4NYLB

Crystal structure of adalimumab fab fragment
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adalimumab FAB fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Adalimumab Light Chain
total genus 20
structure length 117
sequence length 117
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nylB00
1JHTA 2BERA 4WHDA 2B1HH 2HRPL 4FQQB 4PJFB 1Y0LB 3T0XA 1JPGB 1FZKA 5IFAL 4J1UA 1FVCA 3NCCB 4FQXD 3BH9B 4GAJL 3IFOA 3D18A 1PGRB 5DVKA 3GRWA 2HVJB 3WUWG 4DVRL 1QHPA 3LQAH 4ALAL 3OZ9L 4WFFE 2FECL 4ZG1A 3FT3A 5E00B 5CFHA 4FTVD 2NZ9C 1OGAA 4ZO9A 3DX7A 2Z8WC 4EZMA 3IT8D 1U93A 4X7SL 2UZIH 3LEXB 3RY6C 4XCCH 4YHNA 3DXAE 3WXWL 4HF5H 2VC2L 5EC2A 5I8CB 1I85A 2VXVH 3TT3L 3LPWA 2BSRA 4HX1B 1JTTA 4PRIE 4D8PA 1F6LL 2BMKB 1D5BB 4X4MA 2ZPKL 4UOW1 1UM5H 1YPZF 3SN6N 3VG9B 4LVEA 5IV2B 3VE0A 1YNLL 8FABA 5EU5B 5FM5O 3S5LG 3X12B 2HT2D 1MOEA 2VDQH 3S34H 3FQXB 3P0YH 5EUKA 3QQ4A 1KPVA 3VG9C 5ALCL 5E2WH 1MRFL 3LV3A 2J5LC 5GGTH 4X83A 5DUMH 4J12A 4LDEB 1OCWH 3DXAA 3G6DH 3VXOB 4F2MA 1MEXH 3P0VH 3UTTE 1OW0C 3ILPB 3ARTA 1TZIA 1FIGL 1V8HA 4NQCD 2J12B 2UWEA 5IHBA 2P45B 3RP1A 3WMSA 4UT6L 3DUSA 2Z9TA 3SPVB 4JKPL 5MHSD 1UVQB 1T1XB 2GTZB 1G7HB 2F53D 1Q9OA 2R29L 3U4EB 2Y6SD 5KVGL 3MJ9A 2J8UB 1T83A 3L95B 4XBGA 3G5YA 2ZG3A 3GMOA 4PJCA 1LO2H 2GSIA 2YS4A 5BV7C 2BY1A 1UWEH 3FB5A 5TGBA 3PWUB 1EEYA 2YK1L 2ED7A 4MZ3A 5DURB 5I71B 1R24B 2VLMD 4XMKH 3HNVL 3GK8L 3DROA 4NRYA 3EO9L 2BNRA 1BD2D 5E0QA 1HILA 3IS1X 1U58A 1HXMA 1A6VL 3U4BH 4QHLB 1RZJL 3MFFB 3FOLB 4Z7NE 5I8EA 1H5BA 5I73B 1JHLH 3T08A 1KJ2B 3EDEA 1BVLB 5IESL 2UVEA 1MJ7H 4OLZL 5F6HI 2DM7A 2GUOB 3HRZB 4BZ2H 3RX8A 2GEEA 1RFDH 4DZBA 2BHYA 3GUTB 1G0XA 3RX7A 2SEBA 5FHBL 2EDEA 1NDMA 3RGHA 1VSCA 1KLGB 2QHRH 2VDRL 1BZ7B 1TTGA 2J8UE 5CHNB 5GSRB 1A6ZB 3SJVA 3GSXA 5IFAH 1NAKL 4G8EB 5DVNA 4KI5D 1R3IH 2YRPA 4ZPVB 3LB6D 1G7IB 1PG7X 2F54D 1EIBA 2VLJE 4HZLB 3ZE2E 4YO0B 2H9GB 3BAEH 4OM0L 4BFIB 4FQCH 3D69B 1P4IH 2LU3A 2R4RH 4RZCB 4XNXH 3QZWB 3FO9A 4MCZB 5ERWA 1DN0B 4RMVA 2PF6A 4HXAL 1UACH 4OLXL 4XNYH 1AP2B 4O2FB 1HCFX 1FNEA 1H3PL 1MCFA 2HFEA 1MJ8L 2YD6A 3WNOA 2O5XL 4MDIB 3LOWA 5EU6E 3MLTA 3FO9B 1BQHB 4MCZA 4YXKH 3NIGF 3RU8H 1Y6NR 1QFHA 3UZEA 1SEBB 4Y5VC 4Y16D 1F6AA 3S36X 4U7KA 3KXFE 4K3DH 2ZSVB 3L3GA 1T7VA 3WS6C 4HW6A 5IR1B 1NC2D 1F3DJ 2J5LB 1RV6X 4NNYA 1EBPA 5B4MC 3L3DA 1BP3B 4JFDA 2X4TB 1T2XA 4Z76A 1U91A 3W82A 5IV2A 1LEGB 1XT5A 2XICA 2ADGA 3ARYA 3FN0L 3BJLA 3EYSL 4ZQKA 1LO3L 4OZGA 5J6GA 2BDNH 3OB8A 2B1HL 2BMKA 4LPXA 4FQJH 2GCYA 1FFQA 2B1AL 5DMGC 3SJVE 4M1GL 2OTPA 5JA8B 1R3JB 3BEVA 4RWYH 1LEIA 1TENA 5DJXB 5KJRH 5TDPB 2LE9A 5F7FA 5DUPL 4KRPD 2APVA 4OLVH 3RGVC 1PZ5B 4WTXA 4GRLB 4ENED 3U79A 3C8KB 2DQDH 4F7TB 3FB8A 1X5HA 4BFGA 3HPJB 1MHCA 3C60C 1SY6H 3FT4A 4HWEH 1KCVL 2DTMH 3V7MA 3MRFB 4JDVA 2EEAA 1Q9LB 1MH5A 4XRCB 1QBLH 1G7HA 4M9PA 4B5EA 1S9WA 5I66A 4NO2A 1XF5A 2A6DA 4X7SH 4R0LB 4JG1L 4NRXB 2UWEB 3QUYB 4L3ED 1E4XI 2HTKD 3STZB 3HI6H 4PJ7B 4U7MA 5I74C 4WO4C 3QPXL 1VPOL 4NM4L 1OLZA 4TN9A 1CFNA 2CLZA 1XGPB 4PRPA 4LCYB 5ANME 1DLHA 2ERJB 4QGTA 3BRFA 1ZSDA 4M7JH 4MJID 4ZODA 5H8DA 1YY8B 5K59F 1LEGA 5GGUB 1I9IH 4LLUB 1OL0A 1CZ8H 2A6IA 2VLRB 4EI6B 3VGHA 1U8PA 4MX7B 5C0BB 1U95A 3BI9X 3HS0A 5LCVH 5EZIL 2VRAA 2ZUYA 4NQUA 4PGCB 3NZ8B 4ETYA 3L3KA 3PGCB 1PVHA 3EYFB 4NIKB 3AS0A 4GMTH 5IT2H 3I84A 2DQEL 1HSAB 5A3IC 3VXMA 5B38G 3K2MC 1CE1L 3UYOD 5HYQB 4L4VB 4N8VG 3ZKQD 5LG1A 4LNVA 3NZHH 4I77H 5BJTA 1WFNA 3PWPA 5DTFA 1B4RA 4JB9H 3U30C 4QWWC 5ITFB 4JFEA 3I6LE 1NGZB 3HZYA 4WEBH 4YHNB 2PCPA 1OCWL 3G6DL 1JFQL 4NCC2 4XBGB 4LDOB 1MFCL 4JQVA 3MV9A 5CIPA 1U8LA 2JB6A 4BK4A 3WIHH 3GMRB 4O9HL 2GQHA 5FUOL 3GHBL 5I1CL 4Z0XA 3IETB 2J88L 5I1AA 2L0DA 5LAXB 5EZLB 3VRIB 3T4AA 3P0YL 2NW3B 3D39B 3PQYB 3V6FB 2Z4QA 3QO0A 4GS7C 1AHWC 1U8PB 4MX7A 2EC9U 1IILE 1TZHA 5E8EA 4DUVA 4JM2C 5A1AA 1Y0LA 1U8IA 3W9DA 2R9HD 3HZKB 5T3XE 3BSZH 1YEDA 1IARB 1FFOA 5CP3H 3OJMB 3BQUC 3GIZH 4G80B 4IRZL 3LKRB 2XN9D 5HYEA 3D5OF 5DRXA 2E7HA 4FHBD 4J2XA 3BGAA 3I2CH 3TWCL 4J3WA 5C0BD 2PTTB 5DJDA 5E24E 3ZE1E 4LVNB 4WHYG 3MYJA 4PJ8D 1ZVSB 4MJIB 1LO2L 3AU1A 1F11B 4NQXA 5I30H 3QDGB 5IF0B 4EVNA 2Z92B 5GGTA 4LARL 4QHKI 2VLLB 4BKLA 3IU3A 4POYA 4MA7H 2DL2A 1NCNA 4WW2F 3VFOB 3UPRA 1MFBH 5GS1B 2V2WB 1PKQB 3KPRD 1ZGLP 1OPGH 3D2UA 3W81A 1CGYA 1QFWH 3GMQA 1H0DA 4ZFOB 3BEVB 4FFYH 4WIQA 1P69B 3MV9D 4HGWA 5SWZE 1QVOA 4YXHL 3TZVB 1P7KB 5E8PB 3SGKA 4JFED 3X13A 1CDBA 1JPSL 1CICD 3BGMA 4NZRL 5E4EC 3PWPD 3QIBA 5D7JA 3GSWA 1MCRA 5LVEA 1NFDF 3ALPA 2FB4L 2EDLA 4M7JL 4DZ8B 3QA3A 5MEOA 1T2QH 1SBSH 3K2UH 4X8JB 3FN0H 3VCLA 4OI7A 2OTWB 1YEHL 4I18C 4YHYC 5L7XH 3O4OC 5IB3A 4MA8L 2IADA 3D25B 4LVHB 4YGVB 4EUPH 4KMTH 4M1DH 1I7RB 2YPLA 2X4SB 2VABB 4NZTH 1HWGB 1AR1C 1NDGB 4R90L 3T3PE 1IM9D 1F6FB 3OL2A 1KPUB 4U6XB 4KRNA 1K8DB 4BUHA 5B4MD 4PV9A 2DIBA 5EO9B 3ARPA 4XCFH 3MLXH 3AXLA 3FRUB 1DN0A 3ABZA 4Y4FA 5DXWA 1XR8B 4FG6D 4JFEE 1FVDA 2MPAH 2EICA 2BCKA 3S35X 3MLSH 4CJ1A 4LSDA 3FO0H 1P1ZA 4OCMC 1RJCA 4TSBH 5BW7C 2FGWL 1D7FA 3DECA 2BOCB 1I8KB 3KPRE 1XF3A 4Q7DA 3RI5K 5DSCA 4Q9RL 1XGTB 2EC9T 1HHGB 4JPKH 4ELKB 1KIQA 1NDMB 