4NYUA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in c 2 2 21
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
406
structure length
406
Chain Sequence
TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 139
structure length 406
sequence length 406
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyuA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyuA01
4NZ1A 4V33A 4NY2A 2NLYA 2W3ZA 1W17A 3WX7A 4L1GA 2C79A 4M1BA 1W1A1 1W1B1 4NZ5A 2C71A 3S6OA 4OUIA 3CL8A 2CC0A 5BU6A 2VYOA 2I5IA 2C1IA 2E67A 2J13A 4F9JA 2Y8UA 1V6TA 3RXZA 3HFTA 4LY4A 4U10A 1Z7AA 4WCJA 3CL7A 2XU2A 2IW0A 4NZ3A 3CL6A 3QBUA 1XW8A 4F9DA 5JMUA 4HD5A 2QV5A 2DFAA 4NZ4A 2C1GA 4NYYA 1NY1A 4NYUA 3VUSA
chains in the Genus database with same CATH superfamily
5CPNA 4AZIA 5BRQA 2PRLA 3APGA 1W56A 3UA3A 3AIEA 3CMGA 4JTKA 1TVLA 2C1HA 3UJFA 3VIPA 3WH5A 2FTYA 4RR4A 3S9YA 2VELA 4UWMA 1QPOA 1QJWA 3CXOA 1JPMA 1EP1A 1X96A 4M80A 3KS6A 1KCXA 2RDTA 3J7HA 2ZIDA 4G5DA 1L6GA 1A80A 3MSRA 4GXMA 3QRHA 1UA7A 4EWND 3WDJA 4TTGA 1I8JA 3I7QA 3VD9A 1EUNA 1QI3A 5BXRA 3DU0A 3QYQA 1BXBA 3PB0A 3KTXA 4IMDA 4US5D 3V4BA 3NVTA 2ZA3A 4GYPA 2BHYA 5DFAA 3QMSA 3QM3A 2C7FA 5D2YA 1HW6A 3LHUA 1ZAIA 3GNRA 4GXPA 3W1RA 1CBGA 4ML9A 1IT0A 3TW7A 3VGHA 1DIOA 4C6QA 1TO3A 3OGVA 4O52A 2J9XA 1H4PA 3W26A 1E3ZA 1V5XA 3PBMA 3RK8A 3GD6A 1QASA 3DENA 3S6OA 1EX1A 4QE5A 2VX7A 3QW3A 4J2MA 1J0IA 4GACA 2RDUA 4GPNA 3UJSA 2RH9A 4OOZA 1F76A 3FJ6A 4JBRA 2CYGA 4WJ8A 2WJZA 5I03A 4AXNA 4ZODA 3UP8A 2FDMA 1J5TA 4JTHA 3RU6A 1J5SA 2FZNA 3HU7A 3CC1A 3U2ZA 1EIBA 2QPUA 4RX0A 2D3LA 4QAIA 1JUBA 2XTKA 4F0HA 1VPYA 4XAZA 2V3GA 3QOKA 5GJPA 4DLFA 1PTAA 2PTWA 4PUMA 3IUIA 4C6MA 1E0XA 1W2PA 1F8MA 4O1FA 4A35A 2BY1A 1B2YA 2ZX8A 4A29A 1PCWA 3GU9A 2A7RA 5FF7A 4KQNA 5KZEA 3LHWA 3A4XA 1K8YA 2IMRA 3QPYA 4R7OA 4QQUA 4HHMA 3MUAA 2O7QA 4QNWA 5A8NA 6ENLA 1SUXA 3WFAA 2YL6A 1XBZA 3N1AA 4MDOA 3IUHA 3CO8A 2IQDA 5FKYA 3TWBA 4PMUA 3ZSSA 3P0XA 1ML1A 2ZX6A 4UTLA 1S2WA 3SIMA 4H9ZA 5I7GA 2RDWA 3EZ4A 1ZFJA 2GPTA 1Z48A 3GVWA 1A49A 4S3DA 4P7OA 4IBDA 1UHVA 4LPCA 3LI0A 3GDKA 2PAJA 4UMAA 1XPYA 1CXHA 3O0FA 4N7QA 4HSNA 4N4QA 1RQEA 1WPCA 2WMGA 4JEJA 1OFPA 1KCKA 3MS8A 3IK2A 1J10A 1TYGA 3VKCA 1NWTA 2DPEA 4E4PA 3WUFA 2VEMA 4DJFA 3SDOA 2NX3A 4GI4A 2DGAA 2AOSA 3QR1A 1P43A 2OTDA 1VCVA 5C0QA 2PF0A 3AOFA 3LTSA 1ZP3A 4J3UA 2FGZA 5A69A 3H2AA 4URIA 4HZ6A 4DBWA 1TPUA 2OYLA 2NQZA 2NVCA 5D32A 2PDBA 3ID7A 3XIMA 1DXIA 2E8YA 2W3ZA 3RLVA 1TREA 3FJLA 2WK2A 9XIMA 2FYMA 3M41A 2ZE0A 3AYVA 1REQA 2OZTA 1VGAA 4FMVA 3AXXA 4AIEA 3AS0A 2L5HA 3AIRA 1DHKA 4GQGA 4CQ8A 5E09A 2WKLA 3S4TA 4I8YA 1F05A 3WKZA 1A5MC 2WWDA 4JZ5A 1G67A 1FWBC 3AXKA 2O9PA 3DYMA 4HCDA 3VAVA 2R1PA 3T2QA 4ZO7A 5A94A 4O53A 3ZQ9A 3IIOA 4FAMA 3FA5A 3IJ8A 1IT8A 3F5KA 3AIBA 3L12A 2FHCA 1DOSA 2E5BA 1H8PA 1UWAA 3U7BA 2C18A 1OWQA 1XQKA 3B8VA 3UY7A 1HNYA 1FFQA 4EXAA 1ALDA 2XGZA 3WIJA 3MW7A 3AMKA 1W5OA 3CEPA 3W3OA 2EG8A 2CESA 3AAMA 4O4WA 4HMEA 1CYGA 2FGLA 1O1HA 1PS9A 3EWXA 3KOYA 2RHGA 4TVDA 4BEQA 3RAOA 2W6RA 3OZMA 4UXDA 3L28A 4QG9A 4TIMA 1A3HA 3VVGA 1HVQA 5CCZA 1V6VA 3N4FA 4UTUA 2P3ZA 1QPKA 3STGA 1TWZA 2YB1A 4HHPA 2QCDA 3WMLA 3O06A 3WNKA 3LPPA 1F2JA 4EACA 1VFSA 5MKGB 2GK1A 1IIHA 3C0LA 3LM7A 3OW1A 1BWLA 3FX4A 3TAOA 1EDGA 4U2YA 4PUJA 3E1F1 1CX9A 3SCVA 4EIVA 4LBSA 4PCFA 4LYPA 1HG3A 5ENLA 4XUYA 2VD9A 3CAKA 4QEHA 1XH1A 3E2RA 3P60A 4M29A 2I9EA 2J7DA 1U30A 1L6SA 3VINA 4LVBA 4CU6A 1LL4A 1QXLA 3KBVA 4YMZA 4DB7A 3SSJA 1QATA 5D09A 4MVAA 1RALA 4MKSA 3B06A 4NSBA 1TWIA 3VTRA 1E55A 3ZFHA 3VKDA 1VJSA 3W38A 1GWJA 4AWSA 3THCA 2VXNA 3C2YA 1JZ3A 1EQPA 5CSYA 4W88A 2JCHA 1Y5VA 4AU0A 3HZ3A 2FPVA 4QDWA 1S5NA 3LGGA 3N4AA 3BVJA 3WSUA 1BG4A 1KFEA 4QJ5B 1SPQA 4XBKA 3RXZA 3PR2A 5KZMA 1A0EA 2B7PA 4HKPA 3ES7A 2J9YA 1Q6LA 4H8UA 1U22A 1G6CA 3LLDA 5CJNA 3UZXA 3M0JA 5HPCA 2E6DA 4PCSA 5LXXA 2J8TA 4GYPC 1H61A 1QPQA 1UZ1A 5I06A 4RCXA 3N9KA 3V5CA 4Z2GA 3SGZA 4K39A 1M01A 4X2PA 1CGVA 1ME9A 3DAQA 3PULA 2TYSA 3L2AA 3BOLA 1IGWA 3JZEA 4GD0A 4MNJA 1AH0A 4QITA 1WDRA 4O17A 1VEMA 4H9XA 3FLUA 4DXVA 4Z0SA 2Y0FA 1V03A 4XD3A 1E72M 2GVLA 1A5NC 2O9RA 4IIGA 5AECA 4XAPA 1PWMA 3OLDA 1A5KC 2P0OA 3ERPA 3CMJA 3P61A 2G0WA 3WO8A 4NG3A 2FVMA 4MJZA 4PH6A 2PDKA 2QYGA 3FXYA 1UIOA 4NJGA 5LKYA 4H6QA 3N3FA 1UP2A 4AISA 5FACA 1FUYA 1KD0A 3PZIA 1FQ0A 2NLIA 3M0KA 2OSYA 3L21A 2Q6ZA 4PSRA 3WF3A 2ZYFA 2Y7DA 2WC3A 5FJTA 3PFMA 3NQAA 2OO6A 4IGNA 4D6GA 4FIRA 5HUOA 2VCCA 3TC3A 2BGQA 3MB9A 5JU6A 4RNFA 2UBPC 3BAKA 2OLSA 4TV5A 4NZCA 3CL8A 1NP2A 3VABA 1ZHAA 1NFGA 3TDFA 3GAKA 4AEOA 1BYAA 1QI0A 1SFTA 4NZ1A 1DIDA 1BYCA 1PDCA 1V6WA 4PYSA 4DX3A 5CAKA 2Y8VA 3BOFA 3S2CA 3PBVA 1VYRA 1ODUA 2OZ0A 2I7GA 3MSGA 2GFTA 3VDBA 2MNRA 1G4EA 3DGBA 3APTA 2OU4A 3MCMA 4I6KA 3NJ3A 3GXPA 4IJCA 3CV2A 4GQ0A 1F7BA 3GH5A 1EXPA 3GR8A 1EC7A 4DJFC 4LS2A 4D6IA 4FF5A 4GZIA 1V79A 3AMCA 4JQAA 3TSMA 3PVFA 3SUTA 2V3DA 4OE7A 3W22A 3W71A 1UH2A 3M7SA 4DI9A 3N6HA 5EFDA 5K9DA 1N8WA 2B31A 1DJXA 3M6YA 5U4NA 1J12A 3GTNA 4TX9A 