4NYFA

Hiv integrase in complex with inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACDWAGIKQEPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Discovery of BI 224436, a Noncatalytic Site Integrase Inhibitor (NCINI) of HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 55
structure length 149
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4nyfA00
2HB5A 4DTRA 1VSJA 1NJXA 3C6TA 4CHOA 1YTAA 1NJWA 1R0AA 2XY8A 4AILC 1S9EA 4Q0BA 3ZSWA 3DLEA 3RR8A 3AO3A 4KAZA 2IS3A 4FLTA 4IG3A 4CF2A 3K2PA 2ZE2A 3CM6A 3QEVA 4FJ9A 2B6AA 1RTJA 3AA2A 4DSEA 2KFZA 3NGIA 1VSKA 2YNIA 1UOCA 2G8UA 1BL3A 4CJSA 3RRGA 4M3YA 3KD1E 3K5NA 3LWMA 3T3FA 1QSSA 1W9HA 2X78A 3OYFA 1D9DA 1C1AA 3VQ8A 4BDZA 3C94A 4E7KA 4QCLA 4G1QA 4LSLA 3WNGA 4ELTA 3LP1A 3K5LA 4Y1DA 4DFMA 1SL1A 4FJJA 1D9FA 1BGXT 4OJRA 4FXDA 4CIEA 3MAQA 4HTUA 4FJLA 4CECA 4W5RA 1Z26A 4FJIA 1HQUA 2YNGA 4JS5A 4Z4EA 3VQDA 4M3UA 1FXXA 4FW1A 1U4BA 4FJ5A 4B3OA 1L3TA 3K59A 1JL2A 1VSHA 1T7PA 3DLGA 3QIPA 1N6QA 4ELVA 4AHRA 5FDLA 3HK2A 1IH7A 1WLJA 3ASMA 3ISNC 4FZYA 5DK5A 3EY1A 4ICLA 3JYTA 2WOMA 4L8RB 3BGRA 4CFDA 1TK5A 3QO9A 3HJFA 1Z25A 2Z1GA 5KTQA 4Q5VA 4B9TA 4DQPA 2HHVA 1W0HA 4YFUA 3V1RA 4HHTA 3S3OA 1C6VA 1JLAA 1EKEA 4CK1A 1RDBA 4HVJA 3MXJA 1NJZA 3OS1A 3TAQA 2FBYA 3OYNA 5HRPA 4E3SA 3DRSA 3OYKA 3ZSVA 2KQ2A 4DMNA 4AHTA 4BE0A 4FLUA 2EHGA 4DFPA 4B9LA 1HPZA 2F96A 3U3YA 3B6PA 3PX0A 1LAVA 4DQQA 4CHYA 2XY7A 3SJJA 1YT3A 2IDOA 1VRTA 1DTQA 3DM2A 4FLXA 4CERA 2D0AA 3SNNA 4O0IA 3ZT1A 4DTMA 4GW6A 3VN5A 2XY5A 4ID1A 3HPGA 5KGXA 2YNHA 3O4QA 3L2QA 1WSFA 2IGIA 2ZD1A 3KJVA 1NK7A 1HNVA 1X9MA 5JS2A 4KHUA 3SQ0A 1VSFA 1WAFA 4Z4HA 1CLQA 5J2NA 1XHZA 3NH1A 4O4GA 1LWCA 2BE2A 1XWLA 4RG8A 4M42A 4CK3A 3NGZA 1JXBA 3IS9A 1VSEA 1WAJA 1BCMA 1ZBFA 2YKNA 1LW2A 3AO1A 4AHSA 4E1MA 4DTUA 1ZBLA 1QSYA 4ZTJA 4BACA 1A5XA 1HJRA 4KFBA 4FJNA 4NCGA 2G8FA 2GUIA 4FLYA 2G8WA 3OYLA 4LH4A 5T7BA 4F2SA 4M41A 3QINA 2GBZA 4CJ5A 1NK5A 1FKOA 3ZSRA 4B9MA 1EP4A 3TANA 1RT5A 3QEWA 3V1OA 1S1TA 4OPJA 4E19A 1YVUA 4DWIA 4B8AB 3NF8A 4IDKA 3PX4A 1RT7A 2P5GA 4CIFA 4H4MA 3MEDA 2RKIA 2LSNA 3ZT0A 2YHAA 1BQMA 1NK8A 5D3GA 3RMDA 1NOYA 4Z4FA 3VQ7A 4B9VA 3K5MA 4CJKA 4KKOA 4LD0A 1CXQA 3B6OA 2G8VA 5J2MA 4E89A 1U04A 1KTQA 1TGOA 4JRQA 1NK9A 4N41A 3OYCA 1JKHA 3V9SA 3H08A 1NJYA 2O4GA 4CJ3A 4KB1A 2PZSA 3AA3A 3ZSYA 3SV3A 4ZTFA 4FK2A 2YHBA 1BISA 4KV8A 3AA4A 4C8MA 4M45A 1LWFA 2EX3A 2W42A 4KTQA 1KVAA 3CFOA 3SUPA 3LAMA 1JXEA 1IG9A 4IKFA 3C95A 3OS0A 1KRPA 2OPSA 2HNDA 4FLWA 1B9FA 1C1BA 2XRIA 3ITHA 3SV4A 1L3VA 2P1JA 3AO5A 4FCYA 4DTXA 1ITGA 1JLEA 4IG0A 4CEBA 2D5RA 1NKCA 4IFYA 4RW4A 3I0SA 4W5TA 1HQEA 3SQ2A 2OPPA 3WNHA 3NH2A 4AHVA 4Y1CA 1SV5A 1IO2A 4FJXA 3DLHA 4DFJA 3L2UA 3OYAA 4CJLA 1TAQA 3VQ6A 4CJUA 1TK0A 4J2EA 3HVTA 3KTQA 4K8ZA 5SWMA 4F8RA 2R7YA 4W5QA 1TKZA 2Y1JA 4KHSA 4FM2A 3RWUA 5J2QA 1DTTA 2OA8A 2Q3SA 3DRRA 3VQCA 3SQ4A 4F4KA 3UIQA 1S1UA 4CEAA 3L2WA 3DYAA 4I9LA 4O5BA 4O0JA 3ZT3A 2PY5A 1C0TA 2QK9A 3S3NA 1VK0A 3AVNA 3LWLA 1LAWA 3SUNA 4FK0A 2HHXA 4CFBA 3OYJA 4CCHA 4CJVA 4DTJA 2B4JA 4NCAA 4CJRA 2HHQA 4R5PA 1C1CA 3TABA 4LH5A 4GVMA 3HT3A 4HUFA 3ULDA 1UA1A 2A1SA 1NOZA 1S1XA 1WSEA 4N5SA 5SZTA 3O3HA 4BWMA 4FLVA 1QTMA 4PY5A 4I9QA 3FFIA 3KLFA 3F73A 5HBMA 3O3GA 1NKEA 3ZSXA 4IBNA 3AVGA 3PUFA 4FM0A 1LWEA 5KGWA 3AVHA 1RBUA 3AVKA 3OY9A 1XC9A 4OKKA 4CGHA 1RDCA 3CFRA 3MXIA 3ZT4A 4BE2A 4E7IA 3OYEA 2BANA 3T1AA 1J5OA 1K6YA 3NHGA 1HYVA 2GV9A 2Z1HA 4B08A 1C0MA 1ASUA 4OPKA 2HW3A 1BI4A 1S5JA 4JS4A 1ZBHA 5C25A 4PWDA 3D45A 4YNQA 2DFHA 1FK9A 1RBSA 3HO1A 2FBTA 2KZMA 1EETA 4CGFA 1RILA 3HPHA 3I8DA 3V4IA 3AVFA 3SPZA 1BCOA 1QSLA 4OLBA 4KREA 1WN7A 3HPOA 1KSPA 2WONA 2YNFA 3LPTA 3KK3A 1RT6A 4DG1A 2XHBA 4HUGA 3DRPA 2P5OA 3RRHA 1GOCA 2HVHA 1KLNA 4LSNA 3DLBA 4I2QA 3D0PA 3U3GA 4N56A 2B5JA 2RPIA 4OVLA 2VG7A 2ITGA 1RT3A 4DSFA 3SPYA 2P51A 1NK6A 4E0DA 4AHUA 1JLQA 1IKYA 3HXMA 4KHNA 1RTDA 1J53A 4EZ9A 3HP9A 1L3SA 4ZHRA 4F3OA 4KB0A 3NBPA 1CZBA 1KCFA 1QE1A 4O55A 3OYBA 1RT2A 5KRSA 1LW0A 1IKVA 3JSMA 2OYQA 1BQNA 2VWJA 1RT4A 1I39A 1T05A 4FYDA 2KTQA 1RCHA 4NYNA 2VWKA 4Z4CA 4DQIA 3TARA 4CJWA 1I3AA 1TL1A 3F9KA 3TAGA 1X9SA 4CHPA 1RTIA 1TVRA 3P83D 3HM9A 2G8KA 4DQSA 1JL1A 2E4LA 3C6UA 3V9ZA 1HYZA 5J1EA 2HHSA 3QIOA 2XO7A 1D5AA 1F21A 5I3UA 4KHYA 3DI6A 2DFEA 4TSXA 1ASWA 5FROA 4F3TA 2YKMA 3L8BA 3V9UA 4CEFA 3IAYA 3KKSA 1YTUA 1A5VA 3QETA 1C0UA 2RF2A 2E6MA 3AVJA 4ID5A 3KK2A 5HP1A 1HRHA 2HHWA 1QQCA 3LP0A 2ETJA 3THVA 1TV6A 3AVCA 3O4NA 4DF8A 4CF9A 3TWHA 3QNOA 4EP5A 3AVLA 3QEIA 3NCIA 3KD5E 4ELUA 1RTHA 5FRMA 2DTUA 2HMIA 3NFAA 3NE6A 4EP4A 3DLKA 5CZ1A 4FJGA 3VQPA 3SZ2A 1RBVA 2D0CA 4UQGA 2G8IA 3RTVA 5C42A 2BDPA 4I2PA 3QEPA 2KW4A 1SKWA 4M3TA 4BDPA 3OJUA 4E1NA 2HHUA 3ZSQA 3QERA 3TI0A 1LV5A 3QESA 5K14A 3KLGA 4CFCA 3V81A 2Z1JA 3PX6A 4KTWA 4C8OA 1J9AA 4DS4A 2IOCA 1EX4A 2JGUA 4CEQA 5HRNA 3BDPA 1VSMA 3VA0A 1ZBUA 2I5JA 3MEEA 3NDKA 3LDSA 3WNEA 4OGEA 4FJMA 1CXUA 1VSDA 2RN2A 1S6QA 4CESA 1NK0A 4N76A 3IRXA 1TKXA 1VSLA 1RBRA 4C8NA 4OGCA 2E6LA 3I0RA 4CJFA 3L2RA 1DLOA 3RMAA 1GOAA 3AO4A 5E41A 4OKEA 3HP6A 3OYIA 4KTZA 3LALA 1SKSA 4F2RA 1SL0A 1KFDA 4AH9A 2OZMA 1ZYQA 2F8TA 4HCBA 4KRFA 4DTNA 4OKJA 1KVBA 2XY6A 1Q8IA 1U49A 3LP2A 3SYZA 2QXFA 4DTSA 3CM5A 4FJHA 1TK8A 3AV9A 4DLEA 2HVIA 3G10A 3NH0A 1WSJA 3KLIA 2A1RA 2QKKA 1U48A 3LZIA 2KZZA 3AA5X 4FJKA 1BIUA 3DOLA 1WSHA 3TAPA 4Z4IA 5KI6A 4CGJA 3MEGA 3L3VA 3OYGA 3L2VA 4CHNA 3O3FA 3NF9A 3TAEA 1Q9XA 1O1WA 1EXQA 4Z0UA 1BHLA 1MU2A 3VQ9A 1D8YA 1UA0A 4RW7A 3VQ4A 3PV8A 3RR7A 1WSGA 2DY4A 1S9GA 1HMVA 4CGGA 4MQ3A 3TR8A 4HUEA 4CF8A 3K57A 5JS1A 1VRUA 3ZCMA 2OPQA 1WNSA 4DSIA 4C8LA 3K5OA 4FLZA 4RW8A 4B9UA 2BGGA 1RT1A 3SUOA 4DLGA 1T03A 4BDYA 3P5JA 2ZQBA 4FZXC 2IAJA 2D0BA 2PYLA 3M8SA 3PO4A 4WE1A 4BWJA 1FKPA 3CG7A 3VQ5A 3OJSA 4PQUA 4DQRA 1JLCA 3DLRA 2Y1IA 3PO5A 4CEOA 4CEDA 3SCXA 3VQQA 2NUBA 3ZT2A 3SI6A 4RW9A 1XHXA 3T19A 3VQAA 2AJQA 3KLEA 1T8EA 2FBVA 2F8SA 3AO2A 1KFSA 5EU7A 3DOKA 4CJPA 4KO0A 3M8QA 4M3ZA 4JRPA 3QNNA 3ZSOA 5FRNA 4W5NA 4O44A 3S9HA 4FZZA 4H8KA 1B92A 4M3WA 2PYJA 1RBTA 4CJTA 2X74A 3V1QA 2X6SA 1BI4B 1UAXA 4CJEA 4CGIA 5HRSA 1KVCA 1B9DA 1U45A 1NKBA 2JLEA 4DTPA 4CF1A 4DSJA 3NGYA 3VA3A 2FC0A 4KHQA 1G15A 4CGDA 3V9WA 3HYFA 4DS5A 2HNYA 1WSIA 3KIOA 3AVAA 3V9XA 1Q9YA 2O4IA 1ZBIA 3IG1A 2YV0X 2X6NA 4DF4A 1TKTA 4QOZB 1UWBA 3LAKA 2VG5A 3TAMA 4XIUA 4FJ8A 4DU3A 4NYFA 1HYSA 3E01A 4DU4A 4CK2A 2IC3A 4GMJB 4FM1A 1VSIA 1REVA 4FJ7A 4DTOA 1QHTA 1RDAA 4J2BA 1SUQA 3HL8A 3AVBA 3LP3A 1J54A 1L3UA 3G0ZA 3MECA 2KFNA 1JLBA 3KKRA 3SUQA 4PA1A 3VQBA 4OLAA 1IKXA 4DSLA 4CJQA 1X9WA 4B8CA 1BIZA 4DFKA 5CYQA 1HNIA 1RNHA 3CQ8A 4C8KA 1N5YA 5HLFA 1KLMA 2FBXA 4Z4GA 4KI4A 4AHCA 4E7JA 5CYMA 4CFAA 3AVIA 1Y97A 4NCBA 1RDDA 4E7LA 3OS2A 4E7HA 1U47A 3CYMA 4LY7A 1GOBA 4BE1A 4CIGA 2QKBA 3K58A 3QEXA 4CF0A 1CZ9A 4DU1A 4CHQA 3ZSZA 3OYHA 3S3MA 3WNFA 4N47A 3NAEA 4CEEA 1SKRA 4I7FA 2OZSA 5DMRA 5KRTA 1JLFA 3EYZA 5CY4A 4M3RA 4FW2A 4H4OA 3OYMA 1TAUA 5I42A 1ASVA 3AVMA 4CJ4A 3RMCA 1TKDA 3LANA 2Z1IA 3DMJA 3KLHA 4B9NA 1NK4A 5C24A 3LPUA 5CZ2A 4MFBA 3PY8A 1X1PA 4B9SA 2HNZA 1S1WA 2OPRA 4M3XA 4J2AA 3L3UA 1SL2A 4PUOA 4KPYA 4RW6A 3LZJA 1JLGA 3SQ1A 4IFVA 5J2PA 3M8RA 3KK1A 3HVRA 3HSTB 3MXMA 2HHTA 3V6DA 2ATQA 3EZ5A 1XI1A 3P1GA 4HCCA 3M8PA 3NF6A 3OYDA 3CFPA 1S6PA 5HRRA 1S1VA 4JLHA 4CEZA 2G8HA 4CHZA 3A2FA 4DSKA 3RMBA 4EZ6A 4QAGA 3TAFA 1L5UA 5HROA 2DFFA 4J2DA 4FVMA 1TL3A 4K8XA 3OVNA 2VG6A 4KI6A 3NF7A 1A5WA 1QS4A 4KHWA 3QLHA 3ALYA 4W5OA 3U6FA 1IKWA 4CE9A 4FK4A 3VQEA
chains in the Genus database with same CATH superfamily
2RE2A 1VSJA 2FF3B 1NJXA 3C6TA 2XY8A 4JI3K 4AILC 3RR8A 1HNWK 2D0PA 2P9UA 4KAZA 4IG3A 1BA0A 5LMNK 1NGDA 4LF6K 2KFZA 3CIPA 1KAYA 4IOXA 3THYB 3RRGA 4M3YA 3LWMA 3NVMA 1XUPO 1D9DA 3H3OB 4QCLA 4RCHA 4G1QA 3ENOA 4H0YB 4FJJA 1HLUA 1BGXT 2A6AA 4OJRA 4HTUA 1Z26A 2P9LB 1HQUA 3FZFA 3Q7BA 4H5WA 5M1PA 4M3UA 1U4BA 1L3TA 3K59A 2ASOA 2P9SB 3F2KA 1IH7A 1WLJA 5AQYA 5DK5A 3JYTA 3BGRA 1TK5A 3ZETB 3PSFA 2Z1GA 5AZJB 3S3OA 1C6VA 1JLAA 3CMEN 4JHDB 1MWMA 2FBYA 4BE0A 4B1WB 1LAVA 1VQLN 3SJJA 2I7PA 1VRTA 4K43A 1BU6O 2D0AA 5HOOA 2XY5A 1HX1A 3QICA 3HPGA 4ILJA 2GEMA 4U7BA 1WSFA 1NK7A 3MWTA 3FGUA 5JS2A 2YHYA 2NRXA 4JKGB 3I56N 1Z05A 4O4GA 1JXBA 3IS9A 1WAJA 1ZBFA 3O08A 1VQ8N 4AHSA 3JAMO 1QSYA 4BACA 2A42A 3ZX2A 4FLYA 2P9IB 2UYTA 1EP4A 3CD6N 2NZTA 4YDUC 4B8AB 4IDKA 2HBMA 4DV5K 4DV3K 4H4MA 1LCUA 3CHWA 2RKIA 3WUHA 3THWB 4Z4FA 1NOYA 4B9VA 3K5MA 4KKOA 4LD0A 1TGOA 3WXMB 4JRQA 1TUUA 3CQYA 4NLCA 4FWLA 1T6DA 1NJYA 3FE1A 2O4GA 4ISEA 3C7NB 3ZSYA 3SV3A 4KV8A 2W42A 3CFOA 3TU5A 3SUPA 3LAMA 3VEWA 3C95A 2HNDA 4FCYA 4DTXA 1NKCA 2D5RA 3CETA 2IVNA 4IFYA 5EOYA 2YI1A 4H5VA 4MDAA 3MN9A 2OPPA 3MCAB 4Y1CA 4FJXA 4QS7A 3VQ6A 1TK0A 5KPRA 4FWOA 4CW7B 3U9ZA 4IOCL 5J2QA 1VQNN 3UIQA 3CC7N 4I9LA 4O0JA 2PY5A 4H5RA 3LDQA 3SUNA 4CCHA 4CJVA 2B4JA 2HHQA 1TYQA 4CJRA 3BF3A 4GVMA 3CJBA 4JV5K 1UA1A 2NRWA 1S1XA 4B3RK 4PY5A 3O3GA 1NKEA 4IBNA 4FM0A 1RBUA 2KHOA 1OVQA 3N4PA 5AFUH 4OKKA 4CGHA 1YXQA 4BY9C 