2OJEB 5C0AD 2HKHL 4TOYL 2QSVA 3X3GH 2BRQA 5E8NB 4P5KA 3AY4C 3I3DA 1TJGL 3GJFH 1EGJL 2ADFH 3UX9B 1U42A 3V0WH 2BVPA 2E6JA 4GXUM 2V17H 1EDQA 4ZSOA 5I73C 2PR4L 2BP3A 2IADB 4UV4L 4MAYB 4XB7A 4Z95H 3CVHA 3QAZC 4PBWD 4OLVL 2RFXB 5GS2D 1EHNA 2ED8A 1PZUB 2D3VA 1O7SA 3C87A 5GHWL 2HKFH 4H20H 4IRSD 2PYED 1GOGA 4ONOA 5FCSH 2GK0B 3N1QC 1K4CB 4Z6AT 4F58L 1F90H 1A21A 3HPLB 4L3CA 3KYOA 4G9FD 4PRBA 4PJIF 3CAFA 1YJDH 3VDBA 2ZOLB 4XP9L 2OQJA 2V9RA 1LO3H 4MQXC 4Z5RB 1FE8L 4KAQL 2AJXL 1QLRB 2VR4A 3KPQA 1A7NH 3GMLB 1DSFH 3KJ4C 4HKZB 3HR5A 4AY0A 1ZA3A 1G9NH 4OF7A 4JHAH 4KJPC 3GSRB 4M7ZB 3GI9H 1U8KA 3VXSE 1C5CH 4XPBH 1A4JB 5I1CH 1OARH 4DUXA 4MLIA 2DQCH 5HYSA 1EAPA 4PLOB 5ICYA 4L8CB 4UB0L 4GMSH 3I6GA 4LLQB 1XGRA 2YSSB 4NQXB 4ODSH 4KTYA 4JFEB 3FFCD 3AREB 4XNUH 2ZOKA 4OJFL 3CFCL 3ARFD 1PX4A 4OLWH 2AK1L 4PJXB 4C54A 5BRZB 3JWDH 1X44A 1UQSB 1CE1H 1HOCB 4MQSB 1V3LA 4G43B 3MRBB 1XCQB 4K7PY 4BJLA 5HI3D 5L2KA 3W9EB 3MBEC 4ZAKA 4UQ3B 1AC6A 4NZUL 4KVCL 1Y6KR 1FNGA 4OGXL 5BW7A 1FZJA 1UCTA 1WEJH 4D9QE 3WKML 4B7IA 1MFBL 1XCTB 3MRQB 1FN4A 3O0RH 2H1PL 4LLYB 1SQ2N 4R9HA 1NSNH 2YZ8A 4WI2A 5DRWA 2DM3A 4PJEE 4NT6B 2NY6D 2Z91B 1T89A 2BNRD 1YECL 4P5MA 5HYJB 1JNNH 1DL7H 3KLAA 2FATH 2ZSWB 3K80A 3U2SB 4JGMA 4KXZI 5F7WC 5IW6B 2R1WB 1OHQA 5D5MB 2YPLD 4LVOB 3C5ZD 1Q72H 1UB6A 3EFDH 4W6WB 1B2WL 4ENEC 3AY4A 3RPIB 1WZKA 1KC5H 3NZHL 4DAGL 4KTEH 2E7BA 1F97A 3V8OA 3QNXB 4XBPA 3CCHA 2DQHL 2DD8H 1U8NB 1HIMH 4UOW0 1H3VA 1I1FB 1PG7H 4RA3A 4X6CB 5IHLB 4M8QB 1N6UA 3HC0A 2CDFB 3MV8E 4L8SC 2OP4H 4LQ1A 1JNHB 1CICA 1FLRH 4AEIH 4ZS7H 4BQ8A 4U1NB 4F57L 2ZUXA 4MB5A 5C8JA 3L3HA 4XGZB 3VU2A 1NCWL 4QT5A 3PGFL 3T0EA 4PP2B 4PLJD 3TEUA 1CLZH 1D6EA 1AXIB 4BQBA 1WICA 4FG6C 3FQRA 5EWIL 5L7XL 4J3UA 2X89D 3TGXA 1OTTC 4I48B 4D0CA 4TULH 1JV5B 3BP7A 3O2DH 1CFSA 4NWTH 2VKWA 4M6NH 4PTUB 3IDYB 3QDJD 1KCRH 2Y23A 3FO0L 4PJ5D 2W38A 1AQKL 1WGOA 4KQ4H 1WFOA 3F58L 1FNHA 1X7QA 4KWUA 4RFNB 4W68A 5FKPA 2VXQL 1A7QH 5CINL 3QUYA 3BPOC 3KXFD 1LE5A 1K4CA 4N1EA 2HG5A 1I7UB 2WMPA 1JGVH 4M43L 1VHPA 1EZVX 4GAJH 2B8OT 1U6AH 2YPKA 1LD9B 4JDTH 3DROB 2VLRD 1T3FB 3O8XD 1GHFL 3WSQL 4WFGD 2EIDA 1F45A 1HH9A 1GGTA 4LHUA 5CEZL 1D6VL 1EX0A 1U3ZA 2NY1B 4JGUA 3X11B 1F02I 1UKTA 1JZ6A 1U8MA 1K85A 3PJSB 2HFGL 5D71L 2WBKA 3G5ZA 3ZHKA 4RAUA 3GHEL 4TUJA 1MY5A 1X5GA 1KB5B 1A3LH 4NC0B 3RKDD 5AG9A 1R3JA 3MRPB 1MCQA 1VADB 4LLQA 4UZGA 3BEWA 4GFTB 4IJ3B 2O5YH 5JW4N 1MFEH 3GSWB 1CDCA 4ONGL 1QSEE 4TVPD 1XF3B 4UUJA 1CIUA 1MFDL 2HT3D 4HS6A 4XBEH 2R39A 4P2QB 3JV4A 5FA3A 5GGRB 1UH4A 4BZ1H 1QRNA 2XV6B 2VZVA 3O11B 2P5WB 1WJ3A 5I1KH 4MA1C 4RGNC 3D2UB 1MHEB 1G6RL 5TQ2H 5IB2B 2D0HA 4TRPH 4HUVA 2A77L 1GAFH 2ZUQC 3HTLX 4JVUA 2WBJD 5CEZD 5KS9E 4L9LA 5KN5B 2HT2C 1T0NA 1DN2A 4PRHB 3ZE0E 2DQGL 3DO3A 4CADA 1N2RA 4LEXL 3RWFB 1ADQL 1BQHA 3JWDL 2P5EB 1CICC 1FQ9C 1AC0A 1HXYA 3GBMH 2B4CL 4XNUL 1KFAH 4JPVH 4AT6B 2W9EH 1PX3A 2FHBA 4N0CC 1B90A 1EEYB 3F7VA 1CXIA 2HG5B 3ULVC 4NNPL 4Y16C 4ZOAA 1F4YH 1CYGA 3EO1B 1J1XL 4YBLB 2NMSA 5DJ2B 4X4ME 3DX6A 2J8UA 3MC0A 4XPFH 5CD5C 5B3NA 4ZO6A 1JWMB 3VA2C 1IAIL 2DM4A 4KKBD 3QUKB 4H0HB 4OT1L 3MUJA 3LQMA 3WFHA 2NNAB 2VDNH 3UTTD 1C5CL 4XPBL 4M3JA 1UYWL 3O4LD 4JO3L 4BSWA 2DMBA 4L8BA 2OSLA 4J4PD 3KNBA 4QRSB 3BRGC 1ZGLB 2IPKA 4X4YA 2G75A 2Q3AA 3VXRD 3QXVA 2VXSL 1AD0B 3KGRA 3BZDA 4YDKH 2GUOA 4M8VA 1RVFL 4JFFD 4K55A 3CFCH 1G7PB 4QRTA 1ZLSH 3SDCD 4OZIE 1X5AA 2VXVL 3CVHH 4L8SA 1DR9A 5JDSB 4C58B 4ODSL 5IJKA 1UWXK 3EO9H 1OAUL 4C56B 4HLZG 4M5YH 4ODUA 4PJAB 1BOGA 2FATL 4OCLC 1KIPA 1SJVA 2QL1A 1YDPA 1JWSA 2IAND 4JGJA 2NY5C 2XG4A 3CXDH 3LDBC 5CSZB 4Q0XL 3WNPA 3X3FL 4JY5L 2P5WE 3ROOA 5FGCB 1RD6A 4L9DA 4JJ5A 2JB5H 2OTWA 3LHPH 3MJ7B 3MODL 2HVKA 3H0TA 1GVIA 4U6YB 5DRWB 1NMAL 5E4IA 1FL3B 2BNRE 4DZ8A 1EHXA 2XZQL 4ORGA 5EG6C 3SDXE 5FM4A 3TVMC 1K4DB 2D9QB 2IPKB 4ODTL 2WQRA 5GGQL 1I1YA 4CW1A 4OLEA 4QRQA 3WCYA 1NC2A 3LVEA 5KSUB 3JWOC 4S1RL 3BP5A 5FKAB 1WBYB 4DW2H 1MFDH 3VD7A 3S7GA 4F7PA 5JMOC 2RAMA 1FVCB 3C5SA 3BVNA 5T5NG 5I1IH 1YN7A 2LFGA 5C7XL 3HNVH 5DJ2A 3NIDE 1FL3A 3FQUB 4A2MA 3C6SB 4YGAB 1EERB 2EYRB 2R2BA 2AAVA 4WY7L 2HYMA 1SYSA 1OAQH 1DBJH 3VA6A 4PFEA 5HY9B 2ARJB 3N85H 4PPTA 3IFLL 3ZE1F 2ARJQ 4Z7UA 1I7TB 2J4WL 1DE4B 2PYEB 3T2OA 5ICYB 2VO5A 3OJDA 3S5LB 5E2UL 3ZYOA 3D85A 5F9OH 4HFWA 1FYTB 4JN2B 4E0RB 1GOFA 2ZP0T 4J8RB 1I1AA 3DYMA 5IGXH 4PJFF 4ZAKD 3RA7H 5DJYB 3FQWB 2OS7A 2WAHA 4N0RA 4PBXA 4Z7UB 4Y1AB 5EO1A 1BVZA 4F8QA 1BQLL 1A6AB 4LKCB 4PV8A 4AEFA 3ZDYF 4HUMB 4ZS7L 3VWKD 1U6AL 1QKZL 1IEBB 1A1OB 1X5ZA 2AEWA 2L4OA 4OV6F 4Z18A 5JIHA 5IHZA 5L6YH 1W2KT 4EBQL 2PYEE 5IR1A 2BSSA 2Y5EA 4AENB 1U8MB 1DCLA 5HHXL 2EDHA 1KCVH 5HYJE 3WKNA 3RFZC 1NFDB 1A7OH 1OY3B 3PHOA 2IC2A 5ESVA 3G6JF 4UIKL 3MBEA 3VGAB 5ACLA 4R4BB 3RY4A 1J0ZA 4NM4H 1Q8MA 3LPFA 2F53A 2C9AA 4B0MM 4TVSa 2WWMC 3U46B 3SO3B 1KLFA 3L9RB 4UNTA 3UJIL 3HI5L 2X4RB 3SDYL 1RZKC 4PJDA 5GGSA 3T1FA 4ONHB 4H8WL 2AGJL 1RUAH 3A6BH 3FOMB 5JQ6L 3JTTA 4K8RH 3C5JB 5JUEL 4LMQI 5DUBB 4Y4HA 4ZOEA 4HWEL 5EORL 5EO1B 2W9DL 4MAUL 5IIEB 1A5FH 3LKPB 2PXYD 4G8EA 1MHEA 3TCLA 3LHPL 4YBQC 2QADB 2AXJA 1FVEA 1BZ7A 2XPGA 1LO4H 