1JCTA 3ANUA 3HPXA 4FI4A 2PBGA 1Q6CA 2CLFA 2XU2A 2D23A 1VJIA 3XISA 4LUIA 2YOCA 3IANA 2OEJA 4Q4QA 5FI8A 2QUMA 5IBXA 1K70A 5DBUA 3WEZA 5IDIA 1CXIA 2DT2A 1TV2A 1V6TA 3GDMA 4S3KA 4OBTA 3LB0A 3UW6A 4GIAA 4PB4A 2Q02A 1UP0A 4FOKA 3NQDA 1RV8A 3HPFA 2ATSA 1XL9A 3PP7A 4TV6A 2ZADA 3TH6A 3RX4A 4JKMA 3OYXA 4D72A 4JQ4A 4R34A 1FH8A 1F3TA 2A0NA 4Y9NA 3CUJA 1G69A 2HE5A 4MY8A 1FOBA 1EJRC 2GWGA 4PGLA 1WCGA 1WOAA 1ZJBA 3NG3A 4S1FA 2EBNA 3OVGA 2EO7A 2XD1A 3LQLA 4UMBA 3QQ0A 1ZS2A 3VD4A 4NIRA 1HZYA 4YS1A 3FKEA 4WDXA 2F38A 2W92A 5CLWA 3S9ZA 3CIXA 5BOFA 1OQFA 3TLLA 1NJJA 3TZFA 5M1TA 3LV6A 3WQ4A 4GO8A 5BMXA 3S42A 3AS2A 4X61A 2BY3A 3SN0A 5REQB 4OJPA 1DE6A 3D0CA 2H8ZA 2X1UA 4BR1A 5CJMA 2Z1WA 5EGRA 2D2HA 4TO8A 2WNQA 5F4SA 1J8VA 3URQA 3ZJ8A 1S1PA 3Q94A 4HN4A 3RFAA 4HA0A 3RPMA 4WR3A 3IVTA 4DVOA 1LOSA 3G1XA 3URBA 4DZ5A 2GOKA 4N9EA 1X39A 4N9BA 3DN5A 5CKSA 1S1RA 1OB0A 4A8RA 4DM2A 2EXOA 3UT0A 4V33A 3UQNA 2Y62A 4IPLA 4HOWA 1S2UA 2EPHA 1LTDA 1AL7A 3KM8A 4KEMA 3VIGA 2B4GA 4NL1A 1HX0A 3WJYA 1V3LA 4GABA 4ILSA 4JTIA 2CXGA 1HIZA 3TJLA 2AL1A 3CV1A 4ZXOA 1HQTA 3Q37A 2XM2A 4CN1A 2G8ZA 1SO3A 4Y9OA 4WXZA 3QTGA 3S5OA 4K1GA 2OQLA 1HT6A 2J8FA 1Z69A 4ORIA 1JYVA 3R8HA 3S2NA 3E3HA 3D3AA 1K6WA 2QDEA 2YB4A 3TR9A 1EUAA 3LGDA 1KS0A 3BLEA 3UVAA 2WSQA 2PZNA 5AC4A 5HWNA 5DQPA 2QCFA 1DIKA 5CBIA 8XIMA 2EF9A 1RQBA 3K8LA 2IKHA 4UTJA 4O0ZA 4C6BA 4IJFA 1GOWA 4LAOA 1YTEA 3VUSA 4ZOEA 1RJRA 4GQQA 3EEZA 2Y2OA 5AHEA 3DXIA 4H6EA 1UKPA 4L9ZA 1GONA 5HQLA 4UR9A 3DZ1A 5EY5A 4Q6JA 4L4OA 3SR7A 3HM7A 1WKDA 1G4SA 3CLMA 6REQA 2PDFA 4HMDA 2C19A 3U7VA 5D9PA 1LBFA 4GHRA 4KWVA 5G2HA 4CNUA 4M19A 4Q3MA 3VNLA 2E28A 1LUCB 4JHZA 4PCTA 4JTAA 1KM4A 5HNTA 3VFLA 3JS3A 1GEHA 1G94A 3OA5A 2XN0A 3WUGA 1UWSA 1UW9A 2BGNE 3W4RA 3HGJA 5FA5A 5D03A 4H41A 3EPOA 4N2YA 1SSGA 4X60A 3U9IA 3VKKA 2NQLA 4IMFA 5M03A 3VD3A 4Y96A 1M7PA 1OFRA 2RGMA 4L4PA 3AHYA 4PCNA 4PUUA 4JTFA 1JI2A 2Z28A 4BWLA 2CBVA 2DFAA 2NX1A 2ISVA 2OMAA 3K8MA 4MJMA 1R86A 2FPTA 3PS7A 1UKOA 4WOZA 2Z7KA 1QT1A 5E9XA 5KMYA 3FA3A 2VEIA 3S46A 3LV5A 5CG7A 4U4MA 4XKMA 5FF2A 5HNNA 4C6EA 1PIIA 2Y85A 3ZWSA 3OVRA 4QE4A 4PMDA 4IFKA 1J0HA 5A2BA 4OT7A 3A3XA 2YBVA 2XFYA 3M9YA 1Q2SA 1RD5A 3I7SA 2VD8A 4WSKA 3GLCA 1QFEA 2EJ1A 2WHMA 4DHGA 2NVDA 4DM1A 9RUBA 4OBRA 4AH7A 1RD6A 3BQ5A 3R11A 5RUBA 1SO5A 4QDPA 1SW7A 3E0FA 1BQGA 4XWUA 1AZ2A 1E0TA 2ZFAA 5AYIA 4AWUA 1FDZA 2WM1A 4MY9A 2ZKMX 3KCJA 1TR1A 1GQNA 1XGDA 3N9RA 3TYZA 5HOSA 2IS7A 2AGTA 3QY7A 2V82A 3OP2A 2WBKA 3PTDA 1WX0A 2RKXA 2YSWA 2XSXA 2W27A 3MA8A 6PTDA 3AXHA 1OYBA 1KCLA 1GVQA 1EYWA 3KHJA 4US5A 2PTXA 3AC0A 3SCQA 2F84A 3EB3A 5JH2A 3LCHA 1F3WA 4ONVA 1UASA 4PMVA 5AYXA 3FNDA 4CQ9A 3NIYA 3QC0A 4K38A 2BWGA 3PZGA 4H9VA 2W4XA 1OT1A 4ZO8A 3GG7A 3TXVA 3RCYA 4CN4A 4P7QA 4CQAA 2VQTA 3OGRA 5ABFB 1OX4A 1Q3NA 5FEXA 4D6EA 4MNKA 2OWXA 1FHUA 2VR5A 3IJ7A 3IJ6A 1E6QM 3B8TA 3R12A 4AQLA 3MBFA 1UCWA 3TQPA 2F8QA 1CCWB 3SCPA 2FJKA 4K7YA 2CXEA 3R43A 5AHNA 4LSBA 3BLFA 1ZBVA 5JBEA 2X0YA 1EA9C 1W1B1 1W9XA 2WV8A 4TU1A 3TFCA 2RAGA 1OYAA 4R9OA 4CNPA 4QS6A 1M68A 1YYAA 5JIWA 3IRDA 4GQRA 1Z41A 4JFWA 5C9ZA 2VKZG 2OFJA 4G1KA 2BVDA 4DBUA 3EMCA 3GXMA 3BICA 1CIUA 3LTPA 1QO2A 4UR7A 4BF7A 3HO8A 3W6YA 1VBHA 5D02A 1VFFA 4WK9A 2F6UA 4F9DA 2FZ9A 2EKGA 3LMZA 2IPGA 5K9CA 4GI9A 1VD6A 3RITA 1TJPA 4JNZA 3R8RA 1PKMA 3DHDA 1AODA 1XIHA 5IXEA 5A8OA 3GE7A 1IEVA 4MMWA 4C60A 2QUNA 2V5DA 4J3ZA 4N42A 5CH9A 2GLKA 3ATYA 4B5NA 3AXIA 1N8FA 2PA6A 4FLQA 2Y4SA 4C6PA 4IMGA 3TJ4A 3VZZA 1AH3A 4ZO9A 2ZXAA 3B0XA 1ADSA 5IHSA 2XWDA 3FYOA 3VIKA 3G1YA 1W3LA 3JR2A 4NI8A 4Q4OA 3GU1A 5D8WA 2VNCA 1UYQA 1R2RA 3L2IA 3NQVA 1LROA 4QRNA 4WD0A 5EMUA 1E0WA 2DUAA 5KEZA 4CD7A 3OYZA 4WY0B 4M3PA 2J78A 3CB3A 3QXBA 3TSBA 4MJ4A 1W9BM 4ZZ9A 5T8GA 2VT0A 4RDVA 2E09A 2GUYA 4PRTA 4F9JA 4BI5A 4L9XA 2B7OA 2Y2PA 4W84A 2BBFA 5FF0A 2PURA 2ZVRA 2HVOA 3VGBA 2HWGA 3OGSA 1GW1A 1IXQA 1UC5A 4BF9A 1S2TA 3RJYA 1GVIA 4D6JA 2ZUMA 1AD4A 5IFTA 3FJ4A 3DFPA 1PSCA 2Y8UA 3IJDA 4H7CA 3DHFA 3GHTA 3L4UA 1H7RA 2DORA 2A6LA 1B0IA 2Q8LA 5EMMA 2XYLA 1GHSA 5CPTA 3M0LA 4DJEC 4MDPA 5F1VA 3BG5A 4JTSA 1PO9A 1CI1A 3WD4A 2J8GA 3NQMA 3EWYA 1VFUA 4GHAA 3MPGA 1RBAA 2HBXA 5CC7A 4DAIA 1DBTA 3OB8A 1GVFA 4I5UA 1HP5A 1Y65A 4C6NA 2PGRA 2ZX7A 1TIWA 2WM0A 2GUUA 3LRMA 3ZOAA 1VFTA 1HJWA 3DDMA 1OFQA 3ZM8A 4FXRA 4UQAA 1GJUA 4HMNA 3PJWA 2VFIA 1IEWA 4MZ1A 2NQ9A 3B8SA 4B91A 3TYDA 2VGIA 4WDTA 5DBTA 2H9AB 2OQYA 3WCZA 2V63A 1YXYA 3DECA 2QULA 3VI2A 4KERA 4DYKA 2DT3A 4AY1A 5K7JA 3NQCA 3QH2A 5HJYA 3CNYA 1Q4WA 1YBQB 1UD6A 3DFQA 2PTZA 1XUUA 1JF5A 4KFPA 4P8XA 1BPLB 4E2VA 4AW7A 1JAEA 4DO4A 4L64A 3AHZA 1R30A 4NJIA 1UD4A 2Y2IA 3R89A 4KCUA 4BWLC 2OWCA 3KBSA 3W1QA 3MHFA 3KL3A 1XH0A 3LX9A 4GI8A 4ZBCA 5T26A 4H9UA 1QO5A 5D8ZA 1D3GA 2PTDA 5BMWA 1XS2A 3P67A 1B57A 1UQYA 3NQ2A 3W1AA 2ZZ2A 3H2MA 1KGXA 2OGYA 3OEXA 4WY0A 3QPZA 1YXDA 2FPYA 3O2LA 3RLHA 1JR1A 1W37A 4PULA 4FF7A 2I56A 4LF2A 1FWIC 3CHVA 4DUWA 1E0VA 1LG2A 3G5EA 4C1NA 3LPFA 3KTCA 2UWXA 2ODOA 5CJ5A 1GVRA 5FCZA 