4NYIQ

Approach for targeting ras with small molecules that activate sos-mediated nucleotide exchange
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEASAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Approach for targeting Ras with small molecules that activate SOS-mediated nucleotide exchange.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nyiQ00
4IVPA 2J9RA 3L0PA 1NKSA 1XZQA 3LBHA 3VR6A 3PCRB 1P72A 3EWAA 4TMVA 3RS7A 1WRBA 3T35A 1R5NA 4FWIB 3L82B 1KJYA 4YC7A 3TE6A 3VU9A 4YMTA 1Q0UA 2GJKA 1NJFA 3LV8A 1XXHA 2ZS9A 2RGDA 1OE0A 3GJ5A 3B6EA 2RHDA 3DKVA 1OH5A 2OG2A 1Q20A 2RGAA 2JLUA 5TV2A 4JIMA 2PCLA 3NWJA 1N3BA 4BECA 1EXMA 1W1WA 1OB5A 1H8ED 1JEDA 2J0UA 2VP9A 4ZIRA 5LB4A 3TAHA 4UNSA 5SZJA 1UF9A 4TYYA 2ZRGA 3AM1A 2IK8A 5FFMA 2ZJZA 5CM8B 2RGBA 2V1UA 4LBVA 2O52A 2UVQA 1E2JA 4LYAA 1KJWA 3VKWA 5GVRA 1YR7A 2ZAOA 2FZLA 1W0JD 3REGA 1E0AA 4C4PA 5HCNA 2OCAA 1D2EA 1OH7A 2P65A 3HPQA 5KNBA 2WJYA 4D4MA 4KBFA 4AIIA 3THXB 3M0EA 3Q9LA 2IYTA 2GF0A 2ECKA 2RGGA 2ODWA 4X8OA 3B1WA 3KB2A 1RYFA 4NL4H 3EIEA 2IF0A 2XB4A 4P4SA 1HH4A 2QENA 5FBQB 2QP3A 4JBXA 3RWMB 2QBYA 3EA5A 3LNCA 5D3MA 4J0QA 5HPYB 5JS7A 4G5OA 3EPHA 2BJVA 2VP6A 2H17A 4B47A 4Z8YA 5KOYA 5C18A 4X8HA 2FFAA 5KYKA 4GP7A 4PTLA 1KSGA 2C78A 4DBLC 4BFTA 2HYIC 4ZDKA 4TTQA 1U81A 1YZLA 4PC2A 4EAQA 1HUQA 3ZLJA 5CJPA 2REOA 1UEIA 2ZPTX 3EC2A 3Q85A 2FOLA 4TMKA 2XSZD 3A58B 4NONA 4TMTA 4V0KA 3X1YA 1I2DA 2X2FA 2VA8A 1W0KA 4MRPA 5KU1A 4HB4A 2VP2A 3GEHA 2J87A 2KJQA 1T3SA 2HJGA 2REXB 1H8HD 3W6NA 4HB3A 3EA0A 5FPTA 5JI3E 4TLCA 2IYVA 4Z54A 1ANKA 3LXXA 3NBXX 2EWWA 3BRWD 1G8FA 1M7GA 5CDFE 3SJZA 4O2LA 1SKQA 4TYNA 1CIPA 1N6RA 1HTWA 3E1SA 3IIJA 3QG5A 3CNLA 2D2EA 2VF8A 2JLRA 3AUXA 4A2WA 4FCTA 4DCNA 2WWIA 2HT1A 5IF9A 3DOEA 2MSEB 5L3QB 1ONBA 3DEFA 1HT2E 2QT0A 3I92A 1MABA 3BWDD 1KI2A 3SJAA 2XNSA 4NE2A 2CHGA 1QHHB 3T06B 1G4AE 1VG0B 2H92A 1UM8A 2AXNA 4Q7KA 4OHZA 4C7OB 1Q1BA 2F9MA 5AUNB 3QBTA 4JVSB 1Q22A 1CTQA 4DUGA 1ZIOA 1IONA 1ZNYA 1E96A 4KSBA 4JKYA 3L0SA 1G7RA 5E95A 3PXGA 5K8TA 2XZOA 5TVKA 1OXUA 4P32A 2DPXA 2QRZA 3EX7C 4FXPA 5KSYA 2OV2A 1E9SA 2Q3FA 1KI3A 4O2RA 1ZM2A 3QUSA 4ARZB 3K9GA 3AVXA 1E79A 3CKLA 3AVUA 3AVYA 2HEIA 2VSOA 4M53A 2O0HA 3C5CA 1GITA 2F9LA 4Q4HA 4GL2A 2PBRA 1KAOA 5AWFC 4LC1A 2RH5A 3K8YA 2HLDD 2IYQA 3P20A 2J0QA 4AYXA 1AM4D 2Q3MA 5EE1A 1N6NA 2PZEA 3LW8A 4E09A 2GZHA 3ASZA 2VPPA 1R5OA 1XWIA 1PLKA 2PJZA 1XTQA 3A37A 4C0JA 2CLCX 3TSOA 1JPJA 5BW8A 4EPXA 1JQLB 1GAJA 1ZU5A 1HE1C 2VF7A 1WP9A 2QORA 1MH1A 1XRJA 4R2IA 1GNQA 3UK6A 4F93B 2FV8A 1RYHA 1NMYA 2HT6A 1DS6A 4Q66C 4EUNA 2L0XA 4MKGA 1F60A 1E1RA 4PSAA 4ZPXA 2WHXA 5L3VA 3GLIA 3GFTA 1S1MA 1NL3A 1Z0JA 4RZ2A 4UXIA 5JCZA 3U5ZB 3WMEA 4BFVA 3Q3JB 4V0MA 2IYSA 3LQQA 3TSZA 3ZVLA 1BH2A 2GK6A 4DT1A 2GJ9A 3QPUA 4HB0A 3ICEA 4TT3D 4FCVA 1Z0IA 3U44B 4YXWA 3IHWA 3PENA 1Z28A 5AR1A 2F7SA 3MRSA 4DSNA 2O8CA 2WJJA 2WBLC 3PEYA 1U0JA 5LDDC 1M2OB 1JR6A 4IOMA 2OESA 4NYIR 4AKHA 2ATXA 4YMWA 4AURA 2YYZA 3VHXA 4CGZA 4NU0A 2QP9X 4PHTA 1UDXA 2VEDA 2F55A 3FDIA 3SU8A 4WAUA 1Z63A 2Q6TA 3I8SA 3LAWA 4EQ6A 3KJGA 1NY6A 1NN1A 2ZJ8A 3WMGA 3T1TA 2CL0X 1G4UR 3AEZA 2W6ID 3K1JA 1G7TA 2OE2A 2A5FA 2HF8A 1VDZA 4DCVA 4DWJA 1XJQA 2DWQA 3RANA 3BS4A 2ZI9A 2C99A 2JATA 2IHBA 2ORVA 2GXQA 4RZXA 4UJ5A 5G3YA 4CEIB 5SZHB 1UADA 1NVWQ 2PMDA 2WPDA 3CPJB 1UKVY 2JGNA 3QXHA 4FMDF 4XSGA 4BLSA 3AF4A 4OQMA 1UFQA 3FMPB 4BFUA 1RIFA 4X8LA 5CK5A 4DC9A 2Z6VA 3KXKA 2XXAB 1G5RA 3DMDA 3I3SR 4XH9B 4E03A 5J4LA 2O8BA 3FE2A 4IOJA 4A92A 1D2MA 4OHXA 1CR4A 1K5GA 3X1DA 1Z6YA 1YRBA 2CVHA 3KKQA 1Z06A 2WJVA 5CLQA 1A5TA 4FN5A 3I8XA 4EJSB 5JECA 4A6XA 5KDDA 3KTAA 2R2AA 5FTKA 1GVNB 3FKQA 2Z4SA 2ZRDA 4TMWA 2G83A 4QXAA 4PC7A 3PVSA 2VL7A 3JVVA 4KYIB 4NH0A 2PZGA 1GWNA 1IY2A 3B78A 5KSPA 4B76A 3GD7A 1M8PA 1QDEA 3TUIC 3RC8A 4B3BA 2QSYA 1OPXA 3QF4B 2A5GA 2BBOA 2I4IA 4C0LA 1OFUX 2GTPA 3DZDA 5CK4A 4M22A 1Z83A 1GL6A 2QNRA 4QGHA 521PA 5JWHA 2NTYC 1GUAA 1B23P 4P4TA 1IBRA 5L3RA 1FUUA 1TNDA 2BEJA 1XCGB 1OHHA 3RVBA 5FUWA 1GL7A 4M9QA 2QPTA 5EJEA 2VP5A 1E69A 3H86A 2Z83A 5DE3A 4TZ0A 1VG9B 3PIRA 1U0LA 2JEOA 2ZRHA 2XB2A 3WRXC 1CRPA 4GOXA 4KCGA 1CU1A 1Z47A 2FFBA 1I4LD 1NVVR 2ZRPA 5B2ZA 3UMSA 1ZC3A 1ZMXA 1MRSA 5DGXA 5C46F 1OFHA 5EQTA 3RC3A 3CPHA 1N6OA 3R7WA 2VP4A 3NC0C 3V00A 4DCSA 1AIPA 1E1RD 4MUBA 5TARA 3U3MA 1RC8A 1E2QA 4RD4A 3CB4A 1A2BA 1YHNA 2VHQA 2W58A 4FINA 3AF1A 2AHOA 1GILA 2NO9A 4IXNA 1WCV1 3QKRB 4L16A 2V55B 4JLDA 1II0A 2FDCA 2QGNA 2VH5R 4MKFA 1RRFA 2ZU6A 3AKEA 2WTUA 2J0UB 3QXJA 1LF5A 2HYDA 1Z2AA 2P2LA 3IIKA 4JLNA 2DBYA 1IHUA 1XMVA 3HPRA 2DFTA 5A4JA 4V0NA 4IDOA 3VAAA 3MWLA 4BFZA 2AN9A 1COWA 1LNZA 2QAGC 5FUVA 5EUMA 2GJAA 1TQDA 4U02A 4TMZA 4EIWA 4WVFA 4CIDA 4JYCA 3W3AA 2FFQA 4Q1CA 4AKGA 1JPNA 3LRPA 3BBPA 2QY9A 1E2PA 1DAHA 4Q00A 3RWOA 2WWXA 3CR7A 4OQXA 4NCJA 3BH6A 2V3CC 2DWOA 3BJIC 4OK3A 4RKEA 3EASA 3EZ9A 3RAPR 3PUWA 2WVJA 2YOGA 5KDLA 4LV6A 1YVDA 5FOXA 3TR0A 1CLUA 2ZJAA 2N1BA 4HDOB 4JLVA 4EPTA 1VYVA 4BFSA 3QBVA 5JRZA 1HURA 2LKDA 1T6NA 1NSTA 1XD9A 1R0WA 3LW7A 1TU3A 3MWKA 2XITA 3IEUA 4JL5A 5AK0A 4G0NA 1A2KC 4LX0A 4PPGA 4M1KA 3DOFA 1MKYA 2GEVA 