2IQAA 4HV8B 4Y1AD 4N0FB 1OQXA 2R2HB 2LTQC 1JP5A 1RPQA 2E5EA 4H0GA 4ZAKB 2DLTA 2YEZB 3BKJH 4KVNH 3KYNA 5DUBA 2XKSA 5KS9A 5SWSD 3HI1A 1GZQA 1OAUH 4PG9B 2FD6H 3QPQC 1DBBL 3IF1A 3O9WC 1YEJL 5TDNB 3KLSA 1X5LA 1RZFH 4TSCH 1WWCA 3EOBB 4WW2A 2G75B 4RA0C 1MH5B 1WVZA 2PW1A 3ARBB 3H9HB 2W60A 4WUUE 1CFVL 4TPRH 1NGQL 4MJ5A 4JY5H 3Q5OA 1AFVL 1LK3H 3EBAA 4KJWD 3GZKA 3OHXA 2RJMA 3BN3B 3PNWB 5CD5D 5A16A 1P7QA 2VXSH 3QFDA 4HK0B 3S6CA 2R0WL 3W0WB 3L7EA 4Z7WA 3FAWA 5D7IF 1MWAA 1S78C 2G2RB 1V7NL 3L5XL 1AR2A 1P84J 5F7HA 4BFEA 1V3JA 1CCZA 1M7IA 2PKDA 4XNZB 2CUMA 3WIIL 1MWAH 3KLDA 1KJ3H 3GSUB 2VXUL 4FZEL 3D48R 4CMHC 3M17A 2P44B 2NXYD 3ME0A 4KGJA 4R26L 5IEHB 3BKYL 4FQ1H 4MNQA 7FABH 1TVBB 1QSFA 1EK3A 5FO7B 4HULB 3MQIA 5CS7A 3RDTC 1JL8A 4X5XA 1KG0A 2IAMA 3BUYA 2Z92A 3ULVF 3HRZA 4LPVA 5A2LH 5IVNA 1KTDA 1ZV5A 1CDJA 3KPNB 4MQTB 2ESVD 1B0GB 5HGGS 3QUXC 4I2XE 5EUKB 5FV1L 1D5XA 4Y2DA 1AQDA 2IBBA 1I3GL 2J7LA 4Z78B 4K23H 5ANMB 3QULA 3F7QA 1TJIL 3OR7B 2FJFA 4MA7L 2E9BA 4YDIL 3QCUH 4ZUWA 4CL7A 1FYTA 2HFFB 3RGVA 2J8OA 2H2PC 3C60D 1L6XA 1FGVL 1DVFB 2CQVA 5F1OB 2X4PA 4U1LA 4KROD 4YX2H 2XZZA 2YD9A 1NEZG 4JZNB 4D9LL 4P57A 4OD3L 1KLUB 1EEZA 5B22A 2EIBA 3BKMH 2JTDA 3KPNA 5DS8B 5E99L 1HSBA 1QACA 3L95A 5FDYA 3IDGB 5KANG 4LVNC 2ZCKH 3RIAF 2VDKH 3VXRA 4PJ7F 2R2EA 4HEPG 3UTZB 3D2UD 3ESVF 3R8BB 2XNAA 5KBNC 4Y4KB 4K3EL 2V5TA 4NCDA 3RWGB 1JK8A 1N0XH 6CGTA 1IFHH 5DQJA 4HKZA 3VD4A 2F74B 5BQ7A 4LCIL 4GKSB 4X6DB 4XCEA 5DK0B 5I2IA 1KJ2H 1LP9E 1OOAA 3MODH 1RUKH 5F97E 4JVWA 1JK8B 4CJ0A 1XFPA 2G2RA 3VMPA 4RGND 3O41A 3QHFL 2HLAB 2QTEA 5IQ7H 2HTLC 3BDBA 2BVQA 4NFDA 3HB3D 5E70A 1KXVC 1MUJA 2HKHH 4PJXE 1WCQA 4U49A 1M71A 5SV4A 3BP4A 5DMYA 4WNQB 4UDTB 4WV1A 5KSBE 4QOKD 4YHPA 4WFGE 3FQXA 4OQ1A 4C83A 2VLRE 5C3TA 2YKLH 4TSAH 1DQDH 1CS6A 3JV0A 4Y5YA 4E41B 2PTVA 5C9JB 3RZCB 1UCBH 5H35A 4YH6A 5ESQA 3QWQB 2PW2A 3FZUD 4I3SH 3WD5H 2FB4H 4FQLL 2P5ED 2E6PA 4YR6A 3OKDA 4HX1A 4I5BA 4XZUB 5KAQF 4NN7B 1WFUA 4N5EC 3ZDXF 3UTSE 1XGTA 3HC4H 4F37F 3MMEB 3CLEH 1Q9WA 4WJ5A 3ZMRA 1DUYB 1AO7D 1Q9OB 3CSYB 5J4MA 4QRPA 4K94H 4MJIE 3O3BA 5I1GH 2MQCA 4M1DL 5F96H 1TQCC 4ZS6D 3S97C 2AXGA 5E7FA 1G9NL 3C2AH 1BJ8A 4QHUA 4WTZG 2A6DB 4Z9KB 2I26N 4U1GB 4HPYL 4XPGH 1JPTH 1NL0L 3RIFF 2UZIL 4L3EE 4MQ7B 3SGKC 3G5ZB 4ZOBA 1ROWA 2X4QB 3PQYE 3A6OA 5EULV 5GXBB 3HPLA 4FABL 1OGAE 3ZZ1A 3QFDB 2UUDH 2YRZA 2GK0A 2NZ9D 4NP4L 5KSBA 4XMLL 4DVRH 1J18A 5HYJA 1UZ6F 1CFTA 1MIML 4MNQB 3DI3B 3N1FC 4HUXB 1WAAF 5IQ9A 1DANT 3DVNB 5DGRA 4XB8A 1SY6A 3HE6C 1FCGA 43C9A 1VACB 3MRRB 4LF3B 4J3VA 5AZ2H 5IWLC 1KB5L 4ERSH 5DI8B 3OB0K 1B0WA 3UPAA 5HI5D 1NC4D 5H37H 1E4JA 4KKLD 1ZXQA 2EDOA 2VQUA 3ARWA 5E5MA 2R2HA 1U8IB 4D9QD 1CGXA 4G9DB 1S3KL 1BBDH 1YEIL 1P4LB 5DJCB 4N1HB 4AMKL 4OLWL 3ROLA 4YUEH 3RZCD 5D1QA 1YEHH 1JMZA 2BX5A 3WBDA 1VFOA 4NM8H 3UTSD 4NJ9H 4DN3L 4JRYE 4P9ML 1EO8L 3B2VL 3SQBA 1T0MA 3PWNB 3IFOB 2B7DT 1M7XA 2ZWLT 3EZJB 1D5ZA 3OKLB 2X9WA 2IPTH 1OARL 4P49A 3V95A 1RIHH 3BZFB 5I16B 1RZGB 3KHOA 2VZ1A 2MOVA 4YHOH 1F2QA 1OTUD 4BQCA 2R69L 5KVGH 2D7QA 3PJSA 1NPUA 2YXFA 5DMJB 2OLDA 4M4PA 4QHKJ 2QSCL 3QWRA 1WTLA 5KSAD 3T0EE 1QHOA 5IW6A 4QXUH 4HWBA 3TPUB 3RVUC 1DEEB 5DMIH 4P5MB 4RGNE 4I3SL 5CZKA 5HYSG 2I9LA 4L3EB 4WCYH 1YEJH 3ULUL 5IW1B 3QR2A 3TBVA 5D1ZA 3Q1SH 1YJDL 4X7EC 1KXQE 4KI5E 1DEEA 2HJKB 1GSMA 1IEAA 1UEMA 2VYRE 3QG7H 2IG2H 3LN4B 3NACH 3T3ME 3ZLQC 3TNNA 3WHXB 3V0WL 3QEHB 2R8SL 5T5FH 1YQ2A 3P3YA 4XXCA 1FH5L 1I1AB 2DQIH 4Y4KD 1KJMB 1EVTC 1GRWA 3U0WL 3V6BR 4XT1C 5IB4A 5DD6B 4HWZA 1UWEL 3T0EB 3PWLB 4QRUB 2OZ4H 2CRMA 4MD5B 1NGZA 4PY7A 4GBXD 5EPMA 5J9PA 4JQIL 2AK4D 1FAIH 35C8L 3J8F7 1B88A 4DTGH 1XZ0B 2AXGB 3MV7A 1RMFH 1CLOL 2JLLA 4GUPB 4Q9BA 2OJZL 2VLME 3DGGB 2GTWB 4G6AC 2ZG1A 5F89B 2HFGH 5D71H 5TJWK 5B8CB 2Q86A 5EU3A 2ESVE 4ZFOL 1NLBH 1IGTB 3RUGB 4OCXL 3LKNA 3PL6A 2YK1H 2FWOA 5DRXB 4Z78A 1CLYL 4G6ML 4D3CL 5JORA 4MHHG 1ZT4A 3KPSE 5MHSE 5HPMB 4Y7MA 5D5MA 5FYLE 3GBNH 1DQMH 3UJTL 1RAMA 2VDMH 5HSFA 4M1GH 4NQCE 2EZ0D 1F4HA 3MV8A 3KLAB 4OZIB 1I9JH 1OTSD 2X4NB 1IM3B 3DTXA 1KENH 3VXME 1A7QL 5CINH 1X4XA 5HY9A 5FCUL 2JJTA 2D0GA 1U91B 1ZKAA 4C56E 5DI8A 2AV1B 1JGDA 1KCRL 4FXKA 5D2LE 2N7BA 4OZGE 4ZFZB 2MKLC 2ZUSA 5FUZH 5DFVC 2Z31B 4G6JL 1HIML 3FB7B 5INCA 1FBIH 2ESVB 4U7SA 4L4TE 4IMLA 4ESKA 2IH1A 4L4TA 4QOKA 3RY5A 3C5SB 2A6JB 5I8OH 3QWOB 1WTGT 3SKNB 1QP1A 3BDYL 4JY6B 3V5DA 1EO7A 1U2HA 5B39A 1YDPB 4O2EA 1MCOH 3MA7A 5JIPA 3K1DA 5E5UB 2VIRB 4P46D 3WE6A 3KPSB 5C0DB 1T0NB 4P99A 3LZFH 5DYOA 1JF6A 4JPVL 3QT2A 1PZ5A 4IRJA 5DD1H 2X4QA 2OJEA 1QEWA 5JOFA 5D1ZC 4X6EB 3EJZC 3DXAD 3GMNB 2DJUA 2OR8A 1T6WA 4RFNC 4K3DL 1NBYA 1IAII 3MV9E 4KHTL 1MCJA 4KUZH 5D1QD 1CD0A 5T3XL 1AKJD 5BZWA 1BEYH 4WFFD 1ED3B 3L3OA 5D1XD 2F15A 2GW5A 2XWBB 1U36A 1YPZA 3ZKNC 1B2WH 1XH3B 4UOJA 4Z7VB 1HI6A 5CBEA 3GRWH 3AXLB 4POZD 1MJUH 4XVTH 3SQOH 3IDJB 4L1DA 1VGKB 4EDXB 5ESQB 5ESAA 4LLVB 1CWVA 3RGVD 5LGHH 1RJLB 3H42H 1FNSH 4KPHH 4O5LL 4X6CF 3ULVD 4Y19A 5D72H 4PJIE 3FOMA 5EC1A 4JZJA 2IH3B 4P23A 4M7LL 2BOBB 2BNRB 5HYJD 3O6MH 4X4YB 1L7TL 3ZO0A 1JN6B 2WM0A 1E4KC 4X8XA 1JJUA 3GSUA 3CXDL 5T3XD 1MHPL 1JPST 