2ZE3A 4AZBA 4DLMA 2PDNA 3U5UA 1MWOA 1FY6A 1MFUA 5BXTA 1IXOA 1ED7A 1CLKA 4Y90A 3NDZA 2UY3A 4W8AA 3VFCA 4NJHA 2WCAA 5DT5A 3D47A 1OD8A 4EKJA 5T91A 4FLSA 4CD5A 4F66A 4ZB0A 1O1ZA 2PMQA 3WNLA 3KBNA 4GA8A 2HZGA 3AS3A 4PMJA 5HR7A 3E0WA 2PWFA 1G4TA 1OZMA 2EPNA 1QCWA 1WBHA 3U8GA 2V5JA 4RDZA 3STPA 1J2BA 3GIPA 1LF1A 2MANA 3SFWA 5LXEA 4L6HA 1FKXA 3UCQA 1GVSA 4B5TA 4AIUA 2B7QA 2WMJA 1UUOA 4MWAD 3LEPA 4YWIA 1KFKA 4FP1A 2C91A 3R94A 1P6CA 3CPGA 4FNRA 1CGUA 4X63A 3TMQA 3V18A 3UZJA 4N9CA 2H9AA 2WOQA 1GKQA 4JICA 5C6MA 1LDCA 3SCOA 2VCAA 3K4DA 1EJWC 1OCNA 2PDMA 3SCNA 1KBJA 1JPIA 3W7LA 4YYFA 1XLAA 4O1CA 1PTGA 2XVKA 3LDVA 3HF3A 5DCBA 1YU3A 2WW5A 1KO0A 5A6KA 3RN6A 2VFDA 1XKYA 3QV9A 1EEXA 4Q6XA 1H09A 1I2NA 4V1XA 3BO9A 1PUDA 5F2IA 2WNZA 3EOLA 3ITGA 5AHIA 1ZTVA 1XIDA 4C65A 1AIWA 4MAZA 1Q85A 1W3IA 4DO7A 2UY2A 5FAJA 1WKEA 3Q2DA 4MNMA 2EHHA 2ZZ6A 1LOQA 5BRBA 3PN8A 2VENA 3QQ1A 4M6UA 4Q8MA 1D7KA 3D5HA 3W1PA 4LBUA 3SCRA 2I5QA 2A7NA 4ZA0A 1TRIA 3M5ZA 2GVYA 3O7UA 5TD4A 1FDJA 3UD6A 3ZIZA 2YZ5A 4PRWA 3PC0A 5D2XA 4JYFA 2X09A 2DSWA 3F2DA 4AX6A 2QCNA 3RM8A 2Q8XA 5F4WA 1Q7MA 3F4DA 1JAKA 1PZ0A 2QAPA 1VCGA 2VFFA 3MDUA 4PR4A 2XWEA 2EJAA 2P10A 3EA2A 1SSDA 4B9ZA 2OKTA 1J4EA 3TR2A 2BXYA 3PZVA 3BH4A 1FWEC 5F7UA 2ICSA 2YBUA 2NVAA 3OOQA 3ABQA 1TWWA 5I24A 2V2DA 3NYZA 1VHCA 1H7OA 3QC3A 1SZGA 3LYEA 3T0CA 3SURA 3VKAA 4DYJA 3FW6A 3DFNA 1GOMA 4NXKA 1E6SM 4H1ZA 4HYRA 2QUUA 2DQXA 1Q66A 1IZJA 1AL8A 1UH3A 3KDNA 1KWKA 2P3EA 2BHZA 1XP3A 2VQUA 1YPIA 4MJ2A 2ZTKA 3LHVA 4AB4A 3EXSA 5K4XA 1IQ8A 1PYFA 3IIXA 4S2BA 1I45A 3UNDA 4IP4A 2J6VA 2WVUA 4D1JA 1IXPA 4ZSTA 4OU1A 4B4HA 4O4VA 4QJ4B 1OX6A 1R8LA 3BLOA 2J27A 2FZDA 3E2VA 5DMMA 7ODCA 2NT1A 4FSAA 4GG9A 4QR6A 3S1XA 4IQDA 1E1CA 1WDDA 2NXIA 2O4MA 4H04A 5CZTA 5C7HA 2VUYA 3FA4A 4XX6A 3W2LA 2VURA 3ICJA 3UXDA 2Q3RA 1BKHA 1ICQA 4AZ5A 2QJHA 3ANYA 3EYPA 5IOBA 3ORWA 1XLHA 4U3CA 1C92A 2P5NA 1QWGA 4HVXA 5EL1A 1FVPA 3DG7A 2GJRA 4HZ7A 4ZCWA 4QISA 3HQPA 4K36A 2OPJA 3UU0A 4TUFA 2F61A 4E8CA 4XSLA 1W8GA 2Y1HA 3NVDA 4YVVA 4KRUA 5T9CE 2FB2A 3HA1A 1EWEA 5HNRA 2G3FA 4LYQA 2R1NA 4BQ4A 3HJEA 4BA0A 1RVGA 3Q4DA 1ZP4A 3LXAA 1DTUA 3ARQA 3HURA 1FWHC 4NX5A 1W54A 3STCA 4MHBA 3M64A 2JEPA 1E0UA 5A5WA 5HINA 3W81A 1QHZA 4PA8A 3M07A 5E93A 1WNOA 3LLFA 4Q4SA 2XPKA 4OIFA 1G7UA 3BAJA 2Y2JA 3CLWA 1BGGA 3HQNA 1KKRA 1A5BA 3PZUA 3HV8A 3OG2A 4Q8NA 3PZQA 2QEZA 2W61A 2XIOA 3BJSA 3W7MA 3G0XA 3VPLA 3M0ZA 2VVNA 4JR5A 3A5VA 3DGRA 3EX6A 3LG3A 1OGBA 4GJ1A 3WLPA 5D05A 2BXZA 4GZEA 2CIPA 4I5RA 3LNMA 1HO4A 2VR4A 4LAMA 2GDVA 3VU2A 4XO6A 1XFBA 3S83A 1FCQA 2YW3A 3O3RA 3RHGA 1C29A 2ZUVA 4UQ9A 4TR9A 3CU2A 4NRSA 1GVYA 1F8IA 4IHCA 4C5ZA 3C86A 3GR4A 1YNYA 2Y63A 1YDNA 2J6XA 5LHEA 2Y61A 1I2PA 1EAKA 1IR2A 3L2MA 1W1TA 3BLKA 4LS1A 1UD3A 1KFLA 4IM4A 3P2VA 4UTWA 1KB3A 4L80A 4MB4A 3MJMA 4IIFA 4D6DA 5DMLA 1TPC1 3OG3A 1BD0A 1TV5A 3ZT5A 5A8PA 1OFEA 5G4WA 4NHVA 1ZPTA 4QLJA 4Z1DA 4H00A 1R3YA 3NOYA 3E02A 5LNUA 1T96A 1A5CA 3RJXA 1OGSA 3U0HA 4GKTA 4L56A 3OODA 1QWKA 1QW8A 2JK2A 3R1ZA 1B30A 3CUHA 4GVIA 1VB9A 3BMVA 2J7HA 1CLXA 2XHYA 1OVDA 4K37A 1JVNA 3ITCA 3U48A 4HPXA 2ZRZA 2BGSA 3AYSA 1P6WA 4ADSA 1QHPA 3KX6A 3KL0A 1XW8A 5A8MA 1H63A 5ABTA 1CENA 5EPDA 4DWSB 3KVMA 1W3KA 2ADAA 1RK6A 4HNUA 5CGMA 3VOJA 5FJRA 1E15A 1M3UA 3ZT7A 3N6JA 1DXFA 4IQEA 2QPXA 5C8BB 3GG8A 3ITTA 4GBUA 4PUWA 4BQ2A 1X6LA 4IISA 3IJ9A 3GTHA 3H12A 4H6RA 4BI6A 5JQ9A 1RCXB 3TLQA 1XI3A 2IKGA 3EWUA 3PAJA 3SJNA 2O4QA 3TIMA 4GNKB 1RH9A 2WCSA 1I4NA 4LUTA 3T4WA 4QNEA 3VNIA 2IQTA 3GBEA 3MHGA 1Q2RA 2QNEA 2C1IA 5HQMA 5IDZA 1DJYA 2Z1VA 2ON3A 1Q8AA 1GCYA 1JPKA 1VFOA 4ZSUA 2KZHA 1DWHM 4GYKA 2ZXQA 6XIAA 1BAGA 2VM8A 1ZJHA 1KBKA 1VJZA 5BYWA 3M5XA 1V3JA 3AI0A 2INFA 3IK4A 4EAYA 4HNCA 4JL1A 1WUEA 2X1SA 4FX7A 3H21A 1SMDA 5FJPA 1S2VA 3WDRA 3UZWA 5AHMA 1Q65A 2Z2BA 2AMXA 1JFHA 1MEHA 2INEA 4M82A 2QDHA 3NEHA 4GVGA 3V3WA 2CLPA 4F0RA 3ZVHB 2TMDA 2XD5A 4AMCA 3F7JA 3REQB 3I4EA 3UXIA 1MW2A 3SBFA 1I9CB 4ZQCA 2E4TA 3W72A 3EWBX 7XIMA 2AGKA 2NX9A 1BVZA 1C8YA 2P53A 4OWGA 4RXFA 2FLIA 2VJXA 2AAAA 2YCJA 3NZPA 1XCFA 1UH4A 3QEZA 4HT3A 3AU6A 3ABZA 3ARXA 5JBFA 4QIUA 4L1WA 4JTUA 2C0HA 4OQVA 3E49A 2OX4A 2E6YA 8XIAA 3IGXA 1HN1A 4KPLA 4F0LA 1H7NA 1U83A 5TF0A 3IARA 1UKSA 5ABGA 4FNSA 4WXYA 3MWAA 3VD7A 2XG9A 4DN1A 5AC7A 2YYUA 2WVVB 3AYTA 1BVWA 4HOZA 3A3WA 1V3HA 3AJ7A 2VGBA 1FWSA 5EB8A 4B5WA 4L4LA 3PNZA 4OFCA 1AFSA 3L65A 2E77A 3VD5A 2PSNA 3T0BA 2G37A 2QJNA 4J7RA 4JTCA 3GTFA 4H19A 3QZAA 1EBHA 5FOOA 4XIAA 4AD0A 2Y7GA 4CU7A 3CUIA 2XSBA 2QVNA 2WMHA 4NILA 4TTUA 1J2WA 3OPSA 1A5SA 3CBWA 1FWRA 4LUSB 2BVWA 3CPRA 3ARPA 2A3HA 3POCA 1H50A 2ISSA 4PZVA 3K4AA 2J77A 4CQBA 4L61A 3VOFA 3DC8A 3OQEA 4HNNA 4XZIA 2DIKA 2R8WA 3M7PA 2OOFA 3EDJA 8CGTA 3GVGA 4IQJA 4EX4A 3ZMRA 3CUZA 3WLMA 3KLLA 1QK0A 4JKLA 1PE1A 4YIWA 1XD0A 4AD3A 3AALA 3E96A 2WJDA 5BRPA 2VI0A 4Z0JA 4MYXA 3DBPA 1E5JA 4UTIA 1V6YA 3OIXA 3MHUA 2WZHA 5A1AA 2I9UA 1UD8A 4JTRA 2ZZ5A 4GCXA 4LEFA 1GZ1A 9XIAA 4QE1A 1TPB1 1XC6A 4DXXA 5HA7A 4ZQOA 