4LI0A 4Q4AB 3UWOA 1G41A 2VIIA 1U99A 4DLZA 1JXMA 3OESA 1W4AA 3AP3A 4ZI3A 1BMFD 1JR3E 2XSZA 1KMQA 3M4YA 5UKDA 1TTTA 1KI6A 2YC4C 3IHLA 1MV5A 4GOJA 1QHGA 3A1UA 1OKKA 1P61B 5E4FA 5J4HA 4S2EA 4W5HA 1XZPA 2QU8A 4UXHA 2ZI6A 1TUIA 4C0AC 3SNHA 5DI9A 2W2VA 5CLLA 4NKRA 1NBME 2YJTD 4ABYA 2NIPA 3GJ3A 3A1TA 3RSLA 3UG7A 2V7QA 4U00A 1TPZA 2GEUA 3LQRA 4PHHA 1GKIA 3AUYA 4PAMA 5L3SA 1G17A 3JZAA 2J0SA 3LXRA 3KQKA 3AVWA 3ADKA 1F5NA 2ASEA 3NH9A 4B43A 2R6DA 1P7CA 4P31A 3TBKA 3C5HA 3PQCA 3RS5A 1AQUA 2BDTA 5AUOB 2QL6A 1G8GA 4EPVA 2YWEA 1G291 3L8ZA 3UG6A 3NG1A 1N5LA 1JQJC 3KXLA 1EX6A 2O8DA 2AWOA 4Q5IA 4RKFA 3CF2A 1D5CA 2P5TB 4IOKA 2OAQ1 3GJXC 4R2HA 4TYQA 1AS0A 2ZYUX 2OBMA 3K0AB 5G40A 1DE0A 4NZYA 3K9HA 1GL9B 3GCGA 2OAP1 3MMPA 2AX4A 3I4LA 4Q1AA 2CBZA 3ZIAD 4B48A 4DVGA 3EPJA 4TZ6A 2QP4A 3PUVA 1R6BX 2CEAA 1EFCA 2IL1A 4A0FA 2R8RA 2I3BA 1YU9A 2E9SA 4C30A 3HJNA 1F48A 5KSZA 1S1CA 2AK2A 5E7JA 1CJVC 2H18A 4FI3C 4K46A 4OI2A 3VR4A 2IYWA 2WPDD 4JL6A 4CEHB 3TW4A 1M6NA 4FD2A 3PV0A 4WZBE 2KWIA 1SXJE 2AFHE 1E0KA 4B2IA 1IN8A 1XXHE 821PA 3KQLA 1OT3A 1WBBA 4WW0A 5FI0B 4TYWA 2JLZA 1M34E 4C0SA 3PUXA 2N42A 4L5BA 3M6AA 1YE8A 4A0HA 2W6JD 1M1YE 1MO3A 3PJRA 1DAEA 3IPYA 2Z43A 4IDQA 4Q47A 4A8JB 3B1ZA 4RFSB 5IK2D 2XJ4A 3BE4A 4ZCLA 3WMFA 1GKUB 2AWNA 1H8HA 2R6CA 1XXHB 4ASUD 1VKJA 2OXRA 3QI2A 2J7KA 4QL3A 3CM0A 5AJZA 1CULC 2DCUA 2J5XA 1ZM7A 2BMDA 3W6OA 3A36A 3DM9B 3ZS8A 3U3JA 3BORA 1PUIA 3ASYA 4B6FA 4RVCA 1FZQA 3FB4A 4BPBA 2CL6X 4ITRC 4QG7A 4YXWD 1ZU4A 1WB9A 4ESVA 2PMKA 5FTJA 2Q3HA 2NGRA 3F0TA 2QROA 4PO9A 1X3SA 1W49A 4PSVA 4TL8A 2RGEA 1E2DA 1XCPA 3E5HA 3FKSA 1J70A 4B3DA 2PX3A 4C0QC 2VHUA 3BH0A 3OAAA 2Z5FA 3OHMA 4XWAA 5IT5A 4MYHA 3TW8B 1IXSB 5H70A 4PANA 2PEZA 5EZ5A 1OF1A 2H5EA 4UNNA 5FOVA 4LJ4A 1FFHA 1ZD8A 2JDID 3ZDQA 1E0JA 3ZZUA 2B8TA 5G41A 1DEKA 5L3QA 5HE8A 4WZ6A 1RPZA 4Q48A 2D7DA 4A36A 1NN3A 2IXEA 1S0UA 2ZE5A 1YR9A 1G3IA 4LK2A 2YHSA 4M8NE 3LO5A 3WXMA 2AKAB 5KPJA 2OCBA 4OQLA 1ZUNB 1HQYE 4RFVA 4RZUA 5FI1B 5JSZB 2D06A 1K8RA 3CH4B 4TTPA 1V5WA 5HKKA 4IFBA 3PITA 4TSFA 2CJWB 3CLVA 3LH5A 2P6UA 2F1RA 4FMCB 2JJ2A 3HYTA 4B34A 3SQXA 1KMHB 4M1WA 5JI2E 2ZRNA 1JR3D 4OJKA 5DN6D 2A2ZA 1W5TA 2I1QA 3A1VA 3NHBA 4FW9A 3TVDA 4ZDJA 3OFNA 1KOFA 4DDVA 4GSYA 4G3XA 5CB8A 3DMNA 2PT7A 3RNLA 4UJ3A 5AUPB 1JJVA 3L43A 1TF7A 3ND9A 3QQ5A 4AD8A 1DAMA 1AKYA 4ZCIA 2CL7X 3VR3A 1RVDA 3WHLA 3QVVA 1DO2A 3QXXA 1E2HA 1R4AA 4PC1A 4YONB 2J7PA 3IDQA 1PJRA 2ZEJA 1EFRA 4RD2A 1AN0A 1GOTA 2NPFA 1FX0A 3K09A 2WIBA 1NG1A 1G7CA 4N0DA 3NXSA 3ADCA 4I1SA 1E0SA 4KLNA 3U3KA 1K5DA 3MCAA 2LWIA 4Z51A 4G5QA 2BM1A 2WWHA 4XJXA 5E7IA 4QRHA 3THYA 4RD1A 1NN0A 3TQCA 3NC1C 1UBFA 1E2KA 1K6MA 4H1UA 1XDBA 2JCSA 4PC3A 2CVFA 2YKGA 5G3ZA 4IDHA 4Q4LA 2WSSD 4XOIA 3KKMA 2ZROA 4DZZA 3G0HA 2NO0A 2VHCA 5KSOA 2HJVA 4EJSC 5BXQC 2DFNA 1GRQA 1WE2A 2A7QA 1M7BA 1BO6A 4TN1A 2O8FB 4DLTA 2C8VA 2QQ0A 5CJ2A 5EP4A 5FOWA 3RSOA 2LCFA 3WRYC 1E1QD 3AV0B 3B1YA 4LV5B 2W6IA 2XXAA 1X1RA 2BMJA 2JLWA 3IEVA 5CYPA 3WYFA 4OHYA 1EWRA 3TKLA 1FTSA 1N6HA 3BB4A 5SZIA 5JHHB 3CRW1 3X2SA 1VMAA 2C98A 1OLOA 5JEDA 2CNWA 1P9NA 5CITA 3EZ6A 3RRNA 3IUYA 1DTSA 3ZD6A 3JVUA 2HXYA 2ZE7A 1NLYA 4R98A 1NVVQ 4LDJA 3KUDA 1J8YF 2ZS8A 3U6KA 3U7GA 4HLUC 4MGIR 1E2MA 4QM6A 1NBMA 4K81B 1OXVA 3UKDA 3TNFA 1ZM9A 3VX4A 221PA 1U8AA 4AG6A 4AKEA 4B44A 2IHYA 3N2EA 1N6LA 3KJEA 2WKRA 3ZVMA 4ZO4A 3SEAA 3GLIE 3X1WA 4CRWB 3MGCA 4MGYR 2BIFA 1XMSA 4XVRA 4CF7A 4N1AA 1SVKA 1ZIPA 3CW2A 1JALA 4MUAA 4CEJA 5ANRB 4V0ME 2OSBA 2CDNA 3W8RA 1YZNA 3K9NA 1R0ZA 5FPYA 5LPNA 1AA9A 1XD2A 3V4FA 4L4UA 1U94A 1J7KA 3T1OA 4AYTA 1ZVQA 3WBKA 5JSZA 2GWHA 3IO5A 1G20E 2R6GA 2IBMA 2ANBA 4BQSA 3SJBA 1R0XA 3DO6A 4LSGA 2BWJA 1E9CA 2DHRA 1Z29A 1CKEA 2RB4A 3O8DA 1W44A 3TGPA 5BN4A 2FEOA 2ZRCA 1SZPA 5HTKA 3L8YA 4A0GA 1U8ZA 5B64A 2WKPA 3VU9B 3VX3A 3SBDA 3SYNA 4B2PA 2CLSA 3CO5A 4TL7A 4GDFA 2WWGA 4S35A 1FMJA 3T1QA 3SHWA 1TUEA 2XOKA 4JMPA 2ZSFA 4URWR 3B8HA 5EXPA 1Z6AA 5EUQB 1VYUA 4TL6A 3D8BA 2BMEA 4BWYA 3GLGE 1RW4A 2AKYA 2GESA 2Z0MA 2BC9A 1X8LA 2CCKA 3NIBA 1E6CA 3FGNA 4MH0R 3LBIA 3T5GA 5IK2A 3E70C 1XPRA 2A78A 4RD6A 2KE5A 1US8A 1IJFA 2A5DA 1XD2B 3HU3A 1CS4C 2V1XA 1RRGA 1UPTA 3CX8A 1E9AA 1W2GA 3DKPA 4CEJB 3Q7PA 3W8NA 2JA1A 3G82C 4OHVA 4MDEA 4XTCS 1LS6A 3WY9A 5E3HA 2ZTSA 4MYCA 5D3MB 1OB2A 5FBLB 1KO1A 1GTVA 2FG5A 2ZU0C 3KFVA 1P2SA 4MA4A 1SQ5A 3NEJA 3AB3A 1Q1ZA 4EFNA 4KI0A 4G5SA 2QG6A 3U2QA 3KX2A 3IQXA 4MRVA 2OFOA 1H8EA 2G1JA 2IYRA 2QAGA 2W83A 3IBGA 4HI0E 3PEWA 5FTLA 3BXZA 4DLRA 1N25A 4KFUA 2IS4A 4NYMQ 1VHLA 4KHZA 4L8GA 4KLZA 4DLYA 4A2PA 2F3RA 2VTKA 4EPWA 2ZI5A 2JJ1A 1O3YA 4Z8XA 2XTNA 4TL9A 4I81A 1KDRA 4YDSA 2JIZD 3AF0A 3FFAA 1G8PA 5TMPA 2IF2A 1E9BA 1Z0AA 2J1LA 1OW3B 3CUEF 3ZIAA 4BZQA 4IEIA 3SQWA 3I1FA 1VG8A 3QEJA 1KK2A 4QGAA 4GMXA 4OI0A 2W0SA 2ZRLA 4Q1BA 4RSGA 3GJ4A 1US8B 3MUFA 1HYQA 3NBZC 4W5JA 2V4ZA 1QVAA 1P2VA 1VYTA 1T5LA 1Z8FA 3BFVA 1EK0A 2UZIR 1S9HA 1XTSA 2CCGA 5FUYA 2ZSDA 4LRWA 1P5ZB 2RKOA 4CZ2A 4Q19A 4HLDA 2IEYA 2WWYA 1MRNA 1XD8A 1YKSA 5AJXA 3VKGA 5DH9A 5JJKA 1W46A 2P6NA 1NP6A 1G5PA 1R7RA 5JMTA 1P73A 4JT4A 4BEBA 1SXJB 3SJCA 3TR5A 4DB4A 4C2UA 2GCPA 3BK7A 