4NYUA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in c 2 2 21
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
406
structure length
406
Chain Sequence
b'TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 139
structure length 406
sequence length 406
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyuA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyuA01
2J13A 1W1B1 4F9JA 3S6OA 3CL7A 2I5IA 4M1BA 4U10A 5BU6A 1V6TA 2XU2A 1NY1A 4NZ5A 4NYYA 3QBUA 4V33A 2QV5A 1Z7AA 2C71A 4L1GA 4HD5A 4LY4A 2IW0A 4NZ1A 1W1A1 4NY2A 2C79A 5JMUA 4NZ4A 2C1IA 3CL6A 1W17A 2NLYA 2CC0A 3HFTA 4WCJA 4NZ3A 2DFAA 3WX7A 4F9DA 3VUSA 3RXZA 2C1GA 2VYOA 2E67A 2Y8UA 2W3ZA 4OUIA 4NYUA 1XW8A 3CL8A
chains in the Genus database with same CATH superfamily
3C86A 1ZY9A 4PMNA 1EFZA 2PEVA 5HMFA 2Y8KA 3SCUA 2EF9A 5AC5A 5D03A 4EE9A 4EPEC 2FMNA 3CWOX 2OSXA 1PKNA 3LQLA 3GSMA 4IJCA 3PBMA 3E2RA 3NQVA 5L6UA 3WENA 2YZ5A 5H6HA 3T8LA 1KQYA 1XLBA 2TRSA 1IWPA 3RU6A 4DEFA 4X61A 4LB3A 1ZJIA 4ZO9A 1RZMA 4JFSA 1UR1A 5KTLA 2C1IA 1PXGA 1GVFA 2A3LA 4Q33A 1X98A 4RDVA 1XH0A 4MY9A 4PCFA 3G1VA 4GKLA 3H70A 3DUGA 3HPSA 3MW7A 3PANA 1W1PA 3KXQA 1FBAA 2Z2BA 3FJ6A 3TLQA 3T0BA 5E70A 5HINA 1EXBA 2Q3RA 5FJIA 3UY7A 1AL7A 1BEUA 6XIMA 1XIDA 3P8JA 3UVAA 4ACZB 2L5HA 4AY8A 3L25A 3WL0A 5ABFB 4LAZA 2F6KA 3GW0A 4NSBA 2PDIA 1Q85A 3TTSA 1Q7MA 2E68A 3L2AA 2IMRA 4L65A 1ZBKA 3WZ0E 4FB7A 2A79A 3F1QA 2E6YA 1HQTA 5CC5A 1CZ1A 3TMLA 3MKKA 2A2IA 5M17A 4QNEA 2YZRA 3P3BA 3CHCA 3W6YA 5LGXA 1GKPA 3TUUA 4JPGA 2J9XA 1Z7AA 1VPYA 2VFEA 4P8VA 4AXKA 4YTRA 3QPYA 2CHRA 4CCDA 4J27A 2GJRA 1I0DA 1GZ1A 3ES7A 1Q4NX 4ALDA 4UTFA 2IPGA 4O13A 3TQKA 1YYAA 1EEXA 3GKAA 4G1NA 4KIRA 3BC9A 4MNKA 3NO3A 5EFFA 1JCTA 1UIOA 3I4KA 3MTWA 4EAYA 2PA6A 4GJIA 3OGSA 1RA5A 3O15A 5A6LA 2C1GA 3AXKA 2D2HA 2CXEA 4AHPA 4MZ1A 1RPXA 3RR4A 1OJXA 3VNIA 4E38A 2X2YA 3W7HA 1V6YA 3RIKA 1IEIA 4XTIA 2QQ6A 2ZADA 3ME3A 5E6YA 4IQLA 2QNEA 3VILA 4QISA 1E88A 4YMZA 3ITXA 1F7BA 3WQVA 2YFOA 5CGTA 2BODX 4P2VA 3OODA 2PRHA 3U9IA 5H8MA 3G8EA 3W7LA 2Q02A 3RCMA 1XQKA 4FO4A 3CL7A 3SUVA 2WBKA 1EX1A 3GDTA 2ZRWA 4JIQA 4C6IA 1YPFA 3DZ1A 3TP4A 1E1EA 2JIWA 2GWGA 3THDA 1EP2A 5H8PA 2C0AA 3WF4A 2CWXA 3H8AA 4XV0A 1UD3A 2YBTA 1IZKA 4QR6A 1S1PA 3PC0A 5CJMA 3S5NA 3S2NA 2BX7A 3TN3A 4TVCA 3AICA 5EMLA 5IBXC 3BW4A 1YTEA 4AIBA 3GS6A 2ZICA 4LQ1A 2XH2A 3AYRA 1JNEA 1VAHA 4AIUA 4UFMA 1HP5A 4HMDA 4UMBA 4ERGA 1FWFC 2Z1VA 1JFHA 3E49A 4EXAA 3KAOA 3PK7A 3CL6A 4OV9A 3W27A 4HA1A 3GIYA 1JPIA 2HV5A 2XH0A 2QLYA 1DQUA 3URQA 3VDHA 3A5VA 3VC5A 4KF1A 4TMBA 2PCEA 4C7DA 2CHNA 2PWUA 3PPHA 5EY5A 3W22A 3ZYZA 5FF4A 2J7HA 1LRQA 4UR7A 2HROA 3CUIA 2NQHA 1FHUA 2VR2A 1DWFM 4WY0F 3FV9A 3SECA 2VEKA 4H9ZA 3G1HA 3AIRA 1F3EA 3MV01 1EF2A 1QCWA 1H3GA 4MWAA 3CH9A 3OPSA 3C2EA 7XIMA 1PIFA 1TA3B 4R7WA 1FY6A 3OZYA 3S0CA 1W5QA 4JTRA 5IHSA 5KEZA 2Z0IA 3AU2A 1M6JA 5D8WA 3FA3A 1R7OA 4H6QA 3ZZ1A 4WY0A 4MYAA 1L6GA 1U1UA 3PPCA 3S1WA 2XHYA 2OX1A 2ABBA 1QT1A 1J5SA 1DKWA 5JMUA 1D8CA 3GX9A 4KFPA 3WJXA 3A4WA 1EJSC 2P53A 3D6NA 4OT7A 5FJTA 2OXNA 1LL6A 1JIBA 1EUNA 2BGQA 4C6EA 3VIMA 4DZ5A 2Y2JA 4LCQA 2J8TA 2ICSA 3R7MA 2X05A 4PB3A 4PUNA 4NI3A 3MUY1 2Y89A 3OB8A 3RM8A 3SDOA 1FXQA 4O18A 3DIPA 4QG8A 1S2UA 1FTXA 3H7UA 4MNJA 4ZSTA 4PTVA 5IFTA 2JF7A 4IJBA 5AC6A 2DVUA 4XBSA 2QF8A 4HTBA 3G1XA 4L1GA 4PULA 3R13A 2QCNA 2D23A 3DI1A 1KB3A 3TJXA 7ENLA 2FMOA 2OWCA 4A3QA 2W27A 3TE9A 4JX4A 4LNCA 4F2BA 1OT2A 4F0SA 3WIJA 2BY3A 4EKJA 2CLKA 4R7JA 2VT0A 3GZAA 2YIHA 4DELA 1BTMA 4UNKA 5HXMA 3D3AA 1G6CA 1OB0A 4PMOA 4QLKA 1LTDA 2ODOA 1EIBA 3FYOA 3WK0A 4K1GA 3AROA 6TIMA 2C16A 2QV4A 2GVJA 3GNOA 3EWWA 2C0HA 5E1QA 1HJQA 1A49A 3WUBA 1D3HA 5MHBA 1PBGA 2NSOA 1FHLA 2WPBA 3MUZ1 1W54A 1ZAIA 4HA3A 1ECQA 3TCSA 4EOUA 1CXIA 3RMJA 2XIJA 1BTCA 2X0YA 1WKYA 4RPQA 4WDXA 1UR4A 1G4TA 2FZ8A 1GVOA 4YCPA 5CPSA 4WSJA 2ZUMA 5G1YA 3DYPA 4RDWA 3EEGA 1O6IA 1XL9A 5DBTA 2WKLA 5C55A 3E02A 1CT5A 4XTDA 4IT1A 1GNXA 2QEZA 2E6FA 2FTPA 1YDYA 3M0LA 3KVJA 3AS3A 1GQKA 1QR7A 4U33A 3S47A 2YLLA 3APTA 3LPFA 2XINA 3IVTA 1JYNA 3QVQA 1VPXA 1U5VA 1E56A 3SAZA 3I7SA 1V7AA 4LSBA 1IV8A 4Z2KA 3AMLA 2O7QA 1XISA 3ARXA 1Q4WA 3ZWSA 4E8DA 1GEHA 4RKAA 5ABHA 4GC4A 4DUXA 2G95A 1QW7A 2C13A 4HOXA 1M7OA 2BLEA 2CLLA 2GVLA 4JTUA 4Q22A 3OHIA 8XIAA 1M03A 3BTNA 2FH6A 1BQGA 3L68A 4ECLA 1V0NA 1YNYA 1OGGA 3TTOA 4US5A 2OWWA 1A0DA 4YHEA 1UZ4A 3SN0A 3F2CA 4R88A 3UR7A 3QZEA 4EPDC 1BXBA 2HISA 2XIBA 1GOXA 3EEZA 4KWWA 5L9FA 2HE8A 3VE9A 1OYBA 2XVNA 3BW2A 3LPPA 4NAFB 4MUZA 4V2XA 3UQNA 1OABA 4TTUA 1MI3A 1CYGA 2OYMA 4IMEA 4LEFA 3RGTA 1UH4A 4LWWA 4MFDA 3V0TA 5AYBA 3UWWA 1JZ8A 1LRTA 4UTWC 2C79A 2AQVA 1A5BA 2BB0A 4MVAA 1OFEA 1WXJA 3CS2A 3H12A 3NZGA 5AHFA 5KINA 1FWBC 2QZRA 4N02A 4AD4A 3M7SA 3O7UA 1BF2A 3VI2A 1N2VA 3AYVA 3M0KA 4WDWA 1PTDA 2Y70A 1FWSA 3HA1A 3SB0A 2Y63A 3JZUA 4QEEA 4MOZA 5AECA 2CLPA 4IISA 4QJ1A 2Z29A 3QZ6A 1EHNA 4D6HA 3RPTA 3ARZA 3WN6A 2GGJA 3P74A 3F4DA 1GORA 3W7NA 1I2OA 3NZRA 1W1VA 1SU5A 4J9JA 4JICA 1JQVA 3W6LA 4F79A 1IXQA 3RJXA 2FN2A 5REQA 4G5DA 4IBIA 2WC4A 2MNRA 3KOZA 4QGCA 3T0TA 2RDWA 4H1ZA 2H8ZA 2F2KA 3TAKA 4ZODA 4WJXA 2OTDA 4I8DA 1HW6A 