4E7IA 3MK6A 5BR9A 1NBWA 2GV9A 2Z1HA 2VCPA 5AQFA 4JS4A 1RBSA 3N4QA 1EETA 2YHWA 5TKWA 1RILA 3V4IA 2A40A 1WN7A 4B1ZA 1U2VB 2YNFA 1M90O 3J81O 3QBXA 2V7ZA 4WFNL 3RRHA 1GOCA 4LSNA 3U3GA 4JI7K 4AF1A 3A5LC 1RTDA 1J53A 4KB0A 4DV2K 1RDWX 5KRSA 1LW0A 1IKVA 4NYNA 3VF6A 1IV0A 4U67L 4DKWA 2HHSA 5LJWA 3V9ZA 1D5AA 4KHYA 4G9ZA 3O8MA 2DFEA 2PBDA 4TSXA 1ASWA 4F3TA 3L8BA 3IAYA 1YIJN 3ULEB 3VPZA 1C0UA 3AVJA 1QQNA 3KK2A 1HRHA 3LP0A 2ETJA 3THVA 3AVCA 3QEIA 3NCIA 2O8FB 2DTUA 2HMIA 3NFAA 3OTOK 3VQPA 3QB0A 3RTVA 2BDPA 4A2BA 3G6EN 3QEPA 4JKHA 4JI5K 2D0OA 4E1NA 3TI0A 5CHIA 3QESA 3KLGA 2Q0UA 3SAGA 2O8CA 1WBBA 4CEQA 3TTFA 4BRKA 4FJMA 3WNEA 1CXUA 1S6QA 3SMSA 5LL6Z 1DLOA 4OKEA 3HP6A 3FR0A 5F2RA 1SL0A 2I7NA 5KPZA 4HCBA 4DTNA 2RHKA 1Q8IA 3E9LA 3SYZA 1K8AO 1TK8A 2HF4A 3KLIA 4IO9L 2A1RA 3ZX0A 3TAPA 1TUYA 2VQEK 4LFCK 3THYA 3L3VA 2P9NB 3NF9A 1Q9XA 1O1WA 1EXQA 3SJHA 1JCEA 1D8YA 3VQ4A 3PV8A 1WSGA 2E2QA 4FPAA 3LM2A 4C23A 2QWPA 3MX5A 4CF8A 5JS1A 1VRUA 3O6WA 2P9LA 2VWBA 3WQUA 2VGNA 2ZQBA 2D0BA 2P9SA 3EEQA 4JI4K 2PYLA 3A8YA 3VEOA 3SBGA 2GX9A 3IKMA 3PO5A 4CEDA 4MO5A 5FLXO 3ZETA 4X62K 4DR3K 4RW9A 5AZJA 3FFKB 2HBKA 1KFSA 5EU7A 4JHDA 4KO0A 4OPHA 1R59O 3BZKA 4IJNA 3HOSA 3U4LA 4LF7K 5JLHA 3S9HA 4O8KA 1E4FT 3JS6A 5H1SQ 3G4SN 2PYJA 3V1QA 4XH1A 1YAGA 1KVCA 1B9DA 1NKBA 4DTPA 3PSIA 2E1ZA 4CBUA 2FC0A 1G15A 3EKUA 4CGDA 3V9WA 3CJ7A 2HNYA 1BG3A 1WSIA 2WC9A 2O4IA 1ZBIA 2YV0X 3L4IA 3LAKA 3DXMB 4XIUA 4JKGA 2E20A 2ZWHA 3C0BA 4GMJB 1REVA 1IBLK 4J2BA 1KQSM 1J54A 3BY5A 1X3MA 3VQBA 4OLAA 1X9WA 3CCJN 2CH5A 2QI2A 5CYQA 4DR2K 2P9IA 3E66A 5AJ3K 1Y97A 1GOBA 4WQ5A 4CF0A 4DR7K 3THWA 3H6EA 4YY3K 3OYHA 4H0PA 3NAEA 2OZSA 1SKRA 4CEEA 4I7FA 5CY4A 5I42A 3AVMA 3RMCA 1V4TA 1NK4A 1N32K 4JK9A 3C7NA 3FZKA 5AQVA 3D2FB 3PY8A 2HNZA 2OPRA 4J2AA 4NB4A 1SL2A 1Q81O 4M63C 1JLGA 4IFVA 4JI1K 2ATQA 4HCCA 5CR4A 3M8PA 3K9JA 3NF6A 4CEZA 4JLHA 3WQTA 1DEJA 3A2FA 4BQZA 4QAGA 3ZYYX 1TL3A 2QWNA 1A5WA 2UUAK 4IWVA 1C0FA 2QTDA 5A2QO 3THXB 5ADXA 1DKGD 4WQ4A 3AGKA 1YTAA 2W41A 1R0AA 1N34K 3J7YP 3WXLA 3I55N 4Q0BA 3DLEA 3R1XA 3AO3A 1XMOK 3H46O 3J80O 4B3TK 4MDBA 3KVGA 4BC3A 2WTUA 3QEVA 3BP8A 2YNIA 3IFRA 3EZWA 3DJCA 5TKYA 3KD1E 1QSSA 2X78A 3OYFA 4Z94A 3VQ8A 3C94A 4AM7A 4LSLA 5AQJA 4Y1DA 1SL1A 1D9FA 1KC8O 4FJLA 3HSCA 4W5RA 4JS5A 1FXXA 1H1VA 5ADXH 1JL2A 1VSHA 2A3ZA 5AQMA 4ELVA 4AHRA 3LDOA 5FDLA 3CPWM 3ISNC 5AQQA 4AM6A 4L8RB 2WOMA 4A61A 4CFDA 1QZ6A 4DB3A 1U2VA 5F1XA 5KTQA 3CJAA 4HHTA 1KAXA 3ID8A 1EKEA 2QWOA 4CK1A 3OS1A 1P8ZA 4BG8A 3OYKA 3ZSVA 2KQ2A 4DMNA 4AHTA 4H0TB 4B9LA 4YOWA 2F96A 3O1BA 3PX0A 4DQQA 1NGGA 3KZBA 2IDOA 1Q7YO 4MLHA 1DTQA 3DM2A 3SBTA 3ZT1A 1CZAN 4DTMA 3UKUB 4ID1A 2YNHA 3L2QA 5AQUA 1X9MA 1VSFA 1WAFA 4Z4HA 1CLQA 1XHZA 5AQLA 5EXWA 4YOVA 1XWLA 4RG8A 1YF5L 3ULEA 3NGZA 2D4WA 4X64K 1VSEA 1BCMA 1RDUA 2YKNA 1LW2A 3M3ZA 4DTUA 4BR7A 3CCLN 1XNRK 1HJRA 3DXKB 2O8FA 3KWGA 4JI2K 3CXCM 2G8WA 3HZ6A 4YORA 3OYLA 4M41A 2GBZA 4CJ5A 3AY9A 3ZSRA 1YVNA 4O5FA 1RT5A 4CD3A 4OPJA 4E19A 4DWIA 3WXKA 2OCEA 4WFBL 2YHAA 5D3GA 3VQ7A 3O5BA 3RVCA 1CXQA 1EO1A 1KTQA 2ZM6K 2VYPA 1HUXA 3VEYA 4CJ3A 4KB1A 3NVKA 4ZTFA 4BRAA 3WT0A 4C8MA 3AA4A 1LWFA 2EX3A 1KVAA 2OPSA 1DT9A 1E4GT 1B9FA 2XRIA 3ITHA 3PIPL 4I6MB 1ITGA 1JLEA 4CEBA 4RW4A 3D6RA 4BR9A 3SQ2A 1BOTO 3NH2A 1IO2A 2P9NA 4DFJA 3L2UA 2ZJPL 5F0XA 5SWMA 4H0VB 4F8RA 4E1JA 4FM2A 5KQ8A 1DTTA 3GDQA 1S1UA 5JVGL 3WXIA 1HKBA 4IFEA 3ZT3A 1VK0A 3LWLA 3E9OA 4FK0A 2HHXA 2KLAA 1XC3A 2ZF5O 4AQYK 4DR5K 3SAHA 4A59A 1GLEG 5I9EB 3ULDA 1NOZA 2UXCK 5SZTA 4FLVA 2YJEA 4JKDA 3ZSXA 3LM9A 2GELA 3AVKA 4H03B 2V7YA 1XC9A 3MXIA 1HJOA 3D2EB 3ZT4A 3CFRA 4V19S 3OYEA 1ASUA 4OPKA 1S5JA 1FW6A 4PWDA 1YJ9N 3CJ1A 2CGJA 4DQ8A 3HO1A 1QSLA 3OBYA 1X3NA 1D4XA 3A0IX 4JK8A 2XHBA 4HUGA 4DG1A 3T1HK 2J4RA 3DRPA 3DXMA 1S72N 3TPQA 2NRRA 1MA9B 1KLNA 3DLBA 4I2QA 3D0PA 1N36K 2B5JA 2RPIA 4Y0WA 1RT3A 4DV4K 4DSFA 1NK6A 1OH7A 1VQ9N 4E0DA 4KHNA 3NMUA 1IKYA 4LF9K 2O8BB 3GBTA 2FF6A 4EZ9A 4ZHRA 4F3OA 4DCHA 1NGFA 3JSMA 2OYQA 1QQMA 1BQNA 2VWJA 3LDPA 3UKRB 1I3AA 3F9KA 3TAGA 1X9SA 4CBXA 4CHPA 3P83D 3HM9A 2G8KA 4DQSA 2E4LA 5I3UA 3KKSA 1A5VA 2QWLA 3HTVA 2E6MA 1IBKK 2E2PA 1NGCA 3TWHA 3QNOA 4BRHA 3AVLA 3KD5E 1RTHA 5FRMA 4FJGA 3SAFA 3D2FA 3P39A 1RBVA 2KW4A 4C1NI 1LV5A 4FWMA 3CCMN 5K14A 3OW2M 4PKIA 2FSJA 1BUPA 2Z1JA 3PX6A 4C8OA 2IOCA 1EX4A 2JGUA 5HRNA 3PIOL 4CD1A 4K41A 4OGEA 4BRIA 4KHPK 4GV3A 1TKXA 1VSLA 4IXCA 4C8NA 2E6LA 3THXA 3L2RA 5AFUA 1GLCG 3LALA 3FZLA 3CCVN 2OZMA 1ZYQA 2F8TA 4J8FA 1JCFA 4FJHA 3CM5A 4JD2B 3G10A 5BRHA 2QKKA 3DOLA 3A5NC 3L2VA 3VQ9A 4R79A 3O9TA 1UA0A 3TTCA 4IJAA 1HMVA 1YI2N 4DSIA 2OPQA 3K5OA 4BR5A 4DUZK 3LDNA 1T03A 2IAJA 4CZGA 4YOTA 3VQ5A 3CG7A 1YUWA 3D7EO 4MO4A 1JLCA 3DLRA 2Y1IA 2CGLA 4CEOA 2F9WA 1RFQA 4BREA 3G25A 3FZHA 4A5AA 4EHTA 2ITMA 3BUZB 1IBMK 4O44A 2AP1A 3P4IA 3CCEN 4B1VA 3TSPA 3ZX3A 4DV0K 4H8KA 4FZZA 4M3WA 4CJTA 3H45C 1BI4B 1NGIA 4CGIA 2FLOA 1VQ7N 2FSKA 5AZIB 4DSJA 3NGYA 3VEZA 4KHQA 4DS5A 1V4SA 3UKUA 5M1KA 1Q9YA 4IZ9A 3IG1A 1K73O 2PFUA 1TKTA 4QOZB 1UWBA 1VQON 2VG5A 4CVNE 4EHUA 1VSIA 4FJ7A 1J6ZA 3HL8A 1ESVA 3W0LA 3MECA 3MDQA 1JLBA 1ZBSA 4PA1A 3DXKA 1Q82O 1IKXA 4IOAL 4DFKA 4BRPA 4Z4GA 4KI4A 4AHCA 2CGKA 5CYMA 4CFAA 4FPBA 3AVIA 4YHHK 1YHQN 5M1FA 4E7LA 1ATNA 4E7HA 4LY7A 3AARA 4NO7A 1QZ5A 4FWPA 2QKBA 3I33A 4LF8K 4CHQA 1NJIO 3S3MA 3WNFA 1OH5A 5DMRA 4DV6K 3EYZA 4O8UA 1GLLO 4H4OA 4WQ4C 1ASVA 5EX5A 1NNEA 3KLHA 4B9NA 5C24A 1ILYA 4FO0A 4OO1J 4RW6A 2Q0RA 4BG9A 3KK1A 4JI6K 4I6MA 3MXMA 3V6DA 1XI1A 5AQOA 4LF5K 1S6PA 2G8HA 3RMBA 2V52B 5HROA 3OBWA 2NRZA 3LL3A 3NF7A 3P38A 2HB5A 1SAZA 3O9RA 2E2NA 4DR6K 1NJWA 4YDUA 4JKEA 4NXNK 1S9EA 2ZGZA 3E1YA 4A5BA 2ZE2A 1NGEA 1JJ2M 4DSEA 4FJ9A 4IEIA 3NGIA 2FXUA 1W7AA 1UOCA 1W9HA 4DUYK 1YITN 1C1AA 3WNGA 4ELTA 3HBTA 3LP1A 4DFMA 4FXDA 3C65A 3MAQA 1OVYA 2DY4A 2WFBA 4HWIA 3VQDA 4K42A 1IJJA 1NGJA 4FJ5A 4YOUA 1GLFO 1T7PA 3VETA 3QDKA 3HK2A 2O8DB 4WFAL 4BC4A 3EY1A 3HJFA 4Q5VA 4B9TA 2HHVA 3V1RA 5GAHP 1WUAA 3R6MA 1VQPN 4HVJA 5GADP 3MXJA 3TAQA 3FLCO 5AQHA 3OYNA 4E3SA 4JI8K 3MN7A 4DFPA 3CERA 1VAZA 1HPZA 3U3YA 3B6PA 3CC4N 4CHYA 2XY7A 4QS8A 3RSEB 4FLXA 4CERA 4O0IA 3UKRA 2EWSA 4GW6A 3VN5A 5KGXA 2IGIA 2ZD1A 1XMQK 2GUPA 1HNVA 3MN6A 4KHUA 3CJ9A 3SQ0A 4FVUA 1Q86O 1QHAA 2BE2A 4M42A 4CK3A 2IIRA 2Q1NA 3AO1A 5E84A 4E1MA 4WF9L 2YX6A 3QFPA 1ZBLA 1W2BM 1A5XA 4X65K 4FJNA 2NLXA 3L6QA 2GUIA 4MLEA 2QWMA 5T7BA 4CZFA 1NK5A 4YOYA 1FKOA 4B9MA 3TANA 4CZHA 3JXUA 3QEWA 3V1OA 5AQGA 2P5GA 4L3QA 3MEDA 1BQMA 2HOEA 3RMDA 4CJKA 4XEIA 3B6OA 1Q18A 4E89A 1X9JA 1U04A 1HNZK 1NK9A 3K9KA 4N41A 2E88A 1JKHA 3CCQN 1GLJO 4PL8A 4PL7A 4IDHA 2YHBA 1BISA 4M45A 4EFHA 4KTQA 1XNQK 1IG9A 1HNXK 3DWLA 1KRPA 4FLWA 1C1BA 3SV4A 4JD2A 2HSTA 3I0SA 4W5TA 5BN8A 3WNHA 2W40A 1I94K 3VTIA 3UB5A 2GWKA 2UXBK 4XH5A 2O8EB 3OYAA 4CJUA 1TAQA 4J2EA 3HVTA 4K8ZA 1K9MO 4W5QA 1TKZA 4B1UB 1ZC6A 3RWUA 4YOXA 1FJGK 2OA8A 2Q3SA 3DRRA 3SQ4A 3FZMA 3L2WA 3AGRA 2QK9A 3S3NA 1BA1A 1LAWA 4CFBA 2E2OA 5CE3A 2QW9A 4HUFA 1WSEA 4N5SA 4BWMA 3F73A 2Q2RA 1HKGA 3SMPA 3AAPA 3T7ZA 3PUFA 5KGWA 3AVHA 5AR0A 3OY9A 1RDCA 2WBNA 5C2DA 3T1AA 1K6YA 3M1FA 1KXPA 1C0MA 1BI4A 2ZJQL 1ZBHA 5C25A 3D45A 4YNQA 2DFHA 1FK9A 5JVHL 1BWFO 3AAQA 2FBTA 2KZMA 5AQZA 4CGFA 3AVFA 2UUBK 4OLBA 4BRLA 3CF5L 1KSPA 4JKFA 5KPTA 3LPTA 2P5OA 4JKAA 1W97L 2HVHA 4JN4A 4BR0A 4N56A 3W3DA 3BF1A 3SPYA 4AHUA 1JLQA 3R3LA 3HP9A 1L3SA 4PHTX 1CZBA 1KCFA 4O55A 3OYBA 4FWQA 1RT4A 1I39A 3TSUA 1T05A 4FYDA 4A62A 1M1KO 2KTQA 4Z4CA 2VWKA 5HL7L 5AQSA 3TARA 4CJWA 1TL1A 3F5TA 3EE8A 3VESA 1JL1A 3R9PA 3HRGA 5C2FA 1VQMN 1LOTB 2XO7A 5AQIA 1F21A 3KWIA 3V9UA 4CEFA 5M1OA 3MN5A 1YTUA 3EE9A 3QETA 5HP1A 4ID5A 1QQCA 3O4WA 3HM8A 1TV6A 4HTLA 3O4NA 4ILGB 4DF8A 2P9KB 4CF9A 4ELUA 3NE6A 4EP4A 3DLKA 5CZ1A 3SZ2A 2G8IA 4UQGA 5C42A 4I2PA 4FWNA 4M3TA 3OJUA 2OANA 4DV1K 1JCGA 3V81A 2H3GX 1J9AA 4GKKK 3BDPA 2Q97A 1QVFM 1VSMA 3VA0A 3CC2N 1ZBUA 2I5JA 3NDKA 4DR4K 3LDSA 1VSDA 3H1QA 4CESA 4JAXA 4N76A 4CJFA 1GOAA 3AO4A 4KTZA 1SKSA 4F2RA 3ENHA 3MCPA 5BRDA 1KFDA 4AH9A 5AQWA 5ELZA 4BGAA 3VMFB 4CZLA 4M7YA 4KRFA 3WXJA 1U49A 3LP2A 4DLEA 2HVIA 1MDUB 1WSJA 2UXDK 4FJKA 1WSHA 4Z4IA 3CMAN 1VQ5N 4CHNA 3ZLJA 3TAEA 4Z0UA 4PKHA 4RW7A 3T69A 4GKJK 3MWPA 4EIAA 2E8AA 4B9UA 4BDYA 4FZXC 3PO4A 3HI0A 4BWJA 1WBDA 3OJSA 2O8DA 1ATSA 3SCXA 3VQQA 2NUBA 3VF4A 3ZT2A 3SI6A 4WCEL 1DGKN 3T1YK 2AJQA 1T8EA 4OPAA 2F8SA 3DOKA 4CJPA 2GTDA 3M8QA 4M3ZA 3QNNA 2YHXA 3ZSOA 3O9SA 1OH6A 4W5NA 2NRVA 3P31A 3B8AX 4CJEA 1U45A 3J7ZO 2ZJRL 2JLEA 3RSEA 2JWLA 2D1KA 5BREA 2BTFA 3HYFA 3KIOA 3AVAA 3V9XA 3CPEA 5JMVA 4NLBA 2F9TA 3VGMA 3TAMA 4FJ8A 1HYSA 4DU3A 4NYFA 4CK2A 3A5MC 1EQYA 1QHTA 1RDAA 1SUQA 3VENA 3GOIA 3AVBA 3LP3A 1L3UA 3G0ZA 2KFNA 3SUQA 1VQ6N 4DSLA 4K0KK 4C8KA 1BIZA 4KBOA 2QA4N 5HLFA 2E1YA 1NGHA 2W6KA 2GWJA 1U47A 1IG8A 1WB9A 3VOVA 4JK7A 3K58A 1CZ9A 4BRDA 5DM6L 1JLFA 2E5LK 2PAVA 1N33K 4FW2A 3OYMA 2UU9K 1TAUA 4CJ4A 1TKDA 3LANA 4H5TA 3DMJA 3F9MA 5C10A 3LPUA 4MFBA 1X1PA 4M3XA 4DV7K 3L3UA 4PUOA 4KPYA 4FWRA 3LZJA 