2OODA 5G1MA 2HV5A 4I7VA 2PODA 1FCVA 4JS3A 3T9PA 1XRSA 1SZEA 4ICMA 4BKNA 1X6NA 3F1QA 1BHGA 2X42A 4HTYA 1U1UA 3CUFA 1K8ZA 2NSOA 1EA0A 1FXQA 2VZOA 4FS9A 1KWGA 3NQ6A 4RV8A 4A8NA 1LLOA 5L6UA 4UQDA 4W7VA 4GKLA 3W70A 4OJLA 4FB7A 1P0DA 3RGTA 2XVGA 4Q4PA 4REQB 3WBEA 2OOGA 3AZTA 2PZ0A 3ARZA 2OVLA 1BTCA 4I5XA 3VZYA 1FH7A 4I8DA 3H70A 1SFSA 4IIHA 1XXXA 3GY1A 3TC7A 4QLLA 1FWFC 1OCJA 4B3KA 2PBOA 3PBGA 4PMXA 3MYOA 3CYVA 3KXQA 5FEWA 3VIIA 3FDGA 1VLIA 1HJSA 3KBWA 3Q45A 4JIPA 4IMCA 2O9TA 4DY1A 1KFWA 1NWRA 1QU4A 2J7BA 2QJMA 4HCHA 2CLMA 4NX0A 4QTGA 1UKTA 1E8BA 2BLEA 3N2TA 5AVNA 4PE8A 2PDPA 1P4CA 4HU3A 1OC7A 3GX9A 3CIWA 3TX9A 3VNYA 4ZOCA 1QDSA 2JE8A 1KNWA 1HKWA 2PCQA 1GKRA 2ZTJA 3TC6A 3WQOA 1WP6A 4POCA 1XYMA 3W7JA 3IAQA 2WNNA 4LT9A 3RLUA 4DELA 5C71A 4O19A 4BCEA 4LVAA 3AUOA 4B16A 1BSIA 2GGIA 2YZRA 3EAUA 4PTDA 4GIRA 5CSUA 3SRHA 4DIAA 3F03K 1UWRA 2VEFA 1UPMB 3CJPA 1BXNA 2Y2WA 3UETA 4JOMA 3T7VA 3L5AA 1DWFM 3RMJA 4Q7NA 3W7IA 1CZ1A 4HPNA 1ZU8A 3WZ0E 2WPBA 3EX1A 5D33A 4UQCA 4OHQA 1U33A 1XKJA 3VDGA 1DWAM 3WQDA 3VUPA 7REQA 3W82A 4YYCA 1Z7AA 1IZCA 3AHTA 1FWAC 2PWDA 3AFBA 3WJWA 2WC7A 1EWDA 2FVLA 3NXFA 1Q4NX 3H2OA 3ITLA 1WDPA 3KVKA 3F2BA 3WF4A 1QUMA 1UR4A 4QG6A 4GOAA 4IG2A 4OOUA 2X0SA 2CKRA 4UZSA 3L4YA 3LM3A 4ICCX 3S5YA 4WGXA 3HG5A 3KL5A 1PX8A 4H6KA 2YCLA 3HPSA 3THQA 1O4UA 1DXEA 3TN3A 3NM1A 1F61A 2D3NA 4JFUA 2PDIA 1BTMA 3BJFA 1B31A 2QKFA 4XB3A 4OGZA 4Y9AA 3KDOA 1GW9A 3U2OA 1PX3A 4CQCA 1OADA 5G2IA 4OZOA 2H3DA 3LBCA 1JYNA 2VRJA 1EOKA 3VMNA 2GYIA 3BUVA 4MKNA 3TE9A 2DW7A 4MGGA 3U57A 2JEQA 3NQGA 3M0YA 4N6EA 2V38A 1E73M 5HPOA 1HGYA 1KM2A 5FD0A 1TA3A 3DI1A 4KWUA 1W5MA 3L4WA 1TVNA 1EX5A 3NQEA 5BU9A 1E4IA 5A8GA 1ZAHA 1C7TA 3F4VA 2O9OA 3TQVA 4EXBA 3RPTA 4GINA 4MWAA 3BQ6A 2JKPA 4HK6A 2W9MA 3D3FA 3PPGA 1UD5A 5I78A 1H51A 2YL5A 1EJ7L 1WKFA 3SIZA 4Q8OA 1H1ZA 5GPRA 3B0VC 3M43A 1D3HA 3L5LA 3W2NA 1CECA 2YPIA 4XBJA 3CL7A 4B5XA 4CCZA 4AWTA 4NAFB 1GOQA 3G2GA 2XIBA 4M8UA 1Q6DA 2QAFA 1IV8A 3C8FA 3O63A 5DMYA 1SO6A 1E56A 2PTYA 1HL2A 4O28A 4HSOA 4NAEB 3TXZA 1CGYA 3VMOA 3BGAA 4XVEA 1F6YA 2CHNA 3T40A 4Z17A 4MB5A 2HRWA 1OCBA 1MQPA 1EC8A 2ZUUA 3SCUA 3KAOA 1N55A 1XH2A 3DFTA 2C79A 4PTWA 5AOUA 1ZBWA 3W86A 3XINA 3W85A 2QPSA 4LY4A 1N2VA 3AMGA 4NUWA 1PZ2A 4CVUA 1CW2A 3M0XA 3VOCA 1H41A 3G24A 4G7FA 4U5IA 1ELSA 4W5ZA 3ECQA 4LG2A 3NO3A 1XLMA 3SB0A 4JEQA 4HB7A 3WUEA 3SGGA 4A3UA 1JULA 2WB5A 4NYYA 3EOEA 3GS6A 1SJBA 4LNYA 3QMTA 4IBEA 1F4HA 1SJDA 5CPSA 3GB6A 3N73A 4PTVA 1IHIA 4CNSA 4IBGA 3GXNA 4EP8C 1FFRA 1YUEA 4ZB2A 2Z1XA 2VC9A 1PZ3A 1RBOB 1VQTA 3QQWA 3ZLGA 3W75A 3HPZA 4A2SA 2ZWZA 4MSSA 3FHAA 2DSUA 4H8HA 4QSFA 3K30A 1QI4A 1NSJA 1M41A 4CCEA 1W9UA 4UFMA 4NZ5A 2E6AA 4JAWA 4IJBA 4BQ3A 2Z6IA 4NF7A 4F79A 2CNCA 5FSDC 3SCWA 2FIQA 3RUBL 2VEKA 1MVYA 3AIWA 5FJUA 3MV11 2JGQA 3LXBA 1G5AA 4JY8A 3DESA 4KT2A 2RGLA 1NFPA 2ANUA 3WQPA 4AG0A 1XLJA 4EE9A 2OG9A 3A21A 4GX9A 1JCXA 4YVXA 2Z4GA 1SMAA 1XD1A 1WB0A 5HJLA 1KXQA 4NZ4A 3TFXA 1IEXA 1U5JA 1YE6A 1AMYA 4XZNX 3IPWA 2ZUNA 4GZJA 3MI2A 3O1NA 2OT0A 2VRKA 3DHPA 3MUIA 2P88A 3K13A 3AICA 1VHNA 2BMBA 3CZ8A 1KC7A 2IQ0A 2YXOA 3GNNA 3STFA 4W7WA 2EAWA 1IE7C 4MKVA 4AEFA 1J6PA 1PDZA 3WQ6A 1HVXA 5C54A 1RLDA 4NAEA 4WGHA 5BU6A 3KBJA 2VOTA 1XDMA 1H7PA 3R13A 4YTRA 1GXDA 3C0QA 3LMYA 1PHWA 4ZGYA 3SQMA 5JXQA 1M9HA 1BYBA 1T5AA 1S3HA 2V2CA 4WSHA 1BLIA 1P0KA 4YTSA 5I3DA 4JCMA 4IQLA 1CT5A 3B4YA 2X40A 3UFYA 4DJED 4Q8TA 2I1OA 5DMNA 1W5PA 1JYWA 4MFDA 2QUTA 1KLZA 3P5ZA 1RBLA 1V6XA 3N17A 1Q6FA 4X3ZA 3PPFA 1VBGA 1R87A 1XLCA 2GVEA 1AMKA 3FGCA 4FK9A 3BV7A 3FHQA 3BAIA 3CZGA 3NO5A 1UG6A 2PD5A 1Z3NA 4QQ3A 1ISZA 3A3HA 5JVLA 3HG4A 1LOLA 3G77A 4UFJA 4CKQA 1T0OA 4MPKA 3HONA 2WXDM 3BW4A 1F74A 1DIEA 3L0KA 4Z2KA 2BG1A 4PC8A 2WC4A 3FYPA 3QF0A 3WBXA 1LQAA 2INZA 5CC6A 4G7EA 4K7VA 3UYCA 4ROQA 3CT7A 4PFMA 2GDQA 2UZ9A 4NZJA 4NXSA 1H1NA 3CPUA 4PTNA 2F2KA 1TMQA 1WDSA 1KBIA 2CZEA 3DG6A 2O7SA 3BL3A 4JXCA 2OO0A 5MHBA 2IOUA 3AROA 3UA4A 3M0HA 5H8PA 1RAKA 2D1ZA 3QTPA 1XLGA 1KA9F 3MTWA 2A1YA 3OHMB 1DWJM 2KAUC 3SI9A 5EMYA 1PHQA 3G3DA 1JXJA 1OIFA 1S39A 1Q63A 5B80A 4G6CA 1WDWA 1R0MA 2EPKX 3OLEA 1XSIA 1DPMA 3O6YX 3TEVA 3MMTA 5I5RA 3E74A 4U33A 2XFRA 4JCLA 3PFRA 4O8AA 2EPOA 2CZDA 1ZNNA 2ISDA 3PBYA 3V0SA 1GOOA 1Z42A 1PVNA 2Y6ZA 1E88A 5CZJA 1JZ6A 2OYKA 2NSXA 3GHUA 5LNRA 1Q7QA 4Y9MA 5G1YA 1LP6A 4K1WA 1NTHA 1UWQA 4KS0A 3UY8A 1MUCA 4IMAA 2G3IA 3W7RA 5D04C 3PJUA 4MWAC 3WLIA 2XINA 5BPVA 1V3IA 2D0HA 3EX4A 1KM5A 3R2GA 5A6BD 1L6WA 3MT1A 4QCFA 1ICSA 8A3HA 3N4EA 2XZ9A 1EHAA 5DELA 4BY3A 4AZCB 4IF2A 3A13A 1UC4A 1VKFA 1TUXA 4UTHA 1G7VA 2BP1A 3V7PA 5LIWX 4D71A 1XDLA 1L2QA 4GIYA 4LYKA 4IGMA 4YL2A 4IBJA 2CPUA 1AZ1A 2Y5EA 1GQIA 5CPLA 3ES8A 3KCLA 5CC3A 3NSMA 2OEMA 2Z1BA 1B90A 1AQ0A 3JVAA 3ANVA 3FJNA 2NQHA 3O0KA 1REQB 4OJ6A 1K1DA 2D0GA 5A6AA 3KOZA 3QBUA 2PRHA 2GZXA 1FHLA 5HK4A 1HJXA 3C2VA 1X8FA 2R94A 2A3LA 1RUSA 1TZ7A 4XG1A 4HHHA 3UXKA 4DXKA 1PX4A 3CGTA 2VDIA 3WLLA 1YU4A 3E2QA 2CBJA 1EZ2A 4EANA 1YHTA 2FFCA 4ALDA 