3O2LA 1V7YA 1W91A 1O1HA 3CASA 4NF7A 1GUVA 2INZA 4LUSB 1KBLA 5EKYA 4PBEA 1TIMA 4IBEA 4V15A 2PDUA 3JU2A 3AS2A 2PTXA 5G5IA 2WC7A 1C8XA 1TZ9A 3HG2A 4KBXA 3QEZA 1GW9A 5CH9A 3I68A 2ZWZA 2PC4A 4A6GA 3CHFA 2EPHA 5LNVA 3LU2A 4QROA 3WH9A 2OLHA 1CGXA 2W4XA 2ISDA 2BP1A 2WSRA 1GVYA 3NXLA 3NWRA 3G2GA 1YQ2A 2X42A 3TR2A 4O0QA 3VUPA 4IPJA 5CAKA 3VIHA 2EPNA 3ORWA 4NT0A 3CWNA 3OVGA 4LBUA 3WNMA 1KRAC 3MQLA 4REQB 4FNTA 5CPMA 4MF4A 2VVNA 4DUOA 4HU0A 1EOKA 5I78A 3N2TA 5A1AA 1S5NA 1D7FA 1GZJA 3WDRA 3N13A 1ZNNA 2RGLA 4EX4A 5HPCA 3W1RA 3RFAA 4EWND 3AMGA 5LYRA 5HJYA 2PWEA 3WEOA 4LY8A 5EB8A 1XF0A 3HPZA 1FVPA 3VOIA 1VENA 3VNMA 1OSEA 4W5UA 4B5XA 1J10A 3MHGA 1QW9A 1W5MA 5HPOA 1TIWA 2TYSA 5DELA 2UY2A 4LG2A 1VPQA 1F6PA 4LAMA 4YYFA 2XGBA 3T7VA 2QUNA 1E4LA 4JQ2A 4KGLA 1XW8A 4GA8A 4DBUA 2R24A 2AOSA 3LK6A 1A47A 1KGWA 1BRLA 5A8GA 4DX3A 4F40A 2VRQA 3C4UA 4WCJA 2JE8A 4GQGA 2CYGA 3OLGA 3WFAA 2JIEA 1EGVA 4GHAA 1AH3A 2GFTA 4M6VA 1F3XA 2J7GA 2FIQA 1UKPA 1ITUA 3GVGA 3PBGA 3QPZA 3EB4A 2QCDB 1MUCA 2XVLA 3TR9A 2OT0A 3BZGA 3R94A 2CBUA 2J79A 1HFBA 2NQZA 3CL8A 5H91A 4JNMA 1OGBA 1QRQA 4M1BA 4C5ZA 2KX9A 2QCEA 3S83A 3IIXA 4KGJA 1QMLA 4DPPA 3LCLA 3XISA 4ZE4A 2G3JA 3FVMA 3KVLA 1EO7A 2X16A 3HF3A 1JULA 2X7WA 2CLEA 4UQ9A 5A95A 3MO7A 3V36A 3NGFA 1QK2A 3T07A 1ML1A 3CMGA 2NT0A 4S38A 5CZSA 4IMGA 4RW5A 3PWAA 1PZ3A 3JS3A 4FSAA 3OO2A 4UBPC 4G9PA 4J1OA 4AZ5A 1CTNA 4QNLA 4MWAE 2PBOA 5D05A 3SGGA 1OM0A 4LXFA 3IJDA 3LCIA 3IIZA 1X96A 1ME9A 3W74A 2CLOA 2FZBA 3R79A 4FLQA 2D49A 1GOWA 3CQHA 2AGKA 4Q8MA 4KETA 1IEVA 1DV7A 3P67A 3EZ4A 3VC6A 1AODA 4P7RA 3AHVA 4ZEPA 3KVKA 2GOKA 1AIWA 3AMCA 2E5CA 3INPA 2R9RA 4L61A 1FWJC 2VQTA 3H2AA 3DG6A 4B5NA 1KM0A 3NUKA 4Q6JA 4Y6GA 1K77A 4DLMA 5FAJA 3PPGA 3SCSA 1P6CA 3VOJA 2V5KA 3W86A 1VFTA 2YB4A 1F6KA 3FKKA 1IZJA 2GDVA 4GCXA 3ANUA 3AYSA 3HURA 3N29A 1XLFA 1OT1A 3OP2A 4GNKB 2BFGA 2ZUSA 3KUMA 5D4YA 5E93A 3NTYA 1F9CA 1AQHA 3PBUA 4FNUA 4CGTA 2ANUA 4XUYA 3BDKA 4OUIA 3TYEA 4ATWA 3EWXA 4CD6A 2J66A 3ID7A 4AZIA 4IL0A 3STPA 2P0IA 1EO5A 1VFUA 3PWGA 3UVIA 2FB2A 1R9XA 4IZGA 4S3DA 2WCSA 1S38A 5C54A 1US0A 5BWFA 3MBFA 3HPAA 5AOUA 4C6FA 4QRNA 1YE4A 1R3TA 3W25A 1S2WA 2I56A 2NWSA 3KWSA 4L6HA 3DCPA 3HTWA 1X6NA 4AD0A 1GPFA 1MEWA 5DMMA 2C19A 5CSSA 2DVTA 1Y5XA 1Y0EA 3WBYA 3OEXA 3UW6A 3SCRA 4C7GA 5C0QA 1PIGA 3PNUA 4JCLA 1IEXA 4UZSA 5I09A 7A3HA 1E6NA 2QT3A 1F6YA 2WSYA 3LSCA 3OLDA 5AY7A 1TPEA 3EA3A 5HUOA 2WNNA 1KTBA 1UBSA 1QNSA 4S3GA 1HGYA 2RHGA 1XRSA 3WQEA 3TYCA 3WD0A 2E1WA 3OZPA 1KM1A 4G7FA 5C5YA 5C2CA 1ALDA 4H2HA 1ISZA 4GD0A 2PWGA 3VDAA 1ZCCA 5DRCA 4PSRA 2PZNA 3W75A 1XKYA 1X6UA 4HSHA 4GINA 3GDLA 1F5ZA 4UTHA 4LBRA 4ZR8A 2YPIA 4JHOA 4NNAA 3EMQA 4FNSA 3F2DA 4FS9A 2JEPA 3KS6A 1WXYA 1XH2A 5AFDA 1SJCA 3WD1A 2UY3A 1UWIA 1RR2A 3BK0A 1B3YA 4OJLA 1XYLA 4JY8A 3FAXA 3VYLA 3TFXA 2V5LA 4CNPA 4MJMA 4HK6A 1K9EA 3B8SA 3O0FA 4B4FA 3V4BA 3TQVA 3LNPA 1XIMA 4XIMA 4JX6A 1OFOA 1H7RA 3LD5A 4WOZA 6ENLA 4JQ3A 1GYMA 3GXDA 4I3GA 2OYKA 2H90A 2QV5A 2ZX7A 2QUMA 3T0DA 3R10A 3MC5A 3PF3A 1G9HA 2REQA 1QHZA 2P1FA 3FDGA 4PTXA 3NZQA 1JI1A 2VX5A 2NWRA 5FESA 4MHBA 3RR1A 4QIUA 4NJGA 3VVGA 4UOQA 1TV7A 4W7UA 4ATDA 2FB3A 2PTWA 4BKNA 5CG7A 1EZWA 3MI2A 3GTFA 1E51A 3DU0A 1UB3A 2QCMA 3CZLA 4JQ4A 4ZOEA 2WAGA 4MDPA 4XAYA 4H9YA 3MO4A 5FI8A 3BL3A 1YNQA 4D8AA 2XVKA 4IP4A 5FEPA 3UEQA 3L4TA 3FYPA 3NL5A 4JTQA 5ABEA 3S5YA 2VZTA 3WBAA 2O7SA 5TQLA 3A4AA 4NY2A 2ZXBA 4FF5A 3L4VA 4KESA 1HKKA 2ISFA 2V6AA 1RVKA 1A4MA 3OBAA 1OK4A 4DBSA 3G1FA 2B7OA 4L4PA 2J13A 2HVMA 2HXUA 1TPWA 1UW9A 1VQTA 5FJJA 2QMJA 5JIWA 3W70A 1TV3A 1E55A 3UERA 5TD4A 4N2YA 3UZXA 2GDUA 1V3HA 4ZVJA 3LHVA 2VHLA 2J4GA 1H4PA 4CUCA 3KVMA 3GDKA 3AWNA 4ZO6A 3NIYA 3SFWA 4K3ZA 5MF5A 3H2NA 1UD8A 2CETA 3OTRA 5DLCA 3BLEA 3CB3A 5FA5A 5BOEA 3N12A 2ZUTA 1SSDA 2EAWA 1V3IA 1JDCA 2FFCA 4HHHA 1XCXA 1V02E 3BMXA 1ZU8A 3HPXA 1AFSA 3DKJA 5J5DA 5F7UA 5GJNA 1AH0A 3P60A 3FDKA 4INFA 4AD5A 3O6AA 3DHPA 3WF3A 2OCZA 5K9XA 1R3RA 4QE5A 3LTPA 1E43A 3PAJA 4A8LA 4CQBA 3CT2A 3BLFA 3C8FA 3W2UA 3ZVHB 4A3HA 2P8CA 1OX6A 3CH0A 3CMJA 5EMUA 1GKQA 5K4ZA 5CZTA 2VWSA 5HATA 4E2DA 4F0MA 3PUEA 2NQJA 1XG4A 3FY1A 2V5CA 2ALRA 3HMJG 4E4PA 3K5XA 3PZIA 2CBJA 4FIQA 4QS6A 4C6DA 5KZEA 2VRKA 1EA9C 3WF1A 2DSWA 3N3MA 2YBVA 4AUBA 1VFLA 3RRXA 3SEPA 2ZYFA 1SJAA 1XFCA 4P7LA 2G3NA 4P61A 5AB3A 4NYUA 5F4WA 2PWHA 3WLJA 3AYTA 3G24A 4LAOA 3K30A 1BWLA 1XLCA 4EP8C 2POZA 2OZ3A 2WHKA 4IBFA 2ZFAA 3UESA 1TWSA 5FCZA 1AUSL 4V1XA 3ABZA 1MW3A 2BHUA 4Z2IA 4IFOA 3S5SA 1EGMA 3UXKA 1CW2A 3VD7A 3SCWA 3BARA 2DU2A 3HOJA 4DZIA 5DCEA 4AZBA 2VQUA 5F2LA 5AZ0A 5B80A 3XIMA 2C91A 1NFBA 1JPDX 2DT2A 2INFA 2ZE0A 1HXJA 2EPMX 4GUIA 4AYSA 4I9AA 3R5EA 3N9KA 3S6TA 1SO5A 3EDKA 3PUOA 3FCPA 4NHVA 1PDYA 5I6SA 5HAOA 1W37A 2TAAA 4EPKA 2ASHA 1SM9A 4C5YA 2WJDA 3THUA 5E9XA 2HNEA 3T0CA 1XJBA 1AL8A 1E6XM 3VNDA 3ZFHA 4W7VA 4DWSB 3KEHA 3VFLA 2VC7A 2QAPA 4ASTA 1I1XA 3UYIA 3MCNA 3W00A 4PN2A 1GOOA 4JTTA 3WH5A 2BOEX 3KOWA 3RPMA 4JFWA 5T9CE 4QHRA 1PUDA 1MMFA 2ZOXA 4JTHA 1I60A 4R9XA 2GQ8A 1QPRA 3R8GA 5I3DA 1QNQA 2OR2A 1TJRA 3K2GA 3EX2A 4IBKA 1P7TB 2OSWA 1MW2A 4AG0A 1OY0A 4A21A 3G8RA 1VLWA 2HBVA 1HUVA 