5FPMA 3C6AA 4JEPA 1RGIA 3O1WA 1QVGM 3EZ5A 3P1GA 3CFPA 5LJVA 4DSKA 1S1VA 4WYBA 5IT9O 4RWTA 4EZ6A 1NWKA 3TAFA 3M5RA 1HPMA 2QWQA 5JICA 1L5UA 3OVNA 4XH4A 1ZXOA 4KI6A 4BRCA 1QS4A 2O8EA 3ALYA 3BEXA 4W5OA 5BPLA 1IKWA 1N8RO 4FK4A 4DTRA 4GY2B 4CHOA 1BO5O 5M1NA 3UE5A 5BN9A 5KQDA 1BDGA 3ZSWA 3PLAA 2IS3A 4FLTA 4CF2A 3K2PA 3ATUA 1NMNA 3CM6A 5E26A 2B6AA 1RTJA 3AA2A 2NNWA 4JKCA 5BPNA 3EKSA 1VSKA 2QM1A 2G8UA 1BL3A 4CJSA 3S41A 1VHXA 3K5NA 3T3FA 5BR8K 3WEEB 1S3XA 4BDZA 4E7KA 1P90A 2HBLA 4FWKA 4ILHA 5C12A 1NGAA 3K5LA 3EL2A 4CIEA 4CECA 1KAZA 4FJIA 4H5NA 4Z4EA 2YNGA 4FW1A 4B3OA 3DLGA 3QIPA 1N6QA 4KH6A 1EWRA 4LC9B 5JLFA 4CJ7A 4FL9A 3ASMA 4ICLA 3A5OC 3QO9A 1Z25A 4FOEA 4DQPA 1W0HA 4YFUA 2FSNA 1RDBA 5FPEA 1NJZA 5HRPA 3L4QA 3DRSA 4FOIA 3J7AP 4WQ5C 4FLUA 2EHGA 2AA4A 3ID6A 1YT3A 1Y64A 3SNNA 3QMLA 2UUCK 3O4QA 3K0SA 2ASPA 3KJVA 4B3SK 3O9UA 1EWQA 3CCUN 4X66K 5J2NA 1Z6RA 4BROA 3NH1A 1LWCA 2A41A 2Q31A 3TSQA 1K8KB 4ZTJA 4KFBA 2P9KA 3IMXA 4NCGA 2G8FA 2Q36A 2QWRA 4F2SA 4LH4A 3QINA 4LFBK 5AQKA 1S1TA 3VERA 4BRMA 1YVUA 4FSVA 3NF8A 3PX4A 1RT7A 4CIFA 2LSNA 3ZT0A 1NK8A 3H3NO 1ATRA 3GL1A 1MWKA 4CZKA 4FWSA 4BRFA 4B1YB 5J2MA 2G8VA 4KH4A 3OYCA 3V9SA 3EN9A 3H08A 5AQXA 2ZGYA 1NM1A 4EAHD 2PZSA 3AA3A 3DLLL 3MX2A 4FK2A 2P9PB 4KHWA 4GV6A 1JXEA 4IKFA 3ZEUB 3OS0A 4K25A 1L3VA 2P1JA 3AO5A 4H0OA 4IG0A 4BC5A 3U8XA 4BRNA 1HQEA 4CZMA 5C0YA 4GNIA 2HMPA 4BQLA 3CCSN 2NRTA 4AHVA 1SV5A 3EO3A 3DLHA 1NGBA 1O13A 2IVPA 4CJLA 5GINA 3KTQA 2ASMA 2R7YA 5GAGP 2Y1JA 3I8BA 4KHSA 3VQCA 4F4KA 4CEAA 2P9UB 4M7XA 3DYAA 4O5BA 1C0TA 5GIOA 2KKZA 3AVNA 4LF4K 2QEXN 3OYJA 4DTJA 3D2EA 4NCAA 4R5PA 1C1CA 5AQNA 3M6GA 3TABA 4LH5A 3HT3A 3IDHA 2A1SA 3O3HA 1QTMA 4I9QA 3FFIA 3KLFA 5HBMA 4B3MK 3AVGA 1LWEA 5MLCQ 5B8HA 3VGKA 4BE2A 1J5OA 2BANA 4JYAK 3NHGA 1HYVA 4B08A 5GAEP 4JKBA 2HW3A 2V51B 4BRQA 2VGMA 5EY4A 2O8BA 3I8DA 3HPHA 2BH1A 3SPZA 1BCOA 3O9QA 4KREA 3HPOA 2WONA 3KK3A 1RT6A 1T6CA 1NU0A 4OVLA 2VG7A 2ITGA 3CJCA 2P51A 3HXMA 2OTLN 3NBPA 1QE1A 1RT2A 4A57A 4ISFA 4IO8A 1RCHA 3VEXA 4DQIA 3DAWA 2W6LA 1RTIA 1TVRA 1NMDA 1OKJA 5C15A 3KK7A 1SQKA 4B9QA 1SZ2A 3C6HA 3OHRA 3Q7CA 5LY3A 3C6UA 3OA9A 1HYZA 5J1EA 3QIOA 3DI6A 3SLCA 5FROA 3IUCA 2YKMA 4F9OA 2RF2A 3GE1A 2HHWA 4OX9K 1NLVA 3H1VX 3TTDA 4EP5A 2YCHA 2DPNA 4A2AA 1GLDG 2D0CA 4BR4A 1SKWA 2HHHK 4BDPA 1T44A 2HBJA 3KHYA 5AQPA 3HOTA 2HHUA 3ZSQA 4BVOA 3QERA 3MMVA 5BPMA 4CFCA 3R8EA 4KTWA 2QXLA 4DS4A 3O80A 2F4VK 3MEEA 2RN2A 1KD1O 1NK0A 5FPDA 1HKCA 3IRXA 1RBRA 3BZCA 4OGCA 3I0RA 3RMAA 4BVPA 5E41A 3OYIA 4BGBA 5AQRA 2IVOA 4BC2A 3VGLA 4GVEA 4CZEA 4OKJA 1KVBA 2XY6A 4DTSA 2QXFA 3AV9A 3NH0A 1GLAG 5GIPA 1U48A 3LZIA 2KZZA 3AA5X 5IWAK 1G99A 1BIUA 1E3MA 5KI6A 4CGJA 1OH8A 3MEGA 3OYGA 5LMUK 4ISGA 3GG4A 4CBWA 3O3FA 4FZYA 3VEVA 1BHLA 1MU2A 3WEEA 1GLBG 1U6ZA 3RR7A 4B1XB 4IEEA 3LDLA 1S9GA 4CGGA 4MQ3A 3TR8A 4HUEA 3K57A 3QBWA 3ZCMA 1WNSA 4C8LA 4FLZA 1WOQA 4H0XB 4RW8A 2BGGA 1RT1A 3SUOA 4DLGA 2BUPA 2F7TA 3P5JA 3M8SA 4WE1A 1FKPA 4PQUA 4DQRA 1TYQB 3QFUA 1XQSC 1XHXA 5AZIA 1YJWN 3T19A 3VQAA 3KLEA 2FBVA 3AO2A 5FRNA 4JRPA 3ENBA 1B92A 2HF3A 2VQFK 5BRFA 1RBTA 5AQTA 5HRSA 2X74A 2X6SA 1UAXA 2JWKA 4GV9A 4LFAK 4CF1A 3VA3A 4QS9A 2A5XA 1VQKN 4DF4A 2X6NA 1HR0K 1NG9A 2OTJN 2YJFA 4BR2A 1C0GA 4C1NK 3E01A 4DU4A 4UY8O 2IC3A 4FM1A 4DTOA 3L0QA 4JNEA 3CI5A 1S22A 4BRGA 5FPNA 3ATVA 1K8KA 3KKRA 4DHYA 1YJNN 3J8AA 4CJQA 4B8CA 3CQ8A 1HNIA 1RNHA 1N5YA 1KLMA 2FBXA 4E7JA 4NCBA 1RDDA 2NRHA 3OS2A 3CYMA 3CCRN 4BE1A 4CIGA 3QEXA 4DU1A 4PKGA 3SK3A 3ZSZA 3U9DA 4CZIA 4N47A 5KRTA 5EVZA 4M3RA 4CZJA 3VTHA 2Z1IA 1SS6A 1J5EK 3CQXA 5CZ2A 3VF2A 3G71N 4DR1K 4B9SA 1S1WA 2P9PA 4JI0K 1VQ4N 2CH6A 3SQ1A 2WUSA 3ZEUA 5J2PA 3M8RA 4RTFD 3HVRA 3HSTB 3E9PA 2HHTA 4KH5A 3OYDA 2O8CB 5HRRA 4CI6A 1T3VA 4CHZA 4J2DA 2DFFA 4FVMA 5M1QA 4K8XA 1QQOA 2VG6A 3QLHA 5DM7L 3U6FA 4CE9A 4NXMK 3VQEA
chains in the Genus database with same CATH topology
2HB5A 4DTRA 1VSJA 1NJXA 3C6TA 4CHOA 1YTAA 1NJWA 1R0AA 2XY8A 4AILC 1S9EA 4Q0BA 3ZSWA 3DLEA 3RR8A 3AO3A 4KAZA 2IS3A 4FLTA 4IG3A 4CF2A 3K2PA 2ZE2A 3CM6A 3QEVA 4FJ9A 2B6AA 1RTJA 3AA2A 4DSEA 2KFZA 3NGIA 1VSKA 2YNIA 1UOCA 2G8UA 1BL3A 4CJSA 3RRGA 4M3YA 3KD1E 3K5NA 3LWMA 3T3FA 1QSSA 1W9HA 2X78A 3OYFA 1D9DA 1C1AA 3VQ8A 4BDZA 3C94A 4E7KA 4QCLA 4G1QA 4LSLA 3WNGA 4ELTA 3LP1A 3K5LA 4Y1DA 4DFMA 1SL1A 4FJJA 1D9FA 1BGXT 4OJRA 4FXDA 4CIEA 3MAQA 4HTUA 4FJLA 4CECA 4W5RA 1Z26A 4FJIA 1HQUA 2YNGA 4JS5A 4Z4EA 3VQDA 4M3UA 1FXXA 4FW1A 1U4BA 4FJ5A 4B3OA 1L3TA 3K59A 1JL2A 1VSHA 1T7PA 3DLGA 3QIPA 1N6QA 4ELVA 4AHRA 5FDLA 3HK2A 1IH7A 1WLJA 3ASMA 3ISNC 4FZYA 5DK5A 3EY1A 4ICLA 3JYTA 2WOMA 4L8RB 3BGRA 4CFDA 1TK5A 3QO9A 3HJFA 1Z25A 2Z1GA 5KTQA 4Q5VA 4B9TA 4DQPA 2HHVA 1W0HA 4YFUA 3V1RA 4HHTA 3S3OA 1C6VA 1JLAA 1EKEA 4CK1A 1RDBA 4HVJA 3MXJA 1NJZA 3OS1A 3TAQA 2FBYA 3OYNA 5HRPA 4E3SA 3DRSA 3OYKA 3ZSVA 2KQ2A 4DMNA 4AHTA 4BE0A 4FLUA 2EHGA 4DFPA 4B9LA 1HPZA 2F96A 3U3YA 3B6PA 3PX0A 1LAVA 4DQQA 4CHYA 2XY7A 3SJJA 1YT3A 2IDOA 1VRTA 1DTQA 3DM2A 4FLXA 4CERA 2D0AA 3SNNA 4O0IA 3ZT1A 4DTMA 4GW6A 3VN5A 2XY5A 4ID1A 3HPGA 5KGXA 2YNHA 3O4QA 3L2QA 1WSFA 2IGIA 2ZD1A 3KJVA 1NK7A 1HNVA 1X9MA 5JS2A 4KHUA 3SQ0A 1VSFA 1WAFA 4Z4HA 1CLQA 5J2NA 1XHZA 3NH1A 4O4GA 1LWCA 2BE2A 1XWLA 4RG8A 4M42A 4CK3A 3NGZA 1JXBA 3IS9A 1VSEA 1WAJA 1BCMA 1ZBFA 2YKNA 1LW2A 3AO1A 4AHSA 4E1MA 4DTUA 1ZBLA 1QSYA 4ZTJA 4BACA 1A5XA 1HJRA 4KFBA 4FJNA 4NCGA 2G8FA 2GUIA 4FLYA 2G8WA 3OYLA 4LH4A 5T7BA 4F2SA 4M41A 3QINA 2GBZA 4CJ5A 1NK5A 1FKOA 3ZSRA 4B9MA 1EP4A 3TANA 1RT5A 3QEWA 3V1OA 1S1TA 4OPJA 4E19A 1YVUA 4DWIA 4B8AB 3NF8A 4IDKA 3PX4A 1RT7A 2P5GA 4CIFA 4H4MA 3MEDA 2RKIA 2LSNA 3ZT0A 2YHAA 1BQMA 1NK8A 5D3GA 3RMDA 1NOYA 4Z4FA 3VQ7A 4B9VA 3K5MA 4CJKA 4KKOA 4LD0A 1CXQA 3B6OA 2G8VA 5J2MA 4E89A 1U04A 1KTQA 1TGOA 4JRQA 1NK9A 4N41A 3OYCA 1JKHA 3V9SA 3H08A 1NJYA 2O4GA 4CJ3A 4KB1A 2PZSA 3AA3A 3ZSYA 3SV3A 4ZTFA 4FK2A 2YHBA 1BISA 4KV8A 3AA4A 4C8MA 4M45A 1LWFA 2EX3A 2W42A 4KTQA 1KVAA 3CFOA 3SUPA 3LAMA 1JXEA 1IG9A 4IKFA 3C95A 3OS0A 1KRPA 2OPSA 2HNDA 4FLWA 1B9FA 1C1BA 2XRIA 3ITHA 3SV4A 1L3VA 2P1JA 3AO5A 4FCYA 4DTXA 1ITGA 1JLEA 4IG0A 4CEBA 2D5RA 1NKCA 4IFYA 4RW4A 3I0SA 4W5TA 1HQEA 3SQ2A 2OPPA 3WNHA 3NH2A 4AHVA 4Y1CA 1SV5A 1IO2A 4FJXA 3DLHA 4DFJA 3L2UA 3OYAA 4CJLA 1TAQA 3VQ6A 4CJUA 1TK0A 4J2EA 3HVTA 3KTQA 4K8ZA 5SWMA 4F8RA 2R7YA 4W5QA 1TKZA 2Y1JA 4KHSA 4FM2A 3RWUA 5J2QA 1DTTA 2OA8A 2Q3SA 3DRRA 3VQCA 3SQ4A 4F4KA 3UIQA 1S1UA 4CEAA 3L2WA 3DYAA 4I9LA 4O5BA 4O0JA 3ZT3A 2PY5A 1C0TA 2QK9A 3S3NA 1VK0A 3AVNA 3LWLA 1LAWA 3SUNA 4FK0A 2HHXA 4CFBA 3OYJA 4CCHA 4CJVA 4DTJA 2B4JA 4NCAA 4CJRA 2HHQA 4R5PA 1C1CA 3TABA 4LH5A 4GVMA 3HT3A 4HUFA 3ULDA 1UA1A 2A1SA 1NOZA 1S1XA 1WSEA 4N5SA 5SZTA 3O3HA 4BWMA 4FLVA 1QTMA 4PY5A 4I9QA 3FFIA 3KLFA 3F73A 5HBMA 3O3GA 1NKEA 3ZSXA 4IBNA 3AVGA 3PUFA 4FM0A 1LWEA 5KGWA 3AVHA 1RBUA 3AVKA 3OY9A 1XC9A 4OKKA 4CGHA 1RDCA 3CFRA 3MXIA 3ZT4A 4BE2A 4E7IA 3OYEA 2BANA 3T1AA 1J5OA 1K6YA 3NHGA 1HYVA 2GV9A 2Z1HA 4B08A 1C0MA 1ASUA 4OPKA 2HW3A 1BI4A 1S5JA 4JS4A 1ZBHA 5C25A 4PWDA 3D45A 4YNQA 2DFHA 1FK9A 1RBSA 3HO1A 2FBTA 2KZMA 1EETA 4CGFA 1RILA 3HPHA 3I8DA 3V4IA 3AVFA 3SPZA 1BCOA 1QSLA 4OLBA 4KREA 1WN7A 3HPOA 1KSPA 2WONA 2YNFA 3LPTA 3KK3A 1RT6A 4DG1A 2XHBA 4HUGA 3DRPA 2P5OA 3RRHA 1GOCA 2HVHA 1KLNA 4LSNA 3DLBA 4I2QA 3D0PA 3U3GA 4N56A 2B5JA 2RPIA 4OVLA 2VG7A 2ITGA 1RT3A 4DSFA 3SPYA 2P51A 1NK6A 4E0DA 4AHUA 1JLQA 1IKYA 3HXMA 4KHNA 1RTDA 1J53A 4EZ9A 3HP9A 1L3SA 4ZHRA 4F3OA 4KB0A 3NBPA 1CZBA 1KCFA 1QE1A 4O55A 3OYBA 1RT2A 5KRSA 1LW0A 1IKVA 3JSMA 2OYQA 1BQNA 2VWJA 1RT4A 1I39A 1T05A 4FYDA 2KTQA 1RCHA 4NYNA 2VWKA 4Z4CA 4DQIA 3TARA 4CJWA 1I3AA 1TL1A 3F9KA 3TAGA 1X9SA 4CHPA 1RTIA 1TVRA 3P83D 3HM9A 2G8KA 4DQSA 1JL1A 2E4LA 3C6UA 3V9ZA 1HYZA 5J1EA 2HHSA 3QIOA 2XO7A 1D5AA 1F21A 5I3UA 4KHYA 3DI6A 2DFEA 4TSXA 1ASWA 5FROA 4F3TA 2YKMA 3L8BA 3V9UA 4CEFA 3IAYA 3KKSA 1YTUA 1A5VA 3QETA 1C0UA 2RF2A 2E6MA 3AVJA 4ID5A 3KK2A 5HP1A 1HRHA 2HHWA 1QQCA 3LP0A 2ETJA 3THVA 1TV6A 3AVCA 3O4NA 4DF8A 4CF9A 3TWHA 3QNOA 4EP5A 3AVLA 3QEIA 3NCIA 3KD5E 4ELUA 1RTHA 5FRMA 2DTUA 2HMIA 3NFAA 3NE6A 4EP4A 3DLKA 5CZ1A 4FJGA 3VQPA 3SZ2A 1RBVA 2D0CA 4UQGA 2G8IA 3RTVA 5C42A 2BDPA 4I2PA 3QEPA 2KW4A 1SKWA 4M3TA 4BDPA 3OJUA 4E1NA 2HHUA 3ZSQA 3QERA 3TI0A 1LV5A 3QESA 5K14A 3KLGA 4CFCA 3V81A 2Z1JA 3PX6A 4KTWA 4C8OA 1J9AA 4DS4A 2IOCA 1EX4A 2JGUA 4CEQA 5HRNA 3BDPA 1VSMA 3VA0A 1ZBUA 2I5JA 3MEEA 3NDKA 3LDSA 3WNEA 4OGEA 4FJMA 1CXUA 1VSDA 2RN2A 1S6QA 4CESA 1NK0A 4N76A 3IRXA 1TKXA 1VSLA 1RBRA 4C8NA 4OGCA 2E6LA 3I0RA 4CJFA 3L2RA 1DLOA 3RMAA 1GOAA 3AO4A 5E41A 4OKEA 3HP6A 3OYIA 4KTZA 3LALA 1SKSA 4F2RA 1SL0A 1KFDA 4AH9A 2OZMA 1ZYQA 2F8TA 4HCBA 4KRFA 4DTNA 4OKJA 1KVBA 2XY6A 1Q8IA 1U49A 3LP2A 3SYZA 2QXFA 4DTSA 3CM5A 4FJHA 1TK8A 3AV9A 4DLEA 2HVIA 3G10A 3NH0A 1WSJA 3KLIA 2A1RA 2QKKA 1U48A 3LZIA 2KZZA 3AA5X 4FJKA 1BIUA 3DOLA 1WSHA 3TAPA 4Z4IA 5KI6A 4CGJA 3MEGA 3L3VA 3OYGA 3L2VA 4CHNA 3O3FA 3NF9A 3TAEA 1Q9XA 1O1WA 1EXQA 4Z0UA 1BHLA 1MU2A 3VQ9A 