2Q8ZA 6XIMA 3VKJA 4HNLA 3HSHA 1POJA 3ZWTA 2C71A 3FAWA 2E7FA 4DRSA 2QHAA 5D9OA 1EJUC 2Y5JA 1KW1A 3MKVA 5AHFA 3C56A 4FALA 3HMCA 3QFWA 2ACSA 3VE7A 5C2CA 5M17A 1WKYA 1J0ZA 2XIIA 3WLQA 4KCWA 1XR2A 3FS2A 1J96A 3I6RA 3TQKA 4OV4A 3GW0A 1G9HA 3DFSA 2YCIX 2YL8A 3BARA 5HR6A 3T44A 9CGTA 2CFFA 4A2RA 3GZAA 1N8IA 2QCDB 1PYMA 3E0LA 3MJYA 4RDWA 4MLJA 5DRIA 3FIGA 3BGGA 3BZJA 3CH0A 2GK1B 4LH8A 1SU5A 2JBMA 3ME3A 3EA1A 2C15A 1H7WA 2WKJA 3BE7A 3VGDA 4A8IA 4RE3A 4S3GA 2A3AA 1W17A 1UZHA 2REQA 3W25A 1UR8A 4BEUA 4KEZA 3U2CA 1HL8A 1TX0A 3S1GA 1WE5A 3ZS4A 1TCDA 4NQ1A 5I3KA 1V3KA 1TMHA 3NZ1A 1Q5MA 5HUPA 3SW6A 5KITA 3S1WA 1JNDA 1SZNA 3W23A 3SUUA 3ATZA 2WKGA 5LIYX 2WZTA 2V3EA 4UFLA 3VGEA 1A5LC 4AZCA 5HMSA 3IIPA 4PUKA 1C7SA 1E6RA 2ZICA 4V28A 3RRAA 4MB3A 3N12A 1I1XA 1JCYA 4NJKA 3ABRA 5E9AA 3H22A 3LD5A 3LTYA 4M0XA 2QT3A 1CXLA 3W53A 2FTPA 2QXWA 3ZXWA 3Q65A 4R5EA 4H7VA 4Y2WA 1TQXA 3N34A 3RMEA 4IX0A 1WZMA 2B0MA 1K7FA 4U31A 3CAWA 1JCNA 1GG1A 1UA3A 2I57A 5D9MA 1OC5A 3ZSTA 2QVHA 1MDRA 5E70A 4GRSA 1B9BA 1LWHA 1YNQA 4AFYA 2DZBA 4FLOA 1VCFA 4Z2IA 4H83A 2X7VA 3MP5A 4GNJA 2WSKA 1KFBA 2DQWA 4J35A 4C6JA 5EA9A 4HNTA 4AD1A 1BKSA 2JFEX 4XZLX 1JQXA 1LL6A 1UR1A 5G2WA 5HMFA 3PZTA 1S5MA 1NOFA 1RQHA 2JALA 3KRBA 2ZDSA 1VC4A 4LVDA 1E51A 4M6PA 1KV5A 1E43A 2X8RA 4JTJA 1FDYA 2CBIA 1AQMA 1MW1A 3I6TA 1YDVA 1ZUAX 4X0VA 3PUEA 2Z2AA 4A3HA 2PGFA 2QCMA 4YVPA 3QFEA 2DW6A 2FQIA 2A2IA 4IL0A 4M5PA 2NV2A 2EG6A 2FFIA 1EJXC 1I6NA 1B3WA 4BZYA 1FKWA 1X97A 2V5CA 3BSMA 3NO1A 1RVKA 3KBMA 2XFWA 1GOIA 3W7HA 2KX9A 1WZKA 3GAYA 2YFNA 2V0TA 5CQ1A 1MSSA 1V02A 1KRAC 5F2GA 3GVQA 1YIXA 3T05A 4V15A 3VGGA 1US3A 3DEQA 4C1KA 3G1FA 4W8LA 4MNLA 1KR0A 3LZ5A 3WDPP 1M53A 4O1BA 4R85A 4JQ1A 4MPQA 3L0NA 4LJ3A 1ZB5A 4KBXA 2CLLA 1FCBA 3O05A 2QDDA 3INPA 1FCUA 3S47A 3SUVA 4B15A 1E9YB 1K02A 3IV8A 4HOXA 2DZPA 5GNYA 2XN2A 2GJXA 1E9IA 2VFHA 3JUGA 3SUWA 2VEGA 4I9JA 2JKAA 4LU0A 4MUZA 3FY1A 4ZR8A 3B9NA 3WL1A 3FSUA 3EX3A 1ODZA 2WVTA 4E8GA 3BC9A 3QGKC 2Z24A 4YHGA 4AVFA 2TPSA 4E2OA 4WF7A 2RDXA 3WD3A 3GDLA 4E4FA 3W00A 1JGIA 2X05A 3N2CA 3P82A 3H2EA 1KV8A 1XIMA 3UZ5A 3B0UX 2G96A 5IRPA 1QOXA 1W31A 4QAWA 4ZB5A 2YIHA 3TU9A 1YLVA 3MSYA 3T09A 1RXOB 3T2OA 4LB4A 5C2XA 4O10A 3HN3A 4DBEA 2BV9A 3SQSA 1A47A 4QXIA 5CXPA 4QP0A 3W73A 3GQYA 2W62A 3S6TA 3V75A 2ZDRA 5CZSA 4LW7A 2J25A 1C3FA 4RLIA 1W9PA 2WVSA 4H8VA 2PWHA 2UY5A 3E9AA 2X41A 5LNVA 1VZWA 3VIFA 1NDYA 2ZA1A 3MDWA 3WDIA 4ZQPA 4B5VA 3GXIA 3WYZA 5FL1A 3VZXA 3D46A 1W1IE 1ZBKA 2HE8A 1R9XA 3VCNA 3C2FA 1MDLA 2OLAA 5LIXX 1Z32X 3VDAA 1R9YA 1RLCL 1QI2A 2DVXA 5CLTA 3CWHA 5HAOA 5HATA 1YU2A 5I3FA 2NQJA 3MU7A 1KKOA 3KWXA 2BTMA 3ISIX 2JIEA 4GUFA 1NF0A 1NM9A 3DC0A 5EKYA 4AWEA 1ME8A 4J3TA 1CPUA 2QCCA 3LLXA 5AFDA 3MKCA 1DP0A 3O6AA 4WSJA 4P7NA 5BWAA 1WAUA 2GGJA 3G1HA 3CB8A 1YRRA 1L6JA 4XO7A 3E0IA 3R58A 2JIWA 3WNPA 2W0UA 4G8TA 4RZ5A 3AZSA 4D6CA 1JZ5A 3CO4A 4LEQA 1AUSL 5A6JA 1W2VA 3UG3A 4DPQA 4HNVA 3HFYA 3CUGA 4HJWA 1US0A 2ZZ3A 2WQDA 3MI6A 4DZAA 5AVHA 2X0HA 3WQFA 5B7ZA 4DYEA 2GGEA 1D2KA 3B9AA 4WUIA 2VX6A 1V0LA 1JDDA 1LORA 4IFOA 2WLZA 1T99A 1TWDA 3HGSA 3IGUA 3L67A 3L7RA 2HJPA 3W2JA 5K9XA 1EBGA 3NUKA 4OUEA 3GHSA 4F0MA 1MXGA 3RO8A 3GG1A 3HQOA 5BW6A 5A2CA 5AZ0A 4NI3A 3K5XA 1KXHA 3TUUA 5FEPA 4LXFA 4JNMA 1P0EA 2AL2B 3P81A 3WQ8A 3S5SA 5TAOA 2DVUA 3GDBA 3A9IA 1R3TA 3AJXA 1ZLPA 3GYCA 4JX5A 1TPH1 4WLCA 3NCOA 3UJEA 1O7AA 4ZEPA 3WJSA 2XM1A 4LCSA 3H7RA 3PZ9A 1C8XA 1K4HA 2TRSA 3W1LA 3N9SA 4Q8QA 1UWTA 3UPWA 3M7WA 1EJTC 4BHYA 2ZOXA 3WBWA 1ZSXA 3TTQA 3T81A 4UTFA 1JCMP 1JDFA 2XH7A 3SFKA 4PBGA 2QJIA 4AX7A 3QR0A 4RZ6A 1QOPA 3CV7A 1IT7A 3R10A 2B7NA 2BASA 3LRLA 1PTDA 1P0BA 4HHLA 4UFHA 3L27A 4PN2A 3VDCA 1E5NA 3R6IA 3W2MA 2ABAA 4XV0A 4J1OA 3ZLHA 1IZKA 3QHMA 2VHLA 3WFZA 3GIYA 3ZR4A 1EF3A 5KINA 1NVMA 3HIJA 3MKKA 3ARTA 4N6FA 3WH7A 1O5KA 4MG4A 4FR6A 3UG4A 1RA0A 5FF3A 4HU0A 1CGXA 4OJ5A 3FK4A 4N02A 4KWOA 3CZKA 1I2RA 2D0FA 3LSBA 2D49A 1DL3A 1UOZA 5JMUA 3DHUA 3S1VA 1XCWA 4LVFA 1EO5A 1KGWA 4C6DA 5C9RA 3P62A 1TJ1A 2HS8A 1J9YA 4C7GA 1N7KA 3LERA 3W7KA 4B2DD 1XRVA 3ENLA 3KTSA 5DXYA 4MLRA 1C91A 1XSJA 2EPMX 6REQB 5DCDA 2V9DA 4X9SA 4WZHA 4DBSA 1FA2A 1BYDA 4CU8A 2RJGA 4RPQA 1VYSX 1PV8A 1E4MM 2VC5A 5G4HC 3PBUA 2ZA2A 3GR7A 1EHNA 1K8CA 4EAMA 3LPGA 3W7DA 3GO2A 3OJGA 3W02A 4O12A 3GNDA 2BNJA 2YA1A 2E25A 4PMOA 4A8LA 4MIMA 3PTMA 2DIJA 4YNGA 4CD4A 4GYFA 1JI1A 3UPBA 3DG3A 3EKLA 1HJVA 2FH8A 1XV8A 3QV8A 1TJ0A 2VWSA 3OBAA 3NTYA 2AQWA 1UIPA 1BG9A 4HD5A 2BVTA 3T0DA 4AZGA 2CHOA 4DWSC 1TIMA 3NFUA 2RJHA 1IWPA 2WHLA 2CLHA 4IIDA 1AJ0A 1PIFA 2AL2A 4XZHA 1VR6A 3Q58A 1EFZA 2CERA 1ZALA 2YBTA 4NJJA 3TMLA 4NZ3A 4GY7A 1TZZA 4M7TA 4IFKB 1OCQA 3GUGA 3VIHA 4CEUC 4GUGA 3WL0A 2QGHA 3BK0A 4NT0A 1ONRA 4DUXA 1LRQA 3AO0A 3V0TA 2DZVA 3NQBA 1B3OA 1M03A 4RXGA 3M0MA 3GFYA 1Y5WA 4BFAA 3QV6A 3CHDA 3TONA 3M0IA 1OFAA 3WLTA 1W8SA 4D6HA 2NZLA 2YA2A 2G3JA 3ALFA 3B0PA 3W07A 1BGAA 2ZXBA 5LIUX 4Z2LA 1P7TA 2ATMA 4WY0F 1TV4A 1GOKA 3NSNA 5J04A 1MNSA 4L6OA 4J27A 3VCRA 4DJEA 