1VB9A 3CHDA 5F1UA 1D2KA 3GM8A 5RUBA 4UTMA 1H7NA 3H2OA 5CQ1A 3WMSA 4QSHA 3WSUA 2ZQ0A 3TSBA 2ZZ6A 3DBNA 4XUGA 5T91A 1OFPA 5EYWA 1W2PA 2J6XA 4X60A 1KXQA 3M6DA 4S39A 1M9HA 3TH6A 1EP1A 1G7UA 4CU7A 4PMXA 2PGEA 4AHQA 4IX0A 3FEQA 1AJ0A 1B4KA 4KS0A 4Z0JA 2RDUA 3VDCA 1P6BA 3W1PA 3H26A 1JZ5A 1RJPA 1ENUA 4IH3A 3ARWA 3TXVA 3UGRA 2D3NA 3HO8A 4IIHA 2OJPA 1K9TA 2GOUA 1RK5A 4RE4A 1VC4A 2QXWA 4KEVA 2V63A 4AWTA 3N2CA 4B5SA 5CJ5A 2WHMA 5BMXA 4KW2A 3MHUA 5XINA 1PWMA 2CLMA 5CBBA 2KZHA 2WMFA 1V0KA 1ED7A 1YKWA 4W88A 3BWWA 4NJKA 4F9DA 3HBLA 1REQA 1E0WA 5I77A 4GY1A 1IF2A 1P48A 2RTSA 1Q66A 2ZVIA 2VEIA 3P81A 4HNLA 1LZOA 1P4CA 1GJPA 1L8PA 5HQLA 4YPJA 3S2LA 1Q6GA 2NV9A 1HJSA 3SRFA 1J11A 3WBXA 4IMAA 4DWDA 2A3EA 3WDQA 1A0CA 2DORA 1K6WA 1W9XA 3M47A 1VEPA 5HWMA 3ITGA 4F2TA 4OWGA 2HZGA 4K68A 3ITYA 1K8XA 4WIWA 1XH1A 1I9CB 4QAWA 4J2MA 2VZSA 4ADUA 2EJAA 3AXMA 3NQFA 2A7NA 1OX4A 3PUDA 3VZZA 4R33A 3B4YA 1ZB5A 2GUUA 3GNXA 2GUBA 4HZMA 4XD5A 2E9LA 2F7FA 1GG0A 2J78A 3L28A 3NEHA 3QW3A 2PDXA 2A7RA 4PMRA 2NW0A 1U83A 4H8UA 4QP0A 4RE3A 1KS0A 3WLHA 4BQ2A 3M64A 2BVWA 2UWXA 4I9JA 5AHEA 2O0TA 1ZENA 1TA3A 3L4YA 3QW4B 1JZ2A 3P2VA 3LG3A 1OIMA 4R27A 4D6GA 1JNDA 4C1LA 2VFGA 5M03A 4Z0SA 4C6CA 4QJ4B 4UTKA 1V03A 1G4PA 2BDQA 1WCGA 1BVNP 1WQ5A 4GBUA 1LLWA 3A6OA 2HK1A 5J04A 3AMKA 3QLLA 4ZQOA 4HBKA 3KOFA 1H2JA 3FN9A 4AZCA 4F4RA 4IGHA 1QNVA 1K02A 2YLAA 1HL8A 3PTMA 4FEZA 4QE4A 5CZ0A 1EC9A 3FOKA 1BF6A 3DH7A 3VIKA 1KFJA 4JTLA 3WQFA 2Y85A 3SCNA 1RA0A 4GG9A 1QI3A 3GNNA 3GDRA 3B40A 2J8GA 3RX4A 4UR8A 5GNXA 3CHEA 4GC3A 4ATLA 2JEQA 4AWEA 1XIIA 3LA4A 1V0LA 1EKOA 3NOEA 3W07A 1J0YA 1Q6OA 1YHTA 3KCJA 1LORA 3UBPC 4NI8A 4U5IA 3UWUA 4PUEA 3QQ1A 3UWEA 5D8ZA 3ABOA 3IIVA 3WBEA 3DKLA 2IUZA 1YDVA 4L4MA 1FHDA 5TNVA 3LPGA 3WO8A 2DZBA 3F4NA 4MGGA 1FWGC 1IIHA 3W85A 1RJQA 3GR8A 3PSVA 4IMDA 4XZLX 4QG9A 3I10A 3TU9A 6CGTA 4UTLA 1IT0A 1WDQA 3AIWA 3OOQA 4EPBC 5CCZA 4UXDA 4IGNA 1D8WA 2W91A 4UTWA 4XAPA 1HKVA 3OIXA 1VBGA 4YU1A 2PDMA 4XZ9A 3P62A 4H00A 3TONA 4F8XA 3AS1A 5FKYA 4RNIA 3GB6A 3HJEA 2PTDA 1TVNA 4Q8QA 3QR0A 4O0ZA 3FEMA 1ZSXA 1E72M 3KHDA 2P88A 4IPLA 4CD7A 4XG1A 2J7EA 2ON3A 1BWKA 3E2SA 3ZOAA 1TQXA 1XDMA 3QXBA 3N2XA 1YDNA 4AD3A 3E0VA 3W1MA 1A5CA 1LUCB 1YMYA 5EMMA 3I4EA 2FFIA 1KBIA 1RQEA 2JFEX 4JL2A 3W7MA 4X0NA 4W8AA 2Z6JA 2X0SA 3UCQA 4F0LA 4KWSA 1PDZA 3I7RA 2Y2IA 1W8GA 3EWCA 3OA3A 4B3KA 1Z3NA 1JZ7A 2Y24A 4ZB5A 4PEKA 3A64A 1RY0A 4M81A 1JZ3A 2OYLA 1CIUA 4GNVA 2J7CA 5JVLA 1Q8JA 4IP5A 1GCYA 3RK8A 1W9UA 4FF7A 5C9RA 4IFKA 1EWDA 5BXTA 2AMGA 1HJWA 3DFNA 4O10A 4UQCA 3CWHA 1THFD 4JN8A 3NQCA 2A0NA 2BTMA 4ERIA 3T2PA 2OKOA 4L4LA 3BAWA 3WQ5A 2QJGA 3MMDA 5CBJA 1NQ6A 3A5FA 2PDWA 1HT6A 1NJJA 5DMLA 2BXVA 8RUCA 3TJLA 3BURA 3B9EA 1UG6A 2DQWA 4DNHA 3KBJA 4YLWA 2ZRUA 3MZNA 5HUPA 1WZAA 3VCRA 3WFLA 4R3UA 4PTWA 4AD2A 3HQPA 3BOFA 2Z1XA 5T26A 4C65A 1H0IA 3VTRA 4MADA 1QASA 4AQLA 3C0QA 2WMGA 2G50A 4DJFD 3QZAA 2DZWA 4W85A 1EYEA 3IS4A 3WJSA 2Y1HA 3NOYA 1YU2A 2QYGA 1T8XA 3CPUA 1WAUA 1UKSA 2KAUC 4HCDA 4I8YA 3M46A 3VAVA 4JFUA 3IUDA 4OJ6A 3KCOA 4OBTA 4DYEA 3CZGA 4Q6XA 2X40A 1TCMA 1J01A 4YN5A 4QJ5B 1DJZA 3NPWA 1A5MC 4ZQMA 1OF8A 3CV6A 4CD4A 1I6NA 3TDFA 2J75A 3WLIA 1S1RA 2WLZA 5M5DA 1U1HA 4CNOA 5LIUX 4ES4A 3WQCA 1SQ7A 1TPDA 1UWQA 2D20A 2PDHA 1S5TA 2I57A 4K7VA 4JDBA 6ALDA 1I1WA 2A5HA 4IIFA 5DQPA 1GW1A 1XPYA 4LVAA 1Q2RA 1E0XA 1GPWA 4GUFA 4L1XA 4WEVX 4H04A 3UF9A 4CCZA 1KFLA 4KEZA 3BXWA 3GXPA 3TAOA 5GPRA 1DXFA 4PFMA 3UZYA 4PRTA 1XCFA 2ATSA 2WSQA 1DWJM 4IXHA 1GKRA 4GHRA 4J3ZA 3NR0A 1XLLA 3KBVA 4C1NB 1OQFA 4O54A 1XR2A 3ATZA 2DVXA 5BXRA 4TIMA 1UC5A 3UPWA 4IUGA 2V30A 4O1AA 1MUMA 3BG9A 1K8ZA 3QJAA 1H63A 4AAJA 3TW7A 4M29A 5C6MA 2R1PA 4NZ4A 1K3UA 1J0IA 1J9YA 2RAGA 3MP5A 4ZXLA 4FR6A 3N1AA 1AJ2A 3PR2A 3GY1A 3QH2A 3P5YA 3TVAA 5LIKX 2PSNA 1SPQA 2W63A 4HN8A 5FOOA 1K7FA 3UNDA 4H6EA 4DN1A 5PTDA 3F7JA 3QRHA 4JIEA 1CB7B 4BK9A 1QBAA 1S2TA 1ICQA 1Q5MA 3K8MA 3HU7A 4DUWA 1E4NA 1Z44A 1V51A 3ABSA 2MUCA 3NDOA 4Z2JA 4RW3A 4QLLA 3ZJKA 2DIKA 4QEHA 3TW9A 1PKLA 1HX0A 2Q71A 4PTNA 4GYKA 1KFEA 4AY1A 4JL1A 3LSBA 1YPIA 4HNOA 4MKNA 1RK6A 4M7TA 1PSCA 1HKMA 1UKOA 4L4OA 5EU9A 4EIVA 5EFDA 5GJMA 4IICA 4RZ4A 1UZDA 1DXEA 3E6EA 4UCGA 4AWUA 2XN0A 3VIGA 1TJ0A 3IJQA 4MTVA 3PFRA 4AVFA 3CZ8A 4PCSA 1KLYA 1MFVA 4R7OA 2CLIA 3WMCA 4DAFA 1TWZA 3E5PA 3CUGA 3MJYA 4N0RA 4WSHA 2VFDA 4Q7BA 1GOKA 2GQ9A 5IM51 3T6CA 3DFOA 3MSYA 3S2MA 4EF8A 4O11A 2HRWA 3S9IA 3KM8A 2HTMA 3GR4A 2ZDSA 1JGMA 5BW6A 4HCLA 4Z2GA 1RBLA 2WYSA 4O4WA 4PUDA 4LC8A 1V6XA 4BF5A 2EJ1A 3LUTA 4CLMA 3SW6A 2BBFA 1VFSA 4DY1A 1KWKA 1IE7C 4H9MA 1TE6A 1IXNA 1OFRA 1HG3A 2GGHA 2UZ9A 5HBFA 4H9TA 2CZEA 1E1CA 5IRPA 1QTWA 4NZCA 4M1RA 2CPUA 1LWHA 5D37A 1IT8A 3CUZA 5AVNA 3QFWA 2FZ9A 4CQAA 3O05A 3OYZA 1F4AA 1R87A 4RPPA 4Q7IA 4YS1A 3SCOA 4GI9A 4RV8A 4RXGA 3T0AA 3W01A 4FNRA 3VGEA 2ZX5A 4X0VA 4M0XA 1PZ2A 3P6LA 1XLGA 3MUCA 3B05A 2BHZA 3NQGA 3PN8A 4A35A 3H2MA 1A80A 1PS9A 1SFTA 1WUFA 1QI0A 1QI4A 2DUXA 3HV9A 3DXIA 1R3WA 4HKPA 1L2QA 3T55A 2PFHA 2PI6A 4OHQA 3CJPA 4XAFA 4J3XA 1QNOA 2BGSA 3H2CA 2QJMA 3PZ9A 3PPFA 3B8IA 1DJHA 1MRAA 3KTCA 1FP8A 2XFWA 1YU0A 5C8BB 4ZTXA 1ZP4A 3IK4A 