1D8YA 1UA0A 4RW7A 3VQ4A 3PV8A 3RR7A 1WSGA 2DY4A 1S9GA 1HMVA 4CGGA 4MQ3A 3TR8A 4HUEA 4CF8A 3K57A 5JS1A 1VRUA 3ZCMA 2OPQA 1WNSA 4DSIA 4C8LA 3K5OA 4FLZA 4RW8A 4B9UA 2BGGA 1RT1A 3SUOA 4DLGA 1T03A 4BDYA 3P5JA 2ZQBA 4FZXC 2IAJA 2D0BA 2PYLA 3M8SA 3PO4A 4WE1A 4BWJA 1FKPA 3CG7A 3VQ5A 3OJSA 4PQUA 4DQRA 1JLCA 3DLRA 2Y1IA 3PO5A 4CEOA 4CEDA 3SCXA 3VQQA 2NUBA 3ZT2A 3SI6A 4RW9A 1XHXA 3T19A 3VQAA 2AJQA 3KLEA 1T8EA 2FBVA 2F8SA 3AO2A 1KFSA 5EU7A 3DOKA 4CJPA 4KO0A 3M8QA 4M3ZA 4JRPA 3QNNA 3ZSOA 5FRNA 4W5NA 4O44A 3S9HA 4FZZA 4H8KA 1B92A 4M3WA 2PYJA 1RBTA 4CJTA 2X74A 3V1QA 2X6SA 1BI4B 1UAXA 4CJEA 4CGIA 5HRSA 1KVCA 1B9DA 1U45A 1NKBA 2JLEA 4DTPA 4CF1A 4DSJA 3NGYA 3VA3A 2FC0A 4KHQA 1G15A 4CGDA 3V9WA 3HYFA 4DS5A 2HNYA 1WSIA 3KIOA 3AVAA 3V9XA 1Q9YA 2O4IA 1ZBIA 3IG1A 2YV0X 2X6NA 4DF4A 1TKTA 4QOZB 1UWBA 3LAKA 2VG5A 3TAMA 4XIUA 4FJ8A 4DU3A 4NYFA 1HYSA 3E01A 4DU4A 4CK2A 2IC3A 4GMJB 4FM1A 1VSIA 1REVA 4FJ7A 4DTOA 1QHTA 1RDAA 4J2BA 1SUQA 3HL8A 3AVBA 3LP3A 1J54A 1L3UA 3G0ZA 3MECA 2KFNA 1JLBA 3KKRA 3SUQA 4PA1A 3VQBA 4OLAA 1IKXA 4DSLA 4CJQA 1X9WA 4B8CA 1BIZA 4DFKA 5CYQA 1HNIA 1RNHA 3CQ8A 4C8KA 1N5YA 5HLFA 1KLMA 2FBXA 4Z4GA 4KI4A 4AHCA 4E7JA 5CYMA 4CFAA 3AVIA 1Y97A 4NCBA 1RDDA 4E7LA 3OS2A 4E7HA 1U47A 3CYMA 4LY7A 1GOBA 4BE1A 4CIGA 2QKBA 3K58A 3QEXA 4CF0A 1CZ9A 4DU1A 4CHQA 3ZSZA 3OYHA 3S3MA 3WNFA 4N47A 3NAEA 4CEEA 1SKRA 4I7FA 2OZSA 5DMRA 5KRTA 1JLFA 3EYZA 5CY4A 4M3RA 4FW2A 4H4OA 3OYMA 1TAUA 5I42A 1ASVA 3AVMA 4CJ4A 3RMCA 1TKDA 3LANA 2Z1IA 3DMJA 3KLHA 4B9NA 1NK4A 5C24A 3LPUA 5CZ2A 4MFBA 3PY8A 1X1PA 4B9SA 2HNZA 1S1WA 2OPRA 4M3XA 4J2AA 3L3UA 1SL2A 4PUOA 4KPYA 4RW6A 3LZJA 1JLGA 3SQ1A 4IFVA 5J2PA 3M8RA 3KK1A 3HVRA 3HSTB 3MXMA 2HHTA 3V6DA 2ATQA 3EZ5A 1XI1A 3P1GA 4HCCA 3M8PA 3NF6A 3OYDA 3CFPA 1S6PA 5HRRA 1S1VA 4JLHA 4CEZA 2G8HA 4CHZA 3A2FA 4DSKA 3RMBA 4EZ6A 4QAGA 3TAFA 1L5UA 5HROA 2DFFA 4J2DA 4FVMA 1TL3A 4K8XA 3OVNA 2VG6A 4KI6A 3NF7A 1A5WA 1QS4A 4KHWA 3QLHA 3ALYA 4W5OA 3U6FA 1IKWA 4CE9A 4FK4A 3VQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HB5 A;  4DTR A;  1VSJ A;  1NJX A;  3C6T A;  4CHO A;  1YTA A;  1NJW A;  1R0A A;  2XY8 A;  4AIL C;  1S9E A;  4Q0B A;  3ZSW A;  3DLE A;  3RR8 A;  3AO3 A;  4KAZ A;  2IS3 A;  4FLT A;  4IG3 A;  4CF2 A;  3K2P A;  2ZE2 A;  3CM6 A;  3QEV A;  4FJ9 A;  2B6A A;  1RTJ A;  3AA2 A;  4DSE A;  2KFZ A;  3NGI A;  1VSK A;  2YNI A;  1UOC A;  2G8U A;  1BL3 A;  4CJS A;  3RRG A;  4M3Y A;  3KD1 E;  3K5N A;  3LWM A;  3T3F A;  1QSS A;  1W9H A;  2X78 A;  3OYF A;  1D9D A;  1C1A A;  3VQ8 A;  4BDZ A;  3C94 A;  4E7K A;  4QCL A;  4G1Q A;  4LSL A;  3WNG A;  4ELT A;  3LP1 A;  3K5L A;  4Y1D A;  4DFM A;  1SL1 A;  4FJJ A;  1D9F A;  1BGX T;  4OJR A;  4FXD A;  4CIE A;  3MAQ A;  4HTU A;  4FJL A;  4CEC A;  4W5R A;  1Z26 A;  4FJI A;  1HQU A;  2YNG A;  4JS5 A;  4Z4E A;  3VQD A;  4M3U A;  1FXX A;  4FW1 A;  1U4B A;  4FJ5 A;  4B3O A;  1L3T A;  3K59 A;  1JL2 A;  1VSH A;  1T7P A;  3DLG A;  3QIP A;  1N6Q A;  4ELV A;  4AHR A;  5FDL A;  3HK2 A;  1IH7 A;  1WLJ A;  3ASM A;  3ISN C;  4FZY A;  5DK5 A;  3EY1 A;  4ICL A;  3JYT A;  2WOM A;  4L8R B;  3BGR A;  4CFD A;  1TK5 A;  3QO9 A;  3HJF A;  1Z25 A;  2Z1G A;  5KTQ A;  4Q5V A;  4B9T A;  4DQP A;  2HHV A;  1W0H A;  4YFU A;  3V1R A;  4HHT A;  3S3O A;  1C6V A;  1JLA A;  1EKE A;  4CK1 A;  1RDB A;  4HVJ A;  3MXJ A;  1NJZ A;  3OS1 A;  3TAQ A;  2FBY A;  3OYN A;  5HRP A;  4E3S A;  3DRS A;  3OYK A;  3ZSV A;  2KQ2 A;  4DMN A;  4AHT A;  4BE0 A;  4FLU A;  2EHG A;  4DFP A;  4B9L A;  1HPZ A;  2F96 A;  3U3Y A;  3B6P A;  3PX0 A;  1LAV A;  4DQQ A;  4CHY A;  2XY7 A;  3SJJ A;  1YT3 A;  2IDO A;  1VRT A;  1DTQ A;  3DM2 A;  4FLX A;  4CER A;  2D0A A;  3SNN A;  4O0I A;  3ZT1 A;  4DTM A;  4GW6 A;  3VN5 A;  2XY5 A;  4ID1 A;  3HPG A;  5KGX A;  2YNH A;  3O4Q A;  3L2Q A;  1WSF A;  2IGI A;  2ZD1 A;  3KJV A;  1NK7 A;  1HNV A;  1X9M A;  5JS2 A;  4KHU A;  3SQ0 A;  1VSF A;  1WAF A;  4Z4H A;  1CLQ A;  5J2N A;  1XHZ A;  3NH1 A;  4O4G A;  1LWC A;  2BE2 A;  1XWL A;  4RG8 A;  4M42 A;  4CK3 A;  3NGZ A;  1JXB A;  3IS9 A;  1VSE A;  1WAJ A;  1BCM A;  1ZBF A;  2YKN A;  1LW2 A;  3AO1 A;  4AHS A;  4E1M A;  4DTU A;  1ZBL A;  1QSY A;  4ZTJ A;  4BAC A;  1A5X A;  1HJR A;  4KFB A;  4FJN A;  4NCG A;  2G8F A;  2GUI A;  4FLY A;  2G8W A;  3OYL A;  4LH4 A;  5T7B A;  4F2S A;  4M41 A;  3QIN A;  2GBZ A;  4CJ5 A;  1NK5 A;  1FKO A;  3ZSR A;  4B9M A;  1EP4 A;  3TAN A;  1RT5 A;  3QEW A;  3V1O A;  1S1T A;  4OPJ A;  4E19 A;  1YVU A;  4DWI A;  4B8A B;  3NF8 A;  4IDK A;  3PX4 A;  1RT7 A;  2P5G A;  4CIF A;  4H4M A;  3MED A;  2RKI A;  2LSN A;  3ZT0 A;  2YHA A;  1BQM A;  1NK8 A;  5D3G A;  3RMD A;  1NOY A;  4Z4F A;  3VQ7 A;  4B9V A;  3K5M A;  4CJK A;  4KKO A;  4LD0 A;  1CXQ A;  3B6O A;  2G8V A;  5J2M A;  4E89 A;  1U04 A;  1KTQ A;  1TGO A;  4JRQ A;  1NK9 A;  4N41 A;  3OYC A;  1JKH A;  3V9S A;  3H08 A;  1NJY A;  2O4G A;  4CJ3 A;  4KB1 A;  2PZS A;  3AA3 A;  3ZSY A;  3SV3 A;  4ZTF A;  4FK2 A;  2YHB A;  1BIS A;  4KV8 A;  3AA4 A;  4C8M A;  4M45 A;  1LWF A;  2EX3 A;  2W42 A;  4KTQ A;  1KVA A;  3CFO A;  3SUP A;  3LAM A;  1JXE A;  1IG9 A;  4IKF A;  3C95 A;  3OS0 A;  1KRP A;  2OPS A;  2HND A;  4FLW A;  1B9F A;  1C1B A;  2XRI A;  3ITH A;  3SV4 A;  1L3V A;  2P1J A;  3AO5 A;  4FCY A;  4DTX A;  1ITG A;  1JLE A;  4IG0 A;  4CEB A;  2D5R A;  1NKC A;  4IFY A;  4RW4 A;  3I0S A;  4W5T A;  1HQE A;  3SQ2 A;  2OPP A;  3WNH A;  3NH2 A;  4AHV A;  4Y1C A;  1SV5 A;  1IO2 A;  4FJX A;  3DLH A;  4DFJ A;  3L2U A;  3OYA A;  4CJL A;  1TAQ A;  3VQ6 A;  4CJU A;  1TK0 A;  4J2E A;  3HVT A;  3KTQ A;  4K8Z A;  5SWM A;  4F8R A;  2R7Y A;  4W5Q A;  1TKZ A;  2Y1J A;  4KHS A;  4FM2 A;  3RWU A;  5J2Q A;  1DTT A;  2OA8 A;  2Q3S A;  3DRR A;  3VQC A;  3SQ4 A;  4F4K A;  3UIQ A;  1S1U A;  4CEA A;  3L2W A;  3DYA A;  4I9L A;  4O5B A;  4O0J A;  3ZT3 A;  2PY5 A;  1C0T A;  2QK9 A;  3S3N A;  1VK0 A;  3AVN A;  3LWL A;  1LAW A;  3SUN A;  4FK0 A;  2HHX A;  4CFB A;  3OYJ A;  4CCH A;  4CJV A;  4DTJ A;  2B4J A;  4NCA A;  4CJR A;  2HHQ A;  4R5P A;  1C1C A;  3TAB A;  4LH5 A;  4GVM A;  3HT3 A;  4HUF A;  3ULD A;  1UA1 A;  2A1S A;  1NOZ A;  1S1X A;  1WSE A;  4N5S A;  5SZT A;  3O3H A;  4BWM A;  4FLV A;  1QTM A;  4PY5 A;  4I9Q A;  3FFI A;  3KLF A;  3F73 A;  5HBM A;  3O3G A;  1NKE A;  3ZSX A;  4IBN A;  3AVG A;  3PUF A;  4FM0 A;  1LWE A;  5KGW A;  3AVH A;  1RBU A;  3AVK A;  3OY9 A;  1XC9 A;  4OKK A;  4CGH A;  1RDC A;  3CFR A;  3MXI A;  3ZT4 A;  4BE2 A;  4E7I A;  3OYE A;  2BAN A;  3T1A A;  1J5O A;  1K6Y A;  3NHG A;  1HYV A;  2GV9 A;  2Z1H A;  4B08 A;  1C0M A;  1ASU A;  4OPK A;  2HW3 A;  1BI4 A;  1S5J A;  4JS4 A;  1ZBH A;  5C25 A;  4PWD A;  3D45 A;  4YNQ A;  2DFH A;  1FK9 A;  1RBS A;  3HO1 A;  2FBT A;  2KZM A;  1EET A;  4CGF A;  1RIL A;  3HPH A;  3I8D A;  3V4I A;  3AVF A;  3SPZ A;  1BCO A;  1QSL A;  4OLB A;  4KRE A;  1WN7 A;  3HPO A;  1KSP A;  2WON A;  2YNF A;  3LPT A;  3KK3 A;  1RT6 A;  4DG1 A;  2XHB A;  4HUG A;  3DRP A;  2P5O A;  3RRH A;  1GOC A;  2HVH A;  1KLN A;  4LSN A;  3DLB A;  4I2Q A;  3D0P A;  3U3G A;  4N56 A;  2B5J A;  2RPI A;  4OVL A;  2VG7 A;  2ITG A;  1RT3 A;  4DSF A;  3SPY A;  2P51 A;  1NK6 A;  4E0D A;  4AHU A;  1JLQ A;  1IKY A;  3HXM A;  4KHN A;  1RTD A;  1J53 A;  4EZ9 A;  3HP9 A;  1L3S A;  4ZHR A;  4F3O A;  4KB0 A;  3NBP A;  1CZB A;  1KCF A;  1QE1 A;  4O55 A;  3OYB A;  1RT2 A;  5KRS A;  1LW0 A;  1IKV A;  3JSM A;  2OYQ A;  1BQN A;  2VWJ A;  1RT4 A;  1I39 A;  1T05 A;  4FYD A;  2KTQ A;  1RCH A;  4NYN A;  2VWK A;  4Z4C A;  4DQI A;  3TAR A;  4CJW A;  1I3A A;  1TL1 A;  3F9K A;  3TAG A;  1X9S A;  4CHP A;  1RTI A;  1TVR A;  3P83 D;  3HM9 A;  2G8K A;  4DQS A;  1JL1 A;  2E4L A;  3C6U A;  3V9Z A;  1HYZ A;  5J1E A;  2HHS A;  3QIO A;  2XO7 A;  1D5A A;  1F21 A;  5I3U A;  4KHY A;  3DI6 A;  2DFE A;  4TSX A;  1ASW A;  5FRO A;  4F3T A;  2YKM A;  3L8B A;  3V9U A;  4CEF A;  3IAY A;  3KKS A;  1YTU A;  1A5V A;  3QET A;  1C0U A;  2RF2 A;  2E6M A;  3AVJ A;  4ID5 A;  3KK2 A;  5HP1 A;  1HRH A;  2HHW A;  1QQC A;  3LP0 A;  2ETJ A;  3THV A;  1TV6 A;  3AVC A;  3O4N A;  4DF8 A;  4CF9 A;  3TWH A;  3QNO A;  4EP5 A;  3AVL A;  3QEI A;  3NCI A;  3KD5 E;  4ELU A;  1RTH A;  5FRM A;  2DTU A;  2HMI A;  3NFA A;  3NE6 A;  4EP4 A;  3DLK A;  5CZ1 A;  4FJG A;  3VQP A;  3SZ2 A;  1RBV A;  2D0C A;  4UQG A;  2G8I A;  3RTV A;  5C42 A;  2BDP A;  4I2P A;  3QEP A;  2KW4 A;  1SKW A;  4M3T A;  4BDP A;  3OJU A;  4E1N A;  2HHU A;  3ZSQ A;  3QER A;  3TI0 A;  1LV5 A;  3QES A;  5K14 A;  3KLG A;  4CFC A;  3V81 A;  2Z1J A;  3PX6 A;  4KTW A;  4C8O A;  1J9A A;  4DS4 A;  2IOC A;  1EX4 A;  2JGU A;  4CEQ A;  5HRN A;  3BDP A;  1VSM A;  3VA0 A;  1ZBU A;  2I5J A;  3MEE A;  3NDK A;  3LDS A;  3WNE A;  4OGE A;  4FJM A;  1CXU A;  1VSD A;  2RN2 A;  1S6Q A;  4CES A;  1NK0 A;  4N76 A;  3IRX A;  1TKX A;  1VSL A;  1RBR A;  4C8N A;  4OGC A;  2E6L A;  