5F9DC 1BGXH 1CG9B 3LKQB 4G5ZL 5AYQA 2QSCH 3EFFB 1MLBB 1T7YA 4OFYA 3JV5A 5KZCB 5EZJA 5IOPB 5BVPH 3WUZA 5TDPA 1BFSA 1WT5C 4MLSA 4KROB 3MLYH 4YFDB 2PCPB 2Q20A 2Q3ZA 1K6QL 4HLJA 5D7LA 1Q1JL 2W9EL 2Q7YB 4HS3A 3T2PA 1MAMH 4PRAB 2XWBA 3TT1H 1LP9F 5JIIA 1FCCA 3DGCR 1KLGA 2ICWI 5ICXB 4JFFB 4GXVL 1L4IA 3S98A 5C0CD 5FHAL 5FYJH 4WDIA 4X4XB 2MNUA 1NCDH 3I6LD 3AUVA 1RZJC 1BFOA 3Q6FB 1F3JA 4KV5E 1NBYB 5IK3A 3WLBA 4OCSL 4FFZL 3RRQA 1EEZB 25C8L 2CIIA 3TIEA 2QR0A 4EN3B 3KJ6H 3NVQA 1FYTE 1D5IL 2ZCHL 4JO4L 3O81A 4HPOH 3ECBA 4CGTA 4HWNA 4NC2B 3WUWB 1RIHL 3I02B 3ZKSD 4OT1H 5EO9A 4KI5F 5C0BA 2GJZB 1ZVYA 3G04B 5IT2L 1XH3A 5I75B 1T7WA 4ZSOE 5B38B 2YA2A 5FEBA 2QKIA 1UKSA 5AZ2L 3FB5B 5TPWH 3TJHD 3U48A 1FO0L 2EDXA 3V5HB 1VEMA 4LSSL 1J1PL 2R1WA 5E2UH 1JZ8A 2B39A 4MXQC 3THMH 4P5TB 3TWCH 3P9WB 3U7WH 1TVHA 3FB7A 1KG0B 4X5XB 3W9DB 4PRHE 4HIEB 4LSQH 4D2NA 4Y4HD 1AGCA 2BVQB 4TYUA 5HDOA 4TQEH 3WN5C 4ZTOH 2YUWA 3ZDZE 2GT9A 4YLQT 2CJUL 1W0WA 4EDWH 4D0BA 2B20A 5HHOA 5SWSB 4DUWA 2ATPA 4X98B 2JB5L 1RI8A 3IDNA 2OL3H 1WWAX 5CHNA 5HI5C 1HKFA 1H3GA 4RBPK 2P5WD 3X3FH 4QXWA 4QT5B 1JPGA 3VMOA 1C1EH 3NACL 3JBG7 2NXZB 3KPOA 2VSDA 4YIQB 3MJ7A 4L9LC 1WC7A 2LU4A 5E2TL 3ARBA 3HN3A 3TO2A 3QFJA 4I13B 1A6UL 4LPCA 4PGEA 3UJJH 4LSRL 1M1SA 3MLXL 4TVPL 4O02H 3EDKA 1RMFL 1KV3A 3KDMB 3OR6A 4P4KD 4WHTB 4LPTA 5EIIB 4X99B 1P84K 1T66D 5BO1L 4JFFE 3CSGA 1FBIL 3K8LA 3RL1B 1A6PA 4NKIL 5EUOA 1ZLUH 5F1IB 4NUGH 3WEXB 3UC0L 4ZUSA 3ARUA 3C09B 5EOTA 3C6LD 3TESA 5ID0B 2CIKB 4ZXBC 3SDAA 1KSRA 2FX8H 3ZSSA 1R0AL 4LCCB 1RZKH 5DFTA 2P8PB 4U1SB 1I9JL 1BVKA 3V5KB 5C7XH 5JOFB 2C4XA 2A83B 3GI8H 3QNXA 4LHJB 3O4LB 5CD3A 1IGFH 3EYVB 4MD0A 1NUDA 1IAKA 3LKOB 2NY4C 1CLYH 4HJ0D 4I3RL 5J1AA 5T33L 1HNFA 2R23A 2EYTA 3MRHA 4BSVB 1E4KA 2C3VB 3LV3B 3ELAT 5CWSA 2E27H 4QOKE 2H6PB 1KGCE 2FZ3B 1RZIB 3W11D 2BFVH 2EYTB 3F6LA 5EIQA 1HEZA 4H20L 1NCTA 1IEBA 2W92A 3ARED 1QSEB 4AH2B 4TTDC 2GAZB 5CEZE 3MRQA 5IHZB 4CAGA 1AXTL 1ZHNA 4P2OC 2ITDB 3ARGD 5E6YA 3BQUD 1WITA 3D1MC 4QHNA 4LEOB 4QXTB 5GGVL 3VMNA 4KKAC 4BH7A 3HI1B 2HVKB 3H0TB 2MHAA 2VLJB 3L1OH 1ZT1A 3TVMA 1TJGH 1F90L 3CZFB 5LGHL 4NKMB 1EJ6A 1NGWA 2Q1EA 2EYSB 4H8WH 2VMFA 1K3ZA 3EO0A 5DJAA 3KYKH 5TH2B 4LBEB 1T1WB 3HHRB 1A8JH 3DSNA 4YFLI 5EN2A 2CGRH 4JAMB 3QHZL 4TVPE 3QDMA 1L9MA 3H42L 1S9VB 3A6CL 4GW1B 4LASH 3WJLA 5SX5H 4KVNL 2V17L 1RU9L 4DCQB 4TSBL 1HHIB 4EQ3A 5DDHB 4Z8FH 4DGVL 1KPUA 2HJFB 2RBLA 4U6XA 5JXAH 1BD2E 1FJ1A 4HUWB 4GG8B 3IGAA 3MRDB 5K9OB 1I7TA 4ONHA 4EBQH 1FNFA 3BJ91 4XMKL 5HGDB 4ZYKB 5D7KD 3CC5A 3GI9L 3BXNA 3VG0L 3C6SA 1BZ9B 3G5VB 1KGCD 1AGBB 3PG2A 5LQBH 5EORH 4Q9RH 4NCC1 4OF0A 5IHUH 1NJ9A 3DVFA 4U1MA 3TO4B 5FV2A 3OKEB 1T1YB 2BC4B 1U8HB 3KPLA 4HKJB 1A3QA 3ARFC 1ZEAH 4UT6H 2H41A 1T22B 4HFUH 3FL7A 3TT1L 3DX8B 2CH8A 5I1EL 1K4DA 5E5RB 3NAAH 3P0VL 3MRHB 3MLZL 4NJAL 1CGWA 1MWAL 1IQDB 2I60H 1GL4B 3MUY1 1EVUA 3QUZB 5FGBA 1A1OA 5SV3A 4RGOL 3V0VB 2PN5A 4M7KH 5BVJA 1MCNA 5E8OB 3E8UH 1Q9KA 3VFGH 4NQSB 1N5AA 3DRTB 3KR3H 3V2AR 4KK6D 2ZPKH 3AS2A 4JM2B 1RZKL 4PYGA 4QXGL 5H37G 2DL9A 5CSGA 4LAQL 3KWWB 4PJAE 3OV6A 1T4KA 2V6HA 4JVPA 2W59A 5DVMA 3KPMB 4IDLA 3QEUA 3G04A 4ZUSB 4Y4FB 1VGEL 3WL9A 5E9DE 1IGJB 4EI5C 3H7BA 5HHQA 3MCLH 4CNIB 3S9DB 2LAGB 5IFJB 1B9ZA 1MJ8H 1F5WA 1NFIA 2WBJA 3GSQB 4G7YL 1QFOA 3DX7B 5GRYA 4MGXA 1RZ8B 3QDHA 3H3KA 3UTQA 4X4XA 4JFPA 5C0EB 1P9MA 1A6UH 3BYTA 4X5WB 1WBZA 2MCG1 1TZGL 4KKCC 3B9VA 4TNVK 1XGYL 4RDQF 3BPCA 2CKBL 1U92A 3RVVD 4FTVE 1ORSA 1NBQA 4WNQA 3BP4B 5E6IB 1Y6MR 3M8OH 3QUYC 1NAKH 1B0RB 1RJYA 4KTEL 4I5BB 4L29B 2VIRA 4YWGH 2V2TB 2EIZB 2F19L 4HZLA 4W4OC 2DYPB 3WNLA 2AJSL 3VGEA 4NQEB 3SKNA 1G6RA 1WUNT 2DN7A 2DI9A 3RI5F 5MEQB 4FQ2L 3SEPA 4WWKC 4W6YB 4FFZH 5I74B 1NMBL 3QEQA 5GS1C 3D0VA 4O4YL 5DA4A 1LDSA 2CO7B 3L5HA 2UY6A 4NWTL 2NZIA 1A6WH 5IVXE 2SEBB 3PP3K 2OCFD 2AK1H 1U8OA 3UBXI 1X4ZA 3L7FA 4PRIA 3TNMA 3ULUD 5D70H 3KLHC 5A2IH 3AM8A 3BPOB 4OFIA 5EU4B 5C70A 2RCSL 3MTRA 2Y4SA 3NN8A 3DPBA 1ZVSA 3QUXA 2HN7B 1OTUC 4GW1A 3HZVA 4YX2L 3W11C 3CXHK 3BRDA 4JCMA 1FLRL 3DNKA 4QHUB 4AEIL 4DGYH 4YHKL 4PS4L 3MV11 3P40A 5CJXC 3NZ8A 5HGAA 1M6OB 4I2XB 4PGBB 3PWUA 1PKQA 4N0UE 1Z5LA 4NSKB 1B0GA 2ICCA 2XXCB 2NY1D 3T77B 1ES0B 1YNTB 5B3JE 2VNCA 2IAMB 4J4PA 2EDDA 1QQDB 2UV3A 3ARSA 2FO4B 5CEXA 5IP4A 2AJZB 4DFIA 4MAYD 4LSRH 1KYOJ 1RY7B 4KJYA 3F8UB 4CU8A 4NJAH 4NN6B 4U1MB 3TO4A 2VXTL 5I6XC 1ZT7A 1QLEH 5EWIH 1RURL 3LEVH 1QLRA 1EH9A 2W1NA 2UY7A 5DD6A 2FZ3A 4BA8A 3ULUE 4Y2OA 3RKPA 3WFCH 2APXA 4JLRB 1JCKA 4GQ9H 4Y5YB 1D5MA 2FX8L 5D7SH 4ORZC 2YZ1A 2Y1VA 2CKBA 1KB5H 1I3UA 2UYLB 3HMWH 1G6RH 4WI3A 2D31B 4OUUB 4ONFL 1KTLB 4OI9A 3FN9A 4P5TC 4J3XA 3FO2A 4PP1D 5I1JL 3QI9A 1T0PB 4ERSL 2EEDA 1LEIB 2IJ0C 3GM8A 5FYLL 4Q9QH 4WTZA 5BQ7B 1LO5B 4O9HH 3B8SA 4WWKD 1X7QB 3O6LL 1ZA6B 4GKNB 3L1OL 5LGKA 3GBML 4LLVA 1CT8B 1LEKB 3LY6A 5GRUH 1NBZA 3OXRB 5BZDA 4XP4L 3VXRB 4RWYL 5B38A 4E5XA 1MCCA 3EJJX 5JPNB 4L5FL 3KXFB 2BNQA 1BFVL 4N8VA 4R6UA 1KJVA 3EYQD 3UZQA 4P46B 5DWUL 3QXTA 3MYZA 2IANE 2Y72A 2A6KA 1CE6B 3OXSA 3L6FB 2QBWA 4C59B 1RZ8A 5D2NC 4YEEA 3STZA 1MAJA 5HHPA 2XT1B 1RUQL 3V6ZB 2AK4A 4NBYB 5E9DD 3EOAA 1KB5A 3CDCA 5GGSB 1CE6A 3OXSB 3PHSA 3JV6A 4E9LA 1R3KA 4ODVL 2CKNA 2YD4A 5HVFB 1H9VA 3W0WE 2XZAH 5D1QB 5JTWA 5DYOB 2VLRA 1YEKH 4HIXL 4QGYA 4XMPL 4G9DA 1IC5H 3MR9A 3KPTA 2BVTA 4OD1L 4S1QL 2IH1B 4QOKB 4LLAA 2ID5A 5F88B 3B5HA 3HI6L 3BIBX 4UMGA 2ZG2A 1S3KH 1FN4B 1YEIH 2D4DA 2DQJL 1G7IA 1A2YB 3BP6B 5IMKB 3B5TA 1CGUA 3M45A 2CDGB 4LPWA 5DK2A 2VDNL 4X8JA 3SGDI 3KR3L 3GSNA 3QDMD 2KPNA 2DAVA 5HVHB 1INDL 1V3MA 5FYLD 1OGTA 5IHUL 1C12A 4JDVB 4IDJL 1GGCL 4JM4L 5EIIA 3SE4A 3CNKA 2VN7A 1MCPL 2I60L 3PP4H 4D0CB 2VZUA 5D6CB 4JY4A 2IPTL 5D9SB 5HVHC 3VFTA 4PY8J 1OSPH 4U0QB 3DV4B 2FO1A 4G42A 5I30L 1GIGH 2X70A 3GMQB 4OLYL 2P46B 4ZFOA 4G6AD 5GIRA 1MCBA 1CQKA 2XFXB 5C8JB 4YXHH 4K2UH 3MO1A 1YPZB 3RVXD 3WLBB 5GGQH 4PGZA 3FMGL 4UAOC 5C0BE 3NCEB 4U1KA 2D03L 4ZXBA 5D5MF 2A6KB 1LVEA 3V52L 2LU7A 1EV2E 3CUPA 4UBDC 3CVIH 3B3IB 4N90D 1LDPH 5SWQA 1YC7A 3QAZB 4HS3B 4WY7H 3VXPA 4ZTPL 4LVOC 4K3HA 2A0LC 2W9LA 4DFHA 4HH8A 1LP9B 5D8JL 2AJYL 5J8OA 1IGML 3MUGA 3U6RB 1YN7B 4JM2F 5IKCA 4OGAD 4UIMB 3NIGE 1N59A 3BWAB 2VAJA 4PB0L 5ETUA 5L2JB 4WU7B 1V7ML 1IM9A 3EYUH 3MJGX 2X1OA 1FNEB 2Z31D 2GFBB 4S1SL 3MNVB 5I19H 2GJZA 3WN5A 4NZRH 3GB7B 4WW2C 4E41E 2FR4A 2J6EL 1J88A 1XGQB 2OBGA 3T4AB 5JXEA 3NH7L 1OAYL 1P6FA 4FA8A 4KHTH 5AD0A 8CGTA 4LSVH 5EUOF 2MSPA 4HKBB 2YD2A 1J8HA 4GQ9L 5FYJD 3MFFA 4QXUL 3ARFA 5I1LA 4FN0A 4GO6B 2YRLA 5FFLA 1WBYA 2J88H 4XC3L 1AD9A 2HJLA 2OTUA 1CBVH 3ARBD 3L3IB 3BGFC 1G6VK 2OR9H 1OWWA 2XNAB 1ED3A 2FEEI 5HGBB 3QDJE 4Z7VF 1Q0XL 3EW3B 3WDHA 1HHJB 2WINA 3PDDA 4EN3D 4QRPD 5CEYB 2L7UA 4JFYA 4L8CA 3QUZD 1EAPB 1G7PA 4QRTB 2I5YH 4OI8A 2X44D 5CZXC 4IRSC 4X6BA 4Z7WE 1RUPL 3P4OA 5D5ME 5C0EA 1G9MC 4S1RH 3M1BB 4HF5L 2R56L 3R0NA 1HXMB 2DM2A 5F1IA 3QRGH 1NAMB 4KMLB 3GNMH 3VGBA 2F58L 3QULB 4PY7B 1FPTH 3X17A 5JOEA 1Y18B 3LQAL 2R0ZH 2XA8L 1KUMA 5DWUH 5L8JB 3G6JB 4K8RL 4OCYH 3CLFL 2A9ML 1G9NC 2DLEA 2X9XA 4XCCL 1IVLA 3DMMA 1EUUA 4A2LA 4XP9H 5GRXG 3RQ3A 4NFBA 4NPYA 4F15B 1E6JH 4XTRC 5T1LD 3IVKA 3LSOA 3PQYA 1DLFH 5FOJA 4Y19E 4QRQB 4OLUH 1QPXA 4X6DA 2DIJA 3UYRH 5DQ9A 3MGAA 3WIFA 4X6BB 5KSVA 4N5ED 4MJ4A 5C0CA 2D0FA 3LEXA 4JFYB 5EA0H 3NFPB 4JRYB 4M61A 1EXUA 4JRXD 4N9GA 3LPGA 1ND0A 3VWKB 1AO7E 1U3JA 1OGAB 1BJMA 5ACMA 4XWGL 1DFBL 3IDGA 3CX2A 2NR6D 5L6YL 5KOMC 2VZOA 1CQYA 4JY6A 3V5DB 2P4AB 4BKLB 4HT1L 2PYFA 3U7WL 1FIGH 5EPMB 4MJ6B 2VSCA 1FYTD 2VC2H 3DLQR 3IRZA 3FO1B 2DOCA 3U0PA 1HZHH 2QADD 3RAJH 5CJ5A 4WW1A 1BOYA 2ICEB 2XPGB 2YR3A 5DEZA 3QIUD 5L88H 5HHNB 3HE7B 3E6FB 3IDXH 4J23A 4Y5VA 5F7EL 5AG8A 3QIUA 1BQUA 1D3CA 1HYRC 3BWUC 3ZL4L 5FYKL 3NFSL 3OG4B 2VDKL 4LRIC 3QJHB 4RAVA 4M1CC 4FS0A 2VDQL 4UBDD 3HAEA 1CVRA 4C83B 4O2FA 5GS3A 1ZT1B 3TVMB 3IDMB 1NCDL 1DDHA 1CU4H 2DKMA 4Y4FC 1FZKB 3HZKA 4NUGL 1X6LA 2Q7YA 3QIBD 1J5OL 1AGDB 4PRPD 3MOAL 3NCYS 3T3PF 4P2CG 5B39G 2YA0A 4NDMB 4U6HA 2V7HA 3OGCA 1JTPA 4MAYA 4O2CA 4YPGB 3NOIA 3ZDXE 2W0FA 4YAQA 2JELH 4LGPB 1Q9LA 3EFDL 5MEPA 4X0KA 1Q1JH 1DUZA 3QQ9D 1HEZB 2GTWA 3MBXH 1I3GH 1ULVA 3EGSB 5J1SC 4Y5YC 3RWDA 2F9BT 1ZWIB 4AEHL 3FQNB 5D1XB 4Z77B 5I17A 4R7DB 2B1AH 3EDFA 4PY8I 3P77A 3V0AC 3L3IA 1AGFA 2R2EB 3TYFB 3CDGA 1ORQB 2QQLH 3D39D 5ITFA 5C71A 3EYVA 2JF1A 5E8DL 4XP5H 4OB5H 4FFVD 3O0RL 1UADC 1MCPH 3PP4L 1A1NB 5MI0C 3UPCA 4WI4A 3DVGA 1JHKL 2BCKB 2MMXA 4PTTB 4WGVB 4KTDL 3VFWA 5JW3L 3VFUB 1KBGH 3EKCA 1OTTD 3U4BL 5GGRA 1S7VB 4LLMA 2ADIA 1I7ZB 4QY8A 5EFIA 2C1OA 4H26A 1VDGA 2AXHA 3DRQA 3P11H 1CD1A 2WANA 3G5YB 4ODBD 3QDME 2AJUH 5IVOA 4YQXH 1NGXB 2QQNH 4QHNB 4QXTA 4Q74A 4WHYH 5CGYD 3ULSA 4MQXD 4FZ8H 4NN5B 2ARJA 5DT1L 2N1KA 1BJ1J 3E6FA 4JR9H 4Y5VB 4WI8A 3WSQH 1G9EA 4AH2A 4YXLH 5IB3B 4FQCL 3TH3T 3EAKA 2CXGA 4UNUA 4AMKH 4JN1H 1WK0A 3JWDC 3KPOB 4Z0XB 4HJJH 1FZJB 3MBED 3RBGA 1P4BL 2VL5A 2E7MA 3HUJE 5HJ3B 1KB9J 1A7BA 1M7DA 3P4NA 3IDUA 5FGCE 1OAYH 5GQBA 1ETZA 4WO4A 1WCBA 5E6ZA 2AJVH 5DF0A 4G9FB 3Q3GB 4ZUVB 2W0KA 2WUCL 3IYLW 1PSKH 5SWSE 3VXMD 3CGTA 3QDMB 1WWBX 3ZKXC 4F33A 1GGIL 3VWKA 1BVKB 3G9AB 1K9TA 2IFGA 1J1XH 4OD2A 5LJYH 2A74A 3B9KA 4OSUH 2XN9B 4Y1AE 1JV5A 3RVVC 5C0IA 4OZIA 3EYFA 4NQEE 1DQDL 2OK0H 1NAML 1CL7I 4D8PB 2GSGB 3QIWB 3QXAA 4IIQC 1UYWH 4WI5A 4OZGB 1UWGH 2A38A 4MJIA 1I1AD 1VACA 3MRRA 4LF3A 1UZ8B 3C60B 3UBXB 2PTUA 2C1PA 4ODUB 5DC4B 5IMMB 5C6TL 4HHAA 4JFZL 3ZYJA 5IM7B 3KDMA 3OR6B 4WHTA 3SE9L 3ZT5A 3CD4A 4DGVH 1KTLA 1EHAA 4GOSA 4K94L 2Q8AL 1FRGH 3S4SG 4J4PC 2AK4E 5JPMA 2APFA 2IEPA 2HFEB 3T8XA 1MI5A 3LS4H 4BUGA 4LNRA 1U8OB 1PJ9A 3GNML 4R0LA 2FEDD 4KV5F 2XN9E 2I9TB 4H1LB 4XBEL 2AQ1A 4QRSA 1ZGLA 2GJ6D 3MRFA 1MIEH 5A43C 1J0KA 4NKQB 3QO0B 1ZWIA 5AYUH 1RSFA 3RWDB 5EZLA 3VRIA 3CFKA 1INEH 5T3ZD 1JWMA 1QA9A 5KG9B 1OB1B 3DV6B 3CLEL 2XI9A 4Z7VE 5J11C 3CFBA 5EOTB 3IAPA 3MFGB 2IALA 1J0IA 3M8OL 2CXKA 3HE7D 2XZCL 3HUJF 4F9PA 1S7XB 2ZUVA 3O2WH 3VFGL 4RCAA 4YDVB 3I6KB 5I15H 4HD9A 5ALBH 1OWRM 1HN1A 3ARVA 3LRGA 2PW2B 2ENSA 4JFPB 4UDUB 5FYKH 4P3WA 4JPIA 3ARGA 4HUKB 4EQ2A 4JO2L 3N0PB 1BVLA 1X5XA 3OR7A 4XI5C 5DEGA 4YHPB 1YYMH 4K71B 4Q6IB 3OKOA 4FQPA 1PYWA 3OKMB 1J5OH 4OAWA 3QYCA 1OQOA 4PJEF 1PQZA 1ZTXL 2R69H 2NTFA 3VFMB 1F3DH 3O8XC 1JHKH 1T1ZB 3T4YA 