1R47A 1YADA 3H22A 1RD5A 4RK8A 4KRUA 3A12A 4PMJA 2PDJA 1Z9AA 1UUMA 2IKGA 1RALA 4XKMA 4XO6A 4L9YA 2YBUA 3LYEA 4W8BA 3SRHA 2WZMA 4DJED 1QO2A 3BLLA 4Y9OA 5DT7A 3UCDA 3WJYA 1ELSA 3TJIA 2IW0A 2WVVB 4G7EB 4Q4QA 3WD4A 1ZBWA 2PF8A 5FSDC 3FYYA 4EF9A 3WJWA 3A47A 1NF0A 2YCLB 1XYZA 1JCYA 2VUYA 1M68A 1UR3M 1GQLA 3WDIA 1W1A1 4RZ6A 3S9YA 1J8VA 1SW3A 5AC4A 2BZNA 5CJNA 1UMLA 1LT7A 3IVSA 1W3LA 2VDGA 3NQ7A 4J28A 1V3JA 2NQ5A 3URNA 4X63A 3A21A 3KTSA 4B4HA 4J2PA 3WQPA 1TELA 1OCNA 1E6SM 1DORA 3C52A 4W5ZA 2H6RA 4FLRA 1HTIA 1FWDC 3LCHA 3OHMB 1AMYA 3RM4A 3TQ0A 6XIAA 2ZZ5A 3EDEA 3LHUA 3O1NA 4BQ5A 1O68A 1NFGA 1O66A 3KL5A 1JCLA 1UH2A 4Q7NA 3MDWA 3RCYA 3LY0A 4DLFA 5A2CA 1V6VA 3THAA 1XINA 3URBA 2Y88A 4UOJA 4DO7A 1V77A 4KRZA 2PRMA 1UWAA 2VC9A 3JRKA 5AYYA 1TVPA 1QO6A 3V75A 5CBIA 1HZYA 3G6LA 1UP2A 4JFTA 5G2IA 4TVDA 1Z69A 5JUVA 3LV6A 3BLPX 3HV8A 2W66A 5CAHA 3MP3A 1EBGA 2EG6A 4AF0A 4R53A 3RJYA 4I90A 4LB4A 2QJIA 4A3YA 4IBJA 4DBWA 1YDOA 1R6WA 4GYPC 2GL5A 1VRDA 1IZCA 3PP7A 1Q6EA 1BWVA 3T40A 5T8GA 3WQGA 2P3ZA 1JDFA 4JYEA 5BROA 3RAOA 4Z1CA 1Z6KA 5A2AA 3EB2A 4BFAA 1VKFA 5DMNA 1XD1A 4GMEA 1OIFA 1CXKA 4IQJA 1H09A 3P5ZA 1MRQA 1J96A 2NUYA 4QJ3B 4MB4A 3C0LA 1QNRA 3HFTA 4RUBA 5BYWA 1NDZA 3G77A 3SI9A 3RF9A 2QDDA 1Q6DA 2PD9A 3REQB 1POKA 2I9UA 3EWBX 3MSRA 3VIIA 2NVCA 2XFYA 3ZM8A 3EMZA 3QGAC 3UXLA 3ARPA 1GVQA 1TRIA 2XIOA 1L0PA 3IGHX 2RUSA 3IV3A 4G6CA 4HSOA 3NG3A 4CN1A 5I02A 2DPEA 4LJ3A 1VS1A 3AXXA 2WZEA 3KW3A 1L6WA 1POJA 2I1OA 4BQ3A 4KCVA 4IBCA 1Y5WA 1RXOB 2BXZA 1DIOA 2OGYA 4H7ZA 1GVIA 4IIEA 4O1EA 2X1UA 3CT7A 2BMBA 3N11A 3EBVA 3NJ3A 3BJFA 2XSAA 1SUXA 3VZYA 5CPTA 1FRBA 4LS2A 3MMTA 4MJ2A 1OZMA 4DF2A 3B0UX 3V18A 1HJUA 1NOFA 3IK2A 1GQIA 2ALDA 1V4YA 3U3HA 5AC7A 1MNZA 3MT1A 3QKZA 4XKYB 2W9MA 5E0KA 4RJEA 1MQRA 3AIQA 1XLHA 1T8QA 3VMPA 4AEEA 4W7WA 4WX2A 3RITA 1A53A 1P1MA 3M43A 1G67A 2C3ZA 1FFRA 4Q8TA 1XWYA 4F0KA 4K37A 2Z7GA 3ITCA 1GOMA 3EDDA 3V5CA 3C0SA 2G4FA 2FZDA 3SIMA 4M80A 4E2OA 3M07A 3UD6A 3SBFA 4DF1A 1R3VA 1ZL1A 3B4UA 2H9AB 2ZZ2A 3TYDA 5A8OA 3BCJA 5D09A 3VMOA 1D3CA 2R14A 2UWFA 3UG4A 4YWIA 5HMSA 2XD5A 3GH5A 4JZ5A 1NY1A 2PMQA 1ONRA 1JF5A 2VELA 1U1JA 4DNMA 4BZYA 3TFCA 2Z2UA 2Y62A 3HQNA 4P7NA 2VGBA 2C1HA 3PTDA 4YXGA 1NOWA 4O8AA 2UBPC 4HHMA 4OVXA 3KRZA 2DIEA 4N7QA 2PF0A 2CW6A 1TREA 3W9ZA 2ZC8A 3A9IA 4ZQRA 1HF6A 3B8WA 3G18A 3QC3A 3PZUA 3AZSA 4LRTA 4MPKA 4OECA 3L29A 3KL3A 1VJZA 1UIPA 2TODA 3OZOA 3TC3A 1HKIA 4M5PA 3BLOA 4AVOA 1B5TA 4S3EA 7REQA 1L6FA 3STGA 1UOKA 2VGIA 3WG6A 3DGBA 1B57A 4W9TA 1HO4A 2CEQA 2YL5A 1NU5A 2HPMA 3ZJ7A 3OBKA 3WK2A 4GIEA 2ISWA 5I2UA 2V3DA 2IKJA 1DE5A 3CMFA 3ZJ8A 4O15A 3IUIA 1RBAA 1IR1A 4IG2A 1EOMA 1VF8A 4NRRA 1E6QM 3RLGA 2YDAA 5H1WA 1FWCC 3ES8A 2VEGA 3ALGA 4YNGA 5EL1A 4CVWA 1H51A 4F48A 5CEWA 2Q6ZA 1ZALA 2Y2GA 1GVRA 4LT9A 1DJQA 4MLRA 1A0EA 2Y5JA 3NQAA 3HIJA 3JZEA 2IOUA 1WA3A 5FAGA 4KFOA 4FMVA 4JIPA 1NDVA 1KM2A 3BV7A 2GK1A 3O8AA 5AHMA 3K1GA 4GABA 3CO4A 3CQIA 4HNVA 3PVFA 3NZPA 3N14A 4F3HA 2NX9A 5I24A 3AHTA 3IACA 4O12A 3LCFA 4U3CA 3NYZA 4HGXA 5AYXA 1XIHA 4JNYA 3SUWA 1DPMA 3EXSA 3KHJA 4C60A 3AAMA 5H2ZA 4I7WA 4B3LA 4NX5A 1XYBA 3KS4A 1NF7A 2DH3A 3IEBA 3DOPA 4GLEA 2G3FA 3E0IA 2D2JA 2FFFB 3QHNA 3BLDA 4UFLA 2Z2AA 2VEPA 3T08A 1TCDA 2AL1A 4BI7A 1RQHA 1FWEC 1YPXA 2C8NA 3LHZA 3FK4A 2I5QA 1KXTA 1KGXA 2R8WA 2E1DA 3G1YA 4AMAA 1P1XA 5CPQA 1HJXA 2PDQA 1LQAA 2D1ZA 2B7NA 5CXPA 1LQ2A 3KZSA 4E3VA 3S4TA 5CZKA 2TSYA 5A5WA 3LHWA 4IBGA 8CGTA 4JKLA 2HK0A 1R3QA 4MWAB 3PBYA 4ZBCA 1RVGA 4LNYA 3KBMA 2WJEA 2QDGA 1FH7A 3S8HA 2ISSA 4BEQA 1V6WA 5LNSA 4ZZ9A 4GVFA 3IRDA 1PCKA 2YDRA 3BGAA 4ICMA 1XSKA 3N4AA 4WY0B 3QSTA 3CQJA 2EHHA 1XYAA 4URIA 2Z27A 3WELA 1XP3A 3SUSA 4L7ZA 1ODZA 3BOLA 3D46A 3GBEA 1C93A 1P0NA 4CEXC 2QCLA 2OOFA 4J3SA 3R8HA 3UT0A 1MYRA 1XRTA 1JI2A 4NILA 1TPUA 1YEYA 5D2WA 3FKEA 3CIXA 5E9AA 1R2RA 1C8VA 2V2HA 1EQCA 4GXMA 4GIYA 3DYMA 4S2BA 3Q37A 2BOFX 4I9TA 3AJXA 4GE8A 2PP1A 2OU4A 2EXOA 4LTSA 2V5JA 5LSMA 1JF6A 1ZJHA 3NAVA 1W3HA 3K4DA 3STCA 4IBBA 4HSNA 1V08A 2DZVA 2PP3A 1XIBA 4PBFA 1KM6A 3ELFA 3APGA 3O06A 1UKQA 3TN6A 2WM1A 3Q94A 5K2ZA 3RHGA 3QV9A 4PL2A 3PNZA 2FDMA 3LHTA 5BPVA 1IEWA 4D2JA 1YBQA 3CUXA 2WC3A 1XYMA 4X2RA 4TU1A 4WXYA 4H7VA 4QFUA 2ZX8A 3MS8A 1FXPA 4PUKA 5F2IA 1YXYA 2W79A 1Y7VA 3VM5A 4BJHA 4EXBA 1DJIA 2V67A 2YXXA 1PHWA 2J8FA 3S3GA 4QQUA 4C6NA 4QSFA 4Q8UA 1VP5A 1FWIC 5E09A 4AB4A 1TRDA 4JHZA 1KRMA 2DZPA 3H21A 3L4XA 1XC6A 3CLWA 4NIRA 4ZQPA 3PWIA 3GFYA 3DFPA 2J9YA 4UTIA 2XN1A 4LYPA 3WYZA 4HTYA 1H1NA 1GOQA 1E73M 5IFPA 3ZWTA 1F73A 4MPQA 2AAAA 2J6VA 2ZZ1A 3OZMA 3QOKA 3O9NA 4NZ1A 1Z48A 1QK0A 1J93A 4MAZA 2D2GA 2YKKA 4Q4MA 3M7WA 3L2IA 3R2GA 5F2MA 3QMTA 3ABRA 3PZOA 2GSEA 4I6KA 4NVTA 3L2LA 4GO8A 4OE7A 7PTDA 3W0KA 1B3XA 1BKHA 3SZ8A 5FEZA 3G1AA 3V3WA 4LOCA 5TBOA 1ESWA 3O16A 2CFFA 2V9DA 4ROPA 5BMWA 3M16A 1B9ZA 3ZT7A 2E3ZA 3UR2A 4N6FA 2Z7KA 3K46A 2Y7DA 4FR1A 5D9OA 4D6FA 1LQ0A 4BA0A 4DJFA 1GYNA 1F05A 1KQZA 2RH9A 3RILA 1TMLA 1J0HA 1UBPC 3E74A 1TX2A 1UP3A 1AH4A 4XBKA 1EJVC 2V2CA 1YU1A 3RMEA 3U6WA 1HVXA 4AZ6A 2X1RA 3E9AA 3BG3A 4TUFA 2FDSA 1O94A 2E6AA 1W56A 3IVUA 1ZAJA 3QHMA 3R58A 4PSPA 2W5FA 4WOQA 3G3MA 4ZO8A 1TJ1A 4L9XA 2B0MA 5JBFA 4R85A 1AW1A 1FCBA 4NU7A 2H8XA 4GGBA 3N19B 2ZIDA 2BWGA 3WQOA 4C6BA 2PD5A 2WKGA 2NXGA 2V38A 3AIVA 3WLRA 4KQNA 4DO5A 1C7TA 1DOSA 4HQVA 1VLIA 4MB3A 3VGDA 2XWDA 3R12A 3TSMA 3VNKA 2O92A 4B91A 1CI1A 1E9YB 1NQKA 1XGDA 1B90A 1G69A 3W72A 3NM1A 3KX6A 2O9OA 4HHLA 4C6KA 3GHTA 3DFSA 1OC5A 1R9YA 1ISVA 3FA5A 1LM1A 2XISA 3EXRA 2PCQA 3OW1A 3I3BA 4GQBA 1E40A 4OZOA 4DXKA 4ML9A 5I3FA 3JW7A 4XB3A 3CPRA 3W7IA 4HJWA 3NQEA 2I14A 1TR9A 1OFBA 3G0XA 5C9ZA 3OBEA 4N4QA 1AQ0A 3WBWA 1QXLA 1XHGA 2DSUA 4WKHA 3LZ5A 5REQB 4FI4A 1KD0A 5A6MA 1K7XA 4Y8EA 3GVVA 2DT3A 2TMDA 4QCEA 1L9WA 3OVPA 3C6CA 4OQVA 3JUGA 1HN1A 4U3AA 1DTUA 4CD8A 3HG5A 3UCCA 1PAMA 2EO7A 3KLKA 3DYOA 3B8DA 4PMZA 4H9UA 4H6KA 3CAKA 1WDDA 4CQDA 2OZTA 3L0GA 2G5WA 4ERAA 3BJTA 1VHNA 3VM7A 4GK8A 4E4FA 1X7FA 2SFPA 3DC0A 3HMCA 1UMYA 5F4SA 7ODCA 4U5KA 1SYTA 3WFZA 4UFKA 4HPJA 1N8FA 3UWYA 3VXGA 1TX0A 3WNPA 4ZB2A 2WNZA 1ZRQA 5HR7A 2I5IA 3W2JA 4H8NA 1O12A 5EPDA 2AKZA 4O0KA 3USBA 5D04C 2XIIA 3I6TA 4PRWA 3G1DA 1EHAA 3Q65A 1W3IA 1PDCA 1JD7A 3URAA 4O1BA 3WDJA 3VOCA 3B9DA 3V5OA 5I3HA 2V3EA 4LCRA 3LI1A 1M65A 4MY8A 2Y6ZA 1NWUA 2HWGA 4M6PA 4XVEA 2RDTA 4DIAA 4HZ8A 2W0UA 3GW3A 2EKCA 3CV2A 4FPSA 4IIBA 2Q09A 3WD3A 2Y2LA 3W1QA 3I7QA 2OZ0A 5BRQA 3W1TA 4GVIA 1Q7ZA 3E3HA 4GQRA 3IJ8A 2WZIA 2CZFA 4BWLA 1VHCA 1DTNA 3PBVA 1TV5A 3QKEA 5KMYA 1F74A 1UA7A 2CNCA 1FA2A 4FOUA 5C70A 4RE0A 4X9SA 5K7JA 3MUIA 1A5AA 4UB9A 1Q65A 2Y7EA 5C7VA 3ITTA 3FHAA 3M0JA 3VD3A 1WUEA 4KERA 3PY2A 4WRHA 3ITOA 4W87A 1QI5A 4CQ8A 1K9DA 1Q8AA 1BRLB 5I07A 2CKRA 1MNSA 3ZQ9A 2AMXA 3RM9A 3OJGA 3WQWA 1Q45A 2DV0A 2EG7A 3ZLGA 5K4XA 2UY4A 2J74A 5E5CA 3W7JA 2OVLA 2JGQA 4XD4A 4AFYA 4K7YA 1VIZA 2ZUUA 2ZCGA 4DO4A 1NTHA 4XQ6A 4P8UA 2VR5A 4AYGA 2X30A 2HMCA 3U57A 4RR4A 4U28A 5GJPA 3AIEA 3OYXA 1ITXA 4UQDA 4BI5A 1FCUA 1SSGA 1FH9A 4FIRA 1X8CA 2EEXA 4NQ1A 4M51A 4LVFA 3MWCA 3MKVA 3I3EA 2EGZA 3LS9A 4Y9NA 1TUXA 5B7YA 2ZX9A 1GYLA 3WQ8A 1Z89A 2I16A 2WB5A 4YJ5A 5FJOA 5XIAA 3CZEA 5G2WA 4P7OA 2HSAA 4D9PA 4LALA 3NPVA 4Z2LA 4OJPA 4Q8WA 2PDBA 5CGQA 1FH8A 5LA2A 2OQYA 3H24A 3IV8A 3W7DA 1PX4A 3M4HA 2AL2A 1TSIA 4H83A 1XRFA 4Q8NA 4AH7A 1OG6A 2Z1BA 3LXCA 1T99A 3WL1A 1ZJAA 3HGJA 1UKTA 4FXSA 3VKCA 4XK2A 3UZZA 5A6TC 2G41A 3BMVA 2VL4A 3BLKA 4LUTA 1XYCA 3M0XA 3KBSA 1HVQA 3UJEA 5HNNA 4MJZA 3E38A 2VEMA 1KFCA 4BY3A 4HU8A 3L27A 4IGMA 3SY8A 3ARVA 4GZIA 3YPIA 4DJEA 1XICA 2ESCA 4Y9MA 1F3TA 2IS7A 3TN5A 2DT0A 2WOQA 1JFXA 4FP1A 4G1KA 1FWHC 3W76A 3VIPA 2NZLA 5BRPA 4GISA 3FIGA 1H7WA 5C9UA 3GYCA 2WMIB 4V33A 3TK7A 1L2UA 1LL4A 1WNOA 3LLXA 4A8RA 3ZXWA 3EOSA 1W9DM 3L5MA 5I3GA 2OEMA 5EBUA 3W53A 5DXYA 4D8LA 2GQ3A 2J7BA 3FAWA 1AA1B 1FX6A 1A3XA 1BSIA 3BVJA 3AFBA 1WBJA 2E7FA 3DHUA 4IJRA 4UR9A 3NA8A 1S2AA 4IIGA 1HNYA 1TZ7A 3PZQA 3CB8A 3AOFA 1Q13A 1DYSA 4XSMA 1RPKA 3LERA 2IPJA 4JKMA 3MKCA 4BF9A 2WM0A 2OLSA 1EPVA 1UC4A 4HN4A 1KO0A 4LVGA 2P8BA 3SY1A 4I6VA 1QBBA 3FXYA 5FJPA 3E0WA 1XGEA 2VZVA 1PWLA 4ADSA 3RG6A 3IAPA 4GYJA 3LEPA 4JEJA 1TJPA 3DI0A 2VENA 3QQ0A 5A8PA 4A8IA 4GI6A 3UJRA 1EUAA 2PE4A 1Q6CA 4GCAA 1E1FA 3AIBA 3SUTA 2HVOA 1MVYA 2PDGA 1X1ZA 3VE7A 3MUAA 4PMQA 3ANYA 3U7VA 3ITVA 3W82A 2IQDA 3MPGA 1YE6A 1ME8A 4P7QA 2VO5A 2PTYA 4ZO7A 3P8IA 4QX4A 4B5TA 3VU2A 3ALFA 3W7EA 1PKYA 2VCCA 3TW6A 4V28A 2QR6A 2Z28A 3LNMA 2GJXA 1A5NC 2AGTA 5FIPA 1OF6A 1W5PA 1XRVA 2PU1A 2VNCA 3W7QA 4PUMA 1KM3A 1XBVA 2QIIA 3KWXA 1LJYA 3POHA 4OIFA 2GSJA 3GO2A 3PZGA 3V5FA 2FQIA 2BASA 2FVLA 3WY1A 4H8HA 3VDBA 3LBOA 3RUBL 1US2A 1UA3A 1DJGA 1JUKA 5HJXA 1M1BA 3DG3A 1R3SA 5MKGA 3KE0A 3GQYA 2PB1A 1E70M 2RFGA 4IWWA 4HK5A 1Q6FA 3CUHA 2TPSA 4F2UA 4XZIA 1ECEA 1QWKA 4Q8PA 1ZBCA 2Y0FA 1BFNA 3T05A 1H50A 4X3ZA 3P0WA 2DSVA 3WD2A 1H49A 3DX5A 1XX1A 3P93A 4IP7A 4LW7A 2VVSA 1NEYA 1V3LA 4KEMA 2FJKA 4H2CA 3WH6A 4IQEA 4J7RA 3M0YA 4HYWA 4GYPA 1KFBA 4IPIA 2Z1SA 7TIMA 3R6IA 4NX0A 6REQA 3VNYA 4MB5A 3TMQA 1E4MM 1KBJA 3D0CA 1I2NA 2YCLA 1ZGDA 1NP2A 4O57A 4EK7A 3MZ2A 5CPLA 3OU8A 3ERPA 4JXCA 4PFHA 3PTKA 1WBHA 1VYRA 4LANA 5K9CA 5FD0A 1T6MA 1MFUA 1GQJA 8A3HA 1GJWA 2REQB 2WSPA 1NARA 3VMNA 2V68A 5HANA 5KZDA 3UGVA 2GVGA 1M01A 4GH3A 1TPC1 2B7PA 2BOGX 1ZZMA 3NVTA 2JGYA 1UZ1A 4MZ8A 3QQWA 3NDYA 1KV8A 4V27A 3LHYA 1XD0A 2OQLA 3B0XA 1JZ6A 5DEZA 2PWDA 3G1SA 4HHPA 4JS3A 5A6KA 1YU3A 1W1B1 1JPHA 3GDBA 2OMAA 1LL7A 1EZ2A 1CX9A 1ZBVA 4MMWA 1I75A 1DIEA 5G1MA 1VZWA 4XZMX 4HJFA 1WDPA 3BE7A 2BVTA 2DDXA 4S23A 2PTZA 3GTXA 3Q45A 4RX0A 3GH7A 5I0DA 3SY5A 4LRSA 2AAMA 2I5GA 3OVRA 1RY8A 1IT7A 2EPOA 3QY7A 2D3LA 4OJOA 1MW1A 2NXHA 4RE2A 2QAFA 2P10A 5I5RA 4DF0A 3W28A 1FCQA 2DJXA 2VDHA 2A21A 1VJIA 3G0SA 4JTJA 3MI6A 4U31A 2H3BA 4MYXA 2FTYA 3U2CA 3TQPA 3LLFA 2CZDA 1HGWA 4ZE5A 3UY8A 1S2CA 4NAEA 2Z1KA 3LN3A 1VCFA 3LLDA 2YCIX 5DT5A 5A8QA 3SRKA 1RLDA 3DAQA 3SCVA 2QCFA 4ONVA 3T44A 2WCGA 4BHYA 1QDSA 2CZVA 1PYFA 1LDCA 4AIOA 5LA0A 1OZQA 4MM1A 3W1UA 4GXWA 4DO6A 3EPMA 1WOBA 3NVDA 3THQA 3DHDA 1XI3A 1JEZA 2YCJA 3MB9A 4B5UA 4C90A 1TV4A 4AW7A 3O6CA 4W93A 3WK3A 5C2GA 2YX0A 2QPXA 2VD9A 2DUZA 2HVNA 5D02A 4HD5A 4H19A 3ZVIA 3AISA 2QUUA 4QE1A 5AYIA 3ABQA 3TCEA 4MSSA 5HWJA 2YYTA 2O4MA 2Y5SA 3H54A 4YIWA 2DZUA 1JRBA 5HNTA 2ZA3A 1WZMA 2ADAA 3ARTA 2F2HA 2DIJA 2ABAA 3CZJA 1XSIA 1TPH1 4J3TA 2IXUA 1BXNA 3BLIA 5LA1A 3A22A 5AHLA 3W87A 3CEPA 3EDFA 1QU4A 4OOUA 4JTGA 2XZ7A 3AU6A 3B0VC 3KCLA 4LGXA 4WXZA 1E6ZA 3SSZA 1KLZA 4F0RA 1BD0A 3ZSSA 3NL6A 4G2DA 2YL9A 3N18A 3N2MA 5D9NA 2PZ0A 3C61A 4LAKA 4K8HA 1ZUAX 4ZQCA 3DECA 1GT8A 2J27A 3HQOA 3TJ4A 1H11A 3MVIA 3CV7A 4IL2A 1P0EA 1YX1A 4ZOCA 3EKGA 3W4RA 6TAAA 4DXXA 3LENA 3QMRA 4LVDA 2FLIA 1O7AA 4QXIA 3QR3A 2A3CA 1R46A 1O60A 3UXAA 3SCTA 5FF7A 1FWRA 4O28A 1B3OA 5SWUA 2P76A 3UP8A 3TOYA 1I45A 2XTKA 4JOMA 2H9AA 1FCVA 1YLVA 5G2HA 2J25A 1F2JA 5D9PA 1LG2A 1D9EA 4GJJA 4ICCX 3HZ3A 3FJLA 1DWGM 1S46A 3ZS4A 2VOMA 2RJHA 3ITLA 4XX6A 4PA8A 1B2YA 1JAEA 4JBRA 1UD2A 3M7PA 3N25A 4LPCA 1FWTA 4CKQA 4LUJA 1JUEA 1ICSA 3C2FA 3KBNA 2GVEA 1H1YA 3DFHA 1FWWA 4B9ZA 1I2PA 1BQCA 3GTIA 1G5AA 3A3HA 3D3FA 4N9EA 1RCXB 3P14A 3BV4A 4M6QA 2QF7A 1SR0A 1CK7A 4YHGA 2ZZ4A 3S1UA 2QHAA 3H4WA 3PSWA 2Y2OA 5BOOA 3MWAA 1MXSA 3UNTA 3Q2DA 4XD6A 4PTMA 4DYKA 1PV8A 3B9NA 5JXQA 5LHFA 1CGWA 4CU6A 3CQ0A 4K8EA 3K8LA 3A23A 3E2VA 1J2WA 2A1YA 4AEFA 3ZIZA 4O16A 4JTIA 3GVRA 5LGZA 1LLZA 1BKSA 2G97A 1IQ8A 3BOXA 3IARA 3UWQA 3LM7A 5GNZA 1B0IA 1C7SA 3G22A 4PCNA 1OFDA 2WBGA 3EWZA 1XIGA 2XSXA 2D22A 1J6PA 2PBGA 1F8MA 3OG3A 3VKBA 4AZ7A 4Z42C 2DW6A 1QATA 3W7RA 1XLKA 3OLIA 4O1DA 4HK7A 3W23A 1CBGA 9CGTA 3CPGA 3ZR6A 1T96A 4ENLA 3D47A 5FACA 4A22A 2C18A 1PX3A 2Z4GA 3TOPA 3RU8X 3AQUA 1QHOA 1WYIA 3FVDA 2R94A 3E12A 2CBVA 3QF0A 4N42A 5DXXA 5DX7A 5JBEA 1Z42A 3M5YA 4AC7C 3CIWA 1CGVA 1G01A 1UZHA 1V6TA 1TYGA 1C90A 1O1ZA 4IM4A 4FXRA 4WQ6A 4EACA 1TG7A 1REQB 3TYZA 2Y2HA 2FTWA 2HNHA 3WJZA 4XVDA 1JZ4A 4GZJA 2D73A 2G96A 3W2LA 5CC7A 1W3NA 4WR3A 4Y9PA 3PB2A 4XZWA 5K3VA 1W32A 2QUTA 3IPWA 4TOQA 4ZFCA 4OUEA 1UJQA 3CAQA 1E5JA 2PLKA 2FJUB 3BH4A 3TXZA 1CXLA 4HCHA 3NYDA 3PJTA 3HSHA 1UYQA 1YTDA 4HZ6A 2VM8A 3COTA 2HDJA 2DZAA 1C3FA 2B31A 4D6CA 5I00A 2ZE3A 3WCZA 3PM6A 1A3WA 1N8WA 4MDOA 1CXHA 4OGZA 1QWGA 3TA6A 2FVKA 4JEQA 4KWUA 3V16A 1OWQA 1LG1A 2DSKA 1SGJA 1CLVA 1VCGA 1XBXA 1OX4B 2VKZG 3EWDA 4CD5A 3W2MA 1OX5A 1XKJA 3SJ3A 1SVDA 3EX3A 2UY5A 3VO0A 5A94A 1KKRA 2ZA1A 2NVDA 2VC6A 4Q8VA 2GLKA 3N3FA 1NIUA 2Z00A 4UNLA 1GVSA 1AW2A 3LB0A 1EJRC 2Y8VA 4Q4SA 2VTFA 1XLIA 5D2YA 2BGNE 3R0KA 1OD0A 3TV8A 3BGJA 3VGHA 1OYCA 3B9AA 3NEVA 1M3UA 3CXOA 2NLIA 1RJRA 4B2DD 3HG3A 1D7KA 1XDLA 3VZXA 4ACZA 2OO6A 5ABFA 3W29A 4D71A 4LF2A 1XS2A 3MP4A 2DP3A 1UWTA 3BICA 1TWWA 2DJLA 1CGTA 3GE7A 2IQ0A 3B3DA 1PEZA 1WKEA 4S3BA 1BYDA 5GQBA 2X09A 1O4UA 3RX2A 4FZIA 2DQXA 2R1LA 3AHYA 4AZCB 3UETA 4S3JA 4DHGA 4NRSA 4IF2A 3AALA 4S3CA 4H9VA 1QFEA 3E96A 3SIZA 5KZ6A 4Z1YA 3NSMA 1BLIA 4QNWA 1S5WA 4QS5A 1OYAA 2O9RA 3SCQA 4AX6A 5FL1A 2CIPA 2OT1A 3GIPA 4O14A 1NWTA 3G3DA 8XIMA 4GVHA 2ZC1A 4TX8A 4UTJA 1DXIA 4ZB0A 4J3UA 2Z25A 4C6MA 4Y90A 3J7HA 2Y2KA 1XM3A 3NQ8A 1J7MA 1VBRA 3JR2A 3FGCB 3L9CA 1ZP3A 1ONEA 3PJWA 3GFXA 4LFYA 1DVJA 3IJLA 1JCXA 1PPIA 3ZLHA 2Y7FA 3N9RA 3DDMA 2WZTA 4KMQA 4IFRA 4E3TA 1PYMA 2ONEA 2VR4A 7TAAA 1VCVA 4DWSC 4U4MA 4MLJA 3HGSA 4OV4A 4M7SA 2NVAA 4QAIA 1MQPA 3DN5A 2Y2WA 1XXXA 2PP0A 1WDWA 5DCBA 1W8SA 1XUUA 3HGRA 1X1NA 2Y2MA 2XU2A 1NP0A 4JIRA 3TIMA 2ZUWA 5U7SA 3BSGA 2I17A 2VZOA 3S1XA 4Q8OA 2ZRYA 3WKZA 3A3WA 3M5VA 1OINA 1IGWA 4RDYA 1T5AA 2OWXA 3W1AA 4TX6A 3EWUA 3MMWA 4QTGA 5C9XA 1JR1A 2FHCA 4DI8A 3ZMRA 1KGUA 1UWUA 4I5XA 2VC5A 2VGFA 1UWRA 2B7QA 5BRBA 1U5HA 1NELA 4B3ZA 4IPPA 3LGDA 1KR0A 3H55A 3NL2A 4ZOBA 1QPKA 2POTA 3OGVA 3SN4A 3GNDA 2PDCA 2HQAA 3ARRA 4F9JA 1EWEA 1RAKA 2P3EA 3APYA 6PTDA 2XFRA 4ZOAA 1R38A 3OVQA 1UPMB 4GYFA 3B8VA 2PLMA 4W8LA 4DI9A 4DWSD 2DZTA 1ZS2A 1Y8BA 4WKFA 2CLHA 5LXXA 3K1DA 1SJBA 1ZLPA 1LCOA 2XSBA 3GC4A 1G94A 3LBMA 4S3FA 2R1KA 1EGZA 4KEUA 4D6IA 4E2VA 1SO6A 4C6QA 1TTPA 2PGWA 4GO9A 2WVSA 4O1FA 3SRDA 3WLLA 4XZHA 2E67A 1XUZA 4GVGA 3RCNA 2CBIA 2HXTA 4PL1A 2E28A 3LRMA 2AQWA 1O5RA 4YYCA 4UMCA 4IFKB 4TX9A 4HNUA 4HPXA 3SFKA 3W6MA 4K38A 1ISWA 4KCUA 3CUJA 4CCCA 4JX5A 2GJLA 2GWNA 3UJ2A 3WNKA 4IJFA 2OX4A 4I7VA 3I3DA 4Y9AA 1W3TA 2ZRZA 3VPLA 1XIJA 5J5RA 2PPGA 4PMDA 5ENLA 1TWDA 1I2RA 3VKAA 2VX6A 2W61A 2NXIA 4WVXA 4OJYA 2F9RA 3GXFA 2NSXA 3VA8A 3MY9A 1ICPA 3PUGA 1GGOA 3BAKA 4QLJA 2OEJA 1NAL1 4KCTA 4CU8A 4JTSA 4Z1DA 4DZAA 5HR6A 3VGBA 4MJ4A 2WCAA 1XPGA 5JH1A 2W67A 3IGXA 2ZUVA 3L67A 3VINA 1SO4A 4TXEA 1IWBA 2PDLA 2JE5A 1K9FA 1R85A 1RSCA 1VEMA 1ADOA 4ZFMA 3QTGA 1RQBA 4FA3A 5BU6A 3U2ZA 4LV9A 2C15A 5CSUA 1B31A 4Y7EA 3IJ6A 1JQXA 3FW6A 2RJGA 2J9ZA 3LTYA 3XINA 2EPLX 3OA5A 1K70A 5D2VA 1FDJA 1LYXA 2CESA 4P8WA 1G4SA 3L66A 4WDTA 2D0FA 1GHRA 1JPMA 2VFFA 4DYJA 3VKDA 4HOZA 4LYKA 4LUIA 1N82A 3GXNA 3IANA 3NQ2A 4L64A 1XV8A 1VBJA 1V93A 4E5TA 4HPGA 1EA0A 3GVQA 3C2VA 2O56A 3KTXA 4B15A 3TKFA 1VBHA 1K7EA 3KBWA 3V7PA 4PMYA 4PRRA 2VJXA 1XLDA 1B3VA 3UYCA 1N7KA 1JCJA 4HNCA 1PVNA 3QTPA 2VGGA 3BAYA 1A5UA 2WW5A 1TB3A 3L0NA 1V02A 1YNPA 2JK2A 5A6BD 1KCZA 3LMZA 3W2KA 1P0KA 3ARUA 3KOYA 4LCSA 3SM0A 1OVDA 3MYOA 3N04A 2CXGA 3F4VA 1XFBA 3GHSA 1ADDA 2X0HA 2YSWA 1U33A 3M5ZA 3NL3A 4C6LA 4PUWA 1WDSA 3WK1A 1TTJA 3WLOA 4FLSA 1PCWA 3L4UA 2QCHA 2ZDRA 4B90A 5CPNA 1XBYA 4DJDC 4RLIA 3U7BA 1KW1A 2Y61A 3GXMA 4US6A 4H9XA 3RRAA 3UZ5A 2HE5A 3ECQA 3TZNA 5GNYA 2X2GA 4X22A 2ZTJA 3FSUA 4M56A 4JIHA 4BCEA 4A2SA 6A3HA 4GFIA 2XM1A 1A5KC 2FHBA 4GZ7A 1IGSA 1TUFA 3TEVA 1EXPA 1H7OA 4D6JA 4BI6A 3AC0A 1E9IA 2J7FA 2YFNA 3ANVA 3TSDA 3LM3A 4JGDA 1GXDA 5AYZA 4M6UA 1GTEA 4S2CA 4BEUA 1K8YA 4QG6A 4JTEA 5ECVA 3KLLA 3VCNA 4PH6A 1MEHA 4DJFC 4GACA 5T9BG 1QOQA 1F8IA 4AZGA 3WQ4A 2XH4A 1C9WA 2VDIA 1UR9A 2ZTKA 2YGYA 3LOTA 3ZJ6A 4LH8A 4DJDD 3S2CA 4A3RA 3A4XA 3CYVA 1LP6A 2ZRVA 1SR9A 1FDYA 4NAFA 2V81A 3H23A 5XIMA 1OCQA 5EMYA 3QY8A 1M7XA 5CSYA 4MNLA 4GQ0A 2FH8A 3WMLA 1E71M 1L6YA 1EL3A 1ZQ5A 4PMVA 4NYYA 2YA1A 5IDIA 3QGKC 5DF0A 2BG5A 3L5AA 3NQBA 1J0JA 4HU4A 1OC7A 3WNLA 3CBWA 1LWIA 1Q6QA 1ISYA 2JKPA 3K4WA 1ZJBA 1XC4A 4HT3A 1QJWA 4DUVA 3DC8A 1MQQA 1IEQA 1A5LC 2CU0A 3GK0A 3C5QA 4M24A 1HKJA 1MXGA 1FDZA 3IRSA 3I65A 4O53A 3GBDA 3BGGA 4AZHA 2ACUA 1PX8A 4J35A 2GVYA 4OU1A 4W89A 5HQMA 4ZENA 3QHOA 2NUWA 3CAVA 4B9YA 5LIWX 5TF0A 5BXSA 4FLOA 3M9YA 3NQ6A 3MDUA 1C29A 1WAWA 5I7GA 2XH7A 4C91A 3L23A 4UFIA 1E0VA 2WKJA 4ADTA 1KCXA 2Q3OA 3QLDA 4HVXA 2WV8A 2J7DA 3U2EA 3UJSA 5FSEC 1E1CB 2F38A 5ECUA 5FEWA 3N6HA 5G1TA 2E09A 2CITA 4D1IA 5HWNA 4GGHA 4U2ZA 3Q4DA 2V3GA 4HNTA 2PDNA 4NZ5A 1WX0A 4FOJA 1W5OA 2WMIA 1PB0A 2D0GA 1TTQA 1DHKA 4LUSA 4FOKA 5EMKA 4F66A 2Y2QA 1LROA 2Z24A 2PGRA 1L6JA 4EAMA 4TQTA 2PWVA 3CHVA 3W26A 3WNOA 3DG7A 4FHAA 2WHLA 2DGAA 5H8UA 4NG3A 3BQ5A 3VOHA 1O5KA 5D32A 3FS2A 2R1MA 3HB9A 4D8ZA 1R0MA 4GIAA 1SMAA 3F4WA 2E0PA 2XYLA 1O5XA 1YW1A 3WEMA 3KP1A 4REQA 1JVNA 4PC8A 1SJDA 2QVNA 4GRSA 2YA2A 2VEFA 3L4WA 1PIIA 3DFYA 3STEA 2FZMA 2IKHA 3GKFA 4GX9A 3VCCA 3GLCA 2ZUNA 3SN1A 1JCNA 1VGAA 1JPKA 4MY1A 1OCBA 2QPUA 3G5EA 4PYSA 4L56A 3WF0A 1LLOA 1E6RA 1XGZA 3SURA 3ZSTA 3NPUA 4BWLC 3P61A 4PGLA 3TROA 1EPXA 3TTQA 4GI8A 3S46A 4JY9A 4NJHA 1TVLA 2JKAA 3R4IA 3ARQA 1A3HA 3OG2A 1E9ZB 2WK2A 5AVHA 5LNUA 2A3BA 3HN3A 1VH7A 1US3A 2JKEA 3T1GA 1CEOA 2BY0A 2E9MA 1QOPA 2FGBA 3CYJA 1YUEA 1E0UA 2WJZA 4GZEA 3U0HA 1BVWA 2Y2NA 3RN6A 3GD6A 3M5XA 4JN7A 3V0SA 4QCFA 5BU9A 5LNWA 2QCDA 1IXPA 1KKOA 3R0UA 2GDQA 4KPLA 5KZMA 2YL8A 1UQYA 4PZVA 3RLHA 4DAIA 4PCTA 3FFSA 3UFYA 2ZVRA 2B81A 4JIIX 3RDKA 3PJUA 1KM5A 1E9LA 3CO8A 1V6UA 3T4WA 3WMBA 4TMCA 5FF2A 1UOZA 4PBGA 4H3DA 4XZBA 4YVPA 4UTTC 1P0BA 2YA0A 1UROA 2G3IA 1C9DA 4ZMGA 1ITQA 1KRCC 3WX7A 1N55A 4NASA 2VX7A 4JTFA 5K9DA 1SZRA 4MNMA 3CAWA 1KFKA 3GWQA 4E6MA 1XBZA 3K4AA 3WLKX 4FX7A 4AF0B 3O07A 2OOGA 3WUGA 3EX4A 5A69A 1EYWA 3WUEA 4F0HA 4UFHA 1C8QA 2JALA 3WLSA 3MMUA 3EA1A 1JCMP 3BANA 3ARSA 3WDPP 4YTTA 3NQMA 3G1RA 1UJPA 1UD6A 5D30A 4ORMA 3U8GA 3SUUA 4NJIA 4FXJA 2ACQA 1KC7A 1FOBA 1HJVA 4M3PA 3TC6A 5C2XA 4R9OA 1I0BA 4Q4RA 3ZR4A 3LCGA 4XSLA 4CQCA 1TPVA 3NGJA 4A05A 1ZCOA 2O4QA 4DJEC 4JAWA 3ISIX 1K8CA 4N9DA 3EX1A 3IJ9A 1RUSA 2JQXA 2BHYA 3WLTA 3AJ7A 2VD8A 2E5BA 5KITA 3CU2A 2DZSA 3GDMA 4R5EA 4O50A 2NQLA 1FWAC 4ZCWA 5IHRA 1UPPA 4MB1A 2IXVA 3PAOA 5DANA 3N4FA 1V3KA 2HS6A 3R11A 1W3JA 2JF6A 2E4TA 1EJUC 3MYPA 3NQDA 2QVHA 4POCA 1P0DA 2GJNA 3FNDA 1MUWA 3GU1A 2DUAA 3MVTA 4AVNA 1JDAA 1ZFJA 3N34A 3T2QA 4NXSA 1F4HA 3M0ZA 1BXCA 2V5DA 2YDSA 1R2TA 1GONA 3SQSA 2GGIA 5HDRA 4Q4PA 3UWZA 1JYWA 2I9EA 4XWUA 1CLKA 4PEEA 1XCWA 3GZ3A 5I79A 4NUWA 3RXZA 2Q01A 4MKSA 4B16A 1OG0A 1DJNA 2OLAA 3M44A 3LXAA 3R0DA 1IR2A 1MO0A 1AW5A 2VZUA 3EOUA 5CKSA 4ACYA 3EPNA 4DZHA 2O9TA 3DHFA 1X6LA 3GYEA 2LLEA 5A8MA 2A3AA 1RD6A 2AKMA 2VFIA 2OFJA 5EA9A 3ONBA 1GZGA 4FAMA 4GI4A 1XDJA 1G0CA 2VXNA 3S42A 1CXWA 3NDZA 4ROQA 1BYCA 5DO8A 3II1A 3UZJA 4EVZA 1GQNA 2XIMA 5AKQA 1B9BA 3VFCA 3MUXA 2FPYA 3F5KA 1W1YA 3MJMA 2XG9A 1K03A 1A4LA 1L6SA 3BUVA 3B8UA 4L9ZA 1WE5A 3B97A 4DPQA 3BQ6A 1LWJA 3V1HA 2CLFA 1VIWA 3LX9A 3DEQA 1DP0A 2VOTA 3WUFA 2DEPA 1X1OA 2RGMA 4PCPA 3EB3A 1E3XA 3QPEA 2ATMA 4D6EA 3EKLA 3LPOA 1VFOA 5G4WA 1W1IE 2YXGA 3PHAA 4ZXOA 3MHFA 2YW3A 2JBMA 2PODA 1X8FA 1MSSA 1AZ1A 5DY2A 4PUJA 4W86A 4J3WA 3N3TA 1FHVA 3GR7A 4S3AA 2OKTA 3GFZA 3CIVA 4GQQA 3N2BA 3VGFA 1FUYA 1WKFA 1TPB1 5CC6A 4LX4A 2V2DA 1QPOA 4WUIA 2VX4A 1E5NA 1S3HA 4HMEA 5CLTA 2BVDA 2ZZ3A 1TJ2A 1OFAA 3KS8A 3G0UA 4PB4A 3V35A 1OD8A 1SW0A 4NL1A 3CGTA 3FX4A 2PDKA 1RP9A 4LYQA 4KKXA 3U2OA 1LOQA 3W84A 1LF1A 2NV1A 3UZWA 4OFCA 3IWPA 4BQ4A 3VABA 2EBNA 3FLUA 3OQEA 1B1YA 2XUCA 3H2FA 1X39A 5A6SA 5BNKA 7REQB 4UOZA 3UA3A 4UFJA 2Y8UA 2WHJA 1LBFA 4IXXA 2BSLA 3AO0A 3FJ4A 3U48A 1R2SA 4LF1A 1UD4A 2DY3A 4IJEA 2DH2A 4LS0A 2YL6A 1BSLA 5GVJA 3PZTA 4KH2A 4AX7A 3NURA 4MAVA 1CWYA 1IYXA 3F03K 3HPFA 1VYPX 4UC5A 5FJRA 1BHGA 1H41A 4IG2B 4L6DA 3CV1A 2VWTA 5HOSA 1EF3A 2FHFA 4GUHA 4J3VA 4N4PA 4L5ZA 1LRNA 3AZRA 3VD4A 1UQZA 1XLAA 2FKPA 3B06A 3VUSA 3H7RA 3AHZA 3B0YA 3O63A 3LCXA 1OHLA 3O6YX 1E3ZA 4JQAA 3GXIA 4WDUA 4O8RA 4RZBA 4K39A 1GJUA 3RO6A 4QDPA 2BS9A 1Z41A 4CCEA 3W7GA 1D3GA 4H6RA 4GX8A 2GK1B 4HYVA 9XIMA 1B30A 4UZUA 3LZ3A 3DENA 3BW3A 3C0JA 2FPTA 4K6AA 4QBXA 3T8QA 2PC8A 3GVWA 4HA4A 2PGFA 3KRUA 4NKCA 4TV5A 5IBXA 1W1ZA 4PR4A 4XD3A 4RZ5A 4NXKA 2RKXA 1CNVA 1DQXA 4B92A 4B2DA 2HPIA 1B3WA 3MCMA 1A5SA 4FK9A 1DHPA 5BZAA 5D9MA 5IDZA 3CZKA 3QM3A 3F5LA 4MIMA 3GHRA 4KT2A 5ABTA 4HA0A 3TZFA 1TO3A 5I3JA 2YW4A 4JCMA 4FNQA 4IHCA 4IMCA 4YVXA 