4NYUA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in c 2 2 21
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
406
structure length
406
Chain Sequence
TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Deacetylase DA1
total genus 139
structure length 406
sequence length 406
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyuA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyuA01
2C1IA 4OUIA 2I5IA 2W3ZA 4NYYA 4NZ5A 3WX7A 2VYOA 4NYUA 2C79A 1XW8A 2CC0A 4U10A 2E67A 4LY4A 4V33A 5BU6A 4F9JA 1W1B1 2J13A 1V6TA 5JMUA 3CL8A 4F9DA 3CL6A 4WCJA 1Z7AA 4NZ1A 2IW0A 2C1GA 2XU2A 3CL7A 4HD5A 4NZ3A 4M1BA 1NY1A 1W1A1 3VUSA 3QBUA 2NLYA 2Y8UA 3S6OA 4NZ4A 4NY2A 2C71A 2DFAA 1W17A 4L1GA 2QV5A 3RXZA 3HFTA
chains in the Genus database with same CATH superfamily
2ZOXA 2OZ0A 3GSMA 2JEQA 4JYFA 1FCVA 2DZBA 4HYVA 2EQDA 4X22A 5CPTA 4IL0A 3NSMA 1N82A 3O6AA 7ODCA 1XIHA 3BSMA 4IFKA 4PUNA 3DFTA 4E4PA 3UFYA 5J5RA 3W7QA 3FEQA 4MYXA 3GXIA 3V3WA 3BLIA 3B8TA 3SQSA 1W9PA 4GHRA 3GG0A 5CZ0A 4JTQA 1X38A 3WMLA 4AW7A 1H7PA 4IMFA 1F4HA 4LCSA 5BW6A 1HP4A 1KA9F 1BVWA 2WJZA 3HN3A 1TTPA 2FQIA 3LBMA 4PUEA 2O4QA 1MUMA 1HTIA 2PDGA 3RX2A 3RRAA 3WENA 1QHPA 4NNAA 2ZA1A 3VNMA 2V30A 5HNUA 5JIWA 2X8RA 3T1GA 3HMCA 3IJ7A 1US2A 1XIMA 2C6QA 4XZWA 1MNSA 4WIWA 1VLWA 4HIBA 3E6EA 3FA4A 3O05A 4GQRA 3GNDA 3LGEA 3HSHA 1LUCA 1QTWA 1JRBA 3KTXA 3U2ZA 1DJQA 4NZ5A 3WQ6A 4I9JA 5B7ZA 5ABFB 2WPBA 2Z24A 5G4WA 2D2OA 2Z4GA 4C60A 3STEA 5AFDA 1N8IA 2QGHA 3GNOA 3ITLA 3HV8A 1T8QA 1H7WA 3CQJA 3SIZA 3ZVHA 3HGJA 4RKAA 1S5NA 4HYRA 3H21A 3PJTA 3OB8A 2QUNA 2D49A 4OTKA 2QUUA 2VNCA 3SRHA 3ZM8A 3IJLA 4H6KA 1NIUA 3H22A 4AY7A 4BF9A 5AC5A 1XF0A 4AIEA 2EGZA 4CVWA 3LEPA 4C1NA 2J7GA 4HB7A 3SW6A 2VGFA 5FSDC 3WK0A 5T91A 2W62A 3DECA 3RLHA 2HVOA 3E0FA 2CETA 3WD2A 3SRFA 1V5XA 4TQTA 4HBKA 3GS6A 3P62A 3WJYA 2P53A 4BFAA 5CBBA 3CEPA 4M1RA 3TVAA 2VRJA 2F2HA 1UIOA 2HVMA 4GNJA 2OKTA 4G9PA 2OX1A 2VD8A 3CL8A 4ZENA 5K2ZA 2XN2A 4FNSA 5PTDA 4QJ5B 4ML4A 2VX4A 2BV9A 1B3OA 1UD4A 1D8CA 4PTNA 1NDYA 1W8SA 3VDAA 1IE7C 4PTVA 4JN6A 5LIKX 4JR5A 3CT2A 4Z08A 2E09A 3WLHA 2Q3RA 4P8UA 2QJJA 2WVSA 3DBNA 2ZUUA 1M41A 3NZGA 3QJAA 4C6LA 2Z28A 2GWNA 3LYEA 4YHGA 5H8MA 3IGUA 5FIPA 1DYSA 2A21A 4AC7C 3A4WA 1ZENA 2WCSA 2PWUA 4N42A 3QQWA 2Y2NA 3AHZA 3B0XA 3UXLA 3MUZ1 4KPLA 1D3HA 3KLLA 3W76A 1WDDA 2QXWA 1LT7A 4PRTA 4RDZA 2IKIA 5LIWX 2FZ9A 2GSEA 1G7VA 1EO5A 2CLOA 3OHIA 1JGIA 4BQ5A 2GJRA 1XC6A 1YDYA 3RU8X 4CQCA 1HZYA 1JD9A 1RK6A 1O5QA 4JYEA 4ZQCA 1QI0A 3FKKA 3G1VA 3AHVA 4I7WA 1J12A 4QQ3A 4F9DA 4XBSA 2IPFA 1A5LC 1I8JA 2R1PA 2WMJA 1T5AA 4ICMA 1PUDA 3UP8A 1V6YA 1X8FA 2ZUVA 3LSCA 3DHPA 4I90A 3ECQA 3V16A 3NQ7A 1LL6A 4N2YA 4JKKA 1Q6LA 3QYQA 3M16A 3MB9A 1EWDA 2DW6A 2JE8A 4Y8EA 3BCJA 4TVCA 4YXGA 5G2WA 4LAMA 3DGRA 2CXGA 3WUBA 3UF9A 3QOMA 5KZDA 6REQA 1NARA 4AXKA 4IJEA 4A05A 3PNZA 2C1HA 2OT1A 4GLEA 1K70A 2YBVA 4QQUA 3DHDA 5LSMA 3N9SA 3S6TA 1KR0A 1YNQA 1YXDA 1PO9A 4AEFA 1Y65A 3F4WA 4ZQPA 1VFUA 4K7YA 1FH9A 3PBVA 5A6JA 3W1AA 1TX0A 5G1YA 3EXTA 4G7EB 3BG3A 4XAYA 1Q6FA 1MVYA 4WDUA 2QR6A 3R8GA 1E8BA 1PJ9A 3NDOA 3WLOA 3HQOA 3USBA 2FMNA 3MMTA 2PEVA 1EX1A 4HN4A 1R3WA 1PZ1A 2QW5A 3RUBL 5ABTA 2W27A 4LNYA 1WZAA 3LCXA 1TPB1 2NQHA 3PFMA 4ZVJA 1VR6A 1XSJA 1K02A 2QAFA 1F2JA 3OIXA 1JNDA 1QNSA 4IICA 3TOYA 3L5MA 1XYMA 2X1IA 3W23A 5A2BA 7ENLA 2QJNA 3TN3A 3G6MA 3PM6A 3HM7A 3G77A 2GZXA 3N2CA 2OQLA 3UW6A 4WY0B 4S2BA 3VCRA 5A6BD 5FACA 4GVHA 5LGZA 4N02A 1Q2RA 2FH8A 1H7RA 4HNOA 3UXDA 2W5FA 3DFQA 1XIGA 1UP3A 3LCIA 1QPQA 4GINA 5A6TC 1AQMA 1NQ6A 2PDIA 3VAVA 1XG4A 3T2OA 1OGSA 4UZSA 3SB0A 4BKNA 5L6UA 3FXYA 1DE6A 3TN6A 3VCCA 1CGXA 5C7HA 3CZKA 3AU6A 4IPJA 2QJHA 3VOIA 3PS7A 2OYKA 2FYMA 1DORA 3QLLA 1ZTVA 3NUKA 4RZ5A 4JCLA 5CG0A 3HJZA 1SSDA 1C8XA 5AHEA 3ONCA 3O6YX 3NURA 1Q4WA 2KX9A 3BXWA 3M0MA 3W9ZA 4D2JA 1WKDA 2ACRA 3QLDA 3F4VA 4QISA 2G96A 4I7VA 2ISFA 2Z6JA 3PZOA 3VIKA 2HNEA 2Z25A 3SGGA 4JTFA 3ZQ9A 4UXDA 3OJGA 1TMQA 4GIRA 3G6LA 3R25A 1UZHA 2Z27A 3BAIA 1RD6A 2XIOA 1EX5A 1CX9A 7TIMA 1V6XA 2FGLA 1BXBA 3WJXA 2ISSA 3H2EA 4GG9A 2CWXA 1O5KA 1ODZA 3RU6A 5EBUA 3VIJA 1HKWA 3R58A 5M03A 2GDVA 4GO9A 3WLRA 5JMUA 2HK1A 3WLSA 3B0YA 1F5ZA 5GQBA 4JQ4A 3ZSSA 3M0XA 3SY5A 2VKZG 1EQCA 5BOOA 3ZT5A 1XIFA 2Y89A 4XD6A 2UWXA 3COTA 4CCCA 4DZHA 3GXPA 4IZGA 2OSXA 2CU0A 4GCXA 2NVAA 1LLWA 3IUHA 3PTDA 1R2RA 1FFQA 1GQKA 3LG3A 3TR2A 1NF0A 2OEKA 3VUSA 4PCNA 2NLYA 2XFRA 3C8NA 4FI4A 3NOEA 3UA3A 1GVFA 4HU8A 4MMWA 1BSIA 2UY4A 2TRSA 1L8NA 1C8QA 4GKLA 3WBXA 1XBXA 4PR4A 1UPMB 1XRTA 4AEEA 1PYFA 3CU2A 3PB2A 4KGLA 4N7QA 4XZIA 1W0MA 3JRKA 4ICNA 2DW7A 4DBEA 1JDFA 5M17A 2WQDA 4MLRA 1JCNA 2WNQA 5AHLA 3LXBA 1GYMA 1BTCA 3I3DA 1EJUC 2AAMA 1TB3A 4MLJA 4C91A 4UFJA 2NW0A 2X05A 4WHBA 2P0OA 1SZGA 2GGIA 2H9AB 1GHRA 4ERAA 1T8XA 1VFLA 4QR6A 3SCWA 2C91A 2ZRXA 4A2RA 5FOOA 4UQBA 2WBGA 5ECUA 2Y5SA 4EXBA 1LRNA 3K5XA 1UJPA 2ZQ0A 4JTLA 4XBKA 5AHNA 2J8GA 4AG0A 3W86A 4QLLA 2BXVA 2EJAA 4PMNA 3EWBX 1FWHC 1R3VA 2PDMA 3PZTA 3W22A 1UB3A 3EA2A 3VX0A 4GVFA 3KCOA 3VGFA 2DT2A 3VX1A 4EAMA 4GJJA 1H0IA 5CGQA 4W8AA 1X96A 1PIGA 3WUEA 3WF1A 1SPQA 4QCFA 5REQA 1M03A 3W70A 3CWHA 3WCZA 1EWEA 5FSEC 3EZ4A 1OINA 3L4VA 3R7MA 5CPQA 2WJDA 4M7TA 3WFLA 4DJEC 3QY7A 3A47A 3BW4A 4A29A 1LZOA 5A6MA 2RJGA 4W8LA 3LOTA 1YIXA 2G3JA 1XLFA 3BOXA 1FWFC 4A6GA 2QULA 3NL3A 3CO8A 3WNNA 4C5ZA 3AS0A 1HF6A 1ZAIA 2J27A 2QDGA 4MWAB 3YPIA 3P14A 3JS3A 3VGBA 3WD3A 4ROQA 4MM1A 5C70A 1MUWA 1LOLA 1GOKA 3UWQA 2YZ5A 3GG7A 1W5MA 5C9ZA 1GOOA 4WOZA 1BVZA 4PH6A 1QR7A 1GJUA 4CD5A 4F40A 7A3HA 3KXQA 2YPIA 3RLVA 4RE3A 3LCWA 3A12A 3VK5A 1TZ9A 1GVEA 4MJZA 1U5HA 2B7OA 3ABRA 4Z1BA 2VZSA 3VFLA 5LA0A 4C6CA 3P74A 1GYNA 2UBPC 1NJJA 2FTYA 5FF0A 2Q71A 3MPGA 1VFTA 4LVDA 2ANUA 3GHTA 1B5TA 3VNJA 1RJPA 2G37A 1PWLA 2ONEA 5I3JA 3ARRA 4RV3A 4HHHA 1H7XA 2Z1VA 4MG4A 2FFIA 2C0AA 4LY4A 1SZEA 4QG9A 1XJBA 2PTWA 5LA1A 1UKSA 2D2JA 1WB0A 3FAWA 3LLDA 1X6LA 2V3EA 2Q6ZA 2WSQA 4JL1A 1WP6A 4N9CA 2R1LA 2F8QA 3VDGA 1DTUA 3UWZA 3GXNA 1XCXA 5HNRA 3NYZA 1DTNA 3RG6A 4UTWC 1N2VA 4PCPA 3S9YA 1A5KC 1RQEA 1Z9AA 4YN5A 1PKNA 1XLLA 3GX9A 5ABHA 4NG3A 3LHVA 1F4AA 3L5LA 3SCSA 3BC9A 1E0TA 1GOXA 4JKMA 4ONVA 5EGRA 4LUSB 3U7BA 3CQ0A 2C1IA 2O9PA 3OG2A 2Y7FA 2ZUSA 2GQ8A 1EXBA 2Q02A 3ZLFA 1U33A 4ATDA 5HJYA 5BMWA 4PUWA 3O2LA 3CHEA 3F5JA 2OG9A 1UR3M 3GNRA 3W24A 2TMDA 2W6RA 4LALA 1EJ7L 1RA5A 1FX6A 3ZR6A 1ME8A 3FJ6A 3ZLGA 4KEVA 1R8LA 4LCQA 5AYYA 4OFCA 3TZFA 3DUGA 1OCJA 3SGUA 2FHFA 4RNFA 3R10A 3CV1A 1DPMA 2NVCA 2VQUA 3STCA 5B7YA 1NFBA 1VEOA 4MY8A 3G1XA 1E9YB 5TAOA 1IQ8A 2OWWA 4HOXA 1TJ2A 1Q63A 5BZAA 2EG8A 4M29A 1UR2A 4P7NA 4ASTA 3PZUA 1ZS2A 2FVMA 3ISIX 3ANVA 3FJ4A 1U30A 1PCKA 5DQPA 2OWXA 1WZLA 3CQIA 5I3GA 3N04A 4CUCA 1NVMA 1RP8A 1FHDA 3VM5A 1OSEA 1TV2A 3OODA 4U31A 3VDHA 4LTSA 3A4XA 5EMYA 5M1TA 3R2GA 1FXPA 1MW0A 3PC0A 4B2DA 3U2EA 2E5BA 1AD1A 3DU0A 1RBOB 2DZAA 4ADTA 4DAIA 2J88A 3JVAA 4HNNA 1E6ZA 2Y2LA 4R9XA 5I03A 2OQHA 3LV6A 4GH9A 1Z48A 1XM3A 1UG6A 4D1JA 1JAEA 1X98A 4PMZA 4KCUA 1W9VA 1G5AA 4IQEA 1SFLA 3VKAA 1EP1A 3GRIA 4Z2IA 1EIXA 3N17A 3EWCA 2J13A 3A23A 3GZ3A 4HNTA 4GC3A 4MZ1A 3B3DA 1A5AA 4CNSA 2PDHA 1H51A 3BAWA 1XYBA 4LPCA 5EA9A 5CPMA 1EYWA 4KWWA 3TKFA 1Q8JA 2R82A 3VNDA 2HK0A 2H8ZA 5BU6A 2ZC1A 3CNYA 2AMGA 4XQ6A 1HN1A 4ATWA 3TTEA 1RALA 1V3LA 1WDPA 4ALDA 4ACZB 3GAKA 1TQJA 3OBKA 1O6IA 4U3CA 3W88A 2J78A 2WK2A 4H3DA 3N2MA 2GGGA 3ZO9A 3W7MA 1IXQA 1SM9A 3QPEA 3VNKA 2CHOA 2VEGA 4ZQRA 2VR4A 4JY8A 4P7QA 2VP8A 4TTGA 3UWUA 2MNRA 3IJIA 2XIIA 5CJNA 1BWKA 1MFVA 4CU6A 1Z7AA 3NQFA 3U5UA 4AEOA 4QDMA 5FCZA 1OC5A 3EXSA 4AWUA 2QMKA 4XV0A 5D2WA 1W54A 5K7JA 5AB3A 2G50A 3C4UA 3WQ4A 2PWDA 1TR9A 1M7PA 3AIWA 3ARVA 3II1A 1Z3NA 4JL2A 1I2QA 4B5SA 4M6PA 3G24A 3TQPA 5CBJA 3BOLA 3CMGA 7TAAA 2FN2A 2QEZA 2O9RA 1NOWA 5IBXA 2ISWA 4M80A 2WO5A 4W7VA 4K68A 4FR6A 5D9MA 1NP2A 1W3IA 4XTDA 3E2SA 4R27A 4R88A 3RPTA 2QDHA 3NVTA 3KBVA 3QSTA 3E0LA 5EFDA 4XAGA 2WHLA 4B9ZA 2PDCA 2PP1A 5CPOA 4N9DA 1G4EA 5DY2A 2REQB 4MY9A 5HJLA 4PYSA 2AMXA 1GOQA 3M7WA 4XUGA 2CZVA 3TYAA 3D3AA 4MB3A 4QE1A 5A2CA 4B3LA 1C9DA 1FHLA 5U7SA 4JQ1A 3C2RA 3ITGA 3N2BA 1I2OA 5JBDA 3CZ8A 4C6MA 1VHCA 2IMRA 2FVLA 3WL1A 2XVLA 2F6UA 4G2DA 3DYPA 2GK1A 2CBJA 3KOXA 5FEXA 1ECQA 4C6EA 1WBJA 3I6TA 4FX6M 4F0SA 3OA5A 2NV2A 4DBUA 4PBGA 1C90A 4L1GA 4LGXA 4ZXLA 5CEWA 1LWJA 1CXFA 1W5NA 1IT7A 2QJIA 3CH9A 1ZJIA 3QGKC 1G4SA 1QBBA 3EDKA 4XD4A 1XINA 2ZZ5A 3ITCA 5CQ1A 1ALDA 1F3XA 2R1NA 3GU9A 3B9DA 1KFWA 2G41A 4O10A 1TWSA 3R6IA 5C55A 2X1UA 3CJPA 4UQDA 1ZQ5A 3H7UA 4M3PA 3CUGA 3SCOA 3WLPA 2GWGA 3NO1A 1HX0A 3AIUA 1TV5A 1L6WA 4KH2A 3DKJA 1UWRA 3L67A 4FNPA 4DO6A 4G6CA 4HYWA 1K6WA 1DJNA 2WVUA 3M7SA 2VOTA 4MPKA 4NX5A 3ARSA 2PSNA 1KGUA 1E1CA 3L65A 5JQ9A 1RR2A 2FLIA 2VZOA 5F1UA 3W1QA 1E73M 1VFFA 3VZZA 4XIAA 3MZNA 4MJ2A 3ZWSA 8RUCA 4IM4A 2I16A 4ZEPA 3P3BA 3FNDA 1XUZA 1RLDA 2DSWA 3ANYA 3DZ1A 2J62A 3N2XA 4DWDA 4LV9A 4OECA 3QV7A 2HJPA 5A8GA 2ZUWA 1XCFA 3THQA 4DZIA 1U5JA 3B0VC 3CGTA 3O15A 3T9PA 1W8GA 4I8DA 2JBMA 2D2GA 4H00A 1K4HA 1XLDA 3GH4A 4DI8A 3OLGA 1V93A 3BARA 3UJSA 6TAAA 3SFKA 2PDXA 1XDMA 3W37A 3ZWTA 1VC4A 3KX6A 4P8XA 1UP0A 2P10A 3C2OA 1P0BA 4JAWA 5ENLA 1TVPA 1UIPA 2HXTA 1VRXA 3H7VA 1GPWA 2J74A 1HG3A 1GKRA 4WJXA 1HL9A 2YYUA 4MOZA 4KWUA 2NXIA 5LGXA 3CIXA 3W1XA 3WH6A 4W88A 1BYAA 3E38A 3S83A 4DF0A 1PV8A 1RLCL 1QNQA 3BL3A 3V1HA 4JTUA 3LZ3A 5I7GA 2W79A 4G7FA 2Y2KA 1SZNA 2J8FA 2EAWA 1XLCA 3TROA 3GC2A 3MHUA 4AZCA 1B3ZA 3F03K 2OYLA 4AD0A 4DM1A 2EG7A 1RXOB 3A22A 2ZWYA 4LU0A 1SQ7A 1TWIA 2BMBA 5LNVA 4NZ3A 3PULA 5K4ZA 3B4UA 1R2TA 3M0JA 4JDBA 5AHMA 4A3QA 3SCTA 1WKEA 4RDVA 2XFWA 1XBVA 1IIHA 1TV7A 4UQ9A 4ZQOA 2QJGA 5T8GA 3CL7A 1R3QA 1TV3A 1Y7VA 1RCOB 4CD8A 6ENLA 5T26A 3RX3A 4RJEA 1TSIA 3GTFA 1E40A 2XGBA 4RZ4A 1JZ7A 2IUZA 4NJIA 4A2SA 4GH3A 2H3DA 3FN9A 4WJEA 1A5OC 2DP3A 3W29A 3NG3A 2EKCA 3DFNA 4AD5A 4JTDA 2ESCA 4O11A 3O6DA 4H41A 2E6FA 2E9LA 4CEUC 1MQQA 2YBTA 4E4UA 3BUVA 3LD5A 3BV4A 4H9TA 4A22A 4IPIA 1WXZA 3EB4A 2H3BA 1ZY9A 2V5BA 3BK0A 1UD8A 2X41A 4NUWA 4XD3A 2E6AA 4N6FA 3P67A 3T81A 3CQHA 4LS2A 1KM1A 4D8LA 5I24A 3UVIA 4F2BA 1ZZMA 4XSLA 4D8AA 4QBXA 3W2NA 3XINA 1HQTA 3NPXA 2ISDA 5G1MA 3M4HA 1CXLA 3TQKA 3QPZA 4BS0A 1MEWA 4H6QA 1XICA 3RCMA 4ROPA 3D47A 4UTMA 4AWTA 2YB1A 4CQBA 4IBDA 4PBFA 5DMNA 4OBTA 4O8AA 2BODX 2PDJA 1S2UA 1ME9A 2O7SA 1GTHA 3GR4A 5H8UA 2BGSA 4PL2A 2WMIA 2Y8VA 4FIRA 3EX1A 1E9ZB 3IJ9A 1YE4A 3VU2A 1S5TA 2P88A 3GDKA 3TFCA 2Q8XA 5LNSA 4UMCA 3MUY1 4HJWA 4ACYA 3APTA 4P7OA 2CLKA 1DIDA 3T4CA 3TCEA 1UUMA 3DERA 3LNPA 3MY9A 1B3XA 5D9PA 2B7NA 2Y2IA 2EHHA 5AYZA 4C6QA 4B4HA 2WHJA 3H4WA 2CESA 2YBUA 3NDZA 2P8BA 5BMXA 3MMUA 2W0UA 3BO9A 5K9CA 5E9XA 4F2UA 4PODA 3UR2A 5HQLA 2AKMA 3KWXA 1F8IA 1UWAA 3GWQA 3NNTA 1Z32X 4GX9A 9RUBA 2YW4A 4DO7A 3BLFA 3EEZA 1QOXA 4LVAA 3BDKA 3URQA 3N15A 4D9PA 2A4AA 3OZYA 3GDLA 4QGCA 5CZSA 4HK5A 3S9ZA 1E15A 4IUGA 4FALA 1W3TA 3WZ0E 1ZUAX 4K7VA 3M9YA 1B3WA 3V7PA 3SCUA 1XQKA 2DJXA 2GDUA 4KFOA 1PHQA 4C6NA 3EKZA 2P50A 1GOWA 1ISXA 4AYGA 1A49A 1QW9A 5E5CA 4FOKA 4TX6A 3WNOA 3GDMA 7XIMA 2QPUA 4ECLA 3AMDA 2XGIA 4WZHA 4D6IA 1GHSA 4GABA 4DBSA 3MP3A 3VKJA 4KKXA 3IVTA 2WW5A 2QF7A 2R1MA 1GOMA 5C9WA 3HONA 3G1RA 4MKSA 2PRMA 5FEPA 4AUBA 3TNOA 1VIZA 3GU2A 2ZFAA 1ZJBA 4IQDA 5D38A 1PDYA 1T7LA 3SN4A 3UCQA 3LLFA 2OQYA 3KBMA 2BX7A 3TE9A 3RIKA 1UR1A 1YU1A 5AYXA 1P43A 2RGLA 5HAOA 2GLKA 3PJXA 4J28A 1A4MA 2C0HA 5EMKA 3PBMA 2PBOA 3TZNA 3CHDA 3S4TA 3QRHA 5BU9A 3WH5A 3QQ0A 2PGEA 4LUTB 4IPLA 2R24A 1WOBA 4B5TA 3TQVA 1GEQA 3I4KA 4AVNA 3O9NA 2VOMA 1TIWA 4LX4A 3M7PA 4LAUA 3P84A 2WC4A 2VZVA 1O1HA 2O92A 3LHUA 4YVPA 1BAGA 2FGZA 1V77A 4GJIA 3VD4A 2ACUA 3HGRA 3THDA 3Q4DA 3CYJA 3BJSA 1PIFA 2D20A 2PMQA 2C19A 1O94A 2YA2A 1A5UA 4Q4QA 3H2MA 3RRXA 2D0HA 2IKHA 3I7SA 1J0YA 5XIAA 1V79A 1I2PA 1Z69A 4PRWA 2DIJA 1KRCC 3WLLA 4LUJA 2YGYA 1QATA 4XKYA 4GY1A 1P0DA 2VR2A 3IIXA 2INFA 1OCNA 1G67A 5BRQA 1F7BA 1WPCA 3PPCA 3O06A 2X30A 3OG3A 3QGVA 3WFZA 1H0GA 4CNNA 4PMOA 4G5DA 1LDCA 2XYLA 3IGHX 2GYIA 4PUJA 4IBKA 1MRQA 5CPSA 1WDSA 2ZRYA 4M24A 1K7FA 2GVYA 4L1WA 4M6QA 5CGTA 2J9YA 5CKSA 1ISZA 1XRVA 2I17A 1ITUA 4NF7A 4FIQA 1FKXA 1VPYA 1OGBA 5D33A 4JIQA 2XVPA 1W3JA 3ICJA 3E12A 3MUIA 4L80A 4LS1A 4JFTA 2OFJA 3FHQA 1RVGA 4V1XA 3E0IA 3GVRA 3NSNA 4NHVA 4QX4A 3PZNA 2HS6A 2ZUTA 3L4XA 3MC5A 2VZUA 1UJQA 4B16A 1MMFA 3PBWA 1XISA 4QDWA 4O57A 5E93A 1XGEA 1F3WA 4RLIA 7CGTA 1NAL1 1AQHA 1CGTA 1XLBA 4QM1A 4MHBA 2OEJA 5HULA 5C9XA 1DP0A 4M8UA 4XG1A 3E02A 2DT0A 2V2CA 2V2HA 4MSSA 3THUA 2PCEA 3L68A 3EWWA 5D9NA 3KE0A 3BAXA 1EDGA 4DX3A 2CLMA 4OKDA 1QCWA 3HFTA 4IIGA 1GORA 1THFD 1OYBA 1F73A 3GBEA 3M0ZA 1B0IA 1W31A 1XLMA 4H7VA 1HGWA 4RW3A 4J3XA 6REQB 3W7LA 3OOQA 2OZ3A 3REQB 1ICSA 1XXXA 4EPKA 1J0KA 2WVVA 1C9WA 2XVNA 1Z89A 3W7GA 4LB4A 4XZHA 4BI5A 1W1TA 1V3IA 2W3ZA 1R9XA 2DH2A 1G4PA 3R1ZA 3R0UA 5MKGA 2E77A 3CAWA 4JX4A 3DKLA 4DJFA 2VMFA 1LQ0A 4HTBA 4UTTC 4XTIA 3B03A 2D0FA 3QR0A 3QPYA 4XISA 2VXNA 1R46A 4I9AA 1PX3A 1F07A 4L5ZA 1TPDA 5F4XA 4LFYA 4Z1YA 1GVYA 5AHFA 1JCXA 1QI4A 3P6LA 2BWGA 4QLKA 4U2ZA 1H11A 4UFMA 4XO6A 4WRHA 4HPXA 4F9JA 3LPOA 3DENA 1JULA 2BXYA 5HR7A 4JYDA 4E2VA 3M1ZA 3NPVA 3BCDA 3QVQA 1H1ZA 4W7UA 2YL5A 1JPMA 2C18A 3EB2A 2Y0FA 3PB0A 4GXWA 4LRTA 1ISYA 4BWLA 3WDJA 2VUYA 2DGAA 3TSMA 1OFDA 2BZNA 2L5HA 3UYIA 3R4IA 2CKSA 1JXKA 1G4TA 1O95A 3L21A 4FLRA 3P8IA 1KBBA 1MO0A 1VBGA 2WWDA 1UZ1A 4IGSA 4O19A 3M07A 1S46A 4YJ5A 2O4MA 4LS0A 4AX7A 4FOJA 1AQFA 1LG1A 4XK2A 2YLAA 3CHCA 3AYVA 1XQLA 3EX3A 2E3ZA 4S23A 3BH4A 3CEUA 1XKJA 4WLCA 4LWWA 1DIKA 5CSYA 3T42A 4LV4A 2WJFA 4L6DA 1KBLA 4UTJA 2QCLA 2CZ5A 3GNXA 4U5IA 1ED7A 4MB1A 5G5IA 1OC7A 1V02E 3PWAA 4XZ9A 4L6OA 4D6EA 2X1TA 2VCBA 4IXXA 4M51A 1B57A 4HVXA 2DZUA 4FK9A 3OU8A 1R3TA 1EC9A 3S1WA 4PUDA 1EZ2A 2HRWA 4IQJA 2C1GA 2PTXA 3EB3A 3PWGA 1UC4A 3CQKA 4H8UA 4TX9A 3UG5A 3EKLA 3GTXA 1UQZA 3DIPA 3SN0A 2BHYA 3RLUA 4FPSA 3A3HA 1WBHA 4BEQA 4BQ3A 1E51A 1F6YA 2VEFA 1UD6A 3IJDA 1ONXA 3HGOA 3AXHA 3B8UA 4NZCA 3ZXWA 4Z42C 3OGVA 4B5WA 4FLOA 4JIHA 1R0MA 4IL2A 1R7OA 3BOFA 3ZLHA 3MBDA 4GQ0A 5BXPA 1O7AA 4TVDA 1J0JA 3V36A 1GJWA 4J3TA 4AZIA 1XYAA 1CLKA 1EP3A 4AF0B 2DZWA 2AGTA 3BE7A 1PVNA 4HJFA 4HNLA 2CCRA 3NA8A 2D73A 1UP2A 4RL3A 1H4PA 1XGDA 5A8MA 3WBAA 1L8PA 3UPWA 3WD1A 3Q94A 2QCMA 4RDYA 4O4VA 1RUSA 3W7NA 1MXDA 3FEMA 3GXFA 2FDSA 3UA4A 2GJNA 3V5CA 4FO4A 2CLEA 3PSVA 3GHSA 2QYGA 3R89A 3GHUA 4MNKA 3UPMA 1AD4A 3AMCA 3L2LA 4EVZA 4M6VA 4HSHA 1TJRA 4J2PA 2PPGA 2J24A 1FWGC 2NQ5A 1JFXA 1RPKA 2XPKA 4MB4A 2P3EA 1HJQA 3W2MA 4OWGA 3LXAA 4D71A 2O9TA 3ARPA 4N4PA 4ZQNA 4NASA 1QPKA 1VBUA 3UWVA 1KWGA 4C6FA 2Y61A 2W67A 2Y8KA 1TQXA 3ARQA 5FF3A 5HWNA 2E40A 1TTQA 3MWAA 3L4TA 1XP3A 1GW9A 2PD9A 2NSOA 1A5SA 3PBGA 4OE7A 4Y8FA 2EPMX 2NUXA 2E1WA 3L0GA 2JKPA 3EWDA 1OX4B 1WZKA 3WK2A 3B9AA 1O60A 1TE1A 1D3GA 4NYYA 1I60A 3QC0A 2F2KA 3WBYA 2EPKX 1W37A 5F2LA 4UTFA 4QITA 4FMVA 1EAKA 4J5NA 1S39A 3TW9A 4BI6A 3W7IA 2ATMA 2WMFA 1AUSL 3WQEA 2WCAA 4H6EA 3EOUA 3GAYA 4QAWA 1FWWA 2OX4A 2PP3A 3F4CA 4RV8A 3EA3A 2R91A 2V5CA 3RDKA 1M04A 2Z29A 1ELSA 3L29A 4NZFA 4Z2JA 1OFRA 2V5KA 5JBEA 3QYSA 3QXBA 4OJPA 1U1JA 3IK2A 4ZGYA 3P60A 4UFHA 1TUXA 4TUFA 1HKIA 1LF1A 4Z1CA 5DCDA 1PIIA 3I3EA 4Z1DA 2VUNA 3WG6A 2WYSA 4Q4PA 3L2MA 3CYVA 3I4EA 1HXJA 4R53A 1YQ2A 3EX2A 5E0KA 1KM0A 4WD0A 2XD5A 1KS0A 1VP5A 2AQVA 1DJXA 1P0NA 3WLIA 1UKOA 3IV8A 4PEKA 3RCNA 4E5TA 5A5WA 2DUAA 3QOKA 5DRCA 3IJQA 3VIGA 3PANA 3RLGA 2QS8A 1IYXA 5BPVA 2GUYA 5RUBA 1WKYA 4H7ZA 3CMFA 1E43A 3S2JA 1CEOA 3UY8A 2Z2UA 1KTCA 3RO6A 4LG2A 2KZHA 5EY5A 1DQUA 3EOSA 3L25A 2Y63A 3UY7A 3DYOA 1LQAA 1AJZA 3F7JA 3RNDA 2R6OA 3EOEA 1F3TA 1R47A 1MFUA 2OEMA 2PA6A 3L0KA 2HE8A 2EPNA 3PK7A 2F61A 1FWJC 3G5EA 4ZBCA 3MWCA 3SIMA 1AW1A 3TP4A 3FIGA 1IZJA 3CV6A 3BLKA 5FI8A 2Q8LA 1OFOA 5I0DA 3SECA 2XWEA 3AMLA 5D32A 4AZBA 4F0HA 2ZX6A 4EOUA 2DY3A 1POKA 3REQA 1YKWA 1HO4A 2JF6A 3NYDA 2VENA 1OGGA 4FAMA 4H01A 4LB3A 3H53A 1YBQA 3KRUA 4UNKA 3AALA 4M6UA 2GGEA 4UMAA 4OUIA 4JKLA 2R94A 2VYOA 1H61A 3S2CA 1SVDA 1QJWA 1DKWA 3CUFA 5DXYA 2AOSA 1J18A 4K39A 4DWSD 3E3HA 3OO2A 2ZUMA 4DJDA 5EBAA 3RR1A 1JZ2A 2PLKA 3WSUA 4B3KA 1PYMA 4ORMA 3U4FA 2AAAA 1KLYA 2B4GA 2NX9A 3ARUA 3BTNA 2Y24A 4UWMA 5IHSA 1XL9A 2NUYA 4EWJA 1BQCA 4DUWA 1ML1A 1PL9A 3SBFA 2QCDA 3UYCA 4XX6A 4PCTA 2W66A 4BZYA 1F9CA 5CC5A 2POZA 1SFSA 4OJYA 4JIIX 3H7RA 4GNKB 3RGTA 4NXKA 2CNCA 4CD6A 3WN6A 2VDIA 4AZHA 3EGJA 1B3VA 3BURA 1W9XA 3GXMA 1EHNA 3N4AA 1G1YA 2FMOA 4M0XA 1AJ0A 2G97A 1TO3A 5DBTA 5LYRA 4E2BA 4KT2A 1ZJAA 3G1DA 1Q45A 4OV4A 1TPH1 2QCNA 3G3MA 3Q67A 3VOFA 2PWFA 3ABXA 4HZ8A 2Z2AA 2Z2BA 3TYCA 3QV6A 2XG9A 1NFPA 4E0CA 4WXZA 1BHGA 3HTWA 1BYDA 3LM3A 1FTXA 3QZ6A 5CC3A 4W84A 3LY0A 3KBWA 2HPIA 3AJXA 3W07A 3PZMA 4PEEA 3AIVA 1VEPA 2WWCA 5AC7A 3U7VA 2Y2MA 4E8CA 1J2WA 1TWDA 3UXIA 1JDCA 4JGDA 4IGHA 4HGXA 3GY1A 1XDLA 4AD3A 2JK2A 1ZNNA 4CN1A 4IGMA 3EYPA 1GZGA 1SMDA 1EC8A 1LRTA 1E9IA 4NL1A 3TN5A 4KCTA 3N3FA 2ZE0A 2I5GA 2BP1A 4DUXA 4CN6A 4B3ZA 5K3VA 3T07A 3FK4A 1EPXA 2DIKA 2XVKA 3QHNA 4PCFA 3LMZA 3ZJ8A 4PMDA 5HQMA 3I6EA 3B06A 4AZCB 5A8PA 2J6VA 4DN1A 4CQDA 1UKTA 4GH1A 3RILA 3LDVA 3WK3A 4YTTA 4TX8A 1D3CA 2DZVA 4RZ6A 1VJZA 4FXSA 1P7TA 5LHFA 3C0QA 2G4FA 3U48A 2X16A 3T55A 1TFVA 3I7RA 1LM1A 5HWJA 3LZ5A 3W6YA 4XIMA 1E3XA 1LYXA 4Q8VA 4GKTA 2CHNA 4MWAD 2ON3A 2OLAA 4RCXA 1SJDA 1Z41A 3MO4A 2GOUA 2C71A 3WLTA 4JQ2A 1YLVA 1QNOA 5BCAA 3EOOA 1Y5XA 4KFNA 1XHGA 2PBGA 3LERA 1GG0A 4ZA0A 1U2YA 4V15A 3FKEA 4MZYA 3SFWA 1EB3A 1FWIC 3RJXA 2FGBA 1ZCOA 3QC3A 1VF8A 1EJSC 5E6ZA 4Q4SA 1IZCA 4IX0A 4QEEA 1E6XM 1DWJM 2GUBA 3IRDA 3VOGA 1P48A 3QMRA 4UQCA 2CHRA 3AXKA 3LA4A 8XIAA 4NX0A 1YDNA 2Y8UA 3D46A 1JNEA 1KW1A 1J79A 1Z6KA 1R2SA 3IGSA 2QKFA 3BMWA 3GU1A 1W9DM 1E4NA 4WSJA 3SCPA 4AYSA 2FPVA 1ITXA 3IK4A 3CHFA 5DELA 1BF2A 3LTPA 1NDZA 2PGWA 1XLKA 2ZIDA 3UR8A 4X2RA 5TIMA 1I4NA 1GKQA 3CUXA 2Y62A 3NEHA 4DWSB 4MZ8A 1MZHA 2WVTA 3ZS4A 1BVNP 3CV7A 3MI3A 4MAVA 2J77A 3BCFA 4AZ5A 4HPHA 4YWSA 4MKVA 4IT1A 3TNBA 2AL1A 3GDTA 3QF0A 1S5VA 3SN1A 2G3FA 3GR8A 4L7ZA 2VCAA 4US5A 1FA2A 1K6AA 3VINA 4XZBA 3PTQA 4GI4A 3DHFA 2V3DA 4GO8A 3N3TA 5E0CA 4K2SA 3TW6A 2AQWA 2BSLA 3T44A 1BWVA 2DZPA 4O14A 3LRKA 4QIUA 5IBXC 1HKVA 2WSPA 4AHQA 4FR1A 3DFHA 1Y5WA 3VOHA 1L9WA 1Q6DA 3CIVA 5HPCA 1IGWA 2Y6ZA 1Q6EA 4PUMA 3T4WA 4O52A 1UA3A 2VGGA 4JEJA 3VOCA 4M7SA 5CG7A 3AS3A 3A9BA 3HPZA 1YYAA 1TREA 2WKLA 5CPLA 4IIEA 3OPSA 4RW5A 3GKAA 1ONRA 3W73A 2ABBA 1E6SM 2BY1A 1TRDA 3NQ8A 1KRAC 1MW3A 2ZXBA 4BCEA 3AO0A 3FDGA 4C1LA 1N8WA 2ADAA 3NSXA 3B9NA 4M56A 2FZBA 3M5ZA 3PJUA 2DZXA 1YEYA 2WKJA 4LVGA 4EF8A 4KIEA 4E2DA 3GG8A 1NDWA 3GVGA 3L12A 1M01A 3BLDA 5XIMA 4WKAA 2OVLA 3RF9A 5BOFA 4QLJA 4EXAA 3TMLA 1UWQA 4UTIA 4GYFA 4L6HA 2C7FA 3HZ3A 4K1GA 2BY3A 3NO3A 1JG9A 4W86A 4M82A 2KAUC 1EHAA 2WM1A 1FDYA 2X1SA 1IXNA 2NT0A 4PMUA 5I07A 4UOQA 3URAA 4H9ZA 3WF2A 4DF2A 3SCQA 3GKFA 1I1XA 3BSGA 4WK9A 3NZ1A 4IMGA 2RDUA 3I65A 3IANA 4WJ8A 5F2GA 3TH6A 3BW2A 3BMXA 3OVGA 4ERIA 5TNVA 4Y9PA 3PR2A 1VB9A 1IZKA 3PFRA 4Q8TA 2J7DA 1JUKA 5KINA 3VZYA 2OU4A 4PMYA 2VX5A 1NP0A 3EX4A 2WSRA 1HJSA 3LM7A 3WMBA 1G94A 2Y2GA 1T99A 3AQUA 4X63A 2PF8A 4E3TA 2YB4A 4DAFA 1OVDA 4Y96A 4WCJA 1R3RA 4LCRA 5H6HA 4NZ1A 3V18A 3MHFA 5BXTA 2GQ3A 3KVLA 3JU2A 3POHA 4Q8WA 2C15A 3KFTA 1WYIA 4FXRA 2FDMA 4UNIA 3IS4A 4QNWA 4MPQA 3W28A 5I06A 3LMYA 4DM2A 5A8NA 1R6WA 1MNZA 1RJRA 5FA5A 4ZFMA 3THAA 3QBUA 3WLMA 1AL8A 2NXHA 1W91A 2ZX8A 1IEXA 2Y2WA 1ZBWA 1XSIA 1F8MA 1XLEA 3VGDA 1XW8A 4ZB5A 3ZZ1A 2IPWA 5AHIA 3PUEA 5LA2A 1KXQA 4V28A 2F84A 4RNHA 3N9RA 1KB3A 1QK0A 3RAOA 4EIVA 4GE8A 2DSUA 3WQWA 5A2AA 1NQKA 1MEIA 1GNXA 3E5PA 3WDQA 1T0OA 2CBVA 3IIZA 4F0MA 3NEVA 5G4EA 1JUEA 4HNVA 5JBFA 5LXEA 1U22A 4JN8A 2XDFA 3UZWA 1EQPA 3UESA 4AMCA 3KBNA 3P0XA 3UGVA 1V02A 3NDYA 2YW3A 2X7WA 1JCJA 1NOUA 3FOKA 3O7UA 4PE8A 1DJGA 5FEWA 4DB7A 4FF7A 3KHDA 3K2GA 4HK6A 1QPRA 2R1KA 2Y7GA 4XZNX 4UR7A 1JR1A 5CAKA 2DQWA 2VFHA 2X0SA 1JRCA 4HCHA 1S5MA 4CCZA 3M44A 2EO7A 2CLPA 1P4CA 1E4IA 3P80A 4DPPA 1MDLA 3CB3A 4ORIA 4AISA 4J3ZA 3AIQA 1C8VA 2GGJA 3GTNA 1J0HA 2VZTA 3C86A 1ITQA 2XGZA 4QAIA 3DG7A 2ZICA 1UR0A 3PZIA 5H91A 8CGTA 1BG9A 3F4DA 1HL2A 4G1KA 1P0EA 1KXHA 5XINA 4A8RA 3KL0A 4GQBA 3UR5A 5GNYA 2VC6A 4JNZA 1Q6QA 4NKCA 1HJXA 1ZRQA 4HCLA 1VIWA 3P81A 4MWAE 2ALDA 3IJ8A 5GJPA 4CCEA 1OZMA 2ABAA 4MKNA 1R86A 2CKRA 1YE6A 2V5OA 4NNCA 2MUCA 4O53A 4YTSA 1FWDC 1QWGA 2C8NA 4LOCA 2OLSA 4FOUA 1R3YA 3TOPA 2CZEA 3WDPP 2NZLA 3QEZA 1X97A 4YWIA 1LOQA 2UZ9A 3B8IA 2BVTA 4FNRA 4DUVA 2FJKA 4Q8UA 3HO8A 1PBGA 4FX8A 2ZA2A 4GUJA 3S5ZA 1ZBCA 1K7XA 1Q4NX 2XINA 2NSXA 4GYJA 3AUOA 2VEKA 5FL1A 3HMJG 3N2OA 5IDIA 3NAVA 3R5EA 2PLCA 3LHWA 3NGFA 4NZ4A 1EGVA 3M6DA 1IT8A 4EE9A 1AIWA 1UH2A 1VFHA 3UZ5A 4LW7A 4GBDA 1BLIA 1X8CA 1UYQA 1TJ1A 1JYXA 5DBUA 3FSUA 4IBEA 3UEQA 4PCSA 1G7UA 1Q5MA 3MDUA 5BXSA 2ZZ1A 1JFHA 5FESA 3SCNA 4TMBA 2GFTA 4E2OA 4C7GA 3SAZA 4P8VA 4RE4A 2OTDA 1L2QA 1UOZA 3CXOA 5JUVA 2A3EA 3T0AA 1F3EA 2J7HA 4PTWA 4UTHA 4QHRA 4M5PA 2WZTA 5H1WA 4AU0A 1E9LA 1ENUA 4HZ6A 1VFSA 3F2BA 2HWGA 1YPIA 1UKQA 3M0YA 4JIPA 3M5YA 1CGYA 1BRLA 4MWAA 2PFHA 3ERPA 3W1TA 3G18A 1DE5A 6A3HA 3GC4A 3ZSTA 4REQA 5AYIA 1EJRC 1CB7B 5CC6A 1JVNA 3H2FA 1D2KA 4NILA 4LF2A 2QPSA 1CT5A 2G95A 1V7YA 3M0HA 3ZYZA 1AH4A 1G69A 1UR8A 4NI3A 5FJTA 1JZ6A 3TONA 1TELA 4BQ2A 2GK1B 3GC5A 3SEPA 5BOEA 4HPGA 4GZJA 3SR7A 3N11A 2AQOA 4HA0A 2PGRA 3HGSA 3H2CA 3A4JA 4CNOA 3BWWA 3TIMA 1PPIA 2YFOA 4Q22A 4HOZA 2AGKA 5JH1A 4OJLA 1KQYA 4CKQA 2JKEA 3APYA 3O8AA 3PBUA 1VS1A 4FF5A 3VGEA 1FH8A 2QVNA 2I5IA 3LCGA 2TYSA 5D2VA 5HPOA 4X2PA 4LRSA 3GIQA 3S2NA 5FJRA 2BGQA 2JCHA 3PHAA 3SZ8A 1Y0EA 1DIEA 3W2UA 5HA7A 4JPGA 4LYPA 3LCLA 2ZZ3A 4B5NA 2A6LA 1CNVA 1KO0A 1U5VA 2YJQA 4RPPA 4Y9MA 4AVFA 1QNRA 1WV2A 2I57A 1E1CB 3B97A 3J7HA 2JQXA 3KBJA 4W89A 4DJDC 3R8HA 2ZA3A 5TD4A 5I09A 1W1IE 1DWFM 5ABEA 3WO8A 3PPGA 3HPAA 1XUUA 1J11A 2A7RA 1DHKA 3R94A 4UIOA 2X40A 3KOZA 1K3UA 4H1ZA 3H2AA 3MSYA 3SUUA 1K4GA 3SUTA 1OZQA 1J10A 4BF5A 1TIMA 3G3DA 5ABFA 3MJYA 1ADOA 4P7LA 1OBAA 4B5XA 3BGAA 3LV5A 3L2IA 7REQB 3W7OA 2DUZA 3G0UA 4F2TA 5CPNA 1P5BA 3F4NA 3PNUA 3Q65A 3OYXA 2FHCA 2GJLA 1L6FA 4W4QA 1RD5A 4C5YA 2YR1A 1HJVA 4OBRA 3DC0A 2C14A 3C61A 1PX8A 5C5YA 5IOBA 3LB0A 2ALRA 3ITXA 3N25A 3ATYA 5D09A 2Z00A 4NZJA 2EEXA 2XIBA 1OYAA 1UUQA 1JQVA 1XPYA 2XU2A 4KRUA 5F7UA 1JDEA 4JHMA 3K4AA 1O1ZA 4K8GA 3CB8A 4HU3A 5DEZA 5J8LA 1JZ4A 5B80A 5LKYA 2ZADA 1SW0A 2CFFA 1TPWA 2UY3A 4LEFA 1BXNA 5AKQA 4KWVA 4DY1A 1LL4A 2XH7A 4JQAA 3IJ6A 1IIGA 3RJYA 1WAWA 1EBGA 3WJWA 3IVUA 2DFAA 1QWKA 2DSZA 4S3EA 1JYWA 4WKFA 1K03A 4OOUA 5ECVA 1H3GA 5HMFA 4HOWA 2AL2B 3KCJA 1M68A 3WH7A 4DVOA 4BEUA 3VE9A 2GJPA 1GZJA 2PCQA 4ZTYA 1VYSX 1RCXB 4CQ9A 4GFIA 3SUVA 1A80A 3KOYA 2VURA 1XBYA 1CECA 1LRQA 1XYCA 3K1GA 1SW7A 5C2XA 5IFTA 2QMJA 3KM8A 4DPQA 1W32A 2WZIA 4A3YA 5C8BB 1JPHA 4Y2WA 4JHOA 3W6LA 8XIMA 3PZGA 1LJYA 2PU1A 1NY1A 2OZ8A 3H6OA 2VI0A 3E1F1 3GZAA 3KVKA 3RITA 2W63A 4S39A 1DWHM 4O13A 3MI6A 2WANA 3W81A 3N2TA 3FX4A 1E6NA 1SO5A 5BNKA 4LC8A 1FP9A 4A8LA 2WLZA 2X1RA 3SQLA 1RA0A 2ZX9A 3WNMA 3V4BA 1C7SA 4W9TA 3VD7A 3AHYA 1C8YA 4K1WA 1HGYA 1IXPA 1GGOA 1OK4A 1ZP4A 4H9YA 1H1YA 2OO6A 4Q32A 2JGYA 1ZBVA 4GIAA 1FH7A 3CAVA 1KGXA 4GIYA 5CBIA 4EP8C 1W1ZA 1KGWA 1QW7A 1B1YA 5CSUA 1C7TA 5DXXA 2O56A 1EC7A 2VTFA 1DBTA 1TCDA 2E5CA 3ABOA 4ACZA 5DMYA 1W9BM 1H49A 3B8DA 1GVRA 4UC5A 3SM0A 1SUXA 1V0KA 1VBHA 4JFUA 4B2DD 1OX5A 1EEXA 2W61A 1OM0A 3OLDA 2IPGA 3H54A 4POCA 1LROA 3PZQA 3VMNA 2G4JA 2V82A 2V63A 1TPEA 2V38A 1BG4A 2GQAA 4JQ3A 5EMMA 3PG9A 3SCVA 4G56A 1O5XA 2P3ZA 4DZ5A 3NVDA 3AICA 1YX1A 4Y90A 3T40A 1V6WA 5D4YA 1HW6A 3H12A 3GNPA 2DJLA 4I7UA 4QRNA 4PB3A 5J04A 4GXPA 4IWWA 1YHTA 4I6KA 2A0NA 3W3OA 4HMNA 3C56A 1MEHA 1B4EA 2OCZA 1E3ZA 1EIBA 4DIAA 1XWYA 5KTLA 5A94A 3WMSA 5HINA 1JD7A 3QKEA 1UR4A 3GUGA 4OJ5A 3W7CA 5C2CA 3WDIA 1TCMA 3G1HA 1VENA 3IEBA 3KDNA 2RHGA 3PBYA 2XM2A 4S2CA 2D0GA 4Q6JA 1RP9A 4DJFD 3FYPA 4UR8A 1TV4A 4W85A 4EX4A 4RXFA 4WGHA 3L4WA 1JIBA 2CYGA 3OBEA 1P1MA 1US3A 2CZDA 3OGRA 5CJ5A 5AVNA 3H55A 4IBGA 3HPXA 4LANA 2V69A 3TX9A 3S1UA 3V75A 2YSWA 4GC4A 4A35A 4IMDA 2VWTA 4F66A 4NIRA 1EH9A 3PAJA 1VFOA 2V5JA 1QO2A 3CZLA 4EK7A 1FWTA 2XN0A 1QT1A 2Y7EA 4DRSA 2PDFA 4NJGA 2Z1BA 2VEIA 3B8WA 3CUZA 4GA8A 3VIIA 1E4LA 2B7QA 3VUPA 5BWFA 1M7XA 3UWWA 1XBZA 3KTSA 4J4KA 1V0LA 2OXNA 1VZWA 2CWNA 1VPXA 2WZHA 1OABA 3BZGA 4JX5A 2GVEA 5E70A 3UJ2A 2FKPA 1E5NA 3U6WA 1EF2A 3K46A 3I10A 1UZDA 1RVKA 1W1YA 2CBUA 5GVJA 2W91A 2EPLX 3M0LA 4GHLA 2C13A 3TYUA 5EMJA 1KBKA 2OR2A 5D2XA 1L6YA 1N8FA 4Y7EA 3BICA 1IEWA 3CBWA 3UG3A 1WQ5A 1AK5A 3AYSA 4TV5A 1ZALA 5HATA 4B5UA 3GR7A 4LUYA 1LG2A 3BLPX 2FZNA 4O0KA 1JPIA 1IGSA 2QCHA 3C3UA 5IFPA 3HJEA 4NAFB 1UPPA 3W75A 4Q7IA 4D6DA 3MANA 3CZGA 4Q3MA 1XI3A 2C79A 4FNUA 4L4PA 1FY6A 4H9UA 2OGJA 5EFFA 1VYPX 3LK6A 4BI7A 1SFJA 4CVUA 1X1ZA 1IEQA 4WUIA 2JALA 1IWBA 3EPOA 3SSJA 4RPQA 5I78A 3GTIA 4PTXA 1C93A 3FYYA 4ES4A 3WBWA 1REQA 4GGBA 3QY6A 3OP2A 4CU8A 2ZKMX 5I3HA 3ITOA 4IPPA 1RSCA 2O55A 2W92A 3ITVA 3CZJA 1VRDA 4MY1A 3TWBA 1ECEA 4IBCA 1KFJA 4KMQA 4PRRA 2ZRVA 3NOYA 4Y9AA 4S3GA 2OZTA 1XIDA 1HVQA 2G8ZA 1JYNA 5T9BG 3BQ6A 1UD5A 3EDDA 4KWOA 4EACA 4GGHA 3QZEA 3WQCA 3WNLA 4WEVX 3TA6A 1SYTA 2JKAA 1V0NA 3DHUA 2A3HA 3STGA 4AY1A 2J9XA 3I3BA 3W7DA 3W7PA 2Z1SA 4H83A 3DX5A 1WUFA 3A3XA 1TE6A 1K1DA 1JQXA 3AHTA 4IMCA 3VZXA 1PAMA 4GUGA 1XRSA 4DJED 4TIMA 2CITA 5DF0A 4W5UA 1QDSA 4N6EA 1FUYA 5FJOA 3EX6A 3KDOA 2WBKA 3FJLA 4L56A 1IXOA 1UHVA 3G1FA 5JU6A 1R85A 2IS7A 4HSNA 1G0CA 1XH2A 1RV8A 4E3VA 1OG6A 1CGVA 2DPEA 1V6TA 3IRSA 2GVLA 1UROA 2G5WA 4UTWA 3QFWA 1XCWA 3WF3A 3DESA 4J3VA 3TLLA 3LPFA 1RH9A 3LGDA 3RXZA 2V68A 2YL9A 4K37A 1XLGA 1JJKA 4AHPA 1W56A 1B54A 4PTDA 3SUWA 3CASA 1LLOA 1Y5VA 2ZDSA 2V2DA 2Y4SA 3RR4A 3LBOA 2PUZA 3FDKA 4LYQA 3UXKA 1DHPA 2VX7A 2NT1A 3B8VA 4AVOA 1CXWA 1E56A 4KGJA 1TTIA 1JUBA 3WEZA 3PUGA 2YDRA 4LVBA 4F48A 4R3UA 1OD8A 3WKZA 2VC5A 3FVDA 4AWSA 3NQCA 1E6QM 2Y5EA 5K9DA 3IGXA 3NQ2A 1V3MA 5A1AA 1RBLA 3OYZA 4V27A 2ZE3A 4DYEA 1UASA 4Q33A 4S3AA 2WQPA 3EDJA 4HMCA 4CU7A 3WK1A 3GE7A 2PP0A 3GG1A 3LNMA 4XKYB 3M46A 2GOKA 4HD5A 2P5NA 1JEZA 5KZMA 1ZP3A 1UKPA 4Q8OA 2PRHA 2ZRUA 3ENLA 2QT3A 1GPFA 4QJ3B 2QNEA 3VKDA 3IIVA 1FKWA 1XLJA 1JZ3A 3B04A 1RBAA 1CGUA 3L27A 3T09A 3L4YA 4UTTA 4IMAA 5E1QA 4Q8PA 3TC7A 3RO8A 2Z0IA 4QJ4B 1JDAA 4C6KA 1RAKA 3B40A 2D22A 3A21A 1QK2A 4CGTA 2VM8A 2RDTA 4Q4RA 4GYPA 1TMLA 4UFLA 5AZ1A 3GH5A 3ATZA 3PJWA 3NO5A 4QTGA 4F0RA 1K9FA 3N34A 1J7MA 2X2YA 4ZB0A 3QR3A 5CJMA 3BAKA 3LI0A 5F2IA 5A6LA 3AS2A 3WL0A 2D69A 4B5VA 2FB2A 2FPTA 3S3GA 2QGYA 3U0HA 1SGJA 2J66A 1PZ0A 5F2MA 3D3FA 3RK8A 3LS9A 5JIPA 1TPVA 1FWCC 1TG7A 3GM8A 4ZMGA 1HFBA 2NX1A 3W7EA 3K8KA 4KIRA 3TYDA 1CBGA 1W3KA 1H8PA 3QMTA 1LWHA 2CW6A 2ZWZA 2D3NA 4PUUA 1S2CA 4LBSA 4PFHA 2A85A 3NWRA 1CZ1A 1V3KA 1G01A 3GW3A 4I9TA 4AD2A 2TSYA 4EF9A 3QSRA 2F7FA 4AIUA 4YTRA 2VJXA 2PE4A 3B0UX 4IPNB 3QFEA 3CWNA 3A3WA 3N3MA 2CPUA 1YNYA 2PTZA 1GVIA 5DO8A 1ME7A 3TN4A 1M6JA 2BG5A 3WQDA 1REQB 1SO3A 2E7FA 2ZC8A 1B30A 4YNGA 1AFSA 4IBBA 2BGNE 3E9AA 1H5YA 3FSTA 5T9CE 1BKSA 3MSDA 2E6DA 1DJIA 4ZL1A 2RJHA 3HF3A 1VHNA 2PDWA 4U3AA 3CPUA 1TA3B 1LBMA 3IAQA 1FWSA 3ZR4A 3TJXA 2CLIA 1Q7MA 5KEZA 4IF2A 2EJ1A 1OT1A 3K4DA 3LI1A 3VGHA 2OPJA 2QCDB 4UTUA 2CXEA 2DZTA 2Z1XA 4J9JA 3G0XA 1VYRA 3LENA 4ZO9A 3UNTA 3OZMA 4UQAA 4WDWA 1TA3A 4D8ZA 1KTBA 1X7IA 5AC4A 1BYBA 3TUUA 4K8HA 3P0WA 3FFSA 4LAKA 4PZVA 2CEQA 1PEZA 4H19A 3BG9A 2DSKA 1A5CA 4PULA 3W0KA 3HIJA 2PF0A 2J75A 3G0SA 3QKZA 1A5BA 4OBSA 3CV2A 3DFPA 2JIWA 3KHJA 3KVMA 3ONBA 1CXKA 1QAPA 2OO0A 5DX7A 1KWKA 3NQGA 3NPWA 3W2JA 3OZPA 2E8YA 3PSWA 4D1IA 1GEHA 1A5MC 3CLMA 1WDQA 3N6HA 2POTA 3AS1A 2E8ZA 5D03A 1T96A 3N19B 4AZGA 2ZZ6A 5HR6A 3L0NA 2XHYA 1HKKA 3G22A 4ZO8A 1IEVA 2UWFA 1MZRA 5C6MA 1KM3A 3C5QA 1GTEA 4LY8A 2VFEA 2PWGA 1ZGDA 1B9ZA 2QHAA 2YDSA 4LAOA 2Y2OA 4IISA 4LUSA 4TU1A 2RH9A 5LXXA 2ZDRA 1G6CA 3A4AA 1MSSA 1LOSA 2WHMA 1S2AA 3EAUA 2GJXA 5CCZA 1L6JA 3VIFA 4HZMA 2BNJA 3QR1A 7PTDA 3PZ9A 1E0UA 3UPBA 3R11A 3RPDA 2I14A 2PZ0A 4KF1A 1UH3A 3HG4A 1ISVA 4I5XA 1XS2A 5E9AA 5DY3A 3S42A 4JS3A 1Q66A 3FYOA 3G1YA 3B0PA 3N9KA 2EKGA 2Z6IA 2G3IA 2E9MA 2ZVRA 3SY1A 4L4MA 1F6KA 4GPNA 1FXQA 4HKPA 3MJMA 1V08A 1VGAA 4JHZA 4RE0A 2P1FA 3DFYA 3QY8A 5CSRA 3W7RA 4AB4A 2YZRA 4CD7A 2F6KA 4I9MA 3OVPA 2HROA 4TOQA 3DN5A 2IXUA 4XZMX 3SJ3A 5LNUA 3QZAA 2ZTJA 3C2EA 1AZ1A 3AZRA 3WQOA 4QG8A 3L4ZA 3W38A 3HA1A 4Q4KA 1CCWB 2ZVIA 4RXGA 4DO4A 1E0XA 1H2JA 1FCQA 4UTKA 5CLTA 2NV9A 3ZFHA 2YXOA 1XFCA 3MV01 3DBPA 3MKCA 3T0BA 2YFNA 3VC5A 2PD5A 4GXMA 5I6SA 4IFKB 3NL5A 4IIHA 3VYLA 1QMLA 2QVHA 5FF2A 5J5DA 3VILA 3KZSA 2P76A 4IJRA 2G3MA 1VH7A 2WSKA 5IRPA 1FCUA 3T78A 4MUZA 4J3UA 3HV9A 4NXSA 6TIMA 2Z7GA 4NT0A 4G7EA 1OT2A 4FP1A 3W53A 3W26A 3EWXA 3U3HA 4B4FA 5HMSA 3INPA 2R8WA 3WYZA 3S1XA 3P93A 3TAKA 3KRZA 3NXFA 4GRSA 4XZLX 1W1B1 2Y85A 1EOKA 1LQ2A 1K8CA 1VAHA 4FS9A 1WA3A 1OCBA 4QXIA 3HPSA 3MDWA 3DFSA 3LCFA 1EJTC 4B91A 1ZCCA 4FNQA 1EJVC 4DJFC 3NQAA 3E2RA 3GTHA 1FHVA 3G8EA 3CHVA 2VC9A 3TU9A 4AIBA 4I3GA 4PSRA 1ZB5A 4TTUA 6PTDA 3H23A 2QUVA 2MANA 2SFPA 5FJPA 4S3BA 3LQGA 2BS9A 3A5VA 1ZSXA 2OSYA 5AOUA 2FZMA 4YCOA 4YTUA 1BEUA 2IW0A 1SZRA 2QIWA 3QW3A 3W2LA 4H2HA 3M5XA 3UCCA 2A5HA 2JIEA 3EDFA 3Q2DA 1ZAHA 3AXMA 1XLAA 1HKMA 1GW1A 3HOJA 2WCGA 2WOQA 1MW1A 4H7CA 2I9EA 1CW2A 1US0A 2ICSA 2OWCA 4FLQA 4O28A 3ZMRA 3FHAA 2OELA 2QV4A 3CPGA 2PGFA 3QM3A 4QNEA 1NWUA 2PLMA 4H9XA 4CQ8A 1FWRA 3AWOA 1OB0A 3NJ3A 3UWYA 5C54A 4ICCX 1O66A 2Z26A 2WC3A 5FJIA 1XIIA 2PDKA 4MDOA 3BV7A 1IWPA 3CM4A 4JZ5A 1FP8A 3LSBA 1V7AA 2GVGA 2Q3OA 4WKHA 4W8BA 1XDJA 5CZTA 1KM5A 4O0QA 8TIMA 1EPVA 1XLHA 4KFPA 5A6KA 1ZBKA 2WXDM 3UGRA 1CIUA 2XIMA 1QPNA 2VELA 4HMDA 2HS8A 1R3SA 4G8TA 3KS5A 4XAPA 4DXXA 5I3DA 3VMPA 2PURA 2X7VA 4O1AA 4LH8A 4JBRA 4KS0A 5D30A 3RM9A 1YU2A 3GLCA 1W3LA 3U8GA 1VEMA 3KS8A 2VEPA 3PUDA 4S3JA 3AISA 3TXVA 4HU4A 2BOEX 4C7FA 3EPNA 2TPSA 1A50A 5BRPA 3O0KA 2XISA 3PAOA 1NWSA 3FCPA 3FS2A 2PC8A 1UBPC 5FF4A 3ARYA 4GZIA 4JIEA 5IM51 1XIJA 1KFLA 1OYCA 3AZSA 5LIYX 3DAQA 1V3HA 1CTNA 1PTAA 1KCZA 3OA3A 3W7KA 2PDNA 2YLLA 3L26A 3WELA 4TMCA 4D6CA 5L9FA 2V0TA 2P8CA 1W3HA 1MXGA 1DXFA 1FWEC 3MVIA 1GWJA 4U5KA 3MS8A 3HPFA 1PTDA 3M64A 3N1AA 5AVHA 3ES8A 1XD1A 3U2CA 4DJEA 1OF6A 3ZJKA 3C0JA 1KC7A 4O50A 3QV8A 1QOPA 1AMYA 4C6BA 3WNKA 1L0PA 1L6SA 2GPTA 4ZB2A 4QEHA 3SO7A 1ADSA 3ZJ7A 2ZZ7A 5HJXA 1EYEA 1PWMA 3T05A 4WSKA 1KR1A 1NEYA 3WQFA 1SR9A 1GONA 3W71A 1EO7A 4TVUA 3VD3A 3RYSA 5I5RA 3UG8A 2PU0A 1A3HA 1EP2A 1F61A 1OFEA 1NU5A 1OFQA 2RAGA 3LBCA 4YVXA 3HB9A 3TYZA 3WD0A 1YPXA 3KUMA 1MWOA 3H26A 4YU1A 2XFYA 3FV9A 3TR9A 2VT0A 3S9IA 1I9CB 2BHZA 4OQVA 4O1FA 4C6JA 1MDRA 3WJZA 1X39A 4JN7A 2PS2A 3VABA 1OCQA 3TTQA 1OIFA 5F4SA 3WDRA 1M7JA 3FAXA 3MCOA 3WMCA 4KEMA 1E88A 2CIPA 2UY5A 1TMHA 4NJKA 4S3CA 3N73A 3TK7A 3OQ8A 1PSCA 3USZA 1DWIM 2XFFA 5CXPA 3M41A 4S3DA 4MJ4A 3E0VA 3UETA 1PX4A 4JY9A 4N4QA 3FVMA 4HA3A 3AMGA 4OJOA 4B90A 3SADA 1UWTA 1GQNA 1QNPA 5DLCA 1FBAA 4MAZA 2QV5A 3OEXA 1ZL1A 3U9IA 2ZRWA 3NXLA 3VIOA 1XX1A 2HTMA 3L9CA 1R5YA 3ABSA 3MUXA 3QTGA 4UMBA 3IACA 3MV11 5I02A 2NQ9A 1VBRA 2NV1A 3IVSA 4H04A 2Q09A 4MVAA 1QO5A 2QUTA 1W17A 5FJJA 2VFDA 5AN7A 3HG3A 1QVBA 3VOJA 6XIAA 1ONWA 2RFGA 4GI8A 1B9BA 4PMXA 2OJPA 3S1GA 3TAOA 1A0CA 5FKYA 3W85A 4KCVA 1W3NA 1KRMA 4QSHA 3WH8A 4H9MA 2BOFX 2ISVA 1SU5A 1UD2A 3PG8A 1MRAA 3KBSA 3GB6A 3H8AA 2AKZA 1IWAA 5BRBA 3WBEA 5A3HA 3B8SA 1DQWA 1YBQB 4P2VA 1DJWA 1TVNA 1DOSA 3AYTA 4D6JA 1QXLA 2GL5A 3A6OA 4S3KA 3TW7A 3LRMA 4N9EA 4MFDA 4AZ7A 3PZVA 1R38A 2Q8ZA 1Q6OA 3L66A 1YW1A 1KM4A 4KESA 1MQRA 2HCVA 1W9UA 4JNYA 3KL3A 3GFYA 3S0CA 4KEZA 1AW5A 2V81A 2NUWA 1EJWC 3OIHA 4IJCA 2PC4A 4RK8A 1E0VA 3SI9A 4IXHA 5M5DA 1OEPA 3URBA 1V4YA 1EUNA 1KXTA 4KRTA 4FLSA 1T6MA 1OK6A 2VO5A 5EYWA 4GISA 2NWRA 3DI1A 4IX2A 3NGJA 3PTMA 3QHMA 3QW4B 4ILSA 3VA8A 2WC7A 5AC8A 4JX6A 4IOTA 3PVFA 3C0SA 3HQ1A 4GQGA 1S1RA 5AC6A 4XWUA 1CGWA 5GNXA 4L61A 3TTYA 1S5WA 3WD4A 1KM2A 1KBIA 4BY3A 3TSBA 4NVTA 1UUOA 1BPLB 3AMKA 4Q4OA 2HISA 4JIRA 2YCKX 3NFUA 3UT0A 4W87A 2X09A 2ODOA 1JI1A 4XB3A 4WF7A 4KWSA 4H4IA 5I3FA 1FWBC 2BHUA 3NL2A 4K3ZA 1HIZA 1TX2A 3ITTA 3LTSA 2FVKA 2PDQA 4C1KA 2INZA 3T08A 4QS6A 4IGNA 1RQBA 1ICPA 4HT3A 3SGZA 2VR5A 1QPOA 1UBSA 1JGMA 2PB1A 2ZX5A 3H70A 3GBDA 3KCLA 3VI2A 2DDXA 5GJNA 4INFA 1GQLA 1NM9A 3L7RA 2Z1KA 4U10A 2DZSA 4DLMA 2IQTA 3H2OA 3DI0A 3CS2A 3ZT7A 1V0MA 1FDZA 1KFBA 3V35A 2GUUA 1FHUA 3BGJA 3S8HA 3TSDA 1HJUA 2D23A 3GIYA 3HBLA 3W27A 2WNZA 1Q85A 2QQ6A 2O7QA 1OIMA 4LVFA 3TC3A 2NX3A 1VKFA 5SWUA 3S5OA 4HSOA 1RQHA 3PPHA 2EXOA 2HQAA 3C2VA 4AH7A 1OFBA 1UH4A 4K38A 2PDLA 4JTHA 3CPRA 4D6FA 5C0QA 3W4RA 4EWND 5HWMA 3N29A 3EPMA 1LLZA 4H8HA 4R7JA 4A8IA 2E1DA 4AD1A 4CNUA 4OIFA 1W2VA 2YL8A 1M65A 3HG2A 2IKGA 1XIBA 4AXNA 4UOJA 4YLWA 3ME3A 3UJEA 3I6RA 4GNVA 1U1UA 5H8PA 5KITA 4X0NA 1IV8A 4JFSA 5JXQA 4F0LA 1UWUA 3EOLA 1RZMA 3VTRA 4YL2A 2JE5A 4WY0A 2J25A 3URNA 3VNYA 4DEFA 4QCEA 2ZBTA 2REQA 4O18A 1SO4A 3T6CA 5HK4A 4A3UA 1TYGA 1KFCA 4DI9A 3NQEA 3GNNA 3CIWA 3MMDA 2VFGA 2UY2A 4D72A 4NYUA 3BW3A 3KZPA 3T7VA 3P5ZA 4JTRA 3KEHA 3GD6A 4UZUA 4M81A 2ZX7A 4BR1A 3S46A 1XH1A 2V67A 4H6RA 1M9HA 4KRZA 3FKRA 3GVQA 1U83A 1TRIA 4J1OA 3W00A 1DJZA 1XYLA 1G9HA 2XH0A 3LHYA 1W5PA 3VKCA 1CLVA 5TBOA 4IJFA 2I9UA 1NDVA 1NF7A 2I5QA 3BG5A 4NJHA 4HK7A 2WKGA 3VO0A 2XZ7A 4AMAA 3U2OA 1GUVA 2XM1A 4Z0JA 3F1QA 3M0KA 3N13A 1Q7QA 3MCMA 1JI2A 4WXYA 3KAOA 3E0WA 5FL0A 3VMOA 1GG1A 5I79A 2ASHA 2PAJA 4WR3A 1NFGA 4EXQA 4NQ1A 4LAZA 2FFFB 2NLIA 3F5KA 1H09A 5TQLA 4J27A 2IPJA 4E4FA 3MO7A 4KETA 1NWRA 2VVNA 4CEXC 1X7FA 4IJBA 1YU4A 4G1NA 3R79A 1OC6A 1FRBA 1EGMA 2IQ0A 4MB5A 5CZJA 3RX4A 4JOMA 4RNJA 1SO6A 3W1PA 1AVAA 2QCEA 1C91A 3W1MA 4ADUA 1EEPA 2EF9A 4H2CA 4DNHA 5EU9A 2QLYA 3G2GA 1TKKA 3ABQA 3ORWA 5C9UA 1CB2A 1XGZA 1K8ZA 2E4TA 5A8QA 2W4XA 4IP4A 1E72M 4J3SA 3B9OA 4ZCWA 4Z2KA 4NNBA 4GI9A 4UTLA 4RUBA 1NSJA 4PMVA 4MUPA 3K4WA 4YTQA 1C3FA 4P5UA 4L9XA 1BRLB 1XR2A 5LZLA 3WIJA 4O4WA 2Y1HA 1A0EA 1ZLPA 5HOSA 2IXVA 3UBPC 1KXVA 1N55A 1CXEA 4EAYA 2AL2A 2BOGX 3KWSA 5I00A 5LNRA 3OW1A 4ZXOA 4C6DA 3UZXA 3S2LA 5KZEA 2WNNA 2INEA 5AZ0A 3AXXA 1UWIA 4O16A 3I68A 3UG4A 3T0CA 2OOFA 3MSGA 1GZ1A 1WAUA 5AECA 2G3NA 4IFRA 5DT5A 1KTNA 1LBFA 3RFAA 1YTKA 5HANA 3M6YA 3QH2A 2OKOA 2WSYA 4E8GA 4LUTA 3VPLA 1EZWA 4H8VA 4A3HA 3BAYA 5HDRA 1N7KA 5C2GA 1YU0A 4ZR8A 5IHRA 3TDFA 4O1DA 1WE5A 4L65A 2OLHA 1FWAC 1I2RA 1JCMP 5AYBA 3TJ4A 3TEVA 3G1AA 4UQEA 2JGQA 4N9BA 5GJMA 4E38A 2DSVA 3H4XA 3O0FA 3DH7A 2YCJA 1EJXC 2OOGA 1H50A 4DYKA 3NZQA 4URIA 4FXFA 3O3RA 1K9EA 1JAKA 2Y2JA 2BBFA 1OJXA 3W1RA 3AIEA 1TWZA 5JVLA 1P0KA 1ZHAA 3EWYA 3WH9A 4ML9A 4FNTA 1R30A 4MADA 4UB9A 3NQVA 3Q45A 4ZOAA 1R7AA 3DEQA 3VGGA 1K8YA 4PMJA 3E96A 3MMWA 2J7CA 1QO6A 1KFEA 3AROA 1PKMA 1WNOA 3QV9A 3UNDA 2X42A 4JTEA 2XSXA 3ANUA 5CH9A 4GUIA 2WNWA 4UNLA 3GFZA 3FGCB 2YA0A 5DT7A 1HP5A 4B92A 3W01A 2ZCGA 4FB7A 3JUGA 3MQTA 3DCPA 1BSLA 4P7RA 1H60A 1I0DA 1R9YA 1VFMA 1B90A 4KQNA 4O0ZA 1WDWA 4DUOA 3LQLA 4JTGA 2ACSA 3U57A 3E5BA 2TODA 1L6GA 4JTSA 4BWLC 3NPUA 3D0CA 2NVDA 2J6XA 1EA9C 2QPXA 2C3ZA 9XIMA 1YTEA 2A3AA 4L4OA 2WB5A 1XSKA 1UA7A 4I5RA 2VDGA 4NI8A 3CAKA 1VPQA 3MP5A 3L5AA 2HDJA 1V51A 3QMSA 4GI6A 2VFFA 1CK7A 2D3LA 3S2MA 2BASA 3OLEA 1J6PA 1QUMA 4QS5A 1S3HA 5D2YA 4QE4A 1K8XA 1ZJHA 4F4RA 3IIOA 4FX7A 4MNLA 4QG6A 4MWAC 1P7TB 1EBHA 4PUKA 1MYRA 3IV3A 2FTPA 4OVXA 4Q7NA 4Q6XA 3MU7A 4ZO6A 2VDHA 4FSAA 3VXGA 1RK5A 3ZVIA 4C6PA 2E0PA 2DQXA 3KTCA 3UJFA 3BZJA 4ZO7A 1YNPA 2BVYA 4KEUA 5HMEA 4K8EA 1P6BA 3MCNA 5A8OA 2VEMA 4XSMA 1IT0A 4GZ7A 2A7PA 3V0UA 3TV8A 1PE1A 3BSHA 3NTYA 5A6AA 2BDQA 3W2KA 3RMJA 1EXPA 3WFAA 3A9IA 4BQ4A 2HBXA 4O1BA 3CWOX 4AD4A 3ZOAA 4O15A 1TJPA 3W84A 1SZFA 4ZTXA 3EKGA 5D2TA 2XZ9A 3GW0A 4HU0A 2XWDA 4R7WA 5LNWA 2Z7KA 3VDCA 4F0KA 3BANA 1P6CA 2PWEA 1EDTA 1DWGM 4CNTA 3HQPA 4YIWA 1YXYA 1S1PA 4MJMA 3C2FA 3CK5A 1B2YA 4AF0A 5G2HA 3T2QA 5HQEA 1AQ0A 3Q37A 2DEPA 3BAJA 1XFBA 3AZTA 1OFPA 3U4AA 3OBAA 1JZ5A 1WXJA 4EPDC 4FZIA 2OYMA 5I3IA 2RDWA 2XSBA 1R9ZA 4A8NA 4NP7A 3VNIA 2XH4A 4Q8NA 1CWYA 1UZ4A 7REQA 3WQVA 3LRLA 4X9YA 3W6MA 2E68A 3W83A 4IP7A 1SJAA 2A3CA 4I8YA 3DFOA 2RUSA 3LLXA 4ZOEA 4UFIA 1VD6A 3OLIA 4X3ZA 4HZ7A 4I6VA 5A6BA 1M5WA 1VCGA 1L2UA 4H8NA 1KCXA 5IXEA 2R14A 5C9RA 1D7KA 1QI3A 2D24A 5EPDA 1LL7A 2A7NA 5G2IA 3VFCA 3VNLA 2FJUB 4GIEA 1QBAA 4NAFA 2NQLA 4NRRA 3OZOA 1NH6A 1PKYA 3GYCA 4DQWA 3WF4A 2VX6A 1J2BA 4GQQA 4GY0A 4MF4A 4UBPC 3WX7A 5D8WA 1JDDA 1E6PA 3WNPA 4L9YA 2BVWA 1H1NA 1HNYA 5HNTA 1J5SA 5G1TA 4HPJA 2VD9A 3KLKA 2Q01A 3WQPA 2YDAA 3TWAA 3BQ5A 3LCHA 2YYTA 3ZVHB 3NCOA 2F9RA 1OX6A 1EGZA 1BD0A 3XISA 3EBVA 1WOAA 6CGTA 1AJ2A 2VWSA 4JTAA 4OT7A 1GKPA 1DIOA 3PY2A 4FEZA 3UZYA 2J8TA 2PDPA 3M47A 3RPMA 5HBFA 2FIQA 2YKKA 4Q7BA 4Y9OA 1TVLA 3LU2A 2BVDA 4P8WA 1J9YA 2CC0A 2D2HA 5M2FX 4WY0F 4X0VA 4MNMA 1AH3A 1LT8A 2A3LA 5FAJA 1H5VA 1OY0A 5DMMA 1PHWA 1WZMA 4LQ1A 1W1PA 1T41A 1NELA 3MBFA 2X0HA 4Z2LA 3A13A 3SJNA 3L23A 3DXIA 2WMHA 4YVVA 3DC8A 2YCEA 1DXEA 4LF1A 3W87A 1VJSA 1CXHA 1E0WA 3JR2A 4PMQA 1UMYA 1F6PA 4AZ6A 3NZPA 5HXMA 1M3UA 4EANA 3N14A 4BA0A 1KRBC 5D37A 4K6AA 1UMLA 4HA4A 5EB8A 1Y8BA 3AUJA 3PTKA 5EMUA 4MFEA 4A21A 3RM4A 4R7OA 1TZ7A 3H24A 3EA1A 4O1CA 1GVOA 1K9DA 3CTLA 3VDBA 4AAJA 3JZEA 1DVJA 1M7OA 4QE5A 3SSZA 1JL8A 1XH0A 1AODA 2JF7A 4JTCA 1J96A 3VNZA 3KOFA 2QJMA 3VKBA 1V8EA 3ARXA 4L64A 1PXGA 2CLLA 2ZZ2A 2BLEA 4US5D 3P82A 3B4YA 2YIHA 4AY8A 1WXYA 4QNLA 4LJ3A 4PL1A 1SW3A 1NTHA 3N6JA 5MF5A 3NIYA 1OX4A 1AA1B 1UW9A 1GCYA 3QHOA 4PMRA 3ABZA 2B31A 3R8RA 1IR2A 3UU0A 3MI2A 4ZODA 1IEIA 4AC1X 1POJA 1IF2A 2Y2PA 3O6CA 1XPGA 4DWSC 3FA3A 2E9BA 5FF7A 1J8VA 3MQLA 3H2NA 2JEPA 1TTJA 2E25A 4R34A 3W02A 3OGSA 1GOIA 3K13A 4C65A 3MKVA 4F79A 4U4MA 3I7QA 2RTSA 3P7YA 2D1ZA 4DWSA 4CCDA 1KQZA 3GQYA 3MUCA 3ZT6A 2ACQA 2RKXA 2B81A 3GYEA 2WPGA 4BF7A 1EL3A 1SJBA 3E74A 4TR9A 3CMJA 3D6NA 4WSHA 1O68A 4IH3A 3SRKA 4YS1A 3AIRA 3M43A 4AX6A 5A6SA 4GJ1A 3CH0A 4PGLA 2DVTA 4ZOCA 5A69A 3S47A 4NAEA 5KMYA 2FPYA 1H7OA 3QN3A 2RGMA 2QF8A 1WCGA 4JDYA 2GDQA 3S5YA 5I3KA 1YMYA 3GVVA 1E4MM 5F4WA 5EMLA 4D6HA 1W1VA 1SR0A 5BWAA 5CZKA 2DVUA 4ZE5A 2YL6A 3N12A 1AH0A 1BF6A 4HHMA 1A0DA 2E6YA 4GX8A 3Q58A 5A95A 3NQDA 3ALFA 4MIMA 2EG6A 2C16A 3P5YA 4GACA 1QHOA 1AZ2A 1M53A 4ZSTA 2Y2HA 2FH6A 3AJ7A 2PZNA 3UVAA 2V5LA 4OGZA 3HURA 2WZMA 1MW2A 1SJCA 2OB3A 2WAGA 2NWSA 3V0TA 3ZIZA 4RNIA 1FDJA 2PDUA 3F2DA 4O1EA 4XO7A 2QDEA 3FGCA 2DT1A 5DFAA 1GVSA 1WX0A 4UCGA 3UZJA 2DU2A 1UD3A 4CNPA 4S38A 1J4EA 2BY2A 2OT0A 1LORA 4AQLA 1QHZA 1UCWA 3CO4A 2HE5A 3O63A 2YXGA 3TTSA 2NQZA 1YADA 4Z2HA 4QROA 1EDQA 3BVJA 4LXFA 1K77A 3W7HA 4MTVA 5CGMA 2HNHA 1JXJA 2RDXA 2DUXA 2CZFA 1V6UA 4B9YA 5H2ZA 4GBUA 3NM1A 1QOQA 5C71A 3BLEA 3NQ6A 2YX0A 2X0YA 5BXRA 4JTIA 3TJIA 1D8WA 2PDBA 3CUIA 2Y70A 3UCDA 2VC7A 3ES7A 4XKMA 4ZFCA 4QP0A 2VGIA 3LXCA 3NR0A 1YTDA 3VE7A 3BPWA 3V5FA 1DJHA 4GWEA 1V3JA 2XD1A 1KD0A 3BMVA 1PDZA 1AG1O 3AAMA 1VCVA 4KW2A 1GQIA 2BY0A 1FOBA 3T0TA 4OV9A 1BWLA 1FFRA 3CL6A 1J5TA 2HV5A 2Y2QA 5JH2A 3MW7A 4XAZA 2QAPA 1TR1A 2YOCA 1M1BA 4P61A 4LBUA 3GDBA 1UWSA 4XD5A 3WEMA 3DOPA 2OODA 1C92A 1IR1A 4GHAA 2LLEA 2DT3A 4Z0SA 3APGA 1KV5A 4JD4A 3AOFA 4MNJA 5FAGA 3G8RA 1MI3A 3EDEA 2A79A 1I0BA 1V03A 3AIBA 1MUCA 1XC4A 3AWNA 3TXZA 2V9DA 3STFA 3KW3A 2XUCA 4C1NB 3SCRA 2NXGA 3N4EA 3DYMA 3KP1A 4GOAA 2CLFA 3SQMA 4X60A 4K36A 3S5NA 4TV6A 2H8XA 1VCFA 3O16A 4R9OA 2GJXB 1DQXA 1JZ8A 3FLUA 4OZOA 4S1FA 2IKJA 2A3BA 4YCPA 1IHIA 3W72A 2CERA 4WGXA 1TPUA 1RJQA 1Q6RA 1BTMA 4BJHA 4UCFA 2WHKA 3R0DA 3TCSA 1H63A 5D02A 3TQ0A 3NQMA 2DORA 1RHCA 4PC8A 1JYVA 2H9AA 5G4HC 2XIQA 1BKHA 3MHGA 4HCDA 1FQ0A 2TAAA 3BJFA 3OTRA 2R9RA 4WDTA 2XIJA 4DBDA 1HUVA 1TPFA 1GYLA 1RCQA 4WX2A 2PI6A 4LYRA 3K8MA 1E71M 3T8LA 1I75A 5D8ZA 3EWUA 4IG2A 4US6A 1WDRA 3RM8A 2Y5JA 5M3WA 3WY1A 1JCTA 1VLIA 3PN8A 3POCA 4PB5A 3VC6A 4HQVA 2BG1A 2X2GA 4QFUA 4C7DA 1S2VA 2ATSA 1ZAJA 2EBNA 2E5DA 4JNMA 4L4LA 1HL8A 1OQFA 4MGGA 4FA3A 4TXEA 4IBIA 1I6NA 5I23A 3IARA 1NOFA 1UQYA 5HMDA 9CGTA 4F8XA 1X1NA 2YCLB 3UZZA 1BFNA 5E0FA 4JTTA 3TYEA 4BHYA 2ZTKA 3A24A 4JTKA 3O07A 4TO8A 3GFXA 1DWAM 4J35A 4H9VA 3H4GA 1Z8AA 3UXAA 4HTYA 3QQ1A 3UD6A 2WJEA 1V6VA 2PDYA 2QCFA 3ARWA 3JW7A 1PKLA 3C3NA 1FWNA 4QJ1A 1YU3A 1CI1A 3R0KA 4XBJA 3TTOA 1K9TA 5BROA 2V6AA 3NM3A 4ZZ9A 3LX9A 2PWHA 3S6OA 1XRFA 1XD0A 2J7EA 2B7PA 4RE2A 3VIMA 2O9OA 1YXCA 4OU1A 4R85A 1F76A 4J40A 3LHZA 5K4XA 1ADDA 4DZAA 5U4NA 1XKYA 3G1SA 4V1YA 4DBWA 3MA8A 2YA1A 1O4UA 4EKJA 3RCYA 5CLWA 1S2WA 3O1NA 4DYJA 4U33A 2XH2A 4MDPA 4LBRA 3WQ5A 5C7VA 1OF8A 5LIUX 4LUIA 1E6RA 4AHOA 3VD5A 1W5QA 3FW6A 1OADA 4GUFA 4I5UA 1KV8A 2Y88A 2ZXQA 4S3FA 5DMLA 2J79A 3AHXA 4HHLA 8A3HA 1S3TC 1GT8A 1D7FA 3GXTA 3F2CA 4U2YA 1QRQA 2DIEA 4JEQA 1X6UA 2A1YA 1D9EA 3V5OA 3K8LA 3DGBA 4IIDA 1KCKA 1E5JA 1HKJA 2YCLA 2E28A 3HQNA 1E1EA 3W1NA 4YYCA 1XV8A 3TYBA 1HT6A 1HJWA 4J3WA 4PFMA 4GVIA 4L1XA 4DELA 2W9MA 3VCNA 3D5HA 4DJDD 1EUAA 1PTGA 1Q13A 2HMCA 3ITYA 3KRSA 1BGAA 3BLLA 3C0LA 3N6QA 3F5LA 3W25A 4AIOA 3SURA 4WDXA 3ID7A 1GVQA 1P1XA 1LTDA 2WV8A 4DLFA 2PWVA 1RY8A 4REQB 2F38A 3VIPA 3W1LA 4PSPA 4ZOBA 3L2AA 4ZSUA 5KSWA 4HHPA 1CYGA 1X6NA 2XN1A 1EFZA 3QGAC 4IIBA 3EXRA 4HA1A 2PTYA 2VGBA 1FVPA 3RMEA 4JFVA 3WUFA 4PTMA 3L28A 3WUGA 4IUOA 3P61A 5D04C 1XYZA 4NJJA 4QDPA 3RHGA 4XAFA 2QCGA 1AL7A 1X1OA 3C52A 4FXJA 2I7GA 3GHRA 3C6CA 3PF3A 4IFOA 4XVDA 1YRRA 2YCIX 1LCOA 2FFCA 4GMEA 5E6YA 1T40A 1OFAA 4W93A