5GZND 4ETQA 5HYSB 4IHOA 5LQBL 1JNJA 5L0QC 3KYMB 1OPGL 2JIXD 3D3VE 2M8XA 3BWAA 3RZWA 3QBTB 5BZWB 4NQSA 4FTVA 1AJ7H 4YWGL 4LARH 4M93B 5D7LB 1CFBA 4NRXA 4O2CB 1HDMA 3C9NA 4KKAD 3S4SA 2CSPA 4YZFE 5MEOB 1HZHL 4H1LA 3SPVA 2BY3A 4XRCA 5I66B 4CMMA 2H32A 4FZ8L 4FQXA 3K8KA 2BVOB 4YDJA 4PJ8C 3NCFB 5CUSL 3QO1A 5FKAA 2YD3A 5I71C 1JPSH 1WBZB 3NCJH 1AO7A 2DQUL 4TUOB 1QO3A 5HGHB 1EHLL 1MCWW 3GIZL 35C8H 1YEGL 3ARDD 4WU5A 1Z6JT 2BOBA 1H15B 3CPLB 3NCBB 5BV7H 4PJXF 3BSZL 2FSEA 1D5XB 4P4KA 1OVZA 4ZPTB 4ELME 1J87A 1E0OB 5D7SL 2VE6A 2J3SA 5TE7H 1FH5H 2Y7QB 2OZ4A 1KB9K 5K9QI 5F7UA 4MA3A 4OB5L 3QI9D 1BQLH 3VFVB 2C4FU 4DCQA 3R1GH 4NN5C 3RL2B 4EI5A 5F7KC 5E4EB 2OL3B 2Q6WA 2DJ4A 1N5AB 3GHBH 5IEHA 3LEVL 1H15A 3CPLA 1CDYA 2DKUA 4FMFA 1GGYA 2F8VA 3V0VA 2BOCA 2DRUA 2EECA 4GRLD 4JANA 1YMMA 5DT1H 5E9DB 5GRVK 4KQ3L 4JRXB 2V2TA 1YZZA 2GY7B 4ZAKC 5F44A 1FFRA 3O4OB 4OZ4A 3WHE0 4JG0L 3O4LE 3QO1B 1E4WH 4NQCA 3JTSB 3EOYG 4J1UB 1UVQA 3FT2A 2R2CA 1SEQL 2WV3A 4MNHB 4WFHE 2QQQA 5FYJU 3IDMA 4HK3N 3QHTC 4MJ5B 3MYJB 5D93B 2OM5A 2OMBA 5ERWB 2NY6C 1H3XA 3HG1E 4FTVB 4QO1A 2FGZA 4LHUD 4P0DA 1Z0NA 3BO8A 5D2NB 2XKNB 1L0YA 1YYLL 1DBAH 3LH2L 4K7PH 4C57C 4G80A 1S7UA 5F7YC 3O8XA 4E42B 2DF3A 1IKNA 5D1XC 2WBJB 3U82B 4LLDA 3A6BL 2C3HA 4ODVH 3O3EA 4NT6A 3CU7A 1MJUL 2R0LL 1HWHB 3CH1B 5DEFB 3UJIH 3PV7A 4N8VB 5ACZB 4IM8A 4LGRB 1H3UA 3KXFA 2IQAB 4HV8A 3W39B 3UTSB 2ZKHL 5CD3B 1AHWA 2CK2A 2FH6A 2F54E 4HLZH 4AM0A 3SGEH 1YNKL 1DVFD 1D5BA 3MGOB 3QDJA 5FK9B 1MPAL 4Y4HB 3WHE1 4UTBH 1L7TH 1TQBB 3U1SL 1RUAL 2DWDB 3GGWB 1QBMH 3NTCH 4P5TD 5IMLB 5IB2A 1QSFD 3P9MB 1U93B 2XTJD 32C2B 5IMOA 5CCKH 1WEJL 4GRMB 2PO6A 1DBKL 5KSBF 4OZHB 2YUXA 4MXVE 4P9HH 1Z3GH 4LKXB 1PEZA 1N3NA 3D9AL 4BSJA 1UT9A 3KPLB 4HKJA 3Q6GH 4KY1H 4OFYD 3MRNA 1QFWM 3TO2B 3ZE2F 4N0UB 4EOWL 1R5VA 4NUJA 4RX4D 1A0QH 1ZHLB 3QCTH 1A1MB 1UB5B 2K3TA 3T0AA 2W91A 5E08L 2J6EA 4DVBA 3MROA 1P5VA 5DD3H 3ULUC 4PJCE 2EO9A 4KRPC 3LQAC 1BLNB 4HMDA 4K9EL 3H3PL 1IKNC 1Z9MA 5DRNA 4TOYH 3K81A 3CVIL 5FO8B 4H88L 1OD9A 2ZCHH 4JO4H 4HKXA 4XPTL 5IG7B 3HMXA 2GHWB 4U2ZA 2Z93A 5TE4L 2HLFD 1S7SB 3F5WB 5IMMA 1HHHB 5IB5A 2R0WH 1X6NA 1ZT4B 5F6HJ 2WUBH 5JLZA 1K3IA 3G5XA 3TIDB 3QUZC 5FHAH 2Q8BH 1INEL 1MY7A 4MXWL 4RMTA 3PL6B 1QR1A 5D96C 8FABB 2DI8A 1ONQA 3TJHC 3FQTA 5IQ9B 1KIRB 3JZ7A 3FTGA 3O9WB 4OGYL 3BFOA 1W72A 3P73A 1KJ3L 3TFKC 4X6DF 2OL3A 3ORJA 2Q6WB 2V2XA 1SBBA 1DQLL 4HSQA 3B3IA 4JDZB 2EDWA 4NHUB 4RFEB 2R4RL 4PJAA 3C8KA 3MLUH 2GJJA 2G5BB 1R3HB 3D87B 3H9HA 4I3GA 2AV7A 3IFNH 2AJYH 2Z8RA 5MP6H 5ID1B 1I9RL 1WZ1L 3V6OC 4NN6C 1A7RH 4PJHE 5IMLA 4U1NA 1LO0H 2BSED 4F57H 1VB9A 2FJGA 1QO3B 5HGHA 5KOVC 5HHMB 3JXAA 4V2BA 5GS0D 5K9JH 5C6PB 1MHHA 2YPLE 5MEPB 4LCIH 3S37X 4D9RE 1J86A 2X10A 3MNVA 4YHZH 2PETA 4FQXB 1O5DT 4E5XB 4ORGB 3SCMC 4K3EH 1IM9B 3PGDA 4M48H 1K6QH 1C1EL 4RZCA 1UENA 4HMCA 2F5AL 2VWEE 3MXVL 3PWJA 1OAXL 2ZOLA 1I4FA 3QEGH 5DQDH 5T1MB 2ORBH 4CVWA 1W0VA 3OMZA 5MENA 4FQJL 1J1OH 1IQWL 3JWNC 1YECH 5FGBC 5TPWL 3GMMA 4D9LH 3EOTH 3VJ6B 4U1JB 3H3BC 1PQZB 3QCUL 1AP2A 1DEDA 4R2GB 2R9HC 4HBCH 2XA8H 5GJSH 4R4BA 3TA3B 1C7TA 2Y9RT 3VFVA 3RVWC 3SKMB 1TTFA 1AKJB 4Y19B 1MSPA 1BFTA 1SMAA 1XGUB 2HLFC 1XF4A 1JIBA 4YBHA 2NY4D 4LIQH 1HH6B 5T1KD 1JNNL 2Q76A 3QPQD 3FFCE 1HOCA 4K2UL 2FLRT 2FDBP 4EXPX 3NCYP 4PJXA 4I48A 2K7PA 2G5BA 3TBWB 5DSCB 1DBAL 3LH2H 4K7PL 4Y4KA 2DQCL 3JSSA 4Z7WF 4JY4B 4OF5A 4PRAA 1RJZA 1HE7A 3BPNB 1G1YA 4PB0H 4I0CC 4RX4A 4DKAA 3ARFB 1B4JL 1F2XK 5CKAA 4PJ8B 3VFPA 5D7LD 1U41A 4WFEE 2GIYA 5IVXB 1DZBA 3RWIB 1UG9A 4QLRA 5C0RL 1TQCB 2FR4B 3L3GB 3STBA 1HXYB 2WIIB 4J7RA 4JG0H 1N64L 4I0PA 2YUZA 3EYUL 4C55A 2Z93B 1C8PA 4I3RH 5T33H 3V6OA 4BQ9A 4AYFA 4YDLB 5E08H 2DLGA 2J6EH 4EJ1C 3Q5TA 5IW3A 2B4CH 3ILQD 4Z7OE 1BM3H 5K9KA 5EOQL 5MENB 5L8KB 2EH7H 2EXYC 1NMCB 4HUUB 1CBVL 1X5FA 2NY6B 3U6RA 2IANA 4LEXH 5CMAA 4QEGA 3ULVE 4K71C 3HCVA 3R1GL 4Q6IC 5E8EB 2KQMA 2X4UA 4S1DC 2YN5A 4K07A 5J7CC 3F7PC 2DTML 3ESUF 4LCUA 4G8GE 1R5VB 2EKSB 5F93C 3BESR 4JKLA 3UC0H 4LSTL 1BQHG 1MCLA 4JFFA 1GHFH 1PD6A 1SJHA 1KTKE 3TZVA 5KVEL 3VI4E 3HC4L 4PP2A 3IAQA 5A40E 1FYHB 1MI5D 3TF7C 1MCKA 1KIQB 1JGLH 3QDGD 4KH2A 4KY1L 3VXSB 3DBXA 4P59L 3QNYA 1MVUB 3IDIB 4X9GA 4YR6B 1QOKA 2Z35A 1NUFA 4ISVA 2CD0A 4KRLB 3EOBA 4NQVA 5LWYL 1UCBL 2VISA 5KJRL 4PJEA 4IRJD 3U0TB 3AM8C 3LSOB 4RMQA 1T3FA 1ZLSL 1OSZB 2P24A 1LO0L 1YUHA 1K2DA 1D6VH 3C6LC 4PJFA 2C4FT 4PJFE 3LN5B 5IFHL 3DURB 2IH3A 4L4TD 2R1YB 2Y06L 1Z9LA 4EI5D 3U4EA 4LOUC 3RVTD 4U1SA 3VXRE 2Z91A 2XKNA 5LCVL 1W72L 1DQLH 1TXKA 3DUSB 1QYGL 3QG7L 1ZK9A 1QFPA 3IDXL 2F74A 4PRBB 2W65B 3E8UL 4WO4D 3G6JE 2NXZD 3E2HB 4G8IA 4EN3C 1NLDL 1CN4A 4WGWB 4QHMA 4L8DA 5C2BH 2ZUUA 2CR3A 2MJWA 3RL1A 3U7YH 3M1BA 5CKGA 4X80L 5SWZD 2F54B 3KPSD 2EXWC 2V5MA 4FQHB 3V6ZA 1Z3GL 5I1EH 2FYYA 1TPXC 4HK0A 1EZVY 1ZHLA 3NPSC 3CUPB 1KENL 1JBJA 1MHCB 3ISWA 1IL1B 5D7IB 3MA9H 4CVUA 2Z35B 3OPZL 4F33B 3I85A 5JW3H 3NA9H 2FRGP 5DJ0A 4GMTL 3PWPB 2AEQL 2ZCLH 5DTFB 4ZUWB 4JFDE 4CN1A 5CJQH 5C2UB 2P5EA 3SE3A 3DMMC 5DD3L 3O6FB 4OZHE 2X4OA 5L9DL 1J1OL 1IQWH 2O26U 2HMID 5DHVA 4UINL 4KK9D 4UU9A 5GZOC 4MB3A 3DO7B 2CKBH 3FTGB 5AZEH 3BUYB 3NABL 4HWBH 5J1TC 4OZFH 3TA3C 4PJAF 3S36H 3LD8B 2XTJB 1TDQA 4PGDB 1OGTB 3ALXA 3GB7A 3H8NA 2VAAA 1GAFL 1KYOK 5HYFA 3QUYD 1DQQA 1QSED 4GH7B 1NGWB 1ZVHA 4I0PC 1ETZB 1CXLA 2JJUA 4ACPA 4PJ5A 5D1ZD 3MUHL 5IROA 2DLFL 1DTUA 5E1AB 2DBLL 1E28B 3OX8A 3ZKMC 1OP9A 5GRUL 3RY6A 3QIUB 4JPKL 1KT2B 2Y36L 1HYSC 5D1QC 2ARWA 3SGDH 1QKZH 3MLUL 4MAYC 5CJOH 3QEGL 5DQDL 5F3HA 3T0ED 2ICEA 5KSAA 3V79C 1Q94A 3G9VA 5ESVB 4X5WA 2JE8A 4K7FA 2QJDA 3SHSA 3BDYH 4NOBA 4I0KA 2RB8A 3KYMA 4B50A 2NX5E 1YMHA 1I8MB 5I8KL 3WIHL 1WZLA 5I1JH 4ZUUB 5FYKD 2NTFB 4GAFB 4M5ZL 4HUWA 4OZHA 5EFIB 4P46A 3TJEH 4HXBH 1RJZB 3GSXB 5ISZA 1BEYL 4GJTB 1I1YB 3O2DA 2H8PB 5DJ0B 5GSRA 3ZDZF 4HGWB 2EDTA 4JRYD 5FKPB 3RJDA 2I27N 3VW3H 4GRWF 5GISH 4X0KB 1BAFH 1SM3L 3D6GA 3TN0D 2N56A 4P2QE 3GSNL 3B9AA 1NANI 3K74B 4LP5A 2P8MA 1IZKA 1W8OA 5F1NA 3SDDB 4APQA 4YXLL 4PGCA 3D0LB 4YEFA 2ILLA 3K4AA 4K3JH 5E6IC 3O6FC 4YPJA 3GJFB 4UV7H 3MV8D 1NDGA 5DJDB 4UV4H 4PJ9A 1QSEA 3VFRA 2APTA 5ACZA 3IXAA 3CH1A 3VRLF 4UIKH 4Y16A 1A02N 1QA9B 2XY2A 5BOZG 4GLRI 1EJOL 4E41A 3GRWL 1P7QD 4LVHC 3NPSB 2DS4A 3CCHB 3PWVA 3ARRA 2Y06H 2XZQH 4FQHA 1O0VA 2IMNA 4AK1A 4Y89A 5D72L 3MXWH 1E28A 5EO0B 3PQYD 1OLLA 4L8BB 1JWUB 5K9OA 1DQML 3UJTH 1X5KA 4DW2L 2R4SH 5D2LB 5SWSA 5HHOB 3OAUH 1R5WB 1SJXA 5JPMB 5DK0A 3FT2B 5DVOA 1SVZA 4UNVA 5A2KH 2BSTB 1QVOB 1I3RB 5GGVY 2O5ZL 4NRZA 4IHOB 1B6DA 3SJVD 3MNZA 2YA1A 3MGTA 1L7IL 4P3DA 4N8CH 1GGBH 3OZ9H 3WNNA 5DJXA 1PG7W 1P2CA 4JN2A 3IU3B 1DQJA 1I1RA 1KPRA 1FNGB 3LAFA 4MA3B 1E27A 1BD2B 1N26A 3OKDB 3OPZH 2M2DA 1NEUA 3RL2A 3CMGA 2D2OA 5I1LB 2P5EE 4YGVA 1E27B 2CLRB 1JGUH 4F9LC 3WFEL 3L3KB 2EYRA 2R2BB 4JPWL 5HHOE 4TQEL 3DBXB 5EU6D 4Y8AA 3TH4T 5C2BL 2HP4A 5CJXA 1HHHA 2FIKA 3E6HA 1NGYB 2YC1B 4OKVA 3OBAA 4IMKC 5LKNA 3N1PC 1IZJA 3LMJL 2B0SH 3K7UA 1MEXL 1T5XA 1CK0H 1AO7B 1OB1A 1QFUL 2E8ZA 2VL5B 1A7PL 5KZCD 5I2IB 4G3YH 1RHFA 4X9IA 2WWKT 5TF1H 2VLJD 3HR5B 2VITA 1J8HD 3BQUB 4LCWE 1FP5A 4G9FE 5GZNC 4R4ND 4GSDL 4PJBB 3VW3L 4KI5C 5MI0B 1FL5A 2FCBA 1DSFL 1X9QA 4NO5B 1MQKH 3LS5H 3QDGA 5DHYB 4EVNB 5IF0A 4ZPVA 1R6VA 2F8OA 4X6FA 1CI5A 3FKUS 2FIRT 4P2OB 5CP7A 4AIOA 2HRPH 4MHHI 3T4YB 3LEYH 5BV7L 5F6IB 4PB9L 1YY9C 2FX7H 3D85D 4R4FH 4ELMA 4K23L 5ANMA 2AVGA 1VKXB 4BZYA 1UZ8A 3C60A 1EPFA 1Q72L 2P8MB 3U7AA 3H9ZA 3U9UA 4FABH 4R3SB 4UTAL 3KYNB 3O2VH 3SO5A 5FDWA 2AQ3A 1XGQA 1EA9C 3LN9A 4KK8C 3SKUD 3GHEH 4IS6B 3I9GH 2A6IB 2AABH 1C12B 3T2NH 5GGUA 2H1PH 1F13A 2YOCA 4ZXBD 4JQVC 2F53E 2R29H 4TUOA 3GI8L 4WU7A 4QF1B 5JA9A 3TH2T 4I0PD 2CR6A 3A0OA 4EDWL 4HGKC 2ZUQB 4BZ2L 3NA4A 5IBLD 3FMGH 2NY3D 2VN4A 4M6AA 4WO4B 2V9TA 1ZHBB 5HDBE 3BO8B 5D2NA 3L7EB 4JHBA 3VFNA 1HQRA 4F15C 2ZNXA 1NJ9B 5EBMB 3LKOA 4PJCF 1CXHA 3X11A 4P5TA 1T83C 3MCKA 2I5YL 5I8KH 5E2WL 1AQKH 1T20A 1U3HB 2HT3C 3H7LA 4G6FB 2LVEA 1H8NA 4KZEH 4LCCC 1PW3A 3MREB 4WUUD 3JTSA 2VZSA 1DVFA 4XX1E 3RBSA 5IVZA 3VDCA 2FJFB 1ADQA 4F7EB 3HNSL 2VTFA 4FFVC 1FHGA 4IMKA 3PWPE 4LSVL 4KQ4L 5HD8C 3O11A 4LL9A 3RHWF 2QHLA 3SDCA 5C0GB 1JZ5A 4RRPG 5D7JB 5E5MB 1IC4L 2NLJB 3P30H 4WDIB 4U6VL 1KF9B 4JM2A 1A9BB 4Y1AA 5HVGB 4CRPA 3SE4C 4M03A 3TJEL 3MRGB 3MLZH 3QCTL 5DLML 1Q9KB 1IAMA 1UXSB 3QJFB 3WD5L 4JG1H 3RVXC 3BP6A 5IMKA 4YNYB 1P4IL 3L3JA 2XIDA 4GAYB 3F5WA 1AGFB 3TYFA 5I76A 5HTSA 5CJOL 4N9OB 1G7QB 4OUOA 1XF4B 4ZUUA 2BSTA 1CFTB 1M7DB 3BKML 1DBKH 4XAKE 2VZ3A 5TGBB 3PNWA 4GUPA 3AU1B 2H6PA 5FB8A 1LE9B 1GC1C 5DRNB 5DR5H 5JHDD 4GRLA 4KU1A 1G7QA 2BVOA 1HQ4B 1BBJA 2QHRL 2VDRH 4XXDA 1MPAH 2UUDK 1JZ3A 1JF1B 5F96L 2Y5TB 1MIMH 2NY7L 1NUGA 2WW8A 2R0ZL 1KCKA 1KT2A 4PIRF 1FV1B 1WIPA 4G8IB 4LAJH 1A2YA 2VITB 3O45B 4AIXA 3G5XB 5C08B 1JYXA 1W0VB 3INUH 1LMKA 4QCIA 1LILA 1ZE3C 4H26B 4V1DA 2C1OB 1ODAA 3FZUC 2BVYA 3RWEB 4LU5L 4Z7QF 1MFAH 4U3CA 4YBLC 5D2NE 2WLYA 1FVEB 4HXAH 1M05B 2FIKB 3E6HB 5EN2B 4L1HA 3TCLB 1MFCH 5CIPH 1LEKA 4K3JL 4UILH 1MREL 3LIZL 4YJZL 3UTOA 3NTCL 4HZAA 4AQ1B 2F58H 3TIEB 1N6QL 4IIQA 3QIBC 4PTTA 1HINL 4QKXB 5TF0A 4QXGH 1BFOB 3OJDB 3HZVB 4XPAH 5DA0B 2HN7A 2E9JA 4LEOA 4P48A 5FUOH 4TUKL 1WC7B 3E3QC 3VD9A 3PDGA 1IJ9A 4K3GA 1BIIA 3MBEB 1RZGA 4LLWA 2V5SA 5BV7B 4RGMB 2XACC 5DHYA 1I8IA 1W72B 4LIQL 4OIAA 1FGNH 1QD0A 5KSVB 4PREA 3RJQB 2ZSWA 1U3HD 5M7QA 1T1XA 2GTZA 5LXGL 4NQEA 1P53A 1G1CA 2OJZH 4XCEB 1WLHA 4P2RA 1JTOA 4F8TA 4MD0B 3KPQB 2OSLB 1JGUL 3I9GL 3AVEA 3X14B 3QP3A 4KJYB 5TFSH 1IM3A 2VH5L 3V5KA 4EXKA 4N68A 2MKWA 3TPKA 1NBVL 4M62L 3FHQA 1RUMH 4HH9A 2DQIL 3T65B 3DX9B 5C09B 4EOWH 1G7MB 3VXUA 1K5NA 4A6YB 4HWUA 3FOLA 3EOTL 4JZNA 5INDA 1WIUA 5DJ6A 4ELMB 3MJ9L 3HE7A 3SKJH 5LBSL 3VFWB 5FO9B 3FRPG 2CMRL 4OCXH 2HFFA 3IJHB 4HMEA 3TLRA 1EO5A 3VE0B 5KANI 2AJUL 1YPZE 2IGFL 2P24B 4EUPG 3RWFA 1NCCH 3RDTD 5BXFB 2CIIB 3CFEB 5HHXH 4YHIB 3UO1H 4PGEB 4JZJC 1EFXD 4ISVB 5EC2B 2A1WH 4G7YH 3QSKB 4ZDHA 4AL8H 5TQ0H 4NQDD 1QSZA 4APQC 3QISA 1WT5A 5L8LB 2XXMB 3U0WH 1A3RH 5GRJH 1MRDH 2VDLL 2H2PD 3WFZA 3FT3B 5C09E 2OK0L 3GMLA 1FFPA 1S5HA 2EE9A 2NY2D 2F5AH 4F9PC 3WFCL 1MCOL 5D6CA 4HIHA 4OIBA 5KVMC 1W0WB 4M4RA 3MOBL 2F54A 2AEPL 4CBPA 1J8HB 3ZKND 2GT9B 4MSWA 5FUZL 4XHJD 1Q0YH 1IC4H 3P30L 4RAUB 4XCYB 3ZHLA 