3I0R A;  4CJF A;  3L2R A;  1DLO A;  3RMA A;  1GOA A;  3AO4 A;  5E41 A;  4OKE A;  3HP6 A;  3OYI A;  4KTZ A;  3LAL A;  1SKS A;  4F2R A;  1SL0 A;  1KFD A;  4AH9 A;  2OZM A;  1ZYQ A;  2F8T A;  4HCB A;  4KRF A;  4DTN A;  4OKJ A;  1KVB A;  2XY6 A;  1Q8I A;  1U49 A;  3LP2 A;  3SYZ A;  2QXF A;  4DTS A;  3CM5 A;  4FJH A;  1TK8 A;  3AV9 A;  4DLE A;  2HVI A;  3G10 A;  3NH0 A;  1WSJ A;  3KLI A;  2A1R A;  2QKK A;  1U48 A;  3LZI A;  2KZZ A;  3AA5 X;  4FJK A;  1BIU A;  3DOL A;  1WSH A;  3TAP A;  4Z4I A;  5KI6 A;  4CGJ A;  3MEG A;  3L3V A;  3OYG A;  3L2V A;  4CHN A;  3O3F A;  3NF9 A;  3TAE A;  1Q9X A;  1O1W A;  1EXQ A;  4Z0U A;  1BHL A;  1MU2 A;  3VQ9 A;  1D8Y A;  1UA0 A;  4RW7 A;  3VQ4 A;  3PV8 A;  3RR7 A;  1WSG A;  2DY4 A;  1S9G A;  1HMV A;  4CGG A;  4MQ3 A;  3TR8 A;  4HUE A;  4CF8 A;  3K57 A;  5JS1 A;  1VRU A;  3ZCM A;  2OPQ A;  1WNS A;  4DSI A;  4C8L A;  3K5O A;  4FLZ A;  4RW8 A;  4B9U A;  2BGG A;  1RT1 A;  3SUO A;  4DLG A;  1T03 A;  4BDY A;  3P5J A;  2ZQB A;  4FZX C;  2IAJ A;  2D0B A;  2PYL A;  3M8S A;  3PO4 A;  4WE1 A;  4BWJ A;  1FKP A;  3CG7 A;  3VQ5 A;  3OJS A;  4PQU A;  4DQR A;  1JLC A;  3DLR A;  2Y1I A;  3PO5 A;  4CEO A;  4CED A;  3SCX A;  3VQQ A;  2NUB A;  3ZT2 A;  3SI6 A;  4RW9 A;  1XHX A;  3T19 A;  3VQA A;  2AJQ A;  3KLE A;  1T8E A;  2FBV A;  2F8S A;  3AO2 A;  1KFS A;  5EU7 A;  3DOK A;  4CJP A;  4KO0 A;  3M8Q A;  4M3Z A;  4JRP A;  3QNN A;  3ZSO A;  5FRN A;  4W5N A;  4O44 A;  3S9H A;  4FZZ A;  4H8K A;  1B92 A;  4M3W A;  2PYJ A;  1RBT A;  4CJT A;  2X74 A;  3V1Q A;  2X6S A;  1BI4 B;  1UAX A;  4CJE A;  4CGI A;  5HRS A;  1KVC A;  1B9D A;  1U45 A;  1NKB A;  2JLE A;  4DTP A;  4CF1 A;  4DSJ A;  3NGY A;  3VA3 A;  2FC0 A;  4KHQ A;  1G15 A;  4CGD A;  3V9W A;  3HYF A;  4DS5 A;  2HNY A;  1WSI A;  3KIO A;  3AVA A;  3V9X A;  1Q9Y A;  2O4I A;  1ZBI A;  3IG1 A;  2YV0 X;  2X6N A;  4DF4 A;  1TKT A;  4QOZ B;  1UWB A;  3LAK A;  2VG5 A;  3TAM A;  4XIU A;  4FJ8 A;  4DU3 A;  4NYF A;  1HYS A;  3E01 A;  4DU4 A;  4CK2 A;  2IC3 A;  4GMJ B;  4FM1 A;  1VSI A;  1REV A;  4FJ7 A;  4DTO A;  1QHT A;  1RDA A;  4J2B A;  1SUQ A;  3HL8 A;  3AVB A;  3LP3 A;  1J54 A;  1L3U A;  3G0Z A;  3MEC A;  2KFN A;  1JLB A;  3KKR A;  3SUQ A;  4PA1 A;  3VQB A;  4OLA A;  1IKX A;  4DSL A;  4CJQ A;  1X9W A;  4B8C A;  1BIZ A;  4DFK A;  5CYQ A;  1HNI A;  1RNH A;  3CQ8 A;  4C8K A;  1N5Y A;  5HLF A;  1KLM A;  2FBX A;  4Z4G A;  4KI4 A;  4AHC A;  4E7J A;  5CYM A;  4CFA A;  3AVI A;  1Y97 A;  4NCB A;  1RDD A;  4E7L A;  3OS2 A;  4E7H A;  1U47 A;  3CYM A;  4LY7 A;  1GOB A;  4BE1 A;  4CIG A;  2QKB A;  3K58 A;  3QEX A;  4CF0 A;  1CZ9 A;  4DU1 A;  4CHQ A;  3ZSZ A;  3OYH A;  3S3M A;  3WNF A;  4N47 A;  3NAE A;  4CEE A;  1SKR A;  4I7F A;  2OZS A;  5DMR A;  5KRT A;  1JLF A;  3EYZ A;  5CY4 A;  4M3R A;  4FW2 A;  4H4O A;  3OYM A;  1TAU A;  5I42 A;  1ASV A;  3AVM A;  4CJ4 A;  3RMC A;  1TKD A;  3LAN A;  2Z1I A;  3DMJ A;  3KLH A;  4B9N A;  1NK4 A;  5C24 A;  3LPU A;  5CZ2 A;  4MFB A;  3PY8 A;  1X1P A;  4B9S A;  2HNZ A;  1S1W A;  2OPR A;  4M3X A;  4J2A A;  3L3U A;  1SL2 A;  4PUO A;  4KPY A;  4RW6 A;  3LZJ A;  1JLG A;  3SQ1 A;  4IFV A;  5J2P A;  3M8R A;  3KK1 A;  3HVR A;  3HST B;  3MXM A;  2HHT A;  3V6D A;  2ATQ A;  3EZ5 A;  1XI1 A;  3P1G A;  4HCC A;  3M8P A;  3NF6 A;  3OYD A;  3CFP A;  1S6P A;  5HRR A;  1S1V A;  4JLH A;  4CEZ A;  2G8H A;  4CHZ A;  3A2F A;  4DSK A;  3RMB A;  4EZ6 A;  4QAG A;  3TAF A;  1L5U A;  5HRO A;  2DFF A;  4J2D A;  4FVM A;  1TL3 A;  4K8X A;  3OVN A;  2VG6 A;  4KI6 A;  3NF7 A;  1A5W A;  1QS4 A;  4KHW A;  3QLH A;  3ALY A;  4W5O A;  3U6F A;  1IKW A;  4CE9 A;  4FK4 A;  3VQE A; 
#chains in the Genus database with same CATH topology
 2RE2 A;  1VSJ A;  2FF3 B;  1NJX A;  3C6T A;  2XY8 A;  4JI3 K;  4AIL C;  3RR8 A;  1HNW K;  2D0P A;  2P9U A;  4KAZ A;  4IG3 A;  1BA0 A;  5LMN K;  1NGD A;  4LF6 K;  2KFZ A;  3CIP A;  1KAY A;  4IOX A;  3THY B;  3RRG A;  4M3Y A;  3LWM A;  3NVM A;  1XUP O;  1D9D A;  3H3O B;  4QCL A;  4RCH A;  4G1Q A;  3ENO A;  4H0Y B;  4FJJ A;  1HLU A;  1BGX T;  2A6A A;  4OJR A;  4HTU A;  1Z26 A;  2P9L B;  1HQU A;  3FZF A;  3Q7B A;  4H5W A;  5M1P A;  4M3U A;  1U4B A;  1L3T A;  3K59 A;  2ASO A;  2P9S B;  3F2K A;  1IH7 A;  1WLJ A;  5AQY A;  5DK5 A;  3JYT A;  3BGR A;  1TK5 A;  3ZET B;  3PSF A;  2Z1G A;  5AZJ B;  3S3O A;  1C6V A;  1JLA A;  3CME N;  4JHD B;  1MWM A;  2FBY A;  4BE0 A;  4B1W B;  1LAV A;  1VQL N;  3SJJ A;  2I7P A;  1VRT A;  4K43 A;  1BU6 O;  2D0A A;  5HOO A;  2XY5 A;  1HX1 A;  3QIC A;  3HPG A;  4ILJ A;  2GEM A;  4U7B A;  1WSF A;  1NK7 A;  3MWT A;  3FGU A;  5JS2 A;  2YHY A;  2NRX A;  4JKG B;  3I56 N;  1Z05 A;  4O4G A;  1JXB A;  3IS9 A;  1WAJ A;  1ZBF A;  3O08 A;  1VQ8 N;  4AHS A;  3JAM O;  1QSY A;  4BAC A;  2A42 A;  3ZX2 A;  4FLY A;  2P9I B;  2UYT A;  1EP4 A;  3CD6 N;  2NZT A;  4YDU C;  4B8A B;  4IDK A;  2HBM A;  4DV5 K;  4DV3 K;  4H4M A;  1LCU A;  3CHW A;  2RKI A;  3WUH A;  3THW B;  4Z4F A;  1NOY A;  4B9V A;  3K5M A;  4KKO A;  4LD0 A;  1TGO A;  3WXM B;  4JRQ A;  1TUU A;  3CQY A;  4NLC A;  4FWL A;  1T6D A;  1NJY A;  3FE1 A;  2O4G A;  4ISE A;  3C7N B;  3ZSY A;  3SV3 A;  4KV8 A;  2W42 A;  3CFO A;  3TU5 A;  3SUP A;  3LAM A;  3VEW A;  3C95 A;  2HND A;  4FCY A;  4DTX A;  1NKC A;  2D5R A;  3CET A;  2IVN A;  4IFY A;  5EOY A;  2YI1 A;  4H5V A;  4MDA A;  3MN9 A;  2OPP A;  3MCA B;  4Y1C A;  4FJX A;  4QS7 A;  3VQ6 A;  1TK0 A;  5KPR A;  4FWO A;  4CW7 B;  3U9Z A;  4IOC L;  5J2Q A;  1VQN N;  3UIQ A;  3CC7 N;  4I9L A;  4O0J A;  2PY5 A;  4H5R A;  3LDQ A;  3SUN A;  4CCH A;  4CJV A;  2B4J A;  2HHQ A;  1TYQ A;  4CJR A;  3BF3 A;  4GVM A;  3CJB A;  4JV5 K;  1UA1 A;  2NRW A;  1S1X A;  4B3R K;  4PY5 A;  3O3G A;  1NKE A;  4IBN A;  4FM0 A;  1RBU A;  2KHO A;  1OVQ A;  3N4P A;  5AFU H;  4OKK A;  4CGH A;  1YXQ A;  4BY9 C;  4E7I A;  3MK6 A;  5BR9 A;  1NBW A;  2GV9 A;  2Z1H A;  2VCP A;  5AQF A;  4JS4 A;  1RBS A;  3N4Q A;  1EET A;  2YHW A;  5TKW A;  1RIL A;  3V4I A;  2A40 A;  1WN7 A;  4B1Z A;  1U2V B;  2YNF A;  1M90 O;  3J81 O;  3QBX A;  2V7Z A;  4WFN L;  3RRH A;  1GOC A;  4LSN A;  3U3G A;  4JI7 K;  4AF1 A;  3A5L C;  1RTD A;  1J53 A;  4KB0 A;  4DV2 K;  1RDW X;  5KRS A;  1LW0 A;  1IKV A;  4NYN A;  3VF6 A;  1IV0 A;  4U67 L;  4DKW A;  2HHS A;  5LJW A;  3V9Z A;  1D5A A;  4KHY A;  4G9Z A;  3O8M A;  2DFE A;  2PBD A;  4TSX A;  1ASW A;  4F3T A;  3L8B A;  3IAY A;  1YIJ N;  3ULE B;  3VPZ A;  1C0U A;  3AVJ A;  1QQN A;  3KK2 A;  1HRH A;  3LP0 A;  2ETJ A;  3THV A;  3AVC A;  3QEI A;  3NCI A;  2O8F B;  2DTU A;  2HMI A;  3NFA A;  3OTO K;  3VQP A;  3QB0 A;  3RTV A;  2BDP A;  4A2B A;  3G6E N;  3QEP A;  4JKH A;  4JI5 K;  2D0O A;  4E1N A;  3TI0 A;  5CHI A;  3QES A;  3KLG A;  2Q0U A;  3SAG A;  2O8C A;  1WBB A;  4CEQ A;  3TTF A;  4BRK A;  4FJM A;  3WNE A;  1CXU A;  1S6Q A;  3SMS A;  5LL6 Z;  1DLO A;  4OKE A;  3HP6 A;  3FR0 A;  5F2R A;  1SL0 A;  2I7N A;  5KPZ A;  4HCB A;  4DTN A;  2RHK A;  1Q8I A;  3E9L A;  3SYZ A;  1K8A O;  1TK8 A;  2HF4 A;  3KLI A;  4IO9 L;  2A1R A;  3ZX0 A;  3TAP A;  1TUY A;  2VQE K;  4LFC K;  3THY A;  3L3V A;  2P9N B;  3NF9 A;  1Q9X A;  1O1W A;  1EXQ A;  3SJH A;  1JCE A;  1D8Y A;  3VQ4 A;  3PV8 A;  1WSG A;  2E2Q A;  4FPA A;  3LM2 A;  4C23 A;  2QWP A;  3MX5 A;  4CF8 A;  5JS1 A;  1VRU A;  3O6W A;  2P9L A;  2VWB A;  3WQU A;  2VGN A;  2ZQB A;  2D0B A;  2P9S A;  3EEQ A;  4JI4 K;  2PYL A;  3A8Y A;  3VEO A;  3SBG A;  2GX9 A;  3IKM A;  3PO5 A;  4CED A;  4MO5 A;  5FLX O;  3ZET A;  4X62 K;  4DR3 K;  4RW9 A;  5AZJ A;  3FFK B;  2HBK A;  1KFS A;  5EU7 A;  4JHD A;  4KO0 A;  4OPH A;  1R59 O;  3BZK A;  4IJN A;  3HOS A;  3U4L A;  4LF7 K;  5JLH A;  3S9H A;  4O8K A;  1E4F T;  3JS6 A;  5H1S Q;  3G4S N;  2PYJ A;  3V1Q A;  4XH1 A;  1YAG A;  1KVC A;  1B9D A;  1NKB A;  4DTP A;  3PSI A;  2E1Z A;  4CBU A;  2FC0 A;  1G15 A;  3EKU A;  4CGD A;  3V9W A;  3CJ7 A;  2HNY A;  1BG3 A;  1WSI A;  2WC9 A;  2O4I A;  1ZBI A;  2YV0 X;  3L4I A;  3LAK A;  3DXM B;  4XIU A;  4JKG A;  2E20 A;  2ZWH A;  3C0B A;  4GMJ B;  1REV A;  1IBL K;  4J2B A;  1KQS M;  1J54 A;  3BY5 A;  1X3M A;  3VQB A;  4OLA A;  1X9W A;  3CCJ N;  2CH5 A;  2QI2 A;  5CYQ A;  4DR2 K;  2P9I A;  3E66 A;  5AJ3 K;  1Y97 A;  1GOB A;  4WQ5 A;  4CF0 A;  4DR7 K;  3THW A;  3H6E A;  4YY3 K;  3OYH A;  4H0P A;  3NAE A;  2OZS A;  1SKR A;  4CEE A;  4I7F A;  5CY4 A;  5I42 A;  3AVM A;  3RMC A;  1V4T A;  1NK4 A;  1N32 K;  4JK9 A;  3C7N A;  3FZK A;  5AQV A;  3D2F B;  3PY8 A;  2HNZ A;  2OPR A;  4J2A A;  4NB4 A;  1SL2 A;  1Q81 O;  4M63 C;  1JLG A;  4IFV A;  4JI1 K;  2ATQ A;  4HCC A;  5CR4 A;  3M8P A;  3K9J A;  3NF6 A;  4CEZ A;  4JLH A;  3WQT A;  1DEJ A;  3A2F A;  4BQZ A;  4QAG A;  3ZYY X;  1TL3 A;  2QWN A;  1A5W A;  2UUA K;  4IWV A;  1C0F A;  2QTD A;  5A2Q O;  3THX B;  5ADX A;  1DKG D;  4WQ4 A;  3AGK A;  1YTA A;  2W41 A;  1R0A A;  1N34 K;  3J7Y P;  3WXL A;  3I55 N;  4Q0B A;  3DLE A;  3R1X A;  3AO3 A;  1XMO K;  3H46 O;  3J80 O;  4B3T K;  4MDB A;  3KVG A;  4BC3 A;  2WTU A;  3QEV A;  3BP8 A;  2YNI A;  3IFR A;  3EZW A;  3DJC A;  5TKY A;  3KD1 E;  1QSS A;  2X78 A;  3OYF A;  4Z94 A;  3VQ8 A;  3C94 A;  4AM7 A;  4LSL A;  5AQJ A;  4Y1D A;  1SL1 A;  1D9F A;  1KC8 O;  4FJL A;  3HSC A;  4W5R A;  4JS5 A;  1FXX A;  1H1V A;  5ADX H;  1JL2 A;  1VSH A;  2A3Z A;  5AQM A;  4ELV A;  4AHR A;  3LDO A;  5FDL A;  3CPW M;  3ISN C;  5AQQ A;  4AM6 A;  4L8R B;  2WOM A;  4A61 A;  4CFD A;  1QZ6 A;  4DB3 A;  1U2V A;  5F1X A;  5KTQ A;  3CJA A;  4HHT A;  1KAX A;  3ID8 A;  1EKE A;  2QWO A;  4CK1 A;  3OS1 A;  1P8Z A;  4BG8 A;  3OYK A;  3ZSV A;  2KQ2 A;  4DMN A;  4AHT A;  4H0T B;  4B9L A;  4YOW A;  2F96 A;  3O1B A;  3PX0 A;  4DQQ A;  1NGG A;  3KZB A;  2IDO A;  1Q7Y O;  4MLH A;  1DTQ A;  3DM2 A;  3SBT A;  3ZT1 A;  1CZA N;  4DTM A;  3UKU B;  4ID1 A;  2YNH A;  3L2Q A;  5AQU A;  1X9M A;  1VSF A;  1WAF A;  4Z4H A;  1CLQ A;  1XHZ A;  5AQL A;  5EXW A;  4YOV A;  1XWL A;  4RG8 A;  1YF5 L;  3ULE A;  3NGZ A;  2D4W A;  4X64 K;  1VSE A;  1BCM A;  1RDU A;  2YKN A;  1LW2 A;  3M3Z A;  4DTU A;  4BR7 A;  3CCL N;  1XNR K;  1HJR A;  3DXK B;  2O8F A;  3KWG A;  4JI2 K;  3CXC M;  2G8W A;  3HZ6 A;  4YOR A;  3OYL A;  4M41 A;  2GBZ A;  4CJ5 A;  3AY9 A;  3ZSR A;  1YVN A;  4O5F A;  1RT5 A;  4CD3 A;  4OPJ A;  4E19 A;  4DWI A;  3WXK A;  2OCE A;  4WFB L;  2YHA A;  5D3G A;  3VQ7 A;  3O5B A;  3RVC A;  1CXQ A;  1EO1 A;  1KTQ A;  2ZM6 K;  2VYP A;  1HUX A;  3VEY A;  4CJ3 A;  4KB1 A;  3NVK A;  4ZTF A;  4BRA A;  3WT0 A;  4C8M A;  3AA4 A;  1LWF A;  2EX3 A;  1KVA A;  2OPS A;  1DT9 A;  1E4G T;  1B9F A;  2XRI A;  3ITH A;  3PIP L;  4I6M B;  1ITG A;  1JLE A;  4CEB A;  4RW4 A;  3D6R A;  4BR9 A;  3SQ2 A;  1BOT O;  3NH2 A;  1IO2 A;  2P9N A;  4DFJ A;  3L2U A;  2ZJP L;  5F0X A;  5SWM A;  4H0V B;  4F8R A;  4E1J A;  4FM2 A;  5KQ8 A;  1DTT A;  3GDQ A;  1S1U A;  5JVG L;  3WXI A;  1HKB A;  4IFE A;  3ZT3 A;  1VK0 A;  3LWL A;  3E9O A;  4FK0 A;  2HHX A;  2KLA A;  1XC3 A;  2ZF5 O;  4AQY K;  4DR5 K;  3SAH A;  4A59 A;  1GLE G;  5I9E B;  3ULD A;  1NOZ A;  2UXC K;  5SZT A;  4FLV A;  2YJE A;  4JKD A;  3ZSX A;  3LM9 A;  2GEL A;  3AVK A;  4H03 B;  2V7Y A;  1XC9 A;  3MXI A;  1HJO A;  3D2E B;  3ZT4 A;  3CFR A;  4V19 S;  3OYE A;  1ASU A;  4OPK A;  1S5J A;  1FW6 A;  4PWD A;  1YJ9 N;  3CJ1 A;  2CGJ A;  4DQ8 A;  3HO1 A;  1QSL A;  3OBY A;  1X3N A;  1D4X A;  3A0I X;  4JK8 A;  2XHB A;  4HUG A;  4DG1 A;  3T1H K;  2J4R A;  3DRP A;  3DXM A;  1S72 N;  3TPQ A;  2NRR A;  1MA9 B;  1KLN A;  3DLB A;  4I2Q A;  3D0P A;  1N36 K;  2B5J A;  2RPI A;  4Y0W A;  1RT3 A;  4DV4 K;  4DSF A;  1NK6 A;  1OH7 A;  1VQ9 N;  4E0D A;  4KHN A;  3NMU A;  1IKY A;  4LF9 K;  2O8B B;  3GBT A;  2FF6 A;  4EZ9 A;  4ZHR A;  4F3O A;  4DCH A;  1NGF A;  3JSM A;  2OYQ A;  1QQM A;  1BQN A;  2VWJ A;  3LDP A;  3UKR B;  1I3A A;  3F9K A;  3TAG A;  1X9S A;  4CBX A;  4CHP A;  3P83 D;  3HM9 A;  2G8K A;  4DQS A;  2E4L A;  5I3U A;  3KKS A;  1A5V A;  2QWL A;  3HTV A;  2E6M A;  1IBK K;  2E2P A;  1NGC A;  3TWH A;  3QNO A;  4BRH A;  3AVL A;  3KD5 E;  1RTH A;  5FRM A;  4FJG A;  3SAF A;  3D2F A;  3P39 A;  1RBV A;  2KW4 A;  4C1N I;  1LV5 A;  4FWM A;  3CCM N;  5K14 A;  3OW2 M;  4PKI A;  2FSJ A;  1BUP A;  2Z1J A;  3PX6 A;  4C8O A;  2IOC A;  1EX4 A;  2JGU A;  5HRN A;  3PIO L;  4CD1 A;  4K41 A;  4OGE A;  4BRI A;  4KHP K;  4GV3 A;  1TKX A;  1VSL A;  4IXC A;  4C8N A;  2E6L A;  3THX A;  3L2R A;  5AFU A;  1GLC G;  3LAL A;  3FZL A;  3CCV N;  2OZM A;  1ZYQ A;  2F8T A;  4J8F A;  1JCF A;  4FJH A;  3CM5 A;  4JD2 B;  3G10 A;  5BRH A;  2QKK A;  3DOL A;  3A5N C;  3L2V A;  3VQ9 A;  4R79 A;  3O9T A;  1UA0 A;  3TTC A;  4IJA A;  1HMV A;  1YI2 N;  4DSI A;  2OPQ A;  3K5O A;  4BR5 A;  4DUZ K;  3LDN A;  1T03 A;  2IAJ A;  4CZG A;  4YOT A;  3VQ5 A;  3CG7 A;  1YUW A;  3D7E O;  4MO4 A;  1JLC A;  3DLR A;  2Y1I A;  2CGL A;  4CEO A;  2F9W A;  1RFQ A;  4BRE A;  3G25 A;  3FZH A;  4A5A A;  4EHT A;  2ITM A;  3BUZ B;  1IBM K;  4O44 A;  2AP1 A;  3P4I A;  3CCE N;  4B1V A;  3TSP A;  3ZX3 A;  4DV0 K;  4H8K A;  4FZZ A;  4M3W A;  4CJT A;  3H45 C;  1BI4 B;  1NGI A;  4CGI A;  2FLO A;  1VQ7 N;  2FSK A;  5AZI B;  4DSJ A;  3NGY A;  3VEZ A;  4KHQ A;  4DS5 A;  1V4S A;  3UKU A;  5M1K A;  1Q9Y A;  4IZ9 A;  3IG1 A;  1K73 O;  2PFU A;  1TKT A;  4QOZ B;  1UWB A;  1VQO N;  2VG5 A;  4CVN E;  4EHU A;  1VSI A;  4FJ7 A;  1J6Z A;  3HL8 A;  1ESV A;  3W0L A;  3MEC A;  3MDQ A;  1JLB A;  1ZBS A;  4PA1 A;  3DXK A;  1Q82 O;  1IKX A;  4IOA L;  4DFK A;  4BRP A;  4Z4G A;  4KI4 A;  4AHC A;  2CGK A;  5CYM A;  4CFA A;  4FPB A;  3AVI A;  4YHH K;  1YHQ N;  5M1F A;  4E7L A;  1ATN A;  4E7H A;  4LY7 A;  3AAR A;  4NO7 A;  1QZ5 A;  4FWP A;  2QKB A;  3I33 A;  4LF8 K;  4CHQ A;  1NJI O;  3S3M A;  3WNF A;  1OH5 A;  5DMR A;  4DV6 K;  3EYZ A;  4O8U A;  1GLL O;  4H4O A;  4WQ4 C;  1ASV A;  5EX5 A;  1NNE A;  3KLH A;  4B9N A;  5C24 A;  1ILY A;  4FO0 A;  4OO1 J;  4RW6 A;  2Q0R A;  4BG9 A;  3KK1 A;  4JI6 K;  4I6M A;  3MXM A;  3V6D A;  1XI1 A;  5AQO A;  4LF5 K;  1S6P A;  2G8H A;  3RMB A;  2V52 B;  5HRO A;  3OBW A;  2NRZ A;  3LL3 A;  3NF7 A;  3P38 A;  2HB5 A;  1SAZ A;  3O9R A;  2E2N A;  4DR6 K;  1NJW A;  4YDU A;  4JKE A;  4NXN K;  1S9E A;  2ZGZ A;  3E1Y A;  4A5B A;  2ZE2 A;  1NGE A;  1JJ2 M;  4DSE A;  4FJ9 A;  4IEI A;  3NGI A;  2FXU A;  1W7A A;  1UOC A;  1W9H A;  4DUY K;  1YIT N;  1C1A A;  3WNG A;  4ELT A;  3HBT A;  3LP1 A;  4DFM A;  4FXD A;  3C65 A;  3MAQ A;  1OVY A;  2DY4 A;  2WFB A;  4HWI A;  3VQD A;  4K42 A;  1IJJ A;  1NGJ A;  4FJ5 A;  4YOU A;  1GLF O;  1T7P A;  3VET A;  3QDK A;  3HK2 A;  2O8D B;  4WFA L;  4BC4 A;  3EY1 A;  3HJF A;  4Q5V A;  4B9T A;  2HHV A;  3V1R A;  5GAH P;  1WUA A;  3R6M A;  1VQP N;  4HVJ A;  5GAD P;  3MXJ A;  3TAQ A;  3FLC O;  5AQH A;  3OYN A;  4E3S A;  4JI8 K;  3MN7 A;  4DFP A;  3CER A;  1VAZ A;  1HPZ A;  3U3Y A;  3B6P A;  3CC4 N;  4CHY A;  2XY7 A;  4QS8 A;  3RSE B;  4FLX A;  4CER A;  4O0I A;  3UKR A;  2EWS A;  4GW6 A;  3VN5 A;  5KGX A;  2IGI A;  2ZD1 A;  1XMQ K;  2GUP A;  1HNV A;  3MN6 A;  4KHU A;  3CJ9 A;  3SQ0 A;  4FVU A;  1Q86 O;  1QHA A;  2BE2 A;  4M42 A;  4CK3 A;  2IIR A;  2Q1N A;  3AO1 A;  5E84 A;  4E1M A;  4WF9 L;  2YX6 A;  3QFP A;  1ZBL A;  1W2B M;  1A5X A;  4X65 K;  4FJN A;  2NLX A;  3L6Q A;  2GUI A;  4MLE A;  2QWM A;  5T7B A;  4CZF A;  1NK5 A;  4YOY A;  1FKO A;  4B9M A;  3TAN A;  4CZH A;  3JXU A;  3QEW A;  3V1O A;  5AQG A;  2P5G A;  4L3Q A;  3MED A;  1BQM A;  2HOE A;  3RMD A;  4CJK A;  4XEI A;  3B6O A;  1Q18 A;  4E89 A;  1X9J A;  1U04 A;  1HNZ K;  1NK9 A;  3K9K A;  4N41 A;  2E88 A;  1JKH A;  3CCQ N;  1GLJ O;  4PL8 A;  4PL7 A;  4IDH A;  2YHB A;  1BIS A;  4M45 A;  4EFH A;  4KTQ A;  1XNQ K;  1IG9 A;  1HNX K;  3DWL A;  1KRP A;  4FLW A;  1C1B A;  3SV4 A;  4JD2 A;  2HST A;  3I0S A;  4W5T A;  5BN8 A;  3WNH A;  2W40 A;  1I94 K;  3VTI A;  3UB5 A;  2GWK A;  2UXB K;  4XH5 A;  2O8E B;  3OYA A;  4CJU A;  1TAQ A;  4J2E A;  3HVT A;  4K8Z A;  1K9M O;  4W5Q A;  1TKZ A;  4B1U B;  1ZC6 A;  3RWU A;  4YOX A;  1FJG K;  2OA8 A;  2Q3S A;  3DRR A;  3SQ4 A;  3FZM A;  3L2W A;  3AGR A;  2QK9 A;  3S3N A;  1BA1 A;  1LAW A;  4CFB A;  2E2O A;  5CE3 A;  2QW9 A;  4HUF A;  1WSE A;  4N5S A;  4BWM A;  3F73 A;  2Q2R A;  1HKG A;  3SMP A;  3AAP A;  3T7Z A;  3PUF A;  5KGW A;  3AVH A;  5AR0 A;  3OY9 A;  1RDC A;  2WBN A;  5C2D A;  3T1A A;  1K6Y A;  3M1F A;  1KXP A;  1C0M A;  1BI4 A;  2ZJQ L;  1ZBH A;  5C25 A;  3D45 A;  4YNQ A;  2DFH A;  1FK9 A;  5JVH L;  1BWF O;  3AAQ A;  2FBT A;  2KZM A;  5AQZ A;  4CGF A;  3AVF A;  2UUB K;  4OLB A;  4BRL A;  3CF5 L;  1KSP A;  4JKF A;  5KPT A;  3LPT A;  2P5O A;  4JKA A;  1W97 L;  2HVH A;  4JN4 A;  4BR0 A;  4N56 A;  3W3D A;  3BF1 A;  3SPY A;  4AHU A;  1JLQ A;  3R3L A;  3HP9 A;  1L3S A;  4PHT X;  1CZB A;  1KCF A;  4O55 A;  3OYB A;  4FWQ A;  1RT4 A;  1I39 A;  3TSU A;  1T05 A;  4FYD A;  4A62 A;  1M1K O;  2KTQ A;  4Z4C A;  2VWK A;  5HL7 L;  5AQS A;  3TAR A;  4CJW A;  1TL1 A;  3F5T A;  3EE8 A;  3VES A;  1JL1 A;  3R9P A;  3HRG A;  5C2F A;  1VQM N;  1LOT B;  2XO7 A;  5AQI A;  1F21 A;  3KWI A;  3V9U A;  4CEF A;  5M1O A;  3MN5 A;  1YTU A;  3EE9 A;  3QET A;  5HP1 A;  4ID5 A;  1QQC A;  3O4W A;  3HM8 A;  1TV6 A;  4HTL A;  3O4N A;  4ILG B;  4DF8 A;  2P9K B;  4CF9 A;  4ELU A;  3NE6 A;  4EP4 A;  3DLK A;  5CZ1 A;  3SZ2 A;  2G8I A;  4UQG A;  5C42 A;  4I2P A;  4FWN A;  4M3T A;  3OJU A;  2OAN A;  4DV1 K;  1JCG A;  3V81 A;  2H3G X;  1J9A A;  4GKK K;  3BDP A;  2Q97 A;  1QVF M;  1VSM A;  3VA0 A;  3CC2 N;  1ZBU A;  2I5J A;  3NDK A;  4DR4 K;  3LDS A;  1VSD A;  3H1Q A;  4CES A;  4JAX A;  4N76 A;  4CJF A;  1GOA A;  3AO4 A;  4KTZ A;  1SKS A;  4F2R A;  3ENH A;  3MCP A;  5BRD A;  1KFD A;  4AH9 A;  5AQW A;  5ELZ A;  4BGA A;  3VMF B;  4CZL A;  4M7Y A;  4KRF A;  3WXJ A;  1U49 A;  3LP2 A;  4DLE A;  2HVI A;  1MDU B;  1WSJ A;  2UXD K;  4FJK A;  1WSH A;  4Z4I A;  3CMA N;  1VQ5 N;  4CHN A;  3ZLJ A;  3TAE A;  4Z0U A;  4PKH A;  4RW7 A;  3T69 A;  4GKJ K;  3MWP A;  4EIA A;  2E8A A;  4B9U A;  4BDY A;  4FZX C;  3PO4 A;  3HI0 A;  4BWJ A;  1WBD A;  3OJS A;  2O8D A;  1ATS A;  3SCX A;  3VQQ A;  2NUB A;  3VF4 A;  3ZT2 A;  3SI6 A;  4WCE L;  1DGK N;  3T1Y K;  2AJQ A;  1T8E A;  4OPA A;  2F8S A;  3DOK A;  4CJP A;  2GTD A;  3M8Q A;  4M3Z A;  3QNN A;  2YHX A;  3ZSO A;  3O9S A;  1OH6 A;  4W5N A;  2NRV A;  3P31 A;  3B8A X;  4CJE A;  1U45 A;  3J7Z O;  2ZJR L;  2JLE A;  3RSE A;  2JWL A;  2D1K A;  5BRE A;  2BTF A;  3HYF A;  3KIO A;  3AVA A;  3V9X A;  3CPE A;  5JMV A;  4NLB A;  2F9T A;  3VGM A;  3TAM A;  4FJ8 A;  1HYS A;  4DU3 A;  4NYF A;  4CK2 A;  3A5M C;  1EQY A;  1QHT A;  1RDA A;  1SUQ A;  3VEN A;  3GOI A;  3AVB A;  3LP3 A;  1L3U A;  3G0Z A;  2KFN A;  3SUQ A;  1VQ6 N;  4DSL A;  4K0K K;  4C8K A;  1BIZ A;  4KBO A;  2QA4 N;  5HLF A;  2E1Y A;  1NGH A;  2W6K A;  2GWJ A;  1U47 A;  1IG8 A;  1WB9 A;  3VOV A;  4JK7 A;  3K58 A;  1CZ9 A;  4BRD A;  5DM6 L;  1JLF A;  2E5L K;  2PAV A;  1N33 K;  4FW2 A;  3OYM A;  2UU9 K;  1TAU A;  4CJ4 A;  1TKD A;  3LAN A;  4H5T A;  3DMJ A;  3F9M A;  5C10 A;  3LPU A;  4MFB A;  1X1P A;  4M3X A;  4DV7 K;  3L3U A;  4PUO A;  4KPY A;  4FWR A;  3LZJ A;  5FPM A;  3C6A A;  4JEP A;  1RGI A;  3O1W A;  1QVG M;  3EZ5 A;  3P1G A;  3CFP A;  5LJV A;  4DSK A;  1S1V A;  4WYB A;  5IT9 O;  4RWT A;  4EZ6 A;  1NWK A;  3TAF A;  3M5R A;  1HPM A;  2QWQ A;  5JIC A;  1L5U A;  3OVN A;  4XH4 A;  1ZXO A;  4KI6 A;  4BRC A;  1QS4 A;  2O8E A;  3ALY A;  3BEX A;  4W5O A;  5BPL A;  1IKW A;  1N8R O;  4FK4 A;  4DTR A;  4GY2 B;  4CHO A;  1BO5 O;  5M1N A;  3UE5 A;  5BN9 A;  5KQD A;  1BDG A;  3ZSW A;  3PLA A;  2IS3 A;  4FLT A;  4CF2 A;  3K2P A;  3ATU A;  1NMN A;  3CM6 A;  5E26 A;  2B6A A;  1RTJ A;  3AA2 A;  2NNW A;  4JKC A;  5BPN A;  3EKS A;  1VSK A;  2QM1 A;  2G8U A;  1BL3 A;  4CJS A;  3S41 A;  1VHX A;  3K5N A;  3T3F A;  5BR8 K;  3WEE B;  1S3X A;  4BDZ A;  4E7K A;  1P90 A;  2HBL A;  4FWK A;  4ILH A;  5C12 A;  1NGA A;  3K5L A;  3EL2 A;  4CIE A;  4CEC A;  1KAZ A;  4FJI A;  4H5N A;  4Z4E A;  2YNG A;  4FW1 A;  4B3O A;  3DLG A;  3QIP A;  1N6Q A;  4KH6 A;  1EWR A;  4LC9 B;  5JLF A;  4CJ7 A;  4FL9 A;  3ASM A;  4ICL A;  3A5O C;  3QO9 A;  1Z25 A;  4FOE A;  4DQP A;  1W0H A;  4YFU A;  2FSN A;  1RDB A;  5FPE A;  1NJZ A;  5HRP A;  3L4Q A;  3DRS A;  4FOI A;  3J7A P;  4WQ5 C;  4FLU A;  2EHG A;  2AA4 A;  3ID6 A;  1YT3 A;  1Y64 A;  3SNN A;  3QML A;  2UUC K;  3O4Q A;  3K0S A;  2ASP A;  3KJV A;  4B3S K;  3O9U A;  1EWQ A;  3CCU N;  4X66 K;  5J2N A;  1Z6R A;  4BRO A;  3NH1 A;  1LWC A;  2A41 A;  2Q31 A;  3TSQ A;  1K8K B;  4ZTJ A;  4KFB A;  2P9K A;  3IMX A;  4NCG A;  2G8F A;  2Q36 A;  2QWR A;  4F2S A;  4LH4 A;  3QIN A;  4LFB K;  5AQK A;  1S1T A;  3VER A;  4BRM A;  1YVU A;  4FSV A;  3NF8 A;  3PX4 A;  1RT7 A;  4CIF A;  2LSN A;  3ZT0 A;  1NK8 A;  3H3N O;  1ATR A;  3GL1 A;  1MWK A;  4CZK A;  4FWS A;  4BRF A;  4B1Y B;  5J2M A;  2G8V A;  4KH4 A;  3OYC A;  3V9S A;  3EN9 A;  3H08 A;  5AQX A;  2ZGY A;  1NM1 A;  4EAH D;  2PZS A;  3AA3 A;  3DLL L;  3MX2 A;  4FK2 A;  2P9P B;  4KHW A;  4GV6 A;  1JXE A;  4IKF A;  3ZEU B;  3OS0 A;  4K25 A;  1L3V A;  2P1J A;  3AO5 A;  4H0O A;  4IG0 A;  4BC5 A;  3U8X A;  4BRN A;  1HQE A;  4CZM A;  5C0Y A;  4GNI A;  2HMP A;  4BQL A;  3CCS N;  2NRT A;  4AHV A;  1SV5 A;  3EO3 A;  3DLH A;  1NGB A;  1O13 A;  2IVP A;  4CJL A;  5GIN A;  3KTQ A;  2ASM A;  2R7Y A;  5GAG P;  2Y1J A;  3I8B A;  4KHS A;  3VQC A;  4F4K A;  4CEA A;  2P9U B;  4M7X A;  3DYA A;  4O5B A;  1C0T A;  5GIO A;  2KKZ A;  3AVN A;  4LF4 K;  2QEX N;  3OYJ A;  4DTJ A;  3D2E A;  4NCA A;  4R5P A;  1C1C A;  5AQN A;  3M6G A;  3TAB A;  4LH5 A;  3HT3 A;  3IDH A;  2A1S A;  3O3H A;  1QTM A;  4I9Q A;  3FFI A;  3KLF A;  5HBM A;  4B3M K;  3AVG A;  1LWE A;  5MLC Q;  5B8H A;  3VGK A;  4BE2 A;  1J5O A;  2BAN A;  4JYA K;  3NHG A;  1HYV A;  4B08 A;  5GAE P;  4JKB A;  2HW3 A;  2V51 B;  4BRQ A;  2VGM A;  5EY4 A;  2O8B A;  3I8D A;  3HPH A;  2BH1 A;  3SPZ A;  1BCO A;  3O9Q A;  4KRE A;  3HPO A;  2WON A;  3KK3 A;  1RT6 A;  1T6C A;  1NU0 A;  4OVL A;  2VG7 A;  2ITG A;  3CJC A;  2P51 A;  3HXM A;  2OTL N;  3NBP A;  1QE1 A;  1RT2 A;  4A57 A;  4ISF A;  4IO8 A;  1RCH A;  3VEX A;  4DQI A;  3DAW A;  2W6L A;  1RTI A;  1TVR A;  1NMD A;  1OKJ A;  5C15 A;  3KK7 A;  1SQK A;  4B9Q A;  1SZ2 A;  3C6H A;  3OHR A;  3Q7C A;  5LY3 A;  3C6U A;  3OA9 A;  1HYZ A;  5J1E A;  3QIO A;  3DI6 A;  3SLC A;  5FRO A;  3IUC A;  2YKM A;  4F9O A;  2RF2 A;  3GE1 A;  2HHW A;  4OX9 K;  1NLV A;  3H1V X;  3TTD A;  4EP5 A;  2YCH A;  2DPN A;  4A2A A;  1GLD G;  2D0C A;  4BR4 A;  1SKW A;  2HHH K;  4BDP A;  1T44 A;  2HBJ A;  3KHY A;  5AQP A;  3HOT A;  2HHU A;  3ZSQ A;  4BVO A;  3QER A;  3MMV A;  5BPM A;  4CFC A;  3R8E A;  4KTW A;  2QXL A;  4DS4 A;  3O80 A;  2F4V K;  3MEE A;  2RN2 A;  1KD1 O;  1NK0 A;  5FPD A;  1HKC A;  3IRX A;  1RBR A;  3BZC A;  4OGC A;  3I0R A;  3RMA A;  4BVP A;  5E41 A;  3OYI A;  4BGB A;  5AQR A;  2IVO A;  4BC2 A;  3VGL A;  4GVE A;  4CZE A;  4OKJ A;  1KVB A;  2XY6 A;  4DTS A;  2QXF A;  3AV9 A;  3NH0 A;  1GLA G;  5GIP A;  1U48 A;  3LZI A;  2KZZ A;  3AA5 X;  5IWA K;  1G99 A;  1BIU A;  1E3M A;  5KI6 A;  4CGJ A;  1OH8 A;  3MEG A;  3OYG A;  5LMU K;  4ISG A;  3GG4 A;  4CBW A;  3O3F A;  4FZY A;  3VEV A;  1BHL A;  1MU2 A;  3WEE A;  1GLB G;  1U6Z A;  3RR7 A;  4B1X B;  4IEE A;  3LDL A;  1S9G A;  4CGG A;  4MQ3 A;  3TR8 A;  4HUE A;  3K57 A;  3QBW A;  3ZCM A;  1WNS A;  4C8L A;  4FLZ A;  1WOQ A;  4H0X B;  4RW8 A;  2BGG A;  1RT1 A;  3SUO A;  4DLG A;  2BUP A;  2F7T A;  3P5J A;  3M8S A;  4WE1 A;  1FKP A;  4PQU A;  4DQR A;  1TYQ B;  3QFU A;  1XQS C;  1XHX A;  5AZI A;  1YJW N;  3T19 A;  3VQA A;  3KLE A;  2FBV A;  3AO2 A;  5FRN A;  4JRP A;  3ENB A;  1B92 A;  2HF3 A;  2VQF K;  5BRF A;  1RBT A;  5AQT A;  5HRS A;  2X74 A;  2X6S A;  1UAX A;  2JWK A;  4GV9 A;  4LFA K;  4CF1 A;  3VA3 A;  4QS9 A;  2A5X A;  1VQK N;  4DF4 A;  2X6N A;  1HR0 K;  1NG9 A;  2OTJ N;  2YJF A;  4BR2 A;  1C0G A;  4C1N K;  3E01 A;  4DU4 A;  4UY8 O;  2IC3 A;  4FM1 A;  4DTO A;  3L0Q A;  4JNE A;  3CI5 A;  1S22 A;  4BRG A;  5FPN A;  3ATV A;  1K8K A;  3KKR A;  4DHY A;  1YJN N;  3J8A A;  4CJQ A;  4B8C A;  3CQ8 A;  1HNI A;  1RNH A;  1N5Y A;  1KLM A;  2FBX A;  4E7J A;  4NCB A;  1RDD A;  2NRH A;  3OS2 A;  3CYM A;  3CCR N;  4BE1 A;  4CIG A;  3QEX A;  4DU1 A;  4PKG A;  3SK3 A;  3ZSZ A;  3U9D A;  4CZI A;  4N47 A;  5KRT A;  5EVZ A;  4M3R A;  4CZJ A;  3VTH A;  2Z1I A;  1SS6 A;  1J5E K;  3CQX A;  5CZ2 A;  3VF2 A;  3G71 N;  4DR1 K;  4B9S A;  1S1W A;  2P9P A;  4JI0 K;  1VQ4 N;  2CH6 A;  3SQ1 A;  2WUS A;  3ZEU A;  5J2P A;  3M8R A;  4RTF D;  3HVR A;  3HST B;  3E9P A;  2HHT A;  4KH5 A;  3OYD A;  2O8C B;  5HRR A;  4CI6 A;  1T3V A;  4CHZ A;  4J2D A;  2DFF A;  4FVM A;  5M1Q A;  4K8X A;  1QQO A;  2VG6 A;  3QLH A;  5DM7 L;  3U6F A;  4CE9 A;  4NXM K;  3VQE A; 
#chains in the Genus database with same CATH homology
 2HB5 A;  4DTR A;  1VSJ A;  1NJX A;  3C6T A;  4CHO A;  1YTA A;  1NJW A;  1R0A A;  2XY8 A;  4AIL C;  1S9E A;  4Q0B A;  3ZSW A;  3DLE A;  3RR8 A;  3AO3 A;  4KAZ A;  2IS3 A;  4FLT A;  4IG3 A;  4CF2 A;  3K2P A;  2ZE2 A;  3CM6 A;  3QEV A;  4FJ9 A;  2B6A A;  1RTJ A;  3AA2 A;  4DSE A;  2KFZ A;  3NGI A;  1VSK A;  2YNI A;  1UOC A;  2G8U A;  1BL3 A;  4CJS A;  3RRG A;  4M3Y A;  3KD1 E;  3K5N A;  3LWM A;  3T3F A;  1QSS A;  1W9H A;  2X78 A;  3OYF A;  1D9D A;  1C1A A;  3VQ8 A;  4BDZ A;  3C94 A;  4E7K A;  4QCL A;  4G1Q A;  4LSL A;  3WNG A;  4ELT A;  3LP1 A;  3K5L A;  4Y1D A;  4DFM A;  1SL1 A;  4FJJ A;  1D9F A;  1BGX T;  4OJR A;  4FXD A;  4CIE A;  3MAQ A;  4HTU A;  4FJL A;  4CEC A;  4W5R A;  1Z26 A;  4FJI A;  1HQU A;  2YNG A;  4JS5 A;  4Z4E A;  3VQD A;  4M3U A;  1FXX A;  4FW1 A;  1U4B A;  4FJ5 A;  4B3O A;  1L3T A;  3K59 A;  1JL2 A;  1VSH A;  1T7P A;  3DLG A;  3QIP A;  1N6Q A;  4ELV A;  4AHR A;  5FDL A;  3HK2 A;  1IH7 A;  1WLJ A;  3ASM A;  3ISN C;  4FZY A;  5DK5 A;  3EY1 A;  4ICL A;  3JYT A;  2WOM A;  4L8R B;  3BGR A;  4CFD A;  1TK5 A;  3QO9 A;  3HJF A;  1Z25 A;  2Z1G A;  5KTQ A;  4Q5V A;  4B9T A;  4DQP A;  2HHV A;  1W0H A;  4YFU A;  3V1R A;  4HHT A;  3S3O A;  1C6V A;  1JLA A;  1EKE A;  4CK1 A;  1RDB A;  4HVJ A;  3MXJ A;  1NJZ A;  3OS1 A;  3TAQ A;  2FBY A;  3OYN A;  5HRP A;  4E3S A;  3DRS A;  3OYK A;  3ZSV A;  2KQ2 A;  4DMN A;  4AHT A;  4BE0 A;  4FLU A;  2EHG A;  4DFP A;  4B9L A;  1HPZ A;  2F96 A;  3U3Y A;  3B6P A;  3PX0 A;  1LAV A;  4DQQ A;  4CHY A;  2XY7 A;  3SJJ A;  1YT3 A;  2IDO A;  1VRT A;  1DTQ A;  3DM2 A;  4FLX A;  4CER A;  2D0A A;  3SNN A;  4O0I A;  3ZT1 A;  4DTM A;  4GW6 A;  3VN5 A;  2XY5 A;  4ID1 A;  3HPG A;  5KGX A;  2YNH A;  3O4Q A;  3L2Q A;  1WSF A;  2IGI A;  2ZD1 A;  3KJV A;  1NK7 A;  1HNV A;  1X9M A;  5JS2 A;  4KHU A;  3SQ0 A;  1VSF A;  1WAF A;  4Z4H A;  1CLQ A;  5J2N A;  1XHZ A;  3NH1 A;  4O4G A;  1LWC A;  2BE2 A;  1XWL A;  4RG8 A;  4M42 A;  4CK3 A;  3NGZ A;  1JXB A;  3IS9 A;  1VSE A;  1WAJ A;  1BCM A;  1ZBF A;  2YKN A;  1LW2 A;  3AO1 A;  4AHS A;  4E1M A;  4DTU A;  1ZBL A;  1QSY A;  4ZTJ A;  4BAC A;  1A5X A;  1HJR A;  4KFB A;  4FJN A;  4NCG A;  2G8F A;  2GUI A;  4FLY A;  2G8W A;  3OYL A;  4LH4 A;  5T7B A;  4F2S A;  4M41 A;  3QIN A;  2GBZ A;  4CJ5 A;  1NK5 A;  1FKO A;  3ZSR A;  4B9M A;  1EP4 A;  3TAN A;  1RT5 A;  3QEW A;  3V1O A;  1S1T A;  4OPJ A;  4E19 A;  1YVU A;  4DWI A;  4B8A B;  3NF8 A;  4IDK A;  3PX4 A;  1RT7 A;  2P5G A;  4CIF A;  4H4M A;  3MED A;  2RKI A;  2LSN A;  3ZT0 A;  2YHA A;  1BQM A;  1NK8 A;  5D3G A;  3RMD A;  1NOY A;  4Z4F A;  3VQ7 A;  4B9V A;  3K5M A;  4CJK A;  4KKO A;  4LD0 A;  1CXQ A;  3B6O A;  2G8V A;  5J2M A;  4E89 A;  1U04 A;  1KTQ A;  1TGO A;  4JRQ A;  1NK9 A;  4N41 A;  3OYC A;  1JKH A;  3V9S A;  3H08 A;  1NJY A;  2O4G A;  4CJ3 A;  4KB1 A;  2PZS A;  3AA3 A;  3ZSY A;  3SV3 A;  4ZTF A;  4FK2 A;  2YHB A;  1BIS A;  4KV8 A;  3AA4 A;  4C8M A;  4M45 A;  1LWF A;  2EX3 A;  2W42 A;  4KTQ A;  1KVA A;  3CFO A;  3SUP A;  3LAM A;  1JXE A;  1IG9 A;  4IKF A;  3C95 A;  3OS0 A;  1KRP A;  2OPS A;  2HND A;  4FLW A;  1B9F A;  1C1B A;  2XRI A;  3ITH A;  3SV4 A;  1L3V A;  2P1J A;  3AO5 A;  4FCY A;  4DTX A;  1ITG A;  1JLE A;  4IG0 A;  4CEB A;  2D5R A;  1NKC A;  4IFY A;  4RW4 A;  3I0S A;  4W5T A;  1HQE A;  3SQ2 A;  2OPP A;  3WNH A;  3NH2 A;  4AHV A;  4Y1C A;  1SV5 A;  1IO2 A;  4FJX A;  3DLH A;  4DFJ A;  3L2U A;  3OYA A;  4CJL A;  1TAQ A;  3VQ6 A;  4CJU A;  1TK0 A;  4J2E A;  3HVT A;  3KTQ A;  4K8Z A;  5SWM A;  4F8R A;  2R7Y A;  4W5Q A;  1TKZ A;  2Y1J A;  4KHS A;  4FM2 A;  3RWU A;  5J2Q A;  1DTT A;  2OA8 A;  2Q3S A;  3DRR A;  3VQC A;  3SQ4 A;  4F4K A;  3UIQ A;  1S1U A;  4CEA A;  3L2W A;  3DYA A;  4I9L A;  4O5B A;  4O0J A;  3ZT3 A;  2PY5 A;  1C0T A;  2QK9 A;  3S3N A;  1VK0 A;  3AVN A;  3LWL A;  1LAW A;  3SUN A;  4FK0 A;  2HHX A;  4CFB A;  3OYJ A;  4CCH A;  4CJV A;  4DTJ A;  2B4J A;  4NCA A;  4CJR A;  2HHQ A;  4R5P A;  1C1C A;  3TAB A;  4LH5 A;  4GVM A;  3HT3 A;  4HUF A;  3ULD A;  1UA1 A;  2A1S A;  1NOZ A;  1S1X A;  1WSE A;  4N5S A;  5SZT A;  3O3H A;  4BWM A;  4FLV A;  1QTM A;  4PY5 A;  4I9Q A;  3FFI A;  3KLF A;  3F73 A;  5HBM A;  3O3G A;  1NKE A;  3ZSX A;  4IBN A;  3AVG A;  3PUF A;  4FM0 A;  1LWE A;  5KGW A;  3AVH A;  1RBU A;  3AVK A;  3OY9 A;  1XC9 A;  4OKK A;  4CGH A;  1RDC A;  3CFR A;  3MXI A;  3ZT4 A;  4BE2 A;  4E7I A;  3OYE A;  2BAN A;  3T1A A;  1J5O A;  1K6Y A;  3NHG A;  1HYV A;  2GV9 A;  2Z1H A;  4B08 A;  1C0M A;  1ASU A;  4OPK A;  2HW3 A;  1BI4 A;  1S5J A;  4JS4 A;  1ZBH A;  5C25 A;  4PWD A;  3D45 A;  4YNQ A;  2DFH A;  1FK9 A;  1RBS A;  3HO1 A;  2FBT A;  2KZM A;  1EET A;  4CGF A;  1RIL A;  3HPH A;  3I8D A;  3V4I A;  3AVF A;  3SPZ A;  1BCO A;  1QSL A;  4OLB A;  4KRE A;  1WN7 A;  3HPO A;  1KSP A;  2WON A;  2YNF A;  3LPT A;  3KK3 A;  1RT6 A;  4DG1 A;  2XHB A;  4HUG A;  3DRP A;  2P5O A;  3RRH A;  1GOC A;  2HVH A;  1KLN A;  4LSN A;  3DLB A;  4I2Q A;  3D0P A;  3U3G A;  4N56 A;  2B5J A;  2RPI A;  4OVL A;  2VG7 A;  2ITG A;  1RT3 A;  4DSF A;  3SPY A;  2P51 A;  1NK6 A;  4E0D A;  4AHU A;  1JLQ A;  1IKY A;  3HXM A;  4KHN A;  1RTD A;  1J53 A;  4EZ9 A;  3HP9 A;  1L3S A;  4ZHR A;  4F3O A;  4KB0 A;  3NBP A;  1CZB A;  1KCF A;  1QE1 A;  4O55 A;  3OYB A;  1RT2 A;  5KRS A;  1LW0 A;  1IKV A;  3JSM A;  2OYQ A;  1BQN A;  2VWJ A;  1RT4 A;  1I39 A;  1T05 A;  4FYD A;  2KTQ A;  1RCH A;  4NYN A;  2VWK A;  4Z4C A;  4DQI A;  3TAR A;  4CJW A;  1I3A A;  1TL1 A;  3F9K A;  3TAG A;  1X9S A;  4CHP A;  1RTI A;  1TVR A;  3P83 D;  3HM9 A;  2G8K A;  4DQS A;  1JL1 A;  2E4L A;  3C6U A;  3V9Z A;  1HYZ A;  5J1E A;  2HHS A;  3QIO A;  2XO7 A;  1D5A A;  1F21 A;  5I3U A;  4KHY A;  3DI6 A;  2DFE A;  4TSX A;  1ASW A;  5FRO A;  4F3T A;  2YKM A;  3L8B A;  3V9U A;  4CEF A;  3IAY A;  3KKS A;  1YTU A;  1A5V A;  3QET A;  1C0U A;  2RF2 A;  2E6M A;  3AVJ A;  4ID5 A;  3KK2 A;  5HP1 A;  1HRH A;  2HHW A;  1QQC A;  3LP0 A;  2ETJ A;  3THV A;  1TV6 A;  3AVC A;  3O4N A;  4DF8 A;  4CF9 A;  3TWH A;  3QNO A;  4EP5 A;  3AVL A;  3QEI A;  3NCI A;  3KD5 E;  4ELU A;  1RTH A;  5FRM A;  2DTU A;  2HMI A;  3NFA A;  3NE6 A;  4EP4 A;  3DLK A;  5CZ1 A;  4FJG A;  3VQP A;  3SZ2 A;  1RBV A;  2D0C A;  4UQG A;  2G8I A;  3RTV A;  5C42 A;  2BDP A;  4I2P A;  3QEP A;  2KW4 A;  1SKW A;  4M3T A;  4BDP A;  3OJU A;  4E1N A;  2HHU A;  3ZSQ A;  3QER A;  3TI0 A;  1LV5 A;  3QES A;  5K14 A;  3KLG A;  4CFC A;  3V81 A;  2Z1J A;  3PX6 A;  4KTW A;  4C8O A;  1J9A A;  4DS4 A;  2IOC A;  1EX4 A;  2JGU A;  4CEQ A;  5HRN A;  3BDP A;  1VSM A;  3VA0 A;  1ZBU A;  2I5J A;  3MEE A;  3NDK A;  3LDS A;  3WNE A;  4OGE A;  4FJM A;  1CXU A;  1VSD A;  2RN2 A;  1S6Q A;  4CES A;  1NK0 A;  4N76 A;  3IRX A;  1TKX A;  1VSL A;  1RBR A;  4C8N A;  4OGC A;  2E6L A;  3I0R A;  4CJF A;  3L2R A;  1DLO A;  3RMA A;  1GOA A;  3AO4 A;  5E41 A;  4OKE A;  3HP6 A;  3OYI A;  4KTZ A;  3LAL A;  1SKS A;  4F2R A;  1SL0 A;  1KFD A;  4AH9 A;  2OZM A;  1ZYQ A;  2F8T A;  4HCB A;  4KRF A;  4DTN A;  4OKJ A;  1KVB A;  2XY6 A;  1Q8I A;  1U49 A;  3LP2 A;  3SYZ A;  2QXF A;  4DTS A;  3CM5 A;  4FJH A;  1TK8 A;  3AV9 A;  4DLE A;  2HVI A;  3G10 A;  3NH0 A;  1WSJ A;  3KLI A;  2A1R A;  2QKK A;  1U48 A;  3LZI A;  2KZZ A;  3AA5 X;  4FJK A;  1BIU A;  3DOL A;  1WSH A;  3TAP A;  4Z4I A;  5KI6 A;  4CGJ A;  3MEG A;  3L3V A;  3OYG A;  3L2V A;  4CHN A;  3O3F A;  3NF9 A;  3TAE A;  1Q9X A;  1O1W A;  1EXQ A;  4Z0U A;  1BHL A;  1MU2 A;  3VQ9 A;  1D8Y A;  1UA0 A;  4RW7 A;  3VQ4 A;  3PV8 A;  3RR7 A;  1WSG A;  2DY4 A;  1S9G A;  1HMV A;  4CGG A;  4MQ3 A;  3TR8 A;  4HUE A;  4CF8 A;  3K57 A;  5JS1 A;  1VRU A;  3ZCM A;  2OPQ A;  1WNS A;  4DSI A;  4C8L A;  3K5O A;  4FLZ A;  4RW8 A;  4B9U A;  2BGG A;  1RT1 A;  3SUO A;  4DLG A;  1T03 A;  4BDY A;  3P5J A;  2ZQB A;  4FZX C;  2IAJ A;  2D0B A;  2PYL A;  3M8S A;  3PO4 A;  4WE1 A;  4BWJ A;  1FKP A;  3CG7 A;  3VQ5 A;  3OJS A;  4PQU A;  4DQR A;  1JLC A;  3DLR A;  2Y1I A;  3PO5 A;  4CEO A;  4CED A;  3SCX A;  3VQQ A;  2NUB A;  3ZT2 A;  3SI6 A;  4RW9 A;  1XHX A;  3T19 A;  3VQA A;  2AJQ A;  3KLE A;  1T8E A;  2FBV A;  2F8S A;  3AO2 A;  1KFS A;  5EU7 A;  3DOK A;  4CJP A;  4KO0 A;  3M8Q A;  4M3Z A;  4JRP A;  3QNN A;  3ZSO A;  5FRN A;  4W5N A;  4O44 A;  3S9H A;  4FZZ A;  4H8K A;  1B92 A;  4M3W A;  2PYJ A;  1RBT A;  4CJT A;  2X74 A;  3V1Q A;  2X6S A;  1BI4 B;  1UAX A;  4CJE A;  4CGI A;  5HRS A;  1KVC A;  1B9D A;  1U45 A;  1NKB A;  2JLE A;  4DTP A;  4CF1 A;  4DSJ A;  3NGY A;  3VA3 A;  2FC0 A;  4KHQ A;  1G15 A;  4CGD A;  3V9W A;  3HYF A;  4DS5 A;  2HNY A;  1WSI A;  3KIO A;  3AVA A;  3V9X A;  1Q9Y A;  2O4I A;  1ZBI A;  3IG1 A;  2YV0 X;  2X6N A;  4DF4 A;  1TKT A;  4QOZ B;  1UWB A;  3LAK A;  2VG5 A;  3TAM A;  4XIU A;  4FJ8 A;  4DU3 A;  4NYF A;  1HYS A;  3E01 A;  4DU4 A;  4CK2 A;  2IC3 A;  4GMJ B;  4FM1 A;  1VSI A;  1REV A;  4FJ7 A;  4DTO A;  1QHT A;  1RDA A;  4J2B A;  1SUQ A;  3HL8 A;  3AVB A;  3LP3 A;  1J54 A;  1L3U A;  3G0Z A;  3MEC A;  2KFN A;  1JLB A;  3KKR A;  3SUQ A;  4PA1 A;  3VQB A;  4OLA A;  1IKX A;  4DSL A;  4CJQ A;  1X9W A;  4B8C A;  1BIZ A;  4DFK A;  5CYQ A;  1HNI A;  1RNH A;  3CQ8 A;  4C8K A;  1N5Y A;  5HLF A;  1KLM A;  2FBX A;  4Z4G A;  4KI4 A;  4AHC A;  4E7J A;  5CYM A;  4CFA A;  3AVI A;  1Y97 A;  4NCB A;  1RDD A;  4E7L A;  3OS2 A;  4E7H A;  1U47 A;  3CYM A;  4LY7 A;  1GOB A;  4BE1 A;  4CIG A;  2QKB A;  3K58 A;  3QEX A;  4CF0 A;  1CZ9 A;  4DU1 A;  4CHQ A;  3ZSZ A;  3OYH A;  3S3M A;  3WNF A;  4N47 A;  3NAE A;  4CEE A;  1SKR A;  4I7F A;  2OZS A;  5DMR A;  5KRT A;  1JLF A;  3EYZ A;  5CY4 A;  4M3R A;  4FW2 A;  4H4O A;  3OYM A;  1TAU A;  5I42 A;  1ASV A;  3AVM A;  4CJ4 A;  3RMC A;  1TKD A;  3LAN A;  2Z1I A;  3DMJ A;  3KLH A;  4B9N A;  1NK4 A;  5C24 A;  3LPU A;  5CZ2 A;  4MFB A;  3PY8 A;  1X1P A;  4B9S A;  2HNZ A;  1S1W A;  2OPR A;  4M3X A;  4J2A A;  3L3U A;  1SL2 A;  4PUO A;  4KPY A;  4RW6 A;  3LZJ A;  1JLG A;  3SQ1 A;  4IFV A;  5J2P A;  3M8R A;  3KK1 A;  3HVR A;  3HST B;  3MXM A;  2HHT A;  3V6D A;  2ATQ A;  3EZ5 A;  1XI1 A;  3P1G A;  4HCC A;  3M8P A;  3NF6 A;  3OYD A;  3CFP A;  1S6P A;  5HRR A;  1S1V A;  4JLH A;  4CEZ A;  2G8H A;  4CHZ A;  3A2F A;  4DSK A;  3RMB A;  4EZ6 A;  4QAG A;  3TAF A;  1L5U A;  5HRO A;  2DFF A;  4J2D A;  4FVM A;  1TL3 A;  4K8X A;  3OVN A;  2VG6 A;  4KI6 A;  3NF7 A;  1A5W A;  1QS4 A;  4KHW A;  3QLH A;  3ALY A;  4W5O A;  3U6F A;  1IKW A;  4CE9 A;  4FK4 A;  3VQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...