2G41A 2FKPA 1R7AA 4Q22A 2G95A 3H53A 2E9MA 4MYAA 3U3HA 3W27A 3C8NA 1ZCOA 2V2HA 4HN8A 3UR8A 3GWQA 1V4YA 1GJPA 1EJVC 3RX3A 2G5WA 3LBMA 3B8DA 1NFBA 1WBJA 5CPMA 1DORA 3EDEA 1AW5A 4E5TA 3NPUA 2G4JA 2PP3A 1OYCA 1OX4B 2WSYA 5LIKX 1OINA 3IAPA 1YE4A 1FRBA 1PKYA 1D8CA 4GFIA 5A6LA 5H91A 1VFLA 3NDOA 4QCEA 3W1UA 3VX1A 1GVEA 4AAJA 2R9RA 2YXGA 3U6WA 1W5NA 3KW3A 3S9IA 3VILA 2PF8A 1RY0A 2OQHA 1WQ5A 4AVOA 2TODA 2YYTA 4F4RA 4ZXLA 1I0BA 4M56A 3S5ZA 1XBXA 3R4IA 4AMAA 3N2BA 2ZRUA 4DJDC 3AWOA 2E67A 1TCMA 3MCNA 1P5BA 1S5VA 1Y8BA 1JPHA 3DKJA 2GJPA 3P93A 7CGTA 4JFTA 3HOJA 2HCVA 1FWGC 1TB3A 5TNVA 1TPEA 1LBMA 1K03A 1YTDA 4BF5A 4I6VA 3L4TA 3BLIA 1GPFA 3AISA 3THAA 4KETA 1LQ2A 1TTJA 3HBLA 1P1XA 3PUGA 1U5HA 1TWSA 1OF6A 4KGJA 1HGWA 3UGRA 3W83A 4GMEA 1YU1A 1PBGA 1DV7A 1R9ZA 1UOKA 3A6OA 1XIBA 1JNEA 3SO7A 5EBAA 3DBNA 3KOXA 4ECLA 4LWWA 3L4ZA 4OVXA 3QSTA 1DE5A 1OGGA 3W7GA 1Z89A 5DX7A 4JHMA 1TPVA 3DIPA 4JTGA 5A6BA 3GVRA 2PP1A 2V6AA 1XYAA 2C14A 4RNIA 1MUMA 2PGWA 4FXFA 3TJIA 2QUVA 4LUJA 6A3HA 5LA2A 3GC2A 4UTTC 2FMNA 3MQLA 4P7RA 1IF2A 1K4GA 4GGHA 1JUKA 3UXLA 3H4GA 5BWFA 3UG5A 5BCAA 5AZ1A 3WY1A 4LS0A 4WHBA 4ASTA 4C7FA 3WH6A 1T6MA 3G22A 3C2RA 4MUPA 4NKCA 2PLJA 4JX4A 3PB2A 3JZUA 4QGCA 4B92A 4ACZA 2HXUA 4RPPA 1VPQA 5DN1A 3ARYA 2AQOA 1R46A 3RIKA 4JN7A 3UJRA 1KM0A 4H3DA 1OC6A 3GTIA 4KEUA 1QO6A 3WBYA 1CXEA 2VEPA 3ABOA 3OU8A 4Q4MA 3CK5A 2QF8A 4KRZA 4AHOA 3PG8A 2G3MA 4HA3A 1EEPA 2CLEA 2HDJA 1CGWA 2NXHA 3H2FA 4HA1A 2BDQA 2WWCA 3LK6A 1U5VA 2E40A 4E4UA 4ZENA 3LU2A 1JL8A 2Z26A 1B3ZA 1FWWA 4S3BA 1MW3A 1G4PA 3T55A 1LLWA 1XDJA 4CN6A 2Z00A 3WF1A 2XIMA 1TZ9A 1TTQA 3ITOA 2DZAA 3GH4A 3N04A 1NQKA 1HKMA 1BSLA 1BF2A 3TTYA 2R82A 2VWTA 3GFZA 4N9DA 2FH6A 1EIXA 4DPPA 3NPXA 1BWVA 4INFA 4XZ9A 4H9TA 5JBDA 4XKYB 3WDHA 2DJLA 4JN8A 3ARRA 4Y6GA 3WF2A 1VBJA 4J3WA 3F5JA 3ABSA 5CC5A 2HTMA 1GORA 1YMYA 2NWRA 5E1QA 4E2DA 3G3MA 2WZEA 4K8GA 5J8LA 3ITVA 3MO7A 3LCFA 4AIOA 4F0SA 5E0CA 2WCGA 1KQYA 1WXYA 3BANA 4IP5A 4ZVJA 4PMRA 3MMUA 5HMEA 5HWJA 2ACRA 2YGYA 3W24A 1JZ2A 1V7YA 2DIEA 3QOMA 1DJGA 1TE6A 4H01A 3M1ZA 3RCNA 4UFKA 3MQTA 2X30A 3MYPA 5G1TA 3NGJA 2J7FA 2G97A 2DH3A 3NPWA 4IJEA 2VFEA 5DT7A 3FEMA 2VVSA 2VO5A 4XBSA 2CZ5A 1ITCA 1RSCA 4C1NB 3TN6A 5CSSA 1W1VA 5KZ6A 4B90A 2J9ZA 1B4EA 4W85A 1PL9A 2HVNA 3L5MA 4AYGA 5C70A 2BOEX 1I75A 3CZJA 4IGHA 1A3XA 1HKVA 2PDJA 1H0GA 4GISA 4XISA 5LHFA 5M5DA 4Y7EA 3G1VA 4E3TA 4LC8A 1GYMA 2GSJA 5ECUA 2FZMA 4EPKA 1WZLA 3NZRA 1UMLA 2PDCA 4XQ6A 1XLBA 1KXVA 3G18A 1EQCA 3R8GA 1E1FA 3R79A 4LALA 3M46A 3QVQA 1VAHA 2D24A 3VNKA 1BWKA 3DERA 4DBDA 8TIMA 2D20A 3CQIA 3P3BA 3W7QA 5XIMA 1EYEA 1A50A 1CDGA 2BXVA 1VENA 4GH3A 3NOEA 1T7LA 4AF0A 1B3XA 1PJ9A 2I5IA 1QNPA 3CS2A 3GU2A 3W29A 3WQGA 5LSMA 2RUSA 4CNOA 4I90A 4IXHA 1X1OA 2QS8A 2DH2A 4UOJA 3R0UA 1TJ2A 3KFTA 2FTWA 5AC6A 5CEWA 1GYLA 4FR1A 4FNTA 4JTQA 4O8RA 3FFSA 4QJ1A 4A3QA 4XKYA 1OG0A 2PCEA 4US6A 5D2VA 1L6FA 2F6KA 2PI6A 4QM1A 1SFLA 3M5YA 3CQ0A 1LG1A 3JW7A 3WH8A 4IMEA 4W93A 3MANA 4EOUA 2V69A 1ZJIA 5EMJA 3GFXA 2OGJA 5DEZA 2BS9A 2FHBA 4W8BA 3IV3A 1A5OC 3OVQA 1YKWA 4RNJA 2PLKA 4G1NA 2Y2HA 2ACQA 2V3FA 4H4IA 3UWYA 4C5YA 1BVNP 3HV9A 2NUXA 1ISYA 2DUXA 1TPWA 3FOKA 4O57A 1YDOA 3H7VA 1POKA 3EKZA 4Q8UA 1J11A 2Y89A 4HZMA 4WJXA 3SY1A 3VXGA 3ZJKA 2WJFA 1J0KA 5C7VA 1NH6A 3IJQA 4HNOA 5JUVA 1A0DA 2PDQA 3BCFA 1NQ6A 3OBEA 4P8WA 1HF6A 2WBGA 3W6MA 2XH2A 5AB3A 1LJYA 1Z44A 3LPOA 2AKZA 4M1BA 4YJ5A 4C6FA 2C13A 1IR1A 4KESA 1K7EA 2HSAA 3TCSA 1RPXA 3KOWA 3HMJG 1LWIA 6ALDA 2Z0IA 2DSVA 4FZIA 1VS1A 4ZE4A 4UOZA 1V08A 1JRCA 3SADA 4AD2A 3GW3A 3QY8A 1XINA 3LI1A 3A4JA 3PBWA 2Z2UA 4ZTXA 4UTKA 1HKJA 5J5DA 2X16A 4FA3A 4GHLA 2EQDA 2ZRYA 4F40A 2H90A 2I17A 2UY4A 4O16A 4PTMA 3CV6A 3PZMA 1HL9A 3BDKA 1TG7A 1FHVA 4IWWA 3M0VA 3IRSA 1PWLA 3VM7A 2Y7FA 4LCQA 4C6OA 1EDQA 2J75A 2I5GA 2R24A 4P5UA 4CGTA 1QVBA 3ARVA 1Q13A 4IH3A 2CW6A 2QCGA 1Z6KA 3S8HA 3T0TA 1OEPA 3F4WA 1A53A 5F4XA 1NOUA 1MXDA 2HK0A 1U2YA 3QZ6A 1M65A 3UNTA 1F5ZA 1FWJC 2A4AA 2PFHA 1V51A 4ATLA 2OKOA 4H9MA 3LXCA 4HU8A 3QKZA 1GT8A 4UCFA 1RY8A 1E1CB 3QHOA 2QCHA 1AH4A 2XVLA 3LQGA 4O13A 4R27A 1SJAA 3O6DA 4IIEA 1V7AA 4ZQNA 1KTBA 4BK9A 4DNMA 4RZ4A 1QHOA 3W1NA 1YADA 2AKMA 3PPCA 1W1ZA 3S5NA 4LCRA 4NNAA 1KM1A 1GHRA 1ZRQA 4KH2A 2OT1A 5HXMA 2ZX9A 4DZHA 4UZUA 3WLRA 3GSMA 4OUIA 1I2OA 3T4CA 3ZR5A 3UXAA 2GDUA 1E40A 1AW2A 2ALDA 3PM6A 2J7CA 2PLCA 4HTBA 3I65A 3KZSA 5ABEA 4YN5A 1PKLA 4S3CA 1CXFA 4KIRA 4D6FA 2WZMA 1QR7A 5FJOA 1NELA 4EPBC 3NQFA 3H4XA 3L25A 1SR9A 4GY0A 3UCDA 1D3CA 5A3HA 4A3YA 5BXSA 2X1TA 3VIJA 2WHJA 1PPIA 4NNBA 2R91A 5CGTA 4Z1BA 1DVJA 4LRTA 2J79A 4AEEA 4MAVA 4A22A 2XH4A 2BSLA 4JIQA 3HG2A 2HPIA 2FDSA 2O0TA 1UR3M 3UWUA 5TIMA 3USZA 3BOXA 3DCPA 1T41A 3KS8A 1JPDX 3R0DA 1IEIA 1YDYA 1LQ0A 1GZGA 1TUFA 1S2CA 2XGBA 2I14A 3ZT6A 1J01A 1V93A 4GUIA 4JDBA 3IGSA 5LYRA 1EP3A 5GJMA 5D30A 2C8NA 3GDRA 4KFOA 1KCZA 4HBKA 4U10A 4IUGA 8RUCA 1TTPA 2W91A 1X7FA 4Q32A 4HIBA 3QLDA 4F8XA 2YX0A 3TYAA 3NL5A 1GZJA 1UQZA 4HP5A 1DYSA 2ISFA 