3DESA 1WPCA 1DJYA 4C6JA 1KWGA 3ZVHA 1X7IA 1AD4A 3A24A 3CM4A 3T78A 2G37A 5D33A 1K4GA 4OTKA 3KS5A 4UMAA 4ICNA 1W5NA 2CZ5A 4X2PA 4D6DA 1NWRA 3VDGA 1O5QA 1C91A 1W9PA 3C56A 4PB5A 3H6OA 3L12A 4QM1A 4I5RA 5D38A 5JQ9A 1NDWA 4CNTA 3RPDA 2P5NA 3W1LA 3ZLFA 1XLMA 4YTUA 2HJPA 3W1NA 5M2FX 3MI3A 5B7ZA 5HA7A 3W7PA 1XIFA 1KRBC 2E40A 5LXEA 5U4NA 3F2BA 1ITCA 2BVYA 1RH9A 2OG9A 3TWAA 2QIWA 4A4AA 1BYBA 3SGUA 2YB1A 1Y5VA 2YDQA 1X97A 3GAKA 3TC7A 5JBDA 3W1XA 4UWMA 4WGXA 1JJKA 3TYUA 3KDOA 2XPKA 4I5UA 2E25A 4V1YA 4PUUA 3EPOA 2OO0A 1U2YA 2X1IA 2WNQA 4GH9A 4FNPA 4Z1AA 3NSXA 2X1TA 4KWVA 1ZTVA 2H3DA 1QW8A 2ZKMX 5EBAA 1QNPA 4RNFA 3LGGA 4DBDA 3HONA 2XZ9A 3AHXA 4UNIA 3GIQA 4XBJA 3M0IA 3VKKA 1F3WA 2A85A 3F4CA 4H8VA 3N6QA 2G8ZA 3VX1A 1EEPA 4UQEA 2D0HA 3E0FA 3VOFA 2YYUA 3VIOA 1W17A 2HEJA 1TQJA 3GG1A 4GXPA 4E8GA 2GGEA 3P80A 2ZXQA 3IGSA 4WGHA 5F2GA 1H5YA 3A9BA 3TTEA 3H2EA 3CLMA 4YCOA 3RNDA 3VGGA 4AIEA 4DWSA 1WP6A 1GEQA 5CC3A 1YBQB 2WANA 3KP0A 1NFPA 3EOLA 3E1F1 3UA4A 4ML4A 3E0LA 3H4GA 4EANA 2DW7A 3RO8A 2W3ZA 2V69A 2QS8A 2FVMA 4LEQA 3VIFA 4JTKA 5G4HC 2NV2A 3AUJA 3WDHA 4RXFA 1S5VA 3B04A 3QV6A 3L21A 4S3KA 2W92A 1QHPA 1P7TA 4GY0A 3MSDA 1PJ9A 1CCWB 2Q8ZA 1BVZA 1DIDA 3Q58A 4HIBA 1QI2A 4O19A 2D24A 2GJPA 4QITA 3T9PA 1LBMA 2UV8G 1DE6A 3W7KA 3R89A 5JIPA 1IHIA 1UHVA 3MV11 2GGGA 2PDPA 4GHLA 5DN1A 5FEXA 4Z1BA 2YCEA 5LIYX 3BAXA 4Y96A 4IIDA 1ONXA 4IBDA 2PWFA 3FXGA 3EOEA 4UQBA 3JVAA 1LBLA 1GVEA 4Y8FA 4XAZA 3BCFA 1R9ZA 1EAKA 2WWCA 1TWIA 3W24A 3RX3A 4Z08A 1JAKA 2XM2A 3NXFA 3FGCA 1M53A 1V3MA 2WXDM 3OLEA 1S3TC 3W7CA 2GPTA 3W81A 1TR1A 1KTNA 3B8TA 4D72A 1QO5A 3A13A 2Q8LA 3KZPA 1HP4A 4JKKA 2X7VA 3UG8A 3NO5A 3UR8A 5TAOA 1G4EA 1ODUA 4N6EA 2QDEA 3AZTA 4GOAA 3W7OA 5C7HA 2XJ7A 2V5OA 1KR1A 3NO1A 1RP8A 2EPKX 2OEKA 4S1FA 1F07A 1EJ7L 3U5YA 4A29A 4E2BA 1K4HA 2XGIA 1C92A 2OQHA 2IPFA 4LY4A 3U4AA 2A3HA 1SFLA 3MU7A 4J4KA 3UXIA 4ZGYA 2QGHA 3BSHA 2JCHA 4Q32A 1PTGA 1DIKA 1KCKA 4TVUA 3UU0A 4HP5A 1RCOB 1F61A 5HMDA 3K8KA 3QSRA 4ZTYA 4ORIA 1VYSX 1E0TA 1GTHA 3L65A 4DRSA 3RYSA 1J79A 2CHOA 1HL2A 1J0KA 2E8ZA 3GAYA 4E8CA 3DERA 5I3KA 4C7FA 1FKWA 1J18A 2NLYA 4ZSUA 3UXDA 5AHNA 5LHEA 4C6OA 5A6BA 3BZJA 3TTYA 1NDYA 1SMDA 2QCCA 4AMCA 2QJNA 4YTQA 4GJ1A 1XG3A 1V8EA 4CNUA 1CECA 4JTCA 2Z6IA 1L8NA 2ACSA 3CTLA 3DFQA 3QC0A 1X38A 3BPWA 4BF7A 5D2TA 1P6WA 1U5JA 5HQEA 1OFQA 4WZHA 3D5HA 1U30A 1IIGA 1V0MA 1J6OA 1PL9A 4U10A 5HK4A 5HNUA 2A6LA 1DJXA 2XGZA 4LUYA 1O95A 3QYQA 3PTQA 3SQLA 2F6XA 1E6PA 1NVMA 2PLCA 2J47A 3ARYA 2QCGA 4E0CA 3PZVA 1GHSA 4NP7A 1ONWA 2WQPA 4YL2A 4PMUA 2VCBA 4AXNA 3T09A 5DCDA 1UR8A 4MKVA 4MWAC 2J88A 4CN4A 4GUJA 1LOSA 4WKAA 3HG4A 4DVOA 1PZ1A 1OCJA 1CXEA 1ZPTA 3M1ZA 3NCOA 2X1SA 3GXTA 3IIPA 4AU0A 3AXHA 3VKJA 4PE8A 3HFYA 2A4AA 1B4EA 1AZ2A 3W2NA 2YXOA 1JDEA 1YU4A 2OB3A 3UJFA 2VUNA 4G56A 2WMHA 1PKMA 1OEPA 3WNNA 1V79A 1WOAA 4DJDA 1K6AA 3EGJA 4W4QA 4MZYA 1NM9A 1TTIA 1DEDA 1M5WA 4W84A 3W3OA 3W73A 3SADA 1LT8A 3KFTA 1VBUA 3WLQA 3QR1A 1MZHA 4N9CA 4WSKA 3P84A 4WK9A 3TWBA 1KA9F 2PAJA 3BMWA 4GUGA 1DBTA 2YOCA 1E4IA 2J62A 4MWAD 1ZHAA 3GHUA 2BNJA 2DZXA 3IJIA 4OBSA 2YCKX 4X9YA 3AIUA 3GU2A 2HBXA 4GKTA 2E6DA 4QDMA 3IAQA 1EB3A 1Q6LA 2VRJA 2PDYA 4E4UA 2X8RA 4JHMA 3GG0A 5I06A 2V0TA 1JXJA 1J12A 4FALA 4DQWA 1GOIA 4K36A 4LVBA 3GU9A 1K1DA 1R8LA 1DQWA 4MG4A 2VMFA 4LC6A 1I2QA 3A3XA 3PG9A 1W9VA 1W6TA 2I7GA 4FX8A 2NUXA 3LGEA 1R5YA 1AQMA 3U5UA 2GQAA 3B9OA 1EP3A 1SZNA 2NX3A 3PULA 1H1ZA 2OSYA 4K1WA 3G6MA 2CCRA 1MWOA 2GSHA 3SR7A 3NPXA 1PTAA 2F6UA 2R1NA 2Y7GA 2E8YA 4B5VA 4WJEA 2CERA 3QN3A 4FX6M 3USZA 1DWHM 3GH4A 4LV4A 3HJZA 2WSKA 3GC5A 4IX2A 2G4JA 3I6RA 4H4IA 1EC8A 1P5BA 4XZNX 4EWJA 5DBUA 1AK5A 2IPWA 3L0KA 2Y4SA 2WVTA 3DGRA 1AQFA 4LAUA 1ADSA 3THCA 3E2QA 3VD9A 2X41A 4R34A 4Y2WA 5M3WA 1SZEA 1QPQA 1WV2A 3MSGA 2O9PA 1CXFA 4H7CA 3N4EA 4NZ3A 3W02A 1FQ0A 2ZXDA 2C6QA 1LUCA 4WHBA 3BCDA 3CK5A 1B3ZA 3S2JA 3AUOA 3SSJA 4IPNB 1MDRA 4AY7A 5LIXX 1SZFA 1RHCA 1JYVA 2AL2B 1ZAHA 2OODA 1DWAM 3ICJA 1FFQA 1G7VA 3ZO9A 1NSJA 5LZLA 4IUOA 2DFAA 3B03A 4OOZA 4UQAA 3A4JA 2ZX6A 1AVAA 3QYSA 1W2VA 1WZLA 1JL8A 4LUTB 1WO2A 1E8BA 2PS2A 3S6DA 3WQ6A 5CLWA 2C14A 2XVGA 4M19A 4P8XA 3Q67A 2OPJA 1M04A 1MXDA 1SO3A 3VNJA 5J8LA 4OKDA 1XLJA 4XO7A 4CNNA 1KCLA 4UUIA 4JFVA 4HPNA 5HULA 4HNNA 1EBHA 1CGUA 3V1PA 4HB7A 2BG1A 5I3IA 4EXQA 3KDNA 3LV5A 3IJ7A 2OELA 1TMQA 1TV8A 3L4ZA 5G4EA 4JQ1A 5M1TA 1EQPA 1YTKA 3NZ1A 1W1TA 1TMHA 2J24A 2R91A 3I6EA 1T7LA 4A2RA 5CZJA 1KV5A 4ILSA 2OZ8A 3EX6A 3ONCA 5DMYA 4NZJA 5F4XA 5KSWA 4ZQNA 1NWSA 2WPGA 1H7XA 1UP0A 3EYPA 3F5JA 1J0ZA 4NZFA 3M6YA 1RV8A 5ABGA 3LRLA 2G3MA 1MDLA 9RUBA 1PE1A 4MUPA 4US5D 5AHIA 2ZZ7A 5CG0A 1ME7A 2ZXAA 3BSMA 1J2BA 4YTSA 4JN6A 3W71A 3O6DA 1VRXA 5A8NA 4LU0A 3RLVA 4Z2HA 1JUBA 1B54A 2WNWA 2A6NA 4Q4OA 3CC1A 1Z8AA 3K13A 1EC7A 2VYOA 4RDZA 5IOBA 1CLXA 1EDTA 3C2RA 3S5OA 5CPOA 1KBKA 1BPLB 3S6OA 2VP8A 4HYRA 1VR6A 1UH3A 2EQDA 4AHOA 1VEOA 4OJ5A 1J5TA 2V82A 5A6AA 4I9MA 3BAIA 4NNCA 3NM3A 1VFHA 3NNTA 1CGYA 2D2OA 4I7UA 3C3NA 4RV3A 3AS0A 4TO8A 1Q3NA 5DY3A 4KCWA 2PURA 2R82A 1S2VA 2GZXA 3IGUA 1M7JA 3CQKA 1CB2A 2GJXB 3GNPA 3PJXA 3PB0A 2QULA 3TYAA 5F1VA 4YVVA 3N17A<