2NO7A 3BERA 4JSTA 2ZRMA 2XX3A 1EX7A 2QT1A 2V8OA 5CIWA 3U61B 1XTRA 2OFWA 3LLUA 4ERNA 1SHZA 4H9GA 4IDNA 1EFRD 2QPOA 2PL3A 4XVUA 4TT3A 2O8BB 1MT0A 2YWHA 1X86B 4PQFA 4JLJA 3AVTA 1ZW6A 3SI7A 1TQ6A 2ZE8A 3NTUA 5JS8A 2GA8A 2VSFA 4TYPA 4AG5A 1GRRA 1A1VA 4Q02A 4LJ9A 3UATA 3ICQB 2IS2A 1CEEA 3S1AA 5FL7A 3T1VA 4GI7A 3B13B 5AJYA 3B9PA 5JWOA 1KKLA 2J59A 2ZI3A 1CJUC 3IKJA 3Q72A 4QJ3A 1F6BA 1S9DA 5KPDA 3GJ6A 1FP6A 3U3RA 4ILEA 1KO8A 3N2IA 1XEFA 1DAFA 4JZKA 3IQWA 3DDCA 4JLOA 1DAIA 4JS0A 5JLJA 5EE9A 1WBDA 1XPUA 3UMRA 4HATA 4II7A 2ZI4A 4D81A 4AWXA 4NCKA 5CYOA 2NZJA 1FQKA 1RZ3A 3CF0A 3WNBA 4GT1A 3NKVA 1N2CE 1UAAA 4O0MA 4XTRA 4OJQA 1IM2A 1GNRA 2G88A 3CIOA 2PEYA 5J4VA 1MO6A 2JAQA 1OH8A 3F3YA 4Q18A 3C14C 3WYGA 3BGWA 2FU5C 3NDPA 4LYJA 4QFMA 4FCWA 1C1YA 2ZJ2A 4MITA 4TQ9A 2G9NA 1RJ9A 3RRZA 3ZVRA 4RD3A 1YJ5A 3FFBA 4US1R 3FMOB 1G6HA 1OXTA 2WJIA 4ARZA 1AJEA 2X77A 1S8FA 3IO3A 3DPUA 2ZVQX 2IW3A 3THXA 1AGRA 2HUPA 4PO1A 1MOZA 4JVNA 5K8LA 4US2R 2P0EA 1E32A 2QE7A 3C7KA 3PR1A 5B30A 1P6XA 2EW1A 3P1JA 4KJZA 4TWZA 1SVWA 4A2QA 1NRJB 5BYJA 2WICA 2QZ4A 2RAPA 2YVUA 1II8B 2X8AA 4PFSA 3SE0A 3V9PA 3REFA 1U9IA 3I73A 4HZUA 4GPTA 2GNOA 1GNPA 4M4SA 1C4OA 4XWKA 1SXJC 2FE4A 5FR2A 4BRUA 1KY3A 3P4YA 4DEXA 1NVUQ 1RRCA 2H57A 1KSHA 3LX8A 1L4UA 2MSDB 1CJMA 4C9BA 4URUR 4DXAA 2BV3A 1TQ2A 1SXJA 3NH6A 4LZZA 3WP0A 4V02A 2IYLD 5GJWC 2QBYB 4IEEA 4QGGA 4AK9A 1KAGA 4I1UA 1X8KA 1XJ0A 3QG1A 1WMSA 2G0TA 2ZS7A 3GEIA 3FTQA 4PQRA 1G3RA 4P3YA 1TQ4A 3ZS9A 2I1VB 3O47A 1N0WA 3ZD7A 3BD9A 2V7QD 1ZM4A 4UNPA 3FYHA 2XAUA 1G7SA 1FTNA 4NDZA 1VCIA 4ZDIA 4A15A 3VNVA 3AKCA 3OEHA 1QZXA 2ZI7A 3VTKA 2DFKB 3T34A 4HUQB 5JJLA 1W36D 4V0LA 4BZPA 3WP1B 2FA9A 1S96A 1PV4A 4L9SA 1NMZA 1A7JA 3C41J 3QY0A 3KQNA 3K70B 2C5LA 4DLVA 3C15C 2H16A 3HP1A 4Q9HA 1LS1A 5FPHA 2O8EB 2UKDA 4HZIA 2JJ1D 3KFXA 2IS1A 5KNCA 2GDJA 4QHTA 2AD5A 1GZSA 4F4JA 3THWB 1UBGA 3DM5A 4EFLA 2KI5A 2F6RA 1QHNA 1LY1A 1Z22A 2WZQA 4TTRA 1CF4A 1GM5A 1X6VA 2ATVA 1S2MA 2IA5A 1Y3AA 2WSMA 2WM9B 3CH5A 1FW6A 1NI3A 1GDDA 2CLDX 2G1KA 4NYJQ 1Z08A 4A6PA 1KO4A 4HUTA 4W9MC 3AQ4A 4MGKR 1PZNA 4KO8A 2FH5B 2ERXA 5EP1A 4I4LA 1OV4A 3BFKA 4Q9JA 4URYR 2EWVA 3TUZC 2YWFA 3A4LA 2V6IA 4LOAA 3Q5DA 4QBIA 5F2EA 4ZKDA 2OZEA 4DEYA 3LY5A 3V4RA 2JLQA 1XBTA 1Z0DA 2DYKA 5J4YA 1F2UB 1T0JB 4PXAA 4QNRA 2BBSA 3B1VA 2ZSEA 1U8YA 3NHAA 4LJAA 5IHPA 2H1LA 4JJZA 5JZVA 5B58C 1AS3A 1T3HA 4L9WA 4XSHA 1E2NA 3CBQA 2ZR0A 4DCTA 3RS4A 4EKDA 3MWJA 1CJKC 3D6TB 2FPLA 3T15A 3B2EA 2XNDA 3IPXA 5F9FA 2D4HA 4DRZA 1XB2A 1EGAA 2ZYVX 4DSOA 2C9CA 2EFGA 3VR2A 5B57C 3QSYA 1LTQA 3H2YA 1JB1A 1WXQA 1QBKC 2UZ3A 5G53C 4LPSA 2FPMA 3GEEA 1NN5A 1D9ZA 1WF3A 2P67A 2B7BA 2CCJA 3GLHB 4IVQA 4D82A 1LF0A 5JJIA 3VMFA 5J47A 1P62B 1N0UA 4Q9LA 3EXAA 1COWD 4A1FA 3GJ0A 1E4YA 2V54A 2GAAA 3R20A 3CRQA 1G8YA 1ETUA 4B32A 2FGKA 4Q4AA 3GFOA 2D2FA 4QHYA 5FL7D 4D4JA 2BCJQ 1RRPA 4WIAA 4LV8B 3K70C 3ONWA 2VQSA 3BB3A 2QA5A 2YWGA 4QBFA 4URZR 1OFTA 2QMHA 3OIYA 1AK2A 3MJHA 4QGFA 1NKTA 3MSXA 1KK0A 5FBWB 1VG1A 1S4QA 4JLAA 4ESHA 3AF3A 2BKEA 1JI0A 4E07A 1DBSA 3IIMA 5ELXA 4PX9A 4PZLA 2HCBA 4WXPA 3VNUA 1KMHA 4M1SA 1E98A 1VIAA 2QMEA 3KKNA 4LC0A 2ZYTX 3B5JA 4QJ5A 4AYWA 4RCZA 4US0R 4M21A 4QOSA 3O8CA 2EFEB 4D6PA 5EE0A 1AQYA 2E1RA 2QTVB 3OEEA 1KGDA 2FSHA 3A8TA 3AVPA 1GP2A 4B3FX 4G01B 2WIAA 2WMOB 4C0HA 4M1TA 2HF9A 4KBGA 1CXZA 4PZZA 1D6JA 3SZRA 4B35A 1FNNA 3IGFA 3THWA 2FJUA 4HUQA 4D2IA 1P3JA 4Q9KA 2GVZC 3W34A 1II9A 1OIVA 4A4DA 5HZHA 3QPWA 4WOPA 2QGZA 1NY5A 3TUJC 4YLGA 1W0JA 1TEVA 1NMXA 3KXIA 3UMFA 3GLGB 3RDPA 4HYYA 2ZRAA 2BCGY 3BIFA 4Q4JA 3ZVNA 2ZUDA 1F3OA 2PX0A 2GXUA 3U3OA 3ZH9B 4GZLA 2J0VA 4CYMA 3K09C 4Z1MA 2GVDC 2DFLA 5BN5A 3K70D 2HCJB 4LPKA 4B73A 2WWWA 2IC5A 2R62A 1U0HC 2IUUA 4NHOA 3R8CA 4I1OA 1JAHA 1OJLA 2ODNA 2XGJA 4Y0VA 5P21A 4B6EA 4KU4A 2BBWA 3BB1A 3EWSA 3CNOA 3A1WA 1FNMA 1R10A 1BS1A 1GKYA 3EZFA 3FMIA 3WYAA 2ZAMA 1R8QA 4A8JA 4MQBA 2GXAA 3B60A 3GP8A 2F3TA 2OLKA 2JIZA 2QMOA 4JBWA 3U60B 1DVRA 4P4SB 5FBVB 5IRCD 4BEJA 1XTKA 4HLUA 4PPNA 1LV7A 5K8IA 3RABA 3QJYA 3MLEA 4DDTA 3HU2A 5TDHA 2FSIA 4KVGA 4JL8A 2W2XA 2ZREA 2A3RA 3EARA 1IN7A 2F43B 2QSZA 1CR2A 4OKSA 4FIDA 4LUCA 1Q44A 2IWRA 3W6PA 1ZCBA 2XTMA 3QE0A 1KI7A 3UPUA 2JJ2D 2O8EA 1ESNA 1OXXK 1SVIA 3KZ1E 4YMVA 3GLGA 1NG9A 3QENA 1BIFA 4EJSA 4IJMA 4F38A 3GLHA 4M2LA 2QQEA 5KTYA 3MAAC 2HDNB 4AY2A 2OBNA 1FUKA 4GFDA 3OFND 5DI3A 1TU4A 1Q21A 1IAQA 2JLVA 2AFIE 4M0LA 1KDOA 2HV8A 3TQFA 4MGZR 2NPIA 4LBZA 3L0IB 1MO4A 1YZGA 2GAOA 1ZRHA 5D3QA 1JECA 1H65A 2FZ4A 3LX5A 4A82A 1DG3A 2CXXA 1WDTA 4QJ4A 5C4GB 2VYFA 5L8VA 1KTVA 4LJ8A 1BKDR 4LJYA 1LVGA 1CJTC 2W0MA 2EFDB 4BLRA 3QF4A 3AGPA 4NCNA 4PSKA 3LLMA 4U7DA 3VFDA 1XTJA 2BKUA 3QKTA 1JJ7A 4ACBA 4LJ7A 2ZQ5A 2QI9C 2GCOB 3WHKA 3CONA 3ZGXA 2EYUA 3TMKA 2YC2C 3QKSA 1F2UA 2IYXA 3D31A 4BFXA 3TVTA 5FUXA 3AP2A 3I32A 4C2TA 3RRMA 5HCIA 5EE5B 2C96A 2OO7A 3SBEA 5BN3A 2RGNC 3F8TA 4CW7A 3P27A 1VCNA 4UXJA 3KKOA 2N46A 3OAAD 4D4KA 4AC9A 4HB2A 5EXXA 1IXZA 2DB3A 5KO2A 3ZZTA 1RFLA 4PR0A 2VRWA 4FMCF 2GHIA 1W7AA 4LGMA 1DO0A 1E9DA 1U9IC 3B7GA 1QHYA 4HEJA 5E7MA 2ERYA 5FOUA 2YV5A 5SZKB 1S3SA 5TB5A 2IS6A 4V03A 4U5XA 3HU1A 4XD7A 1MABB 4WBSA 1XPOA 5AUQA 1E9RA 4JLBA 1EFUA 2A5JA 4HLCA 1NIPA 5H1YA 3FOZA 3GFPA 1X8JA 2AD1A 4KSCA 2WV9A 3FHOA 2C9YA 4QBGB 5FTMA 5HKKD 4JLKA 4BASA 2PLRA 3FPAA 4NBSA 3U4QA 2CNWD 2WOJA 1QG4A 5EZ6B 3AVQA 3PFIA 1KIMA 2ANCA 4DJTA 1GRNA 1SKYB 4KXFB 3OEHD 4Y0AA 2NO6A 2CHVA 4OYHA 1WQ1R 2VO1A 3K9LA 3ND8A 2VSXA 4MRNA 1G3UA 1NBMD 2BMFA 2C2HA 2B8WA 1LB1B 2WMNB 2ZJYA 1AS2A 4QM7A 2P5SA 3H84A 4Q9IA 1KDPA 1R8SA 3CPEA 4TLAA 2FMXA 1I4DD 1XEWY 2IXGA 3K0AA 1I4TD 2A9KA 4F4IA 1SVLA 3SYKA 1XCMA 3SFVA 3EPKA 2O8DB 3W5IA 1N6IA 2ZIAA 1BYUA 4R7ZA 5J5CA 2ZUBA 1G21E 4ZDWA 4LHYA 3U44A 1XJCA 4B74A 2AR7A 3AGQA 1QRAA 4URXR 3UWKA 1SKYE 5KNDA 4BLPA 2FX3A 5EXTA 4ZCMA 1T4GA 1TL7C 4OHWA 1KJZA 3QXCA 3TK1A 5F98A 5DSZA 1Q3HA 2C77A 3BFXA 3UIEA 4AI6A 5KHOC 4QC2A 2DY1A 721PA 4GP6A 1V43A 4BFWA 3K0FB 1ZNXA 4JJKA 1Z0FA 2FWRA 4OL0A 2CJWA 1Q1QA 2IYUA 2TMKA 1XNJA 3FHTA 5C1BA 3WBJA 4R9UC 1YR8A 4TLBA 4V0OA 3VQTA 1W4CA 4DDUA 621PA 3KJIA 4BZXA 4Q01A 2BM0A 2FSFA 1NIJA 2R6FA 3MWYW 4BE7B 1W36B 4M1YA 3PEVA 3N70A 3HDTA 4HLQB 3TAUA 1Z2CA 2XZLA 2Q0HA 3RS0A 4LCBA 1X1SA 1FQJA 1IN5A 2FPKA 1DARA 2F1HA 3QXSA 4CT5A 2QPAA 2IYYA 3AVVA 4CEHA 1JXOA 5FOSA 2QN6A 3O8BA 3OE7A 4TSFD 4AKIA 2WOOA 5DNYB 4NP6A 3GLFE 1UKEA 3I72A 2B6HA 4B33A 2PH1A 3HYRA 2ZSBA 3B85A 1IOZA 1UDWA 2G3YA 1ESMA 3RS2A 3QIAA 2VBCA 3ZQ6A 4GNKA 2Q9CA 2ZRJA 4LHZA 4KITB 1GFIA 5JEEA 3CX7A 2A30A 3EZ7A 1UJ2A 3K0CA 4KFTA 4R71A 2MMCA 5FPKA 1E9EA 3C4JA 2OM2A 3QKUA 3THOA 1SULA 3QF7A 5LD2B 4NMMA 4DLUA 1VCMA 3EAQA 4XWOA 3ZZ0A 1N5JA 4DUGD 1EFHA 1W48A 4NYJR 2ZM5A 3FHCB 4YDHB 3CWQA 4P33A 4RZ3A 1L2TA 1EFTA 4XD7D 4JBYA 3T12A 3GQBA 1KDTA 3UXMA 1PUJA 2AXPA 5DI3B 1E2IA 3VR1A 4DT1B 1QF9A 4DDWA 2ORIA 1VCOA 4MKHA 4NTZA 1VHTA 4LJ5A 5CB6A 2JLYA 1MO5A 4M1MA 2IYZA 2QM7A 1JBKA 1RE0A 5DLQC 3NBYC 3U4QB 3AP1A 2HLDA 3S1AB 4BUJA 1KY2A 2OFXA 3B1XA 5GJVC 3CX6A 4BLTA 4P0TA 6Q21A 5J4KA 5F3WB 4CEIA 4JVLA 3LBNA 1DAGA 2WSSA 2GETA 2JJ8A 2FFHA 3F5FA 2IT1A 4JT2A 4MYTA 5HZKA 3R7WB 1XTIA 2EYQA 4D0LB 5EXSA 1ZINA 4LHXA 3EG5A 3SC3A 2JLSA 1KI9A 4EQ6B 2R65A 2XEXA 3MD0A 4PC6A 2D7CA 5KUTA 3TIFA 5GADl 1J90A 3NVAA 2Z4RA 1P9RA 2C9OA 2KB0A 2OUKA 3ZJYA 1Y63A 1O87A 2A5YB 3QVUA 2XNDD 3CR8A 2FN4A 2QTHA 4TQUS 3RHFA 4M1OA 4BGDA 3EPLA 5GJBA 3SHFA 2QTFA 3T61A 5JRJA 1XP8A 2ZSAA 1A4RA 1RJ9B 3C16C 1ELOA 1G64A 3MFYA 4NYMR 1AZSC 4IFEA 4DIDA 4A0RA 1T0HB 2GCOA 3K0EA 2G6BA 2E87A 2KBEA 4JKIA 3Q7QA 3QEOA 4EDHA 2WJHA 2DWPA 3X1XA 3U7HB 1EG7A 2B21A 1DAKA 2CK3D 4GRAA 5JBQA 3GLIB 1XMIA 3BC1A 1YZKA 2RMKA 2GBLA 1NLZA 4C0KA 3KB1A 3TJZA 3I5XA 4QNMA 2SHKA 1NSFA 2GZDA 1XU4A 2Q9BA 4QKQA 3EZ2A 4NPHA 1KO7A 2J45A 2QRNA 2F1JA 2ZANA 3PUYA 3TSWA 2AL7A 1KNQA 2JASA 5DHAA 1KSJA 3DL0A 4CT4B 1HT1E 3SFZA 2VLIA 4UKDA 1QVRA 1E4VA 3EIHA 2J46A 1A82A 5CIQA 3SYLA 1HE8B 2OILA 3VKHA 3KDSE 1ZNWA 3OIUA 5FPSA 3SOPA 1Z3IX 2XOKD 2ZUCA 3GLFB 1D2NA 3CWZA 3LFUA 2PZFA 4F7WA 1DG1G 2F1IA 5JCPA 4HDQB 4M9ZA 4H1VA 2OXCA 1OXSC 2HXSA 4HAXA 2GRJA 3R9XA 1C9KA 1P4SA 2OLJA 1CR0A 3TH5A 1EESA 3LA6A 2G77B 1QHIA 3A4NA 4JVMA 4OI4A 1FP7A 2EFHB 4QBHA 4IHQA 1XEXB 3HR7A 4TLDA 1L7VC 3D7MA 4MDFA 2QM8A 1KK1A 5CDFA 4RFSA 4OQFA 3WNCA 4WA7A 4TMXA 1N6PA 2QMUA 2OEPA 4GOKA 1W36C 2O8CB 5DYIA 1TEXA 1NJGA 2IX3A 3IBYA 4D25A 4C0BA 1BYIA 5FH9A 4W5WA 1UKZA 4E22A 4UQOA 1UBCA 1W4RA 2PCJA 2WAYA 2ZETA 5J40A 3O8RA 2O8FA 4URVR 2O5VA 4X8MA 1G3MA 2ZRBA 1ZCAA 2GZAA 1PVOA 2VP0A 2JLXA 3AH8A 1GIAA 2ZJBA 1KI4A 5DYGA 3W5JA 1G8HA 4PQYA 1SVOA 4XIGS 2EVWX 1OHHD 3KTAB 2H8KA 2Q21A 4B3GA 4D0GA 1HEIA 3OZXA 1E99A 4G5RA 3ZQJA 4MKIA 5K8UA 4FWTA 2EU8A 4LJ6A 4MRSA 3THYB 1N0VC 1ZP6A 3BOSA 2R6AA 1PLJA 2W6JA 3EW9A 3NBFA 1W47A 3W9YA 3BAFA 2WKQA 4RY2A 5HE9A 3DHWC 1KI6B 4HAZA 3JZMA 1XFAA 1E2FA 2RGXA 1OFIA 2NOAA 4OQNA 4IVRA 2YOHA 3T5DA 2CHQA 4PHFA 3OE7D 1DADA 4K8OA 4DLXA 1ZBDA 1UKYA 2BOVA 1U90A 2RHMA 3FVQA 1CBUA 4DHEA 5A0FA 5CM9C 2BHRA 2H7VA 1CP2A 2QAJA 3EC1A 1Z5ZA 2P6RA 4WZAE 1G3QA 1BOFA 4DKXA 2QAGB 1Q12A 1CRQA 2YINC 1CR1A 2FSGA 4KV9A 4OK6A 4NCIA 1G6OA 1KZGB 5BYKA 1TF2A 4LWZA 1OIXA 1I2MA 3GJ8A 3ADDA 4MYUA 2KSQA 3OF5A 3LVRE 5HR5A 1ZD9A 2NO1A 1M7HA 4PO8A 2JDIA 2ODBA 2OCPA 4HSEA 3B82A 2ODEA 1FOEB 3I62A 2QE7D 1IN4A 3H0KA 1QHHA 1FMLA 3VHLB 5LBIA 4XVQA 1G9XA 4IOLA 1E79D 1VIYA 1EWQA 1ZJ6A 1W2HA 2ONKA 3AF2A 3PG5A 2PLFA 1NF3A 2GXSA 3W90A 2MSCB 2GILA 1P2TA 2ZVPX 4YMUA 4ZI2A 3SS8A 3K0FA 2IEZA 4KFSA 4BLQA 2D62A 4BFYA 4HAWA 2AK3A 3I61A 3RYTC 2XZPA 1AKEA 3LDAA 2ZJOA 4FMDB 3L0OA 1T8TA 3N5CA 5M04A 2QEQA 2BBTA 1E94E 3GMTA 5GJCA 3NDBB 1YZUA 2PJRA 3H1TA 1U98A 5FL3A 5FBRB 5FR1A 3CNNA 1ZC4A 2IXFA 4NCHA 4WXRA 2NMVA 4Q21A 1G1MA 1SXJD 3CRRA 1ODFA 5DHFA 1XF9A 3GLHE 4PZYA 1W0KD 1BMFA 3A1SA 5FTNA 1NVXQ 1OYYA 3FWYA 1IY0A 1T8UA 1KKMA 4FMBB 3ADBA 1MR3F 1Z6XA 4O3MA 4ZKEA 1KO5A 2IWHA 2WWFA 3P26A 1G16A 4ON9A 1IQPA 4MRRA 2J7PD 3EIQA 4JYBA 2ONJA 421PA 1KK3A 4ASUA 1R0YA 1XEWX 2CE7A 4G1UC 4G5GA 4IRUB 5C4MA 2REBA 1M74A 1J2JA 1Q1EA 2GCNA 3PEUA 2NZ8A 5H68A 4D4LA 4Z1MD 4LHWA 4POAA 4JSYA 3MG9A 4I99A 1P9WA 4YMSA 4M9SA 3HWSA 1TAGA 4GZMA 3M1IA 4OI1A 5GVSA 4OBEA 1UBEA 4LBWA 4B3XA 5KDOA 3QKRA 3P4XA 3FKSD 1ZD1A 4Q7MB 1VTKA 2GKSA 3DZ8A 3U7EB 1UEJA 2IUTA 2ZXUA 2C03A 3LVQE 3C8UA 4LY6A 1FPMA 1B0UA 1W5SA 2FGJA 2ZRKA 1Z07A 3PUZA 4DLWA 2CK3A 1TX4B 3LWNA 1P75A 4C7OA 1P60A 2WAXA 3E2IA 3R9IA 1W4BA 5JHGB 2V6JA 1VPLA 4KFRA 2RGCA 4C3ZA 1QG2A 4DIEA 4D80A 1Q3TA 1Z6TA 2ORWA 1E1QA 2OT3B 4PHGA 2D3WA 2ZR7A 1NLFA 1E9FA 3B9QA 3CZQA 1G5TA 4HAVA 5DIFA 4PPQA 5DISB 4DSTA 4ZV4A 5C2JB 3A6PC 2OBLA 4DLSA 4Q7LA 5JWRA 2X1VA 4P4UA 5AJVB 4GBMA 4D26A 4DCUA 121PA 2GK7A 4JLPA 1LFDB 3RS3A 4UNQA 2OHFA 4IW3B 1KNXA 1AZTA 1KI8A 2D74A 2YZ2A 3KUCA 4A8JC 2C04A 3CZPA 1KI1A 1YR6A 2WJGA 1IN6A 2ZE6A 3AKYA 4QHSA 4KYUA 4EFMA 2EQBA 3AKDA 1JNYA 4W7SA 3CF6R 5EP2A 1D8TA 2W00A 3K0CC 2K5UA 3R9WA 4IDPA 1DPFA 1L8QA 1KZ7B 4F91B 1YQTA 4B71A 2ZYWX 1Z6GA 2NG1A 1IXRC 2C95A 4UNRA 1OYWA 1JEEA 2YOFA 4LBYA 4CVNA 4D0NA 4RJLA 1LW7A 3ZYCA 1Z0KA 2ZJ5A 2BJWA 3AVOA 3TRFA 5A5GA 2OCYC 1ZNZA 3QPVA 1XEXA 4HAYA 4KAXA 1IY1A 1TF5A 4JLMA 3WNDA 4HZUB 3GPLA 2O0JA 4GMDA 5TY0A 4KVAA 1II8A 2LKCA 1T5IA 1N6KA 3J81k 4N3NA 2NQ2C 2EFCB 2ZR9A 1N5IA 2PT5A 1IJEA 2R44A 2VHTA 4B75A 3KQHA 2CE2X 4LYHA 1ZM3A 1DOAA 2YNMA 3TLXA 3K53A 2VHJA 3OIVA 2RGNA 4BLOA 4F92B 5TXGA 4DSUA 5AJWA 2XJ9A 1T3LA 1SVMA 4LHVA 5BQ5A 3IILA 1HA3A 3Q8XB 2B92A 5EP3A 4Q1EA 1U2RA 1PLLA 3CRVA 1WA5A 2ZRIA 4LYFA 4Q4JB 3L2OB 3NEYA 3U7FB 4TQAA 4PAOA 1TADA 1QHSA 2FF7A 4I1VA 3KL4A 2XTZA 2J3EA 1KHTA 4HAUA 4ZIRB 4DB2A 4L15A 3R8FA 2BVNA 1ZUIA 1OIWA 1JAIA 4HDCA 4IKEA 1E3MA 2RCNA 1L4YA 2B7CA 3RLFA 4RD0A 1ZAKA 2GF9A 2P3SA 4PPFA 1F2TB 4Q1FA 1N5KA 4KODA 2J41A 3D3QA 1P2UA 3W3ZB 1FL9A 1E2LA 1G18A 1RKBA 2Y8EA 4Q1DA 1T9HA 1FX0B 2GBLC 5LD2C 1DELA 4PAQA 4IXMA 1GG2A 3OEED 1F2TA 3QKSB 2QUZA 3KQUA 1JR3A 2G0NA 3DVLA 3LD9A 4B2LA 5BWMA 5DN6A 1Q57A 3GJ7A 1SHKA 2IUSA 4TLEA 3ETLA 5L3SB 1TMKA 3HR8A 1KSFX 4CDGA 5JFGA 4Q4HB 2O0KA 3RRYA 1D9XA 5IDVA 4E5UA 3K0SA 1HQCA 4BRWA 1XX6A 3FMFA 5F9HA 1T91A 4ACAA 1VECA 4Q7JB 5H8WA 1QHXA 1HV8A 3H4MA 3Q5EA 4B3CA 2GJ8A 2X2EA 2ZRFA 3SDZA 2F43A 3GLFA 1NNEA 4F4CA 2KBFA 1R2QA 2X19A 3X1ZA 1OH6A 1KYIA 4M9XA 1G19A 1GSIA 3G5UA 4A9AA 1HY3A 4EPRA 1OSNA 1ZYUA 5DO9A 3BH7A 2CMKA 3I5YA 8OHMA 3SN6A 3MJRA 3QNUA 1SGWA 3KJHA 3KKPA 2BEKA 4O25A 5LB2A 3SR0A 1ZUHA 3P32A 1E2GA 2MMGA 3QOFA 2ZITA 5FOTA 3ECCA 3A4MA 3OIWA 4Q03A 1XMJA 1YZTA 1SVSA 3UANA 2R9VA 1J99A 2W2TA 2GJSA 1AGPA 2Q9AA 1E2EA 1S3GA 2V9PA 4N0EA 2GEDA 2DR3A 3VR5A 1OKKD 4NYIQ 3CRMA 1R5BA 4OK5A 2FNAA 3U6BA 4EPYA 4RCYA 1YRAA 2FEMA 1J8MF 5EE3A 1YZQA 4YQFA
chains in the Genus database with same CATH superfamily
3OZBA 3L0PA 1MRZA 1NKSA 5T5QA 4DV5B 3FLAA 1XZQA 1QUEA 5AM5A 3TZQA 3VR6A 5ADHA 4R3NA 3HKDA 2P68A 3IAS1 1A88A 5EJMA 1RYZA 1KFJB 3TE6A 3VU9A 2BLLA 4J0GA 4QECA 3FYUA 1Q0UA 1YRWA 2GJKA 4FONA 4NK4A 2I66A 1XXHA 2VP3A 1U6IA 1A5ZA 1GZHB 1SG0A 1RZUA 2YXBA 2ZS9A 2G4LA 3GJ5A 3ENWA 2RHDA 1LEHA 2A35A 2OG2A 3DLTA 1J5XA 4PLVA 4QXQA 3VNQA 1PGQA 1LDMA 5BVGA 3QEBZ 1ZR2A 1B8OA 4EAAA 5KYTA 1H8ED 1JEDA 4MAAA 3VJKA 2VP9A 2XYGA 2O9JA 5LWQA 2QK4A 3E7FA 3J81A 3UMJA 3H7IA 4BVHA 4X64B 4Z4QA 2ZRGA 4HNHA 4GI1A 4X44A 5CM8B 1OZHA 1UQRA 4C7KA 4W8HA 5LQKA 4LBVA 1DEOA 2O52A 4D8TA 5KTKA 2J6BA 4EO7A 4MMYB 3PNPA 1DQNA 1KFKB 3OLVA 2NSLA 2WP8J 3PZRA 5GVRA 5HCNA 3EFHA 1D2EA 1M1NB 4HEHA 2OVBA 1LBHA 3NHWA 3NCHA 4KE9A 4D4MA 4I2NA 4AIIA 3GAZA 4B7CA 3G9TA 5EG5A 1M2KA 2GF0A 2BGMA 2RGGA 5FPQA 3IV9A 1MDFA 1OBVA 2P2ZA 2ODWA 4I9GA 4KACA 4K2HA 1A8PA 4X8OA 5H80A 4C06A 4YJHB 4CCAA 3PD7A 3K1YA 2J9FB 4N4AA 3DWFA 1G8SA 4P4SA 3B7WA 1EUDB 2IZ6A 5IPFA 4JBXA 4PZCA 3RWMB 2QBYA 3SZ3A 2VHWA 2YVLA 2XYVA 1E1MA 4FK8A 3LNCA 3PXUA 3CXRA 2ZUUA 1QTRA 1T0PA 4LIPD 3E9MA 1EDEA 3P19A 4PS1A 3EH2A 2BJVA 2VP6A 1SM4A 3B70A 4TV9F 4B47A 5C18A 1AQ6A 4X8HA 2FFAA 3JVIA 4GP7A 2CBGA 2C78A 2O2JA 5K9ZA 1KYYA 4UEKA 2P1DA 1TJNA 1PT5A 2PT6A 4D0RA 1K6IA 4I9UA 4PC2A 4EAQA 5DHPA 1PL7A 1NOIA 1PGPA 2FR1A 3K94A 2QTNA 1YC2A 1UEIA 4Q3OA 4E07A 2XCSB 3A58B 3Q87B 1TRHA 3A3YA 5IBQA 4R3WA 3AEQA 1L4LA 5IJ9A 3K30A 1R8JA 2H85A 2COUA 3QVGB 1P2GA 1HQKA 1OWPA 4XLLA 3TDNA 4QT4A 2VP2A 2J87A 3JAKB 1T3SA 2HJGA 2REXB 3P8ZA 3HUTA 5I45A 5IMBA 3W6NA 2CT8A 1M1ZA 2YHIB 3QPAA 4YRZA 1SELA 1WDKA 4MWZA 5DM1A 2IYVA 4MCIA 1JHQA 4OIMA 1ANKA 4M0MA 1W76A 1H4VB 3H8JA 2Z6QA 1G8FA 3IOCA 3SJZA 2C92A 3RQIA 3TCXB 2BYTA 1SKQA 2GRAA 3MZ0A 1CIPA 1H2HA 2W11A 2XWBF 3E1SA 4JWKA 3GQBB 3IIJA 3W2TA 5A04A 5JS1A 2Q2WA 3CNLA 1QM5A 4O1MA 4R1NA 5CHYA 4C43A 2JLRA 3GCXA 4I46A 4DCNA 4TMFA 2HT1A 2K87A 1QS0B 1GL3A 1XMQB 4B7XA 2HREA 3KAQA 4LDRA 1Z62A 4CN9A 4H18A 2D1SA 2CY0A 1SD5A 1GZ7A 1I1HA 1Q5PA 1AKWA 4WLVA 1TQHA 4IJWA 2BGLA 3WKEA 2AX3A 4H7KA 1GDTA 2CHGA 4Z4EA 4Y6SA 3CUYA 1G4AE 1WD5A 1H1DA 4M99A 4C7OB 4I50F 4Q7KA 4BQOA 3HFRA 5AUNB 2OZVA 5KTMA 4R8VA 1Q22A 2NW6A 5EVJA 1GFZA 4LJKA 1AUQA 3ZY2A 4NZMA 2E37A 1HDCA 3L1HA 4GMFA 3BL6A 3L0SA 3UMBA 2O3RA 3NBAA 3PXGA 1L5ZA 3PRKE 4G5FA 1JA9A 5KJ6A 3QVMA 3AUUA 4FXPA 3NLLA 2OV2A 2C5EA 5E1MA 1KH3A 1KI3A 4NICA 1M2VA 1YJ8A 2WE7A 3N3BC 3AVXA 4FDMA 3AVYA 3AVUA 4M53A 1XMPA 2O0HA 3C5CA 3IAFA 1DOZA 1YI1A 2ILVA 2ZKIA 3GR6A 2PBRA 2PK3A 3L6OO 4X6LA 4PN3A 4RTMA 4RNDB 4WBNB 4KOAA 4DQKA 1R4ZA 1LLDA 3K8YA 2HLDD 4PSCA 1VHQA 4W6QA 3VZBA 3VZDA 4DGQA 5L95A 1IVSA 1U11A 2Q1XA 5AXAA 1QPBA 5KOJA 1I5EA 2OP1A 2X13A 1AB5A 2GZHA 5IXJA 3EIUA 4RUKA 1VE9A 3A37A 4OCZA 1U1GA 4BKMA 1SXQA 3DG9A 4O4HB 3CNBA 5DLPA 1WXXA 3O21A 3QJGA 3TSOA 5BV7A 3CVUA 4EPXA 1GO2A 4M1ZA 2BUAA 2D13A 1RBZA 4B6RA 4NQRA 2G5PA 1HE1C 1Z16A 3FG9A 3HKCA 1WIWA 1MH1A 1W59A 1XRJA 3TQHA 3KKZA 3VGPA 4DVJA 3T5PA 1RYNA 5BVHB 1SHUX 3O82A 4URFA 4ZEXA 4ZVUA 4ECAA 1EYZA 2HT6A 4Q66C 4EUNA 2L0XA 3V1UA 1T4MA 1VSTA 2WUDA 1GTJ1 1U0FA 3GGDA 4PSAA 4YRQA 1CEYA 4X20A 3GFTA 1ADBA 3E05A 4QG3A 1S1MA 1YBFA 3OQHA 1LK7A 3WMEA 3LQQA 3LK6A 1SHJA 2Q5CA 4ZEWA 4KMMA 5MDHA 4QPPA 4Y9TA 4DQLA 2NSJA 3BCHA 1WMFA 3IHWA 4YXWA 5LM3A 4DSNA 1Z28A 1M3SA 3T7KA 4HNGA 3QW4B 3T4XA 5K20A 3IQEA 1G5HA 3QTTA 4QGSA 1QO0A 4IOMA 1SG6A 2IIQA 4NYIR 2VQ6A 2X3YA 3I39X 3SBXA 4YMWA 3VYSB 2YYZA 3L6CA 4MSUA 2PR7A 3VHXA 4DE5A 1Y89A 3HDVA 3WWOA 1OC2A 4PHTA 7YASA 3NQ41 5A3VA 3CSSA 1EP2B 1N7IA 2QKYA 4YJ2A 3DMHA 3I8SA 1UMBB 1J49A 4ZRMA 1BWPA 1K4KA 3DCIA 1X7YB 5EIBD 1K8XB 1QE0A 4J7CA 1NN1A 5IJAA 1Y9JA 4BB6A 2WT4A 3F1KA 5KINB 2WU8A 1DRWA 2HK7A 4KXQA 1G7TA 5K2OA 2BGKA 3GW8A 2ESRA 2QR5A 1KBOA 2WRZA 1MORA 1RXCA 3D2AA 3ORQA 2HF8A 3K6SB 1S01A 2ZI9A 3T5CA 2IHBA 4RSMA 3GLTA 3SG0A 1BKYA 3RS9A 1VE5A 5SZHB 2PMDA 4CHGA 1TO6A 2I8AA 5A1JA 2WPDA 5ICMA 3CPJB 1YAJA 5K7SA 1GGHA 3FBTA 1N3IA 3QXHA 4XSGA 1PJ4A 4BLSA 4DQUA 1CDZA 3OY2A 2W6OA 4X20B 4BB9A 5I9MA 3FMPB 1H42A 3GFFA 1V4NA 4FNOA 3ZNNA 2Z6VA 3JS5A 4F3TA 3N8HA 3UJ3X 3HCDA 2R97A 3HC7A 4QVIA 1W88B 5EWLB 1O89A 2MCFA 5IAEA 1ZFNA 1IOWA 1FUIA 4A92A 3I9OA 3NP7A 1KYZA 4OHXA 1XTUA 4UTZA 1Z6YA 1B76A 2VWGA 3N6VA 1FDRA 1UBSB 1JKIA 1YRBA 3EGIA 1EX9A 3FNEA 5T64A 5K05A 2YJ3A 2O3UA 4Q9AA 1D1PA 1YE5A 1YVUA 2DBRA 4A6XA 3KTAA 5K3DA 2JGFA 4FILA 1K5HA 1HMYA 1K88A 3FKQA 3OQJA 1X74A 4XGIA 3WSWA 2FOIA 1SZCA 2ZTUA 5I4IA 4ID3A 2GMWA 3D0KA 3PVSA 4WL0A 3PHBE 2FSPA 4KYIB 3IAHA 4R7TA 3RREA 5HUJA 2WU3A 3E35A 2A0XA 1QDLB 4B76A 4HK4A 3TUIC 3IOYA 3SVTA 4BYGA 2A5GA 1NX9A 1HQDA 3W7VA 3L0ZA 3GELA 2O2ZA 1OFUX 3T7TA 4C0LA 2QRPA 2QNRA 2ECPA 4QGHA 2EGGA 1T1GA 3C1TA 1GUAA 3ILSA 3TZBA 4L8YA 4P4TA 2BE7A 1IBRA 1FUUA 1RM3A 4HNQA 4U2KA 1K4MA 4W8OA 1OHHA 3S2ZA 3PGMA 5DXAA 1GA1A 2H6EA 4IMIB 3VYUB 4CFSA 4TZ0A 2KYRA 4ZQHA 3GK3A 1VG9B 4MEAA 3K9WA 4M55A 4ZOLB 2F1OA 1LJLA 2XGMA 2GR9A 3C6YA 4YI5A 1I1QB 1QKJA 4OG2A 1SCAA 1JLHA 5DM0A 5FA6A 3WRXC 1CRPA 5C8YB 4KGZA 4L0DA 4WV3A 1CU1A 1EP9A 2BEVA 1HYGA 3UMSA 2D5AA 2W7TA 3Q3HA 5M34A 2ZDGA 3E22A 3T54A 3TIXB 1MRSA 3PX2A 5DGXA 3GB9A 5C46F 1NJ2A 5ISMA 1OFHA 3M6FA 4NOLA 1G98A 5GP1A 1W4LA 3PEEA 2JFPA 4O02B 4EO4A 1N9GB 3NC0C 1Y3DE 4F5EA 1E2QA 5JDCA 2JIOA 4OUDA 3CB4A 1A2BA 2EL9A 4JXJA 5DEIA 1RHJA 5E1DA 3U40A 4FINA 2AHOA 5CB4A 5BP7A 1FS5A 4KWEA 4BO9A 3N5KA 2CKMA 3KV1A 1GG8A 2PRZA 2V55B 2FDCA 3R6WA 2JGMA 4LS3A 2NT4A 3ZHVA 2JANA 1UPCA 1L4HA 1LLQA 1PGOA 2IHVA 3PXAA 3SM9A 4D8VA 2I87A 4DLNA 1SC1A 2E49A 2JVKA 2JARA 1JPVA 5KCZA 2GEJA 4W1RA 4JLNA 2H1HA 3B51X 3MB5A 1J8DA 2DBYA 4FC7A 4Q3BA 2EIHA 4TXLA 5A4JA 3MGBA 4CIBA 1U3CA 3LDFA 1TD1A 4J2OA 2AN9A 1BHO1 1LNZA 3JQ7A 1MO2A 5EUMA 5H4GA 1C3OB 1EFKA 1DIRA 4G8JA 1ZGBA 1YL7A 4JYCA 4XIFA 3NO4A 4AKGA 2Q4RA 2QTVA 2JJQA 2ZJ0A 5CRIA 3WISA 2Q27A 3HM9A 1E2PA 2FRVA 2WTBA 4ZK6A 2E48A 4NCJA 5K0BA 3BH6A 1JGTA 1VYHA 4UBKA 3VDNB 5ALTA 1T9AA 3T3EA 4D0SA 3RSFA 1BN7A 4RKEA 1MOQA 2HMTA 2WJWA 4IHJB 2E4UA 3GOQA 2BSAA 2XMZA 2ZDQA 4HXEB 3R23A 1RQXA 5GONF 2YOGA 3ILYA 4KWHA 4EHBA 1IXYA 3WB0A 3RFTA 4TTVA 5FOXA 2IUFA 5HA5A 4INZA 1ADYA 4BNJA 3TR0A 2V03A 1CLUA 4HDOB 2N1BA 4QUEA 1VYVA 2NV6A 5EZYB 1T6NA 2OORC 1XD9A 1R0WA 5D87A 4B45A 4I4CA 4NIMA 3IL2A 2HPZA 4M88A 4E14A 1LPPA 4NE7A 1LLUA 5AK0A 3IVAA 1TECE 1BKSB 4QAQA 1ZQ9A 5E9JA 1CUSA 3AERB 2GEVA 5ALHA 2X7HA 3UWOA 1G41A 3IT3A 4ABTA 3L1KA 3OESA 3UFXA 1UFOA 3A9RA 4BWGA 1CZLA 3AP3A 2F64A 1KYXA 1OAKA 1JR3E 1KMQA 4HX5A 1KI6A 5IW8A 4GOJA 3OCVA 3A1UA 5EQJB 3L7DA 5J4HA 3DBOB 2VJDA 4DCJA 1GQSA 1ETHA 5CT8A 1X8XA 1HXHA 1XZPA 2PRSA 3AERA 1WHSB 3HJUA 4FP9A 4IJ5A 4R68A 4UXHA 3MWEA 4C0AC 4GWLA 3WV5A 5BVGB 2W2VA 4DNXA 1LLFA 3F6SA 2FUG1 1R18A 2YJTD 3HV2A 1GNVA 4ABYA 2W2PA 3E15A 5KKCA 3A1TA 1AMUA 4MR7B 1GPUA 3RSLA 1B7GO 4MUFA 1PWYE 2FQ1A 3Q8KA 5FA5A 2V7QA 2J6HA 2XGGA 3S2YA 2OPHA 3UWDA 3U31A 1KQ3A 5DWQA 5A2GA 2PZAA 4CUZA 3RTCA 1GKIA 3B6IA 2WFAA 1NMEA 3OFVA 3SZMA 1Z37A 2YL2A 4C21A 4GD3Q 3NDJA 1IMOA 1U7TA 1U1IA 3JZAA 4OHCA 4RLHA 3VM6A 1JDSA 3NH9A 2WI8A 4EJFA 3ECSA 1A5BB 3PQCA 3JVEA 1JFRA 3RS5A 3S27A 3SLKA 2GCIA 1RXWA 1H5UA 1PR3A 1EMDA 1G8GA 3VVCA 3JQPA 2D4AA 2VNJA 3AFGA 1N5LA 2YYSA 1EX6A 4PX2A 2G7ZA 4GH5A 2Z09A 4Q5IA 4K9PA 1P81A 2XVYA 3GRAA 1NW3A 1KPIA 1DRVA 2XIQA 2OAQ1 1WLYA 4R2HA 4FE4A 1AS0A 3H2SA 1G8AA 3UKJA 3K0AB 1Z7BA 2OCGA 2UYOA 1D4FA 2QG9A 4NZYA 2DU8A 2RC6A 3FNFA 1DBIA 3K9HA 1RWXA 3GCGA 2JAXA 3MMPA 4FJ0A 1NUHA 2DUWA 3HKBB 2NU9B 1RQ7A 2CBZA 3ZIAD 3QWBA 4B48A 4DVGA 1FMFA 2QP4A 1Y6ZA 1R6BX 3PUVA 4Q34A 4RA9B 5DPMA 3DE0X 3FXAA 4PG8A 4Q6WA 5J1TB 5H81A 1YU9A 4WD3A 4F1WA 3NP9A 4B3IA 3RB8A 1CJVC 2VRCA 2I3GA 2TRSB 2YWDA 3INRA 4HPJB 2EKZA 3A11A 5GAJA 4MMXB 5HQJA 1X1TA 2WKSA 4WUTA 2QD3A 5HS6A 2H31A 3GVPA 1BNCA 3C0KA 3E7WA 3I6YA 5BXYA 3LM8A 1CRWG 1K75A 1FA9A 2X5XA 1P44A 3CJRA 5K03A 2DETA 3RV4A 1ZESA 4E94A 2BRUA 2GFIA 4Y6LA 4B2IA 2A94A 3KHSA 4C5AA 4O2BB 4TMYA 1OT3A 2JCXA 1Y8QA 2BFWA 3DC2A 5D1NA 3T3PB 3Q7TA 4ITVA 1K0UA 1IZZA 2JL1A 3M6AA 4O4HF 5EI5A 2NUTA 4UC0A 4CF3A 1PS0A 1MO3A 1TC2A 1XZDA 2XUQA 3IPYA 1FBTA 1N1DA 4B8YA 4Q47A 3VDMA 1E5XA 3B1ZA 5ALEA 2R86A 3WMFA 3CR3C 1GKUB 4QUHA 4COKA 5A5DA 4KC0A 3RSSA 3VVMA 3CT6A 3P5BA 2QYOA 1QLWA 1O2DA 1XXHB 2JIPA 1E58A 5CD1A 2O4UX 4MOWA 2AFHB 4HS9A 2BMVA 1F8FA 1GAXA 3W6OA 1L5OA 1OWLA 2FMHA 2YXPX 3DUWA 3KU4A 4RPIA 4Y2SA 3IPRA 1YRYE 5D51S 2X7JA 3W5HA 2YFHA 1NBHA 4BN0A 3FDFA 3TLCA 3KBBA 4OATA 3K8QA 2BFBA 2W43A 4ESVA 3EBLA 2Q3HA 1PR0A 4OXQA 5FTJA 1WMEA 2N47A 2NGRA 2NXWA 2N9UA 2QROA 3DTVB 1W49A 3F0TA 2XA1A 1DBWA 2Q5JA 4LXXA 4RVUA 1XCPA 4MUNA 4TL8A 5FEUA 5ARBA 2INGX 3S40A 2GHQA 2ZYSA 1GGNA 3BH0A 4HH4A 3HBAA 4UCWA 3ZW9A 1XZGA 3GT3A 3TW8B 4CI0B 2XRZA 4OH7A 2PEZA 2OXTA 1OF1A 1YT5A 3G5LA 2YIDA 3FNIA 2Z2IA 4G8CA 1FFHA 2JDID 4UNNA 2IBSA 2B8TA 5G41A 3GYBA 1DEKA 1N9KA 4WZ6A 5E3JA 3GWZA 2D7DA 3OFSA 1NN3A 2MR6A 4I9FA 4LK2A 4DQVA 2DH6A 4HN9A 3PK0A 1EAYA 2WK1A 3QBEA 3A1CA 4UDOA 1BDHA 1DKNA 4OXRA 7REQA 1HQYE 1MQSA 2HA2A 5FI1B 3T1NA 1HL3A 1MXFA 4NABA 2JLBA 2EZ4A 3VO2A 4DM7A 2OAEA 2A5LA 3IBTA 4X62B 1BGXT 1EM6A 1NBOA 1P9LA 3G1WA 4G1BA 4QEKA 3V4LA 3F6RA 2GBCA 3AI2A 3NBMA 3HGMA 3C3EA 1AXGA 1A0OA 2V7BA 3AXTA 3CLVA 4BX2A 4O4IB 2JJ2A 3HYTA 3L6RA 3JD4A 1KMHB 1HK7A 3R5TA 2ZRNA 3VBCA 3B1JA 3FSGA 4UOZA 2PS9A 7MHTA 1GAEO 4LMPA 2AUMA 1P0CA 3JQAB 2XUJA 1W75A 4TKUB 2I1QA 2X0JA 3A1VA 2FUCA 3NHBA 3NYRA 4N5DA 1YB6A 5CH5A 3TVDA 3PDUA 4ZDJA 4MS4A 3RJ5A 4G3XA 4UHDA 5PNTA 4HDRB 3SX0A 2WHRA 4KQJA 1JG3A 4UJ3A 5ICFA 3WVNA 2VWHA 2HSWA 1LC3A 2P4UA 3COVA 1TIBA 1TF7A 2JK1A 3CEHA 2P5YA 3ND9A 3T9EA 4ALIA 1T5OA 4RTQA 4U3JB 1MF7A 1YDMA 4G07A 2NU9A 4IIXA 2UAGA 3KC2A 3ZTTA 1WB5A 4PO3X 3ZV7A 1SXGA 3OG9A 4P5EA 2H7XA 1QJ4A 5IVHA 1PJRA 2ZEJA 1EFRA 4OREX 1EBFA 4RD2A 2NPFA 1JHXA 3Q10A 1ZAYA 3DAGA 1C3XA 1JEJA 2VBGA 2YV3A 1P1RA 1BSVA 1E0SA 1BQ4A 1HTTA 3MCAA 1IEWA 2B61A 2WWHA 3M4ZA 3NGLA 4G5QA 5KWJA 1Q15A 1K7YA 3EUWA 3THYA 1R27A 5CBPB 5JXHA 3U9LA 3VNSA 5AKKA 3NC1C 1BE1A 5IAOA 3PR2B 3V2GA 1XDBA 1LX7A 3RU9A 2DTEA 2DTXA 5MFZA 1LGYA 3JR7A 1NXOA 4PC3A 1PJCA 4WMLA 3RC7A 4JC5A 4IDHA 2HD4A 4Q4LA 4XOIA 3KKMA 1GTG1 1V2GA 3DW1X 4Y9SA 4LVOA 3Q11A 1SG9A 5BNWA 2O3QA 3K9FC 5A0VA 4D4HA 2JD1A 5HSGA 2H00A 2VHCA 1L5SA 3S7ZA 4J0CA 2IV3A 4EJSC 1Z88A 2PRJA 4AZTA 5BXQC 2DFNA 2HK9A 3VR0A 1WE2A 5BV0A 3LUFA 1BO6A 1LKZA 3IHKA 4MJ3A 4TN1A 2O8FB 2PS1A 3PF9A 3U4DA 4DLTA 2QQ0A 5EP4A 3RSOA 1MC5A 1T2UA 1XZLA 3WRYC 5KKNB 3B1YA 4LV5B 1XV5A 2XXAA 1WUKS 3SX4A 1X1RA 3LOPA 2I4TA 1E5LA 2BMJA 2IEAA 3RHZA 3NYIA 1NFFA 3WYFA 4IDEA 3BRWA 4KIUA 2A67A 2GLUA 3TLAA 3LCUA 3BB4A 1XAIA 2VJLA 1AD2A 2VSNA 4MQ5A 3ZJVA 3ZDXB 1G2PA 4IIFA 3X2SA 5BNIA 1VMAA 1FTQA 4Z5XA 3V7NA 2CNWA 2A0KA 2AEJA 5CITA 4J91A 3DTVA 3RYIA 1QU2A 2DUMA 3EZ6A 3RRNA 1DTSA 1WDLA 3ZD6A 3TIGA 4CKXA 3GY0A 1NLYA 2PPVA 2Q4DA 3KUDA 2ZS8A 4X0EA 3DAPA 1H1LB 4MGHA 1E2MA 3H5LA 4BN5A 3RJMA 4K81B 5IM4F 2XVZA 3VX4A 1JKMA 1ZM9A 4N9WA 4R8RA 2XUFA 5EYPB 1JFTA 3D8RA 2R7MA 3NEPX 2WKRA 4OHUA 5HGXA 1TYZA 3FCUB 4ZO4A 4YLEA 5K3AA 4CRWB 2QX9A 2J3MA 5ENDA 1DWUA 1M6VB 2VJOA 4JBHA 3HVRA 1AQLA 4V0ME 3W8RA 1KXZA 5LPNA 2XMDA 1R0ZA 3V1MA 1AA9A 1TCAA 2H54A 4NOJA 3UV3A 4F4HA 2R60A 1X77A 1YU6A 4PICA 1UPXA 3L06A 4RW0A 3ACCA 3WBKA 2GWHA 3ZXXA 2FEAA 4XB1A 4FFVA 4BIIA 3PC8A 4F3KA 2IBMA 2QZZA 1GGMA 4D3ZA 3DAYA 1W9HA 3SJBA 3CVWA 1R0XA 3DDUA 4YMIA 2RD2A 2DHRA 1C7IA 1Y7IA 1Z29A 3RIGA 1W44A 3LWDA 4DQDA 1C80A 1SD2A 4RTSA 2YXDA 4KE6A 5BN4A 4FT2A 2ZTLA 1SKAA 2ZRCA 2Q4BA 3EPRA 4GYJA 4HWOA 2FTKE 4ND8B 4R81A 4YJDA 1PKXA 4H0NA 4A0GA 2WKPA 2E4XA 3DMTC 3SBDA 4G97A 4B2PA 3I52A 3SYMA 4LF7B 2Q0SA 4S35A 4QIHA 2R2GA 2XOKA 1W9MA 4IDGA 4URWR 3B8HA 4GKJB 1S2GA 4ZHSA 2CLIB 3MWGA 5BRJA 5JD4A 4XJSA 3UGTA 2BMEA 4JI6B 4BWYA 2KPOA 2XOEA 3BRQA 3IMKA 3JQDA 2AKYA 1PKEA 1W1IA 1XTVA 2BC9A 5TNXA 1X8LA 3CE6A 4JJ8A 4PZUA 2E21A 5ALWA 3T0GA 1ND6A 3GC6A 3RS8A 4MH0R 3WGOA 3H42B 3HJTA 1Y42X 5IK2A 1XPRA 2H11A 3H2IA 1PTJA 1US8A 1IJFA 2A5DA 1XD2B 3LYHA 3L6BA 3QITA 4P08A 3RQSA 3V7UA 1Z6QA 4A1OA 3BYZA 5JS2A 3Q7PA 3OF2A 3SXPA 1NVFA 1M6VA 3PQ3A 2CNLA 1PQ4A 3V1YA 2B3TA 4E6EA 3WY9A 5KNCH 1OB2A 1Y82A 1WPQA 2ZU0C 1P2SA 1VJGA 1O95A 3D6UA 3PP8A 4QDXA 5JYDA 4R2WA 3IEIA 4FYIA 3IJRA 3AIOA 1MFZA 2AOXA 1G4HA 1U0TA 3IQXA 2IQIA 2OFOA 3KX2A 3OPYI 4MRVA 5EHQA 1SD1A 5IFLA 3IBGA 2QAGA 2PPLA 2YFYA 4GRIA 5ULLA 5KC8A 1N25A 2IS4A 1HDOA 3KVYA 4NYMQ 4CG2A 4L8GA 4D3DA 3F71A 4DLYA 4ZGWA 1YTLA 1XDGA 5JSUA 5LMZA 1N8SA 2CD7A 5DBIA 2VTKA 4XGQA 3AHIA 5LIPA 1LXCA 3MINA 3NW9A 4Z8XA 2VI5A 4TL9A 1NUPA 3RI3A 1R66A 4CM4A 5GMOA 3ILVA 2YRFA 5J2TB 2CV1A 3FW1A 2VH2A 1K7EB 1GADO 4BNIA 3HVIA 4BCBA 5BR8B 5ALJA 3UMGA 1Z0AA 3UJPA 2Y67A 4BZQA 4UFNA 4YCMA 3GGOA 4EG3A 1Q3KA 3OWXA 1OGIA 1RKXA 4RVFA 3T3DA 5E8JA 3BWCA 4GSLA 3BPSA 3GUZA 3CF4A 3NONA 4PZ9A 4RSGA 3GJ4A 5U9CA 1G63A 3F8WA 1US8B 4G0PA 1RPAA 2OXIA 4EF6A 2YXNA 4OIFA 5DJ5A 2RBKA 1V7QA 2HK8A 5LLSA 2PUWA 4DG9A 3VPHA 1VBMA 1VYTA 1T5LA 1ZK2A 2W2OA 3QUQA 3IUMA 4B6GA 5D5PA 4QULA 2HTFA 4LEIA 1K08A 3EXG1 3R3ZA 3WLOA 3VTAA 3IP5A 3Q6MA 3I3OA 3QFFA 1NP3A 1XTSA 2CCGA 6YASA 1P5ZB 3ORHA 1K9SA 1ONSA 4Q19A 4HNTA 4CMGA 1MRNA 1XD8A 3AYZB 1YKSA 1SUWA 4YEDA 1W46A 4MV8A 1NP6A 3D7LA 1G5PA 2FW1A 3AWDA 3AR8A 5JMTA 1Z4QA 3F3KA 3JQ9C 5BSWA 3LS2A 4DB4A 2OGUA 2R85A 1VCHA 2GCPA 2WUEA 3T3NA 2PGLA 5EIHA 3SAJA 3UJCA 1M1UA 1P4JA 1NM5A 3HZZA 1NXPA 2XX3A 3BL8A 3BGIA 3W6UA 2JJYA 3NM5A 3KD2A 2Q50A 4JR0A 5JCXA 2YTZA 1VM6A 2O06A 4R83A 4U3JA 2PL3A 3DVQX 5L9AA 2V65A 3DOOA 1ECPA 3H17A 4TT3A 5H3CA 2O8BB 3IXQA 3FAZA 3ORSA 4HDAA 1X86B 3OJFA 5LBTA 1EM8A 5EA2A 1K1EA 2ZJFA 4F9EA 2X3UA 1JAXA 4YRBA 2HI0A 3IC5A 3PNQA 1LWOA 3DSRA 1CQPA 4K6OA 2XZDA 2GEBA 4FN4A 1TQ6A 1QO0D 2H07A 2YZ7A 4DYDA 1L5VA 1YL5A 3FDZB 1T15A 3SMVA 3E9DA 2FXVA 1TO1E 3CA8A 1DC8A 2GA8A 3QVLA 3I6QA 1TJ4A 3QEMB 1IEQA 4JB8A 4TYPA 3U13A 1Y3FE 4AG5A 1CVRA 3GCWA 4Q02A 3DW3X 4GECA 3ZV6A 4BMYA 1PWEA 1XZNA 3CEMA 4NZNA 4PRYA 1CEEA 4MWTA 5FL7A 4GI7A 3TR6A 2CW5A 4PWYA 5KNCD 3ZE9A 1O08A 4L4SA 4MPRA 4QJ3A 3T5TA 2RH8A 2B1QA 5FWAA 4DQXA 3GJ6A 3U3RA 4ILEA 1T10A 1MEOA 3MTQA 2PG3A 4EKNB 1Y3IA 2H8GA 3DDCA 3IQWA 3KLOA 3FZGA 3DLPX 1RR6A 4II7A 2QZ9A 2Z08A 1RSZA 2RHTA 3OC6A 4U8GA 4EW6A 5JYEA 4W5NA 2NZJA 4H7IA 1RZ3A 1ZXXA 3VDRA 2DSTA 3WNBA 1C7FA 3AXSA 1E1LA 4CF4A 2PRKA 3COZA 1JPUA 1TQ8A 3KSRA 3T5BA 1QPZA 3TMAA 2JFGA 2ROQA 5GZ3A 4XTRA 1H6AA 1HSOA 5FXMA 4OFWA 5J4VA 1MO6A 4Q18A 3HLKA 2JD2A 3WYGA 1WV0A 3O6VA 2CUKA 4GPBA 3WLEA 3JAMA 1VE1A 3BGWA 4HN2A 5E2AA 5IT4A 1YK0A 2OBXA 2I99A 3P0RA 4QFMA 5TQVA 2Z6AA 5A02A 4FCWA 1C1YA 4LVCA 2FRDA 4TLMB 2OGWA 4RJ2A 4TQ9A 5DNDA 3SXUB 2JFZA 3K5PA 1YJ5A 1K97A 1BA3A 4DNOA 1SJ9A 3FFBA 4ARZA 1FB5A 2DM6A 2X77A 1S8FA 2N3ZA 2P9FA 4MIYA 4WZZA 4DLKA 2JIDA 1V9CA 3DPUA 4AJKA 3ERCA 4WKCA 5C8XA 3THXA 3MJ4A 3OUUA 3BUSA 3ZGVA 1MOZA 2IY8A 5AW7A 2DE0X 4US2R 1E32A 5AKHA 2QE7A 4E46A 3PR1A 4ZI5A 2Q3LA 1DBPA 1CUVA 1DIAA 1P6XA 2JI7A 2BMAA 4KSYA 5B30A 2GO1A 4W99A 5BQ3A 5AVVA 2CF6A 2WICA 3K2BA 2QZ4A 3E22B 4JBNA 3BXEA 3T0IA 4FR5A 3ZVKA 2IDMA 2MJLA 2V9ZA 3I73A 1AV7A 4FZRA 5ENZA 5LYJB 2D6FA 1GNPA 4XWKA 4XGRA 5G02A 1N7GA 1YOVB 2FE4A 3MS7A 3ZHZA 1JR4A 1XXLA 1GY8A 2VDUE 3A6FA 3DKIA 3ET4A 3OOSA 4DEXA 5JZOA 1NVUQ 3UGQA 2AR0A 2AOUB 2JGKA 4JY7A 3PJDA 1RLJA 4D0GA 2PLAA 4URUR 2J08A 1TEZA 1TQ2A 1NA5A 1OAOA 3NH6A 3WP0A 1WVIA 1EVJA 1VE6A 2O2XA 4QJBA 1BCRB 3A14A 4U7WA 2RG1A 4E5YA 3CGWA 2QTCA 4IEEA 4QGGA 4Z4CA 1MFPA 2A0FA 4IWNA 1NTRA 3O7MA 4PQRA 3MT9A 4J1SA 3H1GA 3E8SA 5SV2A 3AR3A 3MTIA 4J2HA 3SYTA 4DMCA 1ZS9A 5JC8A 2R6R1 3C85A 2I1VB 2J32A 1N0WA 3C7TA 3LPMA 2B5WA 1O4WA 2I6TA 3BD9A 3OCJA 5AVRA 2V7QD 1QR2A 1KE1A 2C54A 4UNPA 1V3TA 2FWBA 2G0AA 3U3XA 1BJKA 1G7SA 3JPYA 4NDZA 4Z0HO 2R4UA 5KOHB 2XLCA 2B4YA 1CIVA 3FJ1A 4EUEA 5ALNA 1QZXA 4UM9D 1Y9AA 2DPGA 3KKEA 1QFMA 4MB2A 4I9NA 1W36D 2GPAA 3U4CA 5AI8A 2YX1A 3QLVA 3WP1B 4B3RB 3OO0A 4XQEA 4CM5A 2O07A 2R00C 5EJ2A 1E8NA 3OWOA 3TLMA 2C3MA 1QGYA 3ZK9A 4R2KA 2C5LA 3IRUA 5LQSA 4YJHA 2H4FA 3GEPA 5AQEA 1JHRA 1DTEA 1HGXA 2PXHA 1OLSB 4UU0A 4RKYA 4HZIA 1VPTA 4D3YA 2H9YA 5LL6P 1TUGA 3FRHA 3B9RA 4B7ZA 4QHTA 5AFSA 4V2IA 3E8MA 4OQDA 1XDZA 3ZG6A 3THWB 2Z8YM 2R7LA 1QIHA 4KQEA 4LY9A 1JLMA 5JNVA 1Q50A 3ZV4A 1Z22A 2W5UA 2WZQA 1CF4A 2VZEA 4LFBB 2EZTA 3RVJA 2IA5A 3ONFA 5CVUA 2WSMA 5FBKA 3KDAA 3QE9Y 1NI3A 1ZIXA 3F9IA 1ZICA 1BXKA 4FGZA 5MGBA 1P2DA 4IH9A 1OWNA 3GJQA 4FYMA 1XPOA 2X15A 4HUTA 3PHCA 4W9MC 2CF5A 4MGKR 2XDQA 1NPTO 2BH2A 2FH5B 2ERXA 4TV9B 4KXXA 5EP1A 4I4LA 2CJFA 2ZIUB 3OJWA 1EJ6A 1KS2A 1RNLA 3BFKA 2RHRA 3FVRA 4URYR 4Q9JA 5CFRA 3WG9A 3DOIA 2PSHA 4BNLA 4DSZA 2V6IA 4UUPA 4E1VA 1QQBA 3ESZA 1SUIA 2LVBA 3MT7A 3LY5A 1GLNA 2NSYA 4CG1A 4CXMA 1XBTA 1S8NA 2XF2A 3KOMA 1FU4A 4MVXA 1VL1A 4P7FA 4E7OA 5J4YA 4A0SA 3DE6X 3LY7A 3NBUA 4JQZA 4GLOA 4KTVE 1ULSA 1L4FA 4YUXA 3I9FA 5B58C 2IGTA 1T3TA 1LK0A 2IPMA 3CBQA 4XSHA 3V1KA 3OFKA 4G0OA 1TVMA 1Z3CA 1N2XA 3D5EA 3T15A 1SOAA 3QMMA 3R3JA 2RJ3A 2GAFA 1JG2A 4TZTA 1YB5A 2D4HA 5CDHA 1EGAA 2EARA 2V7TA 3N87A 2A57A 2XCRB 5B57C 4IZIA 4GM4A 1QK5A 5LJIA 3I2JA 1OTHA 5EKUA 4B0PA 3H2YA 1JB1A 3HKBA 4OSOA 4K9MA 4KX3A 5ALKA 2IZ5A 2Y6VA 3ZCTA 4LPSA 2POCA 2AJ8A 3AM4A 1PVVA 3GEEA 3AKZA 4OQ4A 1D9ZA 3P2JA 3SGLA 3TX6A 1L7EA 2R87A 3E81A 2R1VA 1J2YA 4Q12A 4D82A 3EUEA 3PQ4A 5CXXA 3C3XA 1DIHA 4I4NA 1IZ8A 4KUGA 2AG5A 5E6RA 1N0UA 4Q9LA 4YO7A 2B2CA 3EXAA 2CJYA 3D7KA 1T2NA 1MNQA 2HBRA 2PMBA 1C7ZA 1E4YA 1GNSA 2DKNA 3GJ0A 1V3QE 3JW8A 3R20A 5F4ZA 4DTCA 5ECDA 5FNZA 1ETUA 3T38A 4CIVA 3QM1A 2XOXA 4QHYA 4MQFA 2D5IA 4WESB 2OBFA 3SK0A 3UJHA 3OTQA 3AJAA 3K70C 2VQSA 1YRLA 3LC0A 1W6RA 4URZR 1YB1A 3ITDA 5THKA 4DR7B 3WGGA 4I3GA 1U5BB 2YRWA 4QGFA 1NKTA 1TZJA 2R3SA 4ZO6A 5LIRA 4MV6A 1ORIA 3IFSA 4NJMA 5HIMA 2BZGA 1S4QA 3G9QA 1TPYA 1MB3A 2O5EA 3AF3A 4Z0PA 2Q29A 3BD6A 2JH8A 4AZVA 3H05A 2EZUA 2FMTA 2YMPA 4PZLA 1ZD3A 4HTFB 2B20A 4NS4A 1Q6ZA 1Y8ZA 4L4YA 3VNUA 1VIAA 3KKNA 1ORVA 3IXMA 1KP3A 4RCZA 1KEKA 3K73O 2WD7A 9ATCA 5EE0A 3G1UA 4TZKA 3DZJA 3A4VA 1WETA 2AZ4A 1FRFS 1Y98A 3L49A 3TQIA 1XZBA 1QFJA 3A8TA 3AVPA 4EA7A 5IZCC 5K8JB 1CHNA 4MQ4A 5ECWA 2VDNB