3GKWL 2VWEC 2C7UA 4JHWL 3DVNA 1D9KA 1YMMD 5FIEA 1IAOA 4GW4B 4NZTL 1NMCC 3QXWA 5DJ6B 3MSPA 5C0RH 2K7QA 3VXTA 4Y5XA 1VESA 4RIRA 1AGEA 2D4FA 4ETQB 2XOTA 4WWKA 5C09A 4OCSH 4POUB 3JUZA 1G7LA 1N59B 3IU4L 4I8DA 1S7RB 2JCCF 5F1NB 4HIXH 4XMPH 5I8OL 3PIQA 6FABH 4I4WA 1FNSL 2X41A 3SGEI 3U9PH 4ZNEE 1CTNA 1BIHA 2R8SH 3UROR 5TH2A 2VISB 4S11A 4PTUA 3HI5H 4HCRH 5FECA 3MV7B 3IS0X 5E8OA 1FFPB 1Z0MA 5JQHC 1ACZA 2H8PA 4FQ2H 3THML 4G6KH 4S1DD 3TBSA 3GIVA 1N8ZA 2ICWB 3EYOA 5HHME 3BEWB 1I1AC 2JIXB 2X4OB 5IFHH 1FRGL 2W9DH 1NEZB 4OZHF 1CXEA 4HBCL 4IDJH 2F53B 1DBJL 1HNGA 4G42B 4JFZH 2EZ0C 2C26A 4PRNA 4N0YH 3DX6B 3MJ6A 3EGSA 1RUML 3MA7B 3MA9L 2DIAA 5HYQA 5DRZB 5F9WB 3RPKA 4MNQE 2AERT 1IAOB 2EDQA 2PTTA 4GW4A 4WUKL 4XVUD 4XWOD 1ZLWH 1F4WL 1AGBA 4OD1H 4S1QH 2HH0H 1XIWB 2X4UB 1N7ML 3CH8A 5HHVL 3HUJA 4OQTL 1T21A 4MJ2A 2AXFB 1ZS8A 3TBVB 4CN4A 1K5NB 1IC5L 1DDHB 3U36B 4CADB 4EIGB 3MRMB 2MPAL 1OAKL 3QUXD 4JZOB 1QUNA 1YN6B 2IAMC 4ZFGL 3WV0A 1A9EA 1U8QA 5TFSL 5B21A 4S2SB 4P2RD 5C0AA 4PJDF 5IM7A 3TM6A 2AKRA 5BVPL 4HHAB 4PJ5E 4NGHH 2B5IC 2YUVA 3FQRB 2VXUH 4WUUA 1RIUL 1KNOA 1TZIB 3K0WA 3BKCH 4E0RA 3L3OB 1LNUB 3G08A 1A14H 4JHAL 1YUHB 1KTRL 2JJTC 1QBBA 1U8JB 1NGQH 1N6QH 2X7LA 2HJFA 4PP1C 4YHIA 3UZVB 1NGYA 3U7YL 3QIWC 1BWMA 1CDUA 4X4ZA 7FABL 4P57B 1SEQH 1SYSB 5EU7E 2X70B 3B4NA 1T7XA 2DQHH 5I15L 3NFNB 2W60B 5LBSH 4OLXH 4XNYL 2XZCH 4YNYA 4IOSD 3P2TA 5DJAB 2FYYB 3QEQE 4IIQB 3SBWA 4PJ5B 3P73B 3CZFA 5E99H 1T66C 3EUUA 3VI4F 3O3AA 1IGMH 5GRJL 1SYVA 5ELIA 1YEDB 2A0LD 1FNLA 2IBZX 4WI9A 1PKQE 3LN4A 4OM1L 1OP5K 4F7MA 2D7PA 2EKSA 4MA1B 4I9WD 2GFBA 5C92A 5DFWH 1MVFA 3OTTA 4KHXH 2A83A 1LO4L 4V1DD 4Z76B 3IJSB 1YEFL 4Q97A 1I9EA 2AJXH 2CDEB 2CO6B 3S36L 2AI0L 4TVPH 2DQUH 4ZO8A 4QRRD 1YNKH 4LCWA 1MFEL 3O3AB 4IJ3C 4WVRA 3BX7C 4MCYA 1E4XL 5E94B 2BHUA 4YK4B 5T1DH 1S9WB 4K8RC 3KYKL 4PJHB 3QQ3B 5GHWH 4HPYH 3FJTA 1UQSA 1FG9C 5I9QB 5GS2H 1J11A 3UMTA 1AI1H 3CVHB 2IFFH 1AXSB 1URLA 3SOBH 2JKXA 5CEZH 4OFKA 2VR9A 1MHHB 3HPJA 1QTYT 1S9YA 3CFIC 5F3BA 4BFBD 4OCRH 5JHLH 4XBPB 1R0AH 4HK3J 5GPRA 1XZ0A 4XNMA 4PG9A 2MCPL 3SY0B 5T1LA 2CUIA 2PUQT 1NFIB 3B2UD 3QRGL 1JGVL 4M43H 3IDYC 3HNTH 2VL4A 3EYOB 3WLWC 3SDXB 4BSWB 5JO5A 1FAKT 1E4WL 1SJHB 4HS8L 4R7DA 1T4KB 3VGFA 4ZO7A 3SDDC 5AUMA 3VXSD 4JKWA 3UDWA 1F4YL 1PBYA 5FXCH 5FO7A 1P1ZB 1GJIA 5MERB 1YQVH 3MLRH 1IGFL 4TULL 3G6AA 3M17B 1IC7H 3ES6A 1N0XL 3B8YA 3MOBH 3WXVH 3S3JA 1CF8H 3WFDL 1UM4H 3BE1H 4P23C 2BY2A 2IWGA 1WAAE 4XCNB 3RWCB 1TJHH 4OGZA 4G9FA 1M71B 1S7QA 5IVZB 3MLWH 3BKCL 1SYVB 1K8DA 2DQGH 3HUJB 3O6KL 1IT9H 1TTUA 5HI4C 4KC3B 5BS0D 3TN0C 1DE4A 2PYEA 5AAWA 4Q9CA 2WBJC 5MEQA 1SY6L 3MX0A 3HB3C 4OD3H 3QG6A 4PLKC 1T1YA 2BC4A 2DMKA 3MRJB 2WK2A 2NW2A 1WV7T 4XVSL 2WQ8A 4KK5C 5E2VL 5GRZA 4UTBL 4CDHA 9CGTA 2YD5A 1NKOA 3DUUB 4OLUL 4ZTOL 5C07D 3V9FA 4KUCF 4Z8FL 4U6HB 5EBLB 3Q6GL 1AH1A 3RNKA 4N8CL 1L6ZA 3QXDB 1VPOH 1A0QL 1QRNB 3KPPA 5C0AE 1CLZL 1CXKA 1CVSC 1DVFC 3CIQA 3BZ4A 2KZ1B 5KSUA 1JPTL 1NL0H 2R0LH 4QF1A 4U1IA 4P46C 5E8PA 1H3WM 4WCYL 2X4PB 3H9SE 4LKXA 4LSPH 5EH1A 1IGCL 4U31A 1S9VA 3U9PL 5TE6H 3LRSB 2XFXA 1T89C 2GYSA 3L3DB 3UDWC 5KVDL 2MFNA 4LBEA 3CFDA 1YN6A 5DMKA 2EE2A 3VWJD 3WO4C 3QEUB 5GRVL 1R3LA 3ARBC 4JPIB 4XX1G 4FRWA 3VWJA 3IRPX 2VE6B 3MGOA 3QDJB 1RK1A 3RU8L 4QNPE 5H35B 3NN8B 2B2XL 1HILB 5EOCH 3O6FA 4AIZA 3SDAD 1G7JA 1QR4A 1WBXB 2A6JA 5CBAA 3QQ9C 3I6KA 4HEME 2R0KL 3TN0A 4G3YL 3RWCA 4ZSOB 4MB4A 3MCLL 4XCYA 4A6YA 2P48B 1REIA 3BN9C 1ZHBA 4ODHL 3EDDA 4I77L 5SX4H 1WFTA 4YHOL 4PJBA 3GSNH 4DOHB 1ZANH 2C3XA 4XPHH 1G9MH 3QFJD 5EBWB 5JNYB 2DYPA 2XA3A 3GMPA 3FFCA 1HHGA 4ELKA 4Y4KC 3DYOA 3AREC 4JPWH 4L29A 4ZNEA 3ILPA 1ZT7B 3H3PH 1D6EB 3TP4A 4DGYL 4OTXH 3RWHA 1ZGLM 5GSVA 1YJDC 4YZFF 3WYRA 3DXAB 5EZIH 1XR9A 4HJGA 2H26A 2H2SD 4DQOL 5T1LB 4Z7NF 3LMJH 3VDAA 2QQNL 4LNRB 1T03L 5JHDA 3NAAL 3U9UB 1Q9WB 3QIWD 4YUEL 5HHOD 5B8CA 3RZCC 4JRXA 4M7ZC 4HG4K 2JK5A 1I8IB 1A6WL 5ADOL 4NJ9L 5GJSL 4U1LB 1KJVB 1F3RB 4JFOA 5IB1B 1ZAGA 4FOMA 1JNLL 1F4WH 4YHZL 1H3TA 4YE4H 4CU7A 5JHLL 3MUZ1 3SKOB 3GSVA 2X9YA 5IBTL 1CLOH 1OAZH 4MD4A 1KIRA 3O9WA 4IOFC 5J13B 4JKMA 1IKFH 3C5JA 2BNUB 4YHKH 3UYRL 1VFBA 3QUMH 4KHXL 4OF8A 3ULVL 3CFDB 2ZJSH 4J6RL 5BMFL 2XN9A 1CR9L 4FXKB 5T1DL 3HMWL 1T6VN 3A67L 1AD0A 4MSWB 4LRNL 2WP3T 3MV7D 4O51B 1MELA 3BDXA 2E7LA 1T22A 3O3DB 3T0BA 1MRCL 4JFXA 4K8RD 4MZ2A 1R5WA 4GBXA 3X13B 4I9WE 1CL7L 1KBGL 3OKEA 4KXZH 5BCAA 2BY0A 4R7NA 1CGSL 2XRAL 3LEYL 4Z0BL 4KDWA 1FV1A 4FP8H 2JJSA 5EUOE 1IGIH 3BN9D 4WWID 3MBXL 4ZDHB 3BW9A 3UAJD 3UTPE 4GG6B 4DGIL 4RMRA 2KQNA 5B8CC 3MRNB 2FJHB 3BH8B 3ET9F 4NWUH 1I9RH 5I16A 1GYAA 4XHQA 1BHGA 2Z8SA 1HH9B 4MNHA 3NFSH 5IJKC 4Y4FD 1BF8A 5HGDA 2EDBA 4CU6A 5L2JA 2ADJA 4PJBE 4U3XA 3V4PH 3WO3B 3WDJA 3LZFL 2VQTA 4QTHB 2XY1A 4CNIA 3O6KH 3SGJA 1RQ5A 1RZFL 4M6ML 5JORB 3GSRA 2H2SC 3WEXA 4XAWL 3MRCB 2JK5B 1ACYL 5AYUL 4PR5A 1CXFA 2VZTA 4JAMA 3PV6B 4ZUTB 4NRZB 4F58H 5FK9A 4LLUA 4P23D 5IK3B 1PSKL 3VRLE 5FF6B 4NYLA 1ZLVK 1MFAL 3K4DA 3TBYB 3I75A 1KELL 5KTEH 1C16A 4HQQH 4ODXB 5F9OL 3OKKA 2HJKA 4PS4H 4DN4L 1MFNA 2E8YA 3W39A 3WNMA 1IT9L 3F7RA 4OV5B 43CAB