4PL1A 1E70M 1O5XA 4PFHA 2P8CA 3W2KA 3VCCA 3PG9A 3R7MA 3MMDA 5MKGA 4HA4A 4PMQA 1ZL1A 1UUQA 3PK7A 3KE0A 5HMDA 3GNXA 3WLJA 3K1GA 3EWWA 4B2DA 3C2EA 1K6AA 1BXCA 3N13A 3O6CA 1LZOA 1OK4A 3MUY1 3ARWA 3WEOA 4ZOAA 2ASHA 2QGYA 2W63A 2A3EA 3HB9A 4GXWA 1VF8A 2YA0A 3VNDA 3PTQA 4IT1A 4KCVA 3UJ2A 2H6RA 4YWSA 1S38A 2E1DA 4ZTYA 4JIHA 1W1A1 1A3WA 2WQPA 2DDXA 4AXKA 5T9BG 4PEEA 2RTSA 1FWDC 2OCZA 3A4AA 2P0IA 3B97A 2QMKA 3VOGA 1C8QA 2UWFA 4LV9A 3SM0A 3MUXA 1R3VA 4HK7A 2E6FA 1I1WA 5AHLA 3V0UA 1ECQA 4JFSA 1ZQ5A 3FDKA 3LCLA 5E6ZA 4Y8EA 2CZFA 3OZPA 2VP8A 3FAXA 3K46A 2FJUB 2J47A 3ZJ7A 4Z2HA 1O6IA 4CCCA 3W1TA 3CASA 4LUTB 4PTXA 1X7IA 1CB7B 1DEDA 3MO4A 3LHYA 4Q4RA 2IXVA 1O94A 2Y8KA 1LWJA 2V5LA 3MCOA 4ICNA 3W1MA 1A4MA 4WVXA 3VKBA 3SCTA 3C6CA 2QW5A 3R25A 1QW7A 3QV7A 1JZ7A 2W67A 3AQUA 4UIOA 1W91A 2R1KA 4FLRA 1XLLA 1MUWA 1DTNA 2WYSA 4CUCA 1P48A 3NURA 3L68A 3C5QA 3B8UA 4E2BA 1YW1A 1H60A 4ES4A 3VC6A 4K3ZA 3NQ8A 1QNSA 1V8EA 3COTA 4LVGA 1EL3A 2E1WA 4KIEA 4H2HA 4NYUA 2OSXA 4NZFA 1QBBA 4D8ZA 5HDRA 2IKJA 4IXXA 1Z9AA 3EB2A 3C0SA 4MY1A 2A3CA 4GE8A 4AZ7A 4RL3A 2GJLA 2ZCGA 1RHCA 5GNZA 4AY7A 4K8HA 2HROA 1EP2A 2WSRA 3DYOA 1XHGA 1XLIA 4Q8WA 2CLKA 3T8LA 1K7XA 2HVMA 2D2OA 4LX4A 3QKEA 3TW6A 4KWWA 2Z27A 4LB3A 1FP9A 5LZLA 2BFGA 3WD2A 2NWSA 2H8XA 3IIVA 1YPXA 3S0CA 1EGZA 4GCAA 4DF2A 1E6ZA 4TVUA 4HPGA 3LS9A 3I7RA 1A4LA 1KTNA 1GQJA 1MXSA 5DO8A 3FVMA 4WDWA 4IIBA 2DSKA 1QRQA 4DO6A 1GQKA 4CNTA 4AYSA 4S23A 2ACUA 3VX0A 3BG3A 3LNPA 1OSEA 2YLAA 3TK7A 1OG6A 4XTIA 3CHEA 4P8VA 2JKEA 2FHFA 2Q01A 3OO2A 1JQVA 3TSDA 3TROA 1RZMA 3VOHA 4IX2A 3PAOA 1FWCC 1ZGDA 4LV4A 5CSRA 2PEVA 1QNOA 3CTTA 3A5FA 2Y2KA 4NY2A 4JNYA 3CM4A 3ZLFA 4KMQA 1KRMA 4DO5A 4TMCA 1S5WA 2VFGA 1XSKA 3MUCA 2GGHA 3KZPA 4FOUA 1UR2A 3WQ5A 1XBYA 2HNHA 2FVKA 2XISA 2Z1SA 3MZNA 3N2OA 2WJEA 3TAKA 4JD4A 1JD9A 4PMNA 4JTLA 2DP3A 2OJPA 4ZL1A 4TXEA 5TBOA 1AD1A 3MBDA 1AW1A 2ZUTA 1Q6QA 1GJWA 4AD5A 2ZC1A 4I9MA 3A24A 5CPOA 2ABBA 3IVSA 1MO0A 3T08A 5JIPA 5I0DA 3U4FA 2PP0A 3SRKA 4KWSA 4ZOBA 1U1JA 2YW4A 3AU2A 3USBA 5LA0A 1QW9A 4X2RA 5EU9A 3B9DA 3U4AA 2O56A 3LHTA 3R5EA 4A21A 1UJPA 3AIUA 3RPDA 4AC1X 3W84A 3L2LA 4ERAA 3VE9A 1Y5XA 1Q7ZA 4IBCA 5DLCA 2BVYA 4J40A 3NPVA 1T8QA 2DUZA 2C3ZA 1XRFA 1XRTA 3EXRA 1M1BA 2YCEA 4IUOA 1VFHA 3VIOA 3UR2A 4ZQMA 1UB3A 1AQFA 4O0QA 3KS5A 2VDHA 4QNLA 2GSHA 3CUXA 3LOTA 3NSXA 2J88A 3VNZA 3GG0A 3M44A 2WMIB 3QYSA 5SWUA 3AUJA 3P7YA 1QBAA 5I3HA 4W7UA 4Q8VA 5EMKA 5REQA 4WQ6A 2PDGA 3VDHA 2WMKA 4YTUA 1E4NA 3B9OA 3BTNA 4AUBA 2PS2A 4HZ8A 3PZOA 3V5OA 3NQ7A 2NUWA 2WSPA 4F48A 4OTKA 1WO2A 2DZTA 1FBAA 4GC4A 1ZJAA 5KSWA 4LAUA 1QI5A 1H0IA 4FHAA 1J18A 4G9PA 1EXBA 1EF2A 4GI6A 2PWUA 3DUGA 5DY2A 3T42A 1NWSA 1X8CA 4IPNB 4IBIA 2F7FA 4LF1A 3Q67A 4RW3A 5E0KA 3T78A 1NOWA 1VIZA 1VPXA 4GGBA 3N18A 3EWZA 2IPWA 5AYBA 4MF4A 2GGGA 1K9FA 1WXZA 2HQAA 3VMPA 3DX5A 1K9EA 2WANA 2CEQA 2A85A 1AJZA 4PMZA 1P6BA 3TV8A 2NXGA 1FXPA 1H62A 2J7EA 3QGVA 4JTDA 1NEYA 3CQJA 2PUZA 3RDKA 1GNXA 1AJ2A 4Q8PA 4WEVX 3IJIA 5LGXA 2Y2GA 3QW4B 1YQ2A 4HPJA 1RA5A 3G0SA 4F2UA 2TAAA 5EFFA 4A6GA 3EDKA 2JE5A 2YKKA 3CL6A 3KOFA 2CWNA 3CIVA 1R3QA 2D22A 3TOYA 1I2QA 2RFGA 1CWYA 1ZAJA 5A95A 4KGLA 3T1GA 1ZY9A 1T8XA 7REQB 1XG4A 3S2MA 4W86A 1M7JA 5FSEC 1XBVA 1L6YA 3BCDA 2VOMA 2X2GA 4IOTA 1C8VA 1J79A 4IPJA 3A23A 3S2JA 3RRXA 1GGOA 1SW0A 5IFPA 3W76A 1R3WA 1THFD 4IG2B 4IFRA 3UPMA 1HP4A 5IBXC 2GWNA 5H2ZA 4LOCA 3GC4A 4DWDA 3B0YA 2YCLB 3GTXA 4UNLA 3H55A 2YDRA 1CTNA 4JFVA 2BY2A 2JF7A 5CZKA 1XYCA 4BS0A 2NV1A 1L2UA 3BPWA 3N25A 3HGOA 3HG3A 1DJQA 1LUCA 1WOBA 3I10A 2BG5A 1X6UA 1RPKA 4AD4A 4FOJA 5CPQA 1XPGA 1R3RA 4HMCA 1Q6EA 4Y9PA 1L0PA 3A64A 4IZGA 3W0KA 3W1XA 2WMIA 1V0KA 1XJBA 1D7FA 5AY7A 1SFJA 4C6CA 2ZZ1A 4PB3A 4DWSD 2VZVA 3PY2A 4YPJA 1TPFA 1XGZA 3NNTA 3SSZA 1TA3B 2YJQA 3KP1A 4UNIA 3WNMA 3EX2A 1GK8A 2Y88A 4O1EA 2YFOA 3WLOA 1QTWA 3OZYA 3SRDA 1DWGM 5KETA 5D4YA 2CETA 3EMZA 4MWAB 1TE1A 1S2AA 4C7DA 4GUJA 3TTSA 5L9FA 1VEPA 2QV4A 2DT0A 3BXWA 3F4NA 4M7SA 3CWNA 4UC5A 3E6EA 2FZ8A 1RP9A 4AVNA 2GSEA 3TWAA 4Y8FA 4XTDA 2VC7A 3ARSA 4JIEA 3W28A 2VR2A 3LGEA 1SR0A 2VUNA 3T0AA 4RZBA 1A5UA 1KQZA 2QLYA 5H1WA 3GC5A 4QROA 4W87A 5CBBA 3UESA 1M7OA 5H8MA 5FF4A 5AYYA 3G1AA 1IGSA 1UUMA 1GUVA 4WKHA 1TX2A 3UBPC 2X2YA 5C9XA 4X22A 4J3SA 4LAKA 3UGVA 1W3HA 2NT0A 3A22A 4KRTA 3RLGA 2ONEA 2Z7GA 3AIQA 3TJXA 1JXKA 4IBFA 3R0KA 3S1UA 5I6SA 2G4FA 3TYBA 4B3ZA 4OJYA 1DQUA 4UQBA 1KBLA 3ZZ1A 4QHRA 5I77A 5D2TA 3BMXA 3URNA 2QDGA 4PEKA 1U1HA 4ACYA 3WD0A 3STEA 1E6PA 3GXDA 4RNHA 3QJAA 5ECVA 1BRLB 4YCOA 1V77A 1KRBC 4X0NA 3CAQA 3BW2A 4QEEA 4UB9A 4TX8A 2C0AA 3LCGA 1DQWA 4JX6A 4ERIA 1IWAA 4LAZA 5ABFA 2EGZA 4ROPA 1ONXA 1W32A 3PWIA 2YLLA 3IUDA 1VRDA 2Q3OA 4TX6A 1XYBA 5C55A 4ML4A 2HISA 4DJDD 2ZRVA 3S6DA 3CWOX 1HO1A 4AHQA 3P8JA 1B9ZA 2NV9A 1YU0A 3NR0A 3WLKX 1R2TA 5HULA 4W4QA 2GVGA 3CZLA 5EMLA 2X1IA 2E8ZA 4KF1A 1X98A 1VBUA 1N82A 2GQ8A 1BF6A 1CEOA 3BAXA 3G0UA 3QLLA 4C6KA 4UNKA 3THUA 4LY8A 2ESCA 1Q45A 4YLWA 2YR1A 1SZFA 2CHRA 4DEFA 3N14A 1US2A 4J2PA 3D6NA 2J13A 3V1HA 1PZ1A 1E1EA 4LANA 4JDYA 2HXTA 3MUZ1 1WA3A 1LM1A 5HJXA 3KVLA 5LA1A 3WJZA 4M6VA 3NXLA 2G50A 3EKGA 5E0FA 1ISVA 3E12A 3E2SA 2PDHA 1UPPA 4WOQA 3WENA 1DJNA 3ALGA 4R7JA 4BI7A 3RX2A 1OHLA 4RDYA 1JYXA 2DY3A 1E4LA 4V1YA 3OZOA 3ZVIA 5I02A 3KS4A 3KRUA 3UWEA 1QNVA 1NWUA 1GOXA 5U7SA 3IGHX 4JYDA 4EPDC 3OLGA 4BJHA 4FPSA 6TIMA 1XISA 3HJZA 2V68A 5GVJA 3WH9A 4DAFA 1ITUA 3GZ3A 4FXJA 4UBPC 1TELA 1NU5A 3UWZA 4QSHA 1AVAA 5GJNA 4CEXC 4I7WA 4J5NA 1BFNA 2NLYA 5DRCA 1EDTA 2A5HA 2MUCA 1C9DA 1Q6OA 3EXTA 1UWIA 3H4WA 3WDQA 1MW0A 1MMFA 5AKQA 3W7CA 2NW0A 3T07A 3EWDA 5FAGA 3SRFA 3E0VA 4A05A 1E6NA 1GKPA 4IP7A 3VK5A 4Z42C 1NF7A 3VNMA 1XM3A 4BQ5A 3ITXA 1EGMA 2G3NA 2XSAA 3N19B 1UMYA 5BOOA 4KEVA 1BRLA 5FJJA 1QOQA 2VGFA 3GYEA 4W5UA 3FGCB 4NASA 4JHOA 1B5TA 3DFYA 3W6LA 2VL4A 1DJZA 1M6JA 4IPIA 4AZ6A 4TOQA 4M24A 1JF6A 3PTKA 1CNVA 2FGBA 3WNOA 3FYYA 4CLMA 1EZWA 4NNCA 3EPMA 1H1YA 3KUMA 2ZVIA 4G7EB 4ZQRA 4ORMA 2PDYA 5BNKA 4O18A 5A6MA 1KTCA 3MZ2A 4GBDA 1F07A 1QNRA 4HU4A 1O5QA 1UD2A 3SGUA 1HTIA 4JIRA 1OD0A 3LCXA 5E5CA 1OF8A 1GQLA 4K2SA 3HPAA 3NA8A 3P74A 1TKKA 2DJXA 3OVPA 4LBRA 1O68A 5FESA 5LNSA 4A3RA 3VA8A 3WMSA 1C9WA 1KM3A 1GPWA 2DT1A 2IKIA 3AHXA 4PSPA 4F2TA 2ISWA 4GJJA 3IVUA 4P8UA 2JQXA 4GQBA 1K9TA 3B05A 1W1YA 1ONEA 3WX7A 1YBQA 2XUCA 1RR2A 3EOUA 4G2DA 2DZXA 2IUZA 2DU2A 1DJHA 3RR4A 3RR1A 3BW3A 1JGMA 2VGGA 3BLLA 5HBFA 3WJXA 1XIJA 1RJPA 2O92A 4ADUA 1TV3A 1MQQA 3KRZA 2J4GA 3H23A 1EJSC 1FH9A 1FP8A 3QHNA 1W5QA 3C0JA 2Y24A 1MZRA 1LL7A 4UTMA 1D8WA 4XVDA 4HPHA 1OK6A 1JEZA 1EGVA 3KWSA 2QV5A 1LRNA 1HUVA 3RM4A 3CQKA 2R6OA 3APYA 5DY3A 4JIIX 1S46A 5D37A 4U2ZA 3V1PA 3EMQA 2WHKA 1IXNA 3AWNA 1OJXA 1TJRA 4WIWA 1XYFA 2DZWA 2GVJA 3H54A 3FXGA 3P14A 3BJTA 3NM3A 3PNUA 5GNXA 1OX5A 1R47A 2QCEA 5HQEA 2QQ6A 1DWIM 3B3DA 1O60A 2E5DA 2DZUA 2F2HA 4JQ2A 4J4KA 1SZRA 4DZIA 1JZ8A 4DUVA 4TMBA 2Q09A 1WXJA 4NVTA 1UZ4A 5JH1A 4S3FA 3QPEA 3B8WA 3QN3A 3AYRA 4TQTA 5CG0A 2D69A 4DI8A 2ZRXA 2JF6A 1CXKA 1OM0A 1AQHA 1TVPA 4GH9A 4MB1A 3UZZA 4B5UA 1NDVA 2V5KA 2HEJA 3K8KA 1QPNA 2W5FA 3SN1A 3SZ8A 2BX7A 4IGSA 1C93A 3WN6A 1F6KA 2E9LA 1H5YA 1OFBA 2UV8G 3P0WA 3ZJ6A 1R6WA 4E8DA 3QY6A 2ZUSA 4D9PA 3TN4A 5BZAA 3H24A 2CITA 3B40A 3UERA 2R1LA 4AIBA 4F0KA 1UKQA 1XLEA 4HK5A 2FB3A 4YTQA 3T2PA 1R5YA 2YL9A 3U5YA 1ME7A 2ZRWA 4NP7A 2VX4A 2VC6A 3RU8X 4C90A 1E9LA 2QCLA 3NYDA 1XYLA 1PDYA 5TQLA 1A5AA 5A6SA 1QK2A 3P8IA 4ENLA 3WNNA 1DKWA 4ATDA 5CBJA 3T8QA 3BMWA 1VYPX 1WYIA 1JIBA 4H8NA 4S39A 3URAA 3WLNA 1NY1A 4K6AA 5F2LA 1HXJA 2E3ZA 2REQB 4RE4A 3NAVA 3OHIA 4O15A 3THDA 1G1YA 1SJCA 1D9EA 1EPXA 4O11A 3BLDA 3L29A 2XH0A 4L7ZA 4ZFMA 3PPHA 4GVHA 5D2WA 5GQBA 3WQWA 1WUFA 3W88A 1YNPA 3WMBA 5B7YA 4OV9A 1CLVA 1DJIA 1UWUA 2JGYA 1H49A 1XGEA 4W9TA 2PWEA 3OBKA 1YXCA 3BSHA 1QNQA 2ZZ7A 3B8IA 2PDLA 3UCCA 3WK2A 3SQLA 1MFVA 3WFLA 4FNUA 1UROA 1GEQA 1ZBCA 1SQ7A 1IIGA 2NQ5A 2GQ3A 7TAAA 1OFOA 2ALRA 3VIMA 2HPMA 2OEKA 3ONCA 3L0GA 3FSTA 3MP4A 4Q7BA 4PB5A 4UUIA 1JDAA 1F3EA 4MWAE 2CLIA 1GYNA 1OABA 3AMDA 3EOOA 4GH1A 3RF9A 3I3EA 3PHAA 2QIWA 3H7UA 2WO5A 4I7UA 2XIQA 3OLIA 2X7WA 1XIIA 2IXUA 4LGXA 3CYJA 4F2BA 3S3GA 4M51A 1BQCA 2W66A 1GTHA 1KXTA 4EF9A 3C61A 4MADA 3DFHA 3IJLA 3VC5A 1LBLA 1UR9A 3T6CA 2VRQA 4UFIA 4RKAA 3QMRA 1XG3A 3WK3A 2H3BA 1KM6A 3PUOA 3JRKA 5CZ0A 4I9AA 3FEQA 4NRRA 2QF7A 2D2GA 1QMLA 3N3TA 3SEPA 3TYUA 1NIUA 4M81A 4RW5A 4RV3A 4MM1A 2O55A 1QAPA 1B4KA 7PTDA 3O9NA 3QGAC 4PRRA 4DQWA 1Q6RA 5C9UA 4L1XA 2ZZ4A 4GFSA 5K4ZA 3GNOA 1NAL1 4RK8A 4YTTA 4CNNA 3SY5A 3A12A 3II1A 3PJXA 1XF0A 1F73A 1XWYA 5AN7A 1M04A 2YCKX 4HYWA 2J66A 3CZEA 4L1GA 5C2GA 4YCPA 1GG0A 1YEYA 1F9CA 4YHEA 2XJ7A 3BAWA 4RUBA 1PB0A 4R88A 1W1PA 3TP4A 2DZSA 2VX5A 4QFUA 2PWGA 4DNHA 3IIZA 3GRIA 1J0YA 2EG7A 4UQEA 2C1GA 1SO4A 2GL5A 3DOPA 3KRSA 1XLFA 1YPFA 3CTLA 3N29A 1W9DM 2P1FA 4GZ7A 1V0MA 1L8PA 4XAGA 2AMGA 3EDFA 3B9EA 3SN4A 3PWGA 4PBEA 1JZ4A 3TN5A 3MMWA 1M7XA 3UR7A 1Q8JA 3GXFA 1X38A 1XLKA 4QG8A 2Y7EA 1UP3A 4ERGA 3CQHA 2GJXB 1EOMA 2OWWA 2V67A 4C91A 3WELA 3N2XA 3OTRA 1VFMA 1W3NA 4QJ3B 4P7LA 3PANA 3AIVA 1KRCC 3IEBA 1XUZA 3EB4A 3I68A 4GO9A 3ONBA 3HFTA 1TMLA 4IL2A 2D2JA 1LT8A 1P1MA 2A6NA 3LCIA 1L9WA 4D8LA 1K8XA 3I3DA 4RJEA 3WK1A 5I3GA 3V5FA 3W01A 2A21A 1K9DA 2C16A 1K77A 4H7ZA 2POZA 1XX1A 3GIQA 3OQ8A 1AK5A 1R3SA 4XZMX 4QS5A 2HS6A 1YTKA 2V5BA 5H6HA 4PCPA 3FN9A 4U5KA 3RM9A 1MRAA 4FX6M 1FTXA 3C4UA 4LC6A 2BZNA 3AZRA 3H6OA 2IPJA 3W7NA 3NZQA 3L23A 3NL3A 2Y70A 1VH7A 3WQCA 1TTIA 3KCOA 3M5VA 1RJQA 3P5YA 2Y2NA 1CGTA 4XZBA 3VM5A 2OXNA 5MF5A 3DYPA 3O15A 2ZUWA 1XLDA 4ZE5A 3B04A 5HANA 1TRDA 3DFOA 4Z08A 4R53A 3RILA 1MYRA 1VRXA 5EYWA 3LRKA 3BCJA 2YDAA 1NDWA 4N4PA 3B03A 1WAWA 1WZAA 4GK8A 5LNWA 2V81A 2V5OA 5K3VA 3G8RA 2P50A 2OZ8A 3N15A 5I23A 2QZRA 1I0DA 3L4VA 2J24A 3PUDA 5D38A 1A0CA 2OB3A 3TVAA 4JPGA 1VLWA 3ITYA 1PCKA 1TR9A 2EPLX 3MV01 2EKCA 4PL2A 3K4WA 3L9CA 4S38A 4WCJA 2IW0A 5BXPA 1YX1A 1J7MA 4R33A 1J93A 4LTSA 2BOFX 5CAHA 3LBOA 5HNUA 4Q4KA 4FNPA 3UR5A 2TSYA 4JY9A 4CVWA 1OBