2Y1I A;  1G99 A;  3EYZ A;  3OYF A;  1WSH A;  1WBD A;  3HJF A;  3DLK A;  4RW4 A;  4QS8 A;  4DQQ A;  3NF9 A;  4A2A A;  3AVK A;  3H3N O;  4KO0 A;  2ZGZ A;  3QO9 A;  3AA5 X;  2IOC A;  1X3N A;  3FZF A;  3L2W A;  4HUG A;  4IWV A;  5DMR A;  2YHA A;  3O80 A;  3DOK A;  4DLE A;  2YJF A;  3MEE A;  1HR0 K;  4BE1 A;  4HTU A;  4OPJ A;  2B4J A;  4NLB A;  2IC3 A;  1B9D A;  3AA3 A;  4MQ3 A;  4FSV A;  5J2M A;  4JKF A;  4FWQ A;  3PO5 A;  2H3G X;  4CD3 A;  4G1Q A;  1NJI O;  4DV5 K;  3ZSR A;  1RDD A;  4R5P A;  3TAQ A;  4YDU A;  4HCB A;  4DQR A;  2P9N B;  2QWQ A;  4DS5 A;  4DSI A;  4Z4I A;  4IG3 A;  2EX3 A;  3MXJ A;  2IS3 A;  2E2O A;  3SAH A;  3VQE A;  1NKE A;  1NGI A;  4A2B A;  1NK8 A;  4EAH D;  1WLJ A;  1VQK N;  4JKC A;  4O0I A;  2GX9 A;  2O8B B;  4C1N I;  3NE6 A;  3HZ6 A;  1VQO N;  3O9T A;  4CF8 A;  1J6Z A;  4FYD A;  1R59 O;  4DV2 K;  1ATR A;  5LY3 A;  3G6E N;  3NVK A;  3RR7 A;  5CZ2 A;  4ISG A;  2VG5 A;  4DTO A;  1ASU A;  5DM6 L;  3ATV A;  4IEI A;  2ZQB A;  4GNI A;  2DFE A;  3HL8 A;  1F21 A;  3LDO A;  1NJW A;  1LAV A;  1NU0 A;  3L4Q A;  3HSC A;  2Q3S A;  3NHG A;  1UA1 A;  3L2R A;  2HHT A;  4LH5 A;  5JS2 A;  3VEY A;  3IKM A;  1S1W A;  1Z26 A;  1D9D A;  3MEC A;  4QS7 A;  3CIP A;  1BA1 A;  1L3T A;  3L3V A;  3I0S A;  2A40 A;  1ESV A;  2ZE2 A;  4BDY A;  3AO5 A;  2YJE A;  2E6L A;  3E9P A;  3AO1 A;  1RDU A;  1OH7 A;  4FK0 A;  4JKG B;  3SV4 A;  1VK0 A;  3VGM A;  3VET A;  4J2D A;  1KSP A;  2P9L B;  3A2F A;  1KD1 O;  4FZZ A;  3KWG A;  4BRK A;  3ATU A;  3ZLJ A;  3N4P A;  1TUU A;  2A42 A;  2VG6 A;  3OHR A;  2VQF K;  1NGA A;  4GY2 B;  5BRH A;  3L3U A;  3VQP A;  4C8K A;  4QOZ B;  3K5L A;  3NGI A;  3SUN A;  1BGX T;  4DTP A;  1MWM A;  1MA9 B;  3QIO A;  5LMN K;  3M5R A;  3P5J A;  4MO4 A;  4CEZ A;  3VEX A;  4J2E A;  2G8K A;  1NGC A;  4E7K A;  4DR6 K;  1DTT A;  3RSE A;  3OS1 A;  4PKH A;  4CEA A;  4CES A;  1NGD A;  2P9U A;  4C8L A;  2NRW A;  3A5L C;  4E7H A;  4NLC A;  4OGC A;  1OVY A;  4KTW A;  4CF1 A;  3AVC A;  3ULE B;  1JXB A;  1TVR A;  3BF1 A;  2W41 A;  5JIC A;  4FL9 A;  3TAN A;  4H4M A;  5AQI A;  1NNE A;  1FJG K;  4FOI A;  3CXC M;  4U67 L;  2Q97 A;  3ZSW A;  1TAQ A;  3T1A A;  1QHT A;  4JEP A;  4DS4 A;  3P38 A;  2OYQ A;  2P9P B;  2ASP A;  1HYS A;  1WUA A;  4BC2 A;  1UOC A;  2QW9 A;  2VG7 A;  3HM9 A;  3ZX3 A;  4CGD A;  3M8Q A;  3MWT A;  1IKX A;  4CFB A;  2A6A A;  3ZT4 A;  4R79 A;  3OBY A;  3H08 A;  3QEV A;  4CJT A;  4DQP A;  1YTU A;  3J8A A;  4BDZ A;  4HCC A;  4FJI A;  5LMU K;  1ZXO A;  1N5Y A;  1Y64 A;  1X3M A;  1RDA A;  4JKB A;  4B3R K;  3UE5 A;  3A5N C;  2XY5 A;  1U04 A;  4C1N K;  4LD0 A;  4KHS A;  4DB3 A;  4LSN A;  2P9I A;  3AVM A;  5BN9 A;  1VQ4 N;  4CFD A;  4Z4G A;  2YNF A;  4B9Q A;  4OX9 K;  2P9K B;  5JMV A;  4M3Y A;  3DRP A;  4DTR A;  4AIL C;  3QEP A;  2NUB A;  4ILH A;  3J7Z O;  3IRX A;  3P31 A;  5AQL A;  2UXD K;  5M1F A;  1HQE A;  3PX0 A;  3V9X A;  3T1H K;  3AAQ A;  5CY4 A;  4BY9 C;  1S5J A;  2CGJ A;  3LWL A;  2KHO A;  1WN7 A;  1Y97 A;  2QWN A;  3DI6 A;  4QAG A;  3TTF A;  3KHY A;  4BGA A;  2OPP A;  5C42 A;  2D0B A;  2W42 A;  2Q0U A;  1N34 K;  1YJ9 N;  1W7A A;  5ADX A;  1T03 A;  1TKZ A;  2DFF A;  1NKC A;  4A62 A;  4E0D A;  3GDQ A;  1NK0 A;  2F96 A;  3DLL L;  1U47 A;  3V81 A;  2ITG A;  4IOX A;  1XMQ K;  3LM2 A;  1VSL A;  4IOA L;  2UXC K;  4CHN A;  2FSJ A;  4H0Y B;  2D0C A;  2ASM A;  3O4W A;  5F2R A;  4BQL A;  4CF9 A;  4N47 A;  3AVI A;  4IBN A;  2ZWH A;  4IDK A;  2NRT A;  3CC4 N;  3CJC A;  1JXE A;  1G15 A;  2KZM A;  3ZSX A;  5GAD P;  2NRV A;  2QEX N;  4KFB A;  1P8Z A;  4UY8 O;  4KTQ A;  3IG1 A;  3KJV A;  3TI0 A;  3CPW M;  3WXJ A;  5HRN A;  5F1X A;  5AQK A;  3TAP A;  3O5B A;  3RMC A;  1NJZ A;  3O3G A;  4EP5 A;  1ASV A;  2UYT A;  3J80 O;  2G8I A;  3AGR A;  1GLJ O;  4YOU A;  3E66 A;  5C2F A;  1IBL K;  3E9O A;  3OA9 A;  4PKG A;  3ZEU A;  4F3T A;  4IFY A;  1TK0 A;  4CJV A;  2A5X A;  4DCH A;  4DTJ A;  3U8X A;  5BRE A;  1C6V A;  1Z6R A;  2FBT A;  4CZJ A;  3AA4 A;  4MO5 A;  4CZG A;  3DLR A;  5F0X A;  5EOY A;  4WF9 L;  3WXK A;  4XEI A;  3EL2 A;  2W6K A;  3IMX A;  2E2P A;  1RT4 A;  2I7P A;  2X6S A;  4CFC A;  4JHD A;  3M8S A;  2FLO A;  1RT5 A;  3KKS A;  4GV3 A;  4RG8 A;  3O6W A;  3DRR A;  4MFB A;  3W3D A;  3CJ1 A;  4H0X B;  4DSJ A;  1NMN A;  4O5B A;  2G8V A;  1XC3 A;  3CCM N;  4DQS A;  3QER A;  5DK5 A;  3BY5 A;  5GAH P;  3OVN A;  5IT9 O;  5FLX O;  4KB0 A;  5C24 A;  3HPH A;  3KLG A;  5M1Q A;  3T69 A;  4C8N A;  3V9W A;  1K8A O;  4PL7 A;  3C6U A;  3R8E A;  4E7L A;  2PBD A;  3CET A;  3ENO A;  2AJQ A;  3AO3 A;  2F8S A;  4FJH A;  5AQX A;  2VCP A;  4B1W B;  3OYA A;  1X9S A;  2V52 B;  4I6M B;  3F2K A;  3UB5 A;  1XMO K;  2E6M A;  1YT3 A;  4DU4 A;  1QVG M;  2ZJQ L;  2HOE A;  1HMV A;  5T7B A;  3HOT A;  2O4I A;  3HTV A;  3CCS N;  5FPE A;  5AQR A;  3SI6 A;  2HB5 A;  1VSI A;  3HST B;  4LF9 K;  1SKW A;  4IO9 L;  4DR3 K;  2O8E A;  4CEB A;  3AVA A;  4CZI A;  2HHW A;  2E8A A;  3KIO A;  3AVL A;  2RN2 A;  4FLY A;  4DR2 K;  4KHY A;  4AHU A;  5CYM A;  4ILG B;  1C1B A;  3GBT A;  3CCE N;  3T19 A;  1M1K O;  1C1A A;  4IJA A;  4DFM A;  4FZY A;  1E4G T;  3HRG A;  4LY7 A;  3U3Y A;  4NCG A;  1XHZ A;  2YHB A;  3EEQ A;  1JL1 A;  3CI5 A;  2CGL A;  3DXK A;  3SAG A;  4ID5 A;  1JJ2 M;  1D9F A;  2FBV A;  5JLF A;  4N56 A;  1NGH A;  3MMV A;  1BI4 B;  4H8K A;  1BIS A;  1TKD A;  4BRM A;  4O8K A;  1TL3 A;  3G4S N;  4M3U A;  2DFH A;  3RMB A;  3MN5 A;  3SJJ A;  1KFS A;  5M1K A;  1LV5 A;  4BRL A;  4M3X A;  4PQU A;  1HKG A;  3CQY A;  1RCH A;  4YHH K;  1HPZ A;  4IFV A;  4DTS A;  4KAZ A;  4B1Y B;  1SV5 A;  4CED A;  2FF6 A;  2GWK A;  3L6Q A;  2X74 A;  3C0B A;  4BR0 A;  2VGN A;  4HUE A;  4FJX A;  3F9K A;  4H0T B;  3R3L A;  1RGI A;  1RBT A;  3PV8 A;  4FWK A;  4CEO A;  3I8B A;  3HOS A;  3HYF A;  1KVB A;  5TKY A;  4E1M A;  3OYI A;  2YNI A;  3BZK A;  3BUZ B;  3O9Q A;  3H45 C;  4M3T A;  3GL1 A;  3SZ2 A;  4KH5 A;  4IJN A;  3CCJ N;  2QXF A;  4CZF A;  3AO4 A;  3E9L A;  2QA4 N;  4FW2 A;  3UIQ A;  4CK3 A;  4JI4 K;  2G8F A;  2KKZ A;  4J8F A;  1VSH A;  3VGK A;  4M7X A;  3C7N B;  3VPZ A;  2QKK A;  1X9W A;  4CGH A;  3PX6 A;  5FPN A;  4JK7 A;  3UKR B;  4CJR A;  1KC8 O;  4J2A A;  2P9N A;  5J2Q A;  4MDA A;  4E3S A;  2O4G A;  4K25 A;  5AQF A;  5FRO A;  3LAN A;  3IDH A;  2FBY A;  4CHQ A;  1YJW N;  3DM2 A;  4LF7 K;  3J81 O;  4OKK A;  4AHC A;  4Z94 A;  1NWK A;  1S9G A;  4AHS A;  5KGX A;  2D4W A;  4DSF A;  2DY4 A;  1ITG A;  2YI1 A;  4Z4H A;  4M41 A;  4GMJ B;  4L3Q A;  4BVP A;  3HP6 A;  3O3H A;  2Z1J A;  1NK5 A;  3HBT A;  4FWP A;  4ELT A;  2QKB A;  3I8D A;  3MAQ A;  3VMF B;  5GIO A;  3FZM A;  4FK2 A;  5GIP A;  5C25 A;  4B1Z A;  2Z1H A;  3TAB A;  3OYK A;  3TSU A;  3VQ5 A;  3LAL A;  5A2Q O;  1IO2 A;  3WXL A;  3VQD A;  4DSK A;  4Y1D A;  4L8R B;  3U9Z A;  1BQN A;  3O4N A;  4I9Q A;  4WFA L;  3O9S A;  1J5O A;  2CGK A;  4OLA A;  3ZSZ A;  3MXM A;  3QEX A;  3PIP L;  5ADX H;  3EO3 A;  4H0V B;  3DXM B;  3IFR A;  3OY9 A;  1TAU A;  4KHN A;  2IDO A;  4GKK K;  3HPO A;  1YAG A;  4CJU A;  1VRT A;  1S6P A;  3ZSY A;  4X66 K;  1BL3 A;  3T1Y K;  4J2B A;  3SPZ A;  3A0I X;  4JKG A;  1A5X A;  5KPT A;  2WC9 A;  4F8R A;  3RRG A;  4CZM A;  4JV5 K;  3L0Q A;  3ZX0 A;  4I2Q A;  4AM7 A;  1D8Y A;  3FGU A;  4CEQ A;  3OYJ A;  3T3F A;  2E88 A;  3VQ4 A;  4CJQ A;  3MCP A;  3KK3 A;  4CJ5 A;  1YJN N;  2HVI A;  1VAZ A;  4HUF A;  4O44 A;  3CFR A;  3DJC A;  1K9M O;  4Q0B A;  4BR4 A;  5J2P A;  1VSK A;  5HRO A;  4FJK A;  1T05 A;  2Q1N A;  3L4I A;  1RT6 A;  1NM1 A;  4FJ8 A;  3LWM A;  5AQM A;  4IZ9 A;  4DHY A;  2QI2 A;  3O1B A;  1SKR A;  1MWK A;  3S41 A;  2P1J A;  2ETJ A;  5J1E A;  4EFH A; 
#chains in the Genus database with same CATH homology
 3TAN A;  1EKE A;  4H4M A;  4CGG A;  2WON A;  5HRR A;  3NGZ A;  1QE1 A;  3V9U A;  4CEE A;  4ELV A;  2HHV A;  1REV A;  1EXQ A;  3V9S A;  2Y1J A;  1CZ9 A;  1BCO A;  1KCF A;  3ZSW A;  1TAQ A;  3T1A A;  1QHT A;  4DS4 A;  4FLZ A;  3RMA A;  2OYQ A;  2HMI A;  1HYS A;  4FZX C;  4EP4 A;  1KVA A;  1TK8 A;  4RW7 A;  3IAY A;  1LWF A;  1XHX A;  4AHR A;  1BCM A;  1UOC A;  1S1V A;  4CGI A;  2YKN A;  2IAJ A;  2VG7 A;  3HM9 A;  2HVH A;  4CGD A;  5CYQ A;  3OYC A;  3MEG A;  3AVG A;  3M8Q A;  3OJU A;  4BAC A;  1BIZ A;  1IKX A;  3I0R A;  1NOY A;  4AHV A;  1NK4 A;  4K8Z A;  4CEF A;  4CJ4 A;  3ZT4 A;  4CFB A;  4FM2 A;  2KQ2 A;  3NGY A;  3H08 A;  1IKV A;  2JGU A;  1U4B A;  4KI6 A;  3QEV A;  3D45 A;  1QTM A;  4CJT A;  4DQP A;  3AV9 A;  1YTU A;  3S3O A;  1CXU A;  1T7P A;  3HT3 A;  4LSL A;  1LWE A;  4BDZ A;  3QEW A;  4HCC A;  1QSY A;  4FJI A;  2JLE A;  1N5Y A;  4M42 A;  2OPS A;  3SUP A;  4CGF A;  3TAM A;  1RDA A;  2XY5 A;  1U04 A;  1A5W A;  4N5S A;  1RIL A;  4IKF A;  4AHT A;  3ZT1 A;  1LAW A;  3CG7 A;  1SL2 A;  3WNF A;  4LD0 A;  4CJK A;  4KHS A;  4KRF A;  4O55 A;  1UWB A;  3AVM A;  4LSN A;  3KD1 E;  1IKW A;  2YNH A;  3RWU A;  1WSF A;  4CFD A;  3ZT0 A;  4CHZ A;  3LP0 A;  3S3N A;  2YNF A;  4Z4G A;  3QNO A;  2WOM A;  2GBZ A;  2HND A;  2FBX A;  4OKJ A;  3OS2 A;  4BE0 A;  4CCH A;  3DRP A;  4M3Y A;  1XWL A;  5J2N A;  4DTR A;  4AIL C;  3CM6 A;  3QEP A;  4BWJ A;  2NUB A;  3VN5 A;  3OYD A;  2XHB A;  1WAF A;  4AH9 A;  1TKT A;  3QNN A;  3PX4 A;  4B9N A;  4FJM A;  3SYZ A;  4YFU A;  3FFI A;  2BDP A;  2X78 A;  4PWD A;  1XC9 A;  3G10 A;  4Z4C A;  5E41 A;  2KFZ A;  3IRX A;  1J9A A;  1KVC A;  3VQA A;  4DQI A;  3ZSQ A;  1HQE A;  4FXD A;  4EZ6 A;  3PX0 A;  4YNQ A;  3S9H A;  3AVJ A;  3V9X A;  5CY4 A;  1JLA A;  1I3A A;  1S5J A;  3LWL A;  1WN7 A;  1A5V A;  4CJ3 A;  3SQ2 A;  1Y97 A;  4M3W A;  1WSG A;  2OZS A;  4HVJ A;  3DI6 A;  4QAG A;  3TAR A;  2I5J A;  3DRS A;  4KHQ A;  2ZD1 A;  1Q9Y A;  1RTJ A;  1RTH A;  3LP3 A;  1RBR A;  2OPP A;  3L8B A;  5C42 A;  2D0B A;  2W42 A;  2VWK A;  4Z0U A;  3OJS A;  3P83 D;  1HJR A;  4KTZ A;  1C0T A;  1T03 A;  1L3U A;  5FRM A;  1TKZ A;  2DFF A;  2YKM A;  4CIG A;  1S1U A;  3HXM A;  4FM0 A;  1NKC A;  4E0D A;  5FRN A;  1NK0 A;  2F96 A;  1FKP A;  1U47 A;  1WSI A;  3DMJ A;  3V81 A;  1VRU A;  1C0M A;  3LDS A;  4GW6 A;  1ZBI A;  1B9F A;  2RPI A;  4B8A B;  2ITG A;  1KRP A;  3K5O A;  1VSL A;  3DLE A;  4Q5V A;  4JS4 A;  2P51 A;  4CHN A;  2OA8 A;  1JLB A;  3OYE A;  2EHG A;  2D0C A;  4NCB A;  4CFA A;  3QIP A;  4CF9 A;  4DTX A;  1U48 A;  4N47 A;  3PO4 A;  3AVI A;  2IGI A;  4IBN A;  4IDK A;  4B08 A;  3KLE A;  1L3S A;  3TWH A;  4CJE A;  1SKS A;  3SCX A;  1JXE A;  4DF4 A;  1U49 A;  1G15 A;  2KZM A;  3ZSX A;  1JLC A;  1IG9 A;  2RF2 A;  1NKB A;  4FJG A;  4CJF A;  4KFB A;  2HHQ A;  1S1T A;  3HVT A;  4KTQ A;  1LW0 A;  3IG1 A;  4NYN A;  3SPY A;  1VSJ A;  3KJV A;  3TI0 A;  3SQ1 A;  5HRN A;  3NAE A;  4RW8 A;  3TAP A;  2GV9 A;  3RMC A;  1NJZ A;  3O3G A;  4EP5 A;  1ASV A;  3WNG A;  1RTI A;  3RTV A;  2G8I A;  2R7Y A;  3LAM A;  4B8C A;  1QS4 A;  1YVU A;  4F3T A;  2HW3 A;  1HYV A;  4IFY A;  4W5R A;  1TK0 A;  4KPY A;  1Q8I A;  3QES A;  2XY6 A;  4CJV A;  4FJ7 A;  4DTJ A;  4NYF A;  4C8M A;  1C6V A;  2FBT A;  3AO2 A;  3BDP A;  4KKO A;  3AA4 A;  4FK4 A;  3DLR A;  4OJR A;  4CJW A;  1LW2 A;  1QSS A;  2HHS A;  4W5T A;  4Z4F A;  1JLG A;  1RT2 A;  1GOC A;  4FJ5 A;  3QEI A;  1C0U A;  2XY7 A;  4I2P A;  4DMN A;  3NH0 A;  1HNV A;  1RT4 A;  2HHU A;  3V1O A;  1XI1 A;  2X6S A;  4CFC A;  3K57 A;  4DSL A;  3M8S A;  1S1X A;  3OYG A;  1RT5 A;  1J53 A;  2LSN A;  1VSD A;  2BE2 A;  3KKS A;  5SWM A;  5KRS A;  4DU3 A;  4RG8 A;  5HP1 A;  2DTU A;  4W5O A;  3KK2 A;  3DRR A;  3IS9 A;  3ZSO A;  3SV3 A;  4MFB A;  1ZBH A;  4ZTJ A;  4PUO A;  4W5N A;  4DSJ A;  4FLX A;  1HQU A;  4O5B A;  2G8V A;  4DQS A;  3QER A;  5DK5 A;  3KLI A;  4KV8 A;  1NJY A;  3OVN A;  4OLB A;  1TV6 A;  3O3F A;  4ZHR A;  3K59 A;  1L3V A;  4KB0 A;  4O4G A;  3U3G A;  5C24 A;  3HPH A;  3KLG A;  4CF2 A;  2KW4 A;  4B9L A;  1NK9 A;  4C8N A;  3ZCM A;  3TAG A;  5KI6 A;  1JLQ A;  3V9W A;  2XRI A;  3DYA A;  3JYT A;  4DLG A;  1UA0 A;  1N6Q A;  3C6U A;  2FC0 A;  4CK1 A;  3OYM A;  4ID1 A;  4E7L A;  1D5A A;  4Y1C A;  4E1N A;  4CHY A;  1WNS A;  3ASM A;  3QIN A;  4JRQ A;  1R0A A;  3KTQ A;  4DF8 A;  2AJQ A;  1WAJ A;  3AO3 A;  2F8S A;  1HRH A;  3ZT2 A;  2Z1G A;  4E19 A;  4ELU A;  1X9S A;  2HNY A;  4CE9 A;  3CYM A;  3OYA A;  4PA1 A;  4FJH A;  2OPR A;  4FVM A;  2BAN A;  1HNI A;  3HPG A;  3HP9 A;  3K5N A;  2E6M A;  1YT3 A;  1NOZ A;  4DU4 A;  1T8E A;  1RTD A;  4GVM A;  3LP2 A;  1HMV A;  3DLH A;  3VQ8 A;  5T7B A;  1RBV A;  4B3O A;  3LAK A;  4O0J A;  2O4I A;  4CK2 A;  3AVH A;  1EET A;  5KGW A;  4BWM A;  1NK6 A;  1K6Y A;  3LPU A;  5HBM A;  1WSE A;  1SUQ A;  3V1R A;  1JLE A;  4IG0 A;  2XO7 A;  4E89 A;  3SI6 A;  2HB5 A;  1VSI A;  1TGO A;  3HST B;  1W9H A;  5J1E A;  2HHX A;  1SKW A;  1I39 A;  4DWI A;  1Q9X A;  2GUI A;  4CEB A;  1QSL A;  1SL1 A;  2E4L A;  1B92 A;  3QLH A;  3AVA A;  3DLG A;  1X9M A;  4FK2 A;  2HHW A;  3AVN A;  3KIO A;  4FLY A;  3AVL A;  2RN2 A;  1SL0 A;  4KB1 A;  1VSM A;  1CXQ A;  2OPQ A;  4FLU A;  2HNZ A;  3KKR A;  5CYM A;  4AHU A;  4KHY A;  3C6T A;  4OGE A;  1BQM A;  4JRP A;  4KRE A;  3NBP A;  3B6O A;  3VQ9 A;  3QET A;  4PY5 A;  1C1B A;  3L2U A;  3AA2 A;  4CEC A;  4HHT A;  3TAE A;  1DTQ A;  1RBU A;  3T19 A;  3SNN A;  4M3Z A;  3P1G A;  2VWJ A;  1C1A A;  4DFM A;  1FK9 A;  3E01 A;  5SZT A;  4FZY A;  4LY7 A;  1RT7 A;  3U3Y A;  2KFN A;  4NCG A;  5FDL A;  3EY1 A;  1XHZ A;  2PY5 A;  4FJJ A;  2YHB A;  4N41 A;  1JL1 A;  3AVB A;  1QQC A;  2A1R A;  3OYN A;  3THV A;  3DLB A;  4DG1 A;  4B9T A;  1IKY A;  1VSF A;  1DLO A;  2QK9 A;  4ID5 A;  3C95 A;  1D9F A;  2P5G A;  2FBV A;  1EX4 A;  4N56 A;  2G8H A;  3NCI A;  4FJ9 A;  4BE2 A;  1L5U A;  3OS0 A;  4N76 A;  1BI4 B;  1FXX A;  3KLH A;  4KI4 A;  1GOA A;  1BIS A;  1JL2 A;  4H8K A;  3ZT3 A;  1TKD A;  4FLW A;  2OZM A;  4JLH A;  3V1Q A;  1TL3 A;  4M3R A;  4M3U A;  4F3O A;  2DFH A;  4CIE A;  3RMB A;  1RT3 A;  3CM5 A;  3SJJ A;  1BI4 A;  3K5M A;  2PZS A;  1KFS A;  4DTN A;  5HLF A;  3JSM A;  4FLT A;  1LV5 A;  4CJP A;  3MXI A;  1JLF A;  2P5O A;  4CHP A;  3CFO A;  1KTQ A;  4M3X A;  4PQU A;  2ATQ A;  1RDB A;  4CIF A;  3M8R A;  5KRT A;  3LZJ A;  4H4O A;  5KTQ A;  1RT1 A;  1RCH A;  4B9U A;  1HPZ A;  4IFV A;  4M45 A;  4DTS A;  4DTU A;  2Y1I A;  1ZBL A;  4KAZ A;  3EYZ A;  1SV5 A;  3MED A;  4CED A;  4EZ9 A;  3VQB A;  4RW6 A;  2X74 A;  3OYF A;  1WSH A;  3HJF A;  3DLK A;  3WNH A;  1W0H A;  3S3M A;  3VQ6 A;  4I9L A;  4RW4 A;  1ASW A;  4DQQ A;  3NF9 A;  4HUE A;  4FJX A;  3M8P A;  3AVK A;  4XIU A;  3F9K A;  4KO0 A;  4JS5 A;  5D3G A;  3C94 A;  3QO9 A;  3OYL A;  3AA5 X;  2IOC A;  3L2W A;  1RBT A;  3PV8 A;  4HUG A;  3O4Q A;  4CEO A;  5DMR A;  3TR8 A;  2YHA A;  4DLE A;  3DOK A;  3HYF A;  1KVB A;  5HRS A;  4E1M A;  3OYI A;  3MEE A;  4CJL A;  4BE1 A;  3F73 A;  2YNI A;  4OVL A;  4OPJ A;  4HTU A;  2B4J A;  3ITH A;  2IC3 A;  1B9D A;  3AA3 A;  4MQ3 A;  4B9V A;  4M3T A;  3SZ2 A;  5J2M A;  2KTQ A;  3LPT A;  3PO5 A;  1S9E A;  3EZ5 A;  3NH1 A;  4CF0 A;  2QXF A;  4NCA A;  3AO4 A;  4G1Q A;  3G0Z A;  3VQQ A;  5CZ1 A;  4W5Q A;  4FW2 A;  4BDP A;  3L2V A;  3UIQ A;  3ZSR A;  4E7I A;  4CK3 A;  1RDD A;  1EP4 A;  4R5P A;  3B6P A;  3TAQ A;  3KK1 A;  2D0A A;  2G8F A;  1LWC A;  1VSH A;  4HCB A;  4DQR A;  3NH2 A;  4DS5 A;  3L2Q A;  3AVF A;  4DSI A;  4Z4I A;  3HO1 A;  4IG3 A;  2QKK A;  2EX3 A;  4CGH A;  1X9W A;  3MXJ A;  3PX6 A;  2IS3 A;  2KZZ A;  4CJR A;  4RW9 A;  2D5R A;  4DTM A;  3VQE A;  4LH4 A;  2RKI A;  1NKE A;  4J2A A;  1KFD A;  5J2Q A;  1NK8 A;  3VQC A;  1ZBU A;  4ICL A;  4E3S A;  1WLJ A;  2F8T A;  4O0I A;  5I42 A;  1RNH A;  2PYJ A;  2O4G A;  4K8X A;  3NE6 A;  5FRO A;  4CF8 A;  3LAN A;  2FBY A;  1FKO A;  3VQ7 A;  4CHQ A;  3DM2 A;  4FYD A;  4OKK A;  4AHC A;  1S9G A;  2XY8 A;  3SUO A;  4AHS A;  5KGX A;  3K58 A;  4DSF A;  3SUQ A;  1IH7 A;  2DY4 A;  1ITG A;  2YV0 X;  3ULD A;  3RR7 A;  5CZ2 A;  4DSE A;  2VG5 A;  5JS1 A;  4Z4H A;  4M41 A;  4DFJ A;  3NF6 A;  4GMJ B;  5I3U A;  4DTO A;  1ASU A;  2YNG A;  3HP6 A;  2ZQB A;  2Z1J A;  3ISN C;  1RBS A;  5EU7 A;  3ZSV A;  4CER A;  3O3H A;  1NK5 A;  1S6Q A;  2DFE A;  1BHL A;  4ELT A;  3HL8 A;  1F21 A;  2QKB A;  3I8D A;  1WSJ A;  3MAQ A;  1NJW A;  5K14 A;  1LAV A;  3PUF A;  1KLM A;  3KLF A;  3CQ8 A;  5C25 A;  3V4I A;  3SQ4 A;  2Z1I A;  1CZB A;  1C1C A;  4ZTF A;  4Z4E A;  2Z1H A;  1TL1 A;  3NFA A;  3V6D A;  1TKX A;  2Q3S A;  4CHO A;  3NHG A;  3OYK A;  3TAB A;  1HYZ A;  3L2R A;  4LH5 A;  1UA1 A;  2HHT A;  3VQ5 A;  4I7F A;  3LAL A;  5JS2 A;  3KD5 E;  1IO2 A;  3VQD A;  1S1W A;  4DSK A;  3NF7 A;  4Y1D A;  1Z26 A;  4L8R B;  4TSX A;  1BQN A;  3O4N A;  3RRH A;  1D9D A;  4I9Q A;  3MEC A;  3WNE A;  3OYB A;  1J5O A;  1L3T A;  3L3V A;  4B9S A;  4OLA A;  4FW1 A;  3ZSZ A;  3MXM A;  3DOL A;  3QEX A;  3I0S A;  2ZE2 A;  4BDY A;  1J54 A;  3OY9 A;  3AO5 A;  1TAU A;  1BIU A;  2E6L A;  4KHN A;  3CFP A;  2IDO A;  3AO1 A;  3HPO A;  1YTA A;  4FJN A;  4FK0 A;  1NJX A;  3K2P A;  4CJU A;  3SV4 A;  4DFK A;  1VK0 A;  1VRT A;  1S6P A;  4CGJ A;  3HVR A;  1KSP A;  4E7J A;  1MU2 A;  3A2F A;  3ZSY A;  3PY8 A;  3NDK A;  4J2D A;  1BL3 A;  2B6A A;  2G8W A;  4FZZ A;  3LZI A;  1ZYQ A;  4J2B A;  1RDC A;  4CJS A;  3SPZ A;  1A5X A;  4FM1 A;  2VG6 A;  3VA0 A;  2G8U A;  4OPK A;  3L3U A;  3RMD A;  4F8R A;  3VQP A;  5HRP A;  4C8K A;  3RRG A;  4QOZ B;  4QCL A;  4F4K A;  3V9Z A;  3K5L A;  3NGI A;  3VA3 A;  3RR8 A;  3SUN A;  4I2Q A;  1BGX T;  1D8Y A;  3SQ0 A;  4CEQ A;  3OYH A;  4DTP A;  4KHU A;  4KHW A;  4FJL A;  4B9M A;  2X6N A;  3OYJ A;  3T3F A;  4C8O A;  4DU1 A;  3HK2 A;  3VQ4 A;  2PYL A;  3LP1 A;  4CJQ A;  4F2S A;  1Z25 A;  3QIO A;  3KK3 A;  4CJ5 A;  4FLV A;  1U45 A;  1KLN A;  1O1W A;  3P5J A;  2HVI A;  4OKE A;  1GOB A;  1UAX A;  4HUF A;  4O44 A;  3CFR A;  4CEZ A;  1ZBF A;  4J2E A;  1JKH A;  2G8K A;  3NF8 A;  4DFP A;  2B5J A;  4E7K A;  1DTT A;  4Q0B A;  5J2P A;  1VSK A;  1NK7 A;  5HRO A;  4FJK A;  1T05 A;  3OS1 A;  2BGG A;  4F2R A;  2A1S A;  1RT6 A;  4CEA A;  4CES A;  4UQG A;  1CLQ A;  4FJ8 A;  3LWM A;  4C8L A;  3TAF A;  4E7H A;  3D0P A;  1TK5 A;  1SKR A;  4OGC A;  1X1P A;  4KTW A;  4CF1 A;  4FCY A;  3BGR A;  2P1J A;  3ALY A;  3AVC A;  4WE1 A;  3U6F A;  2ETJ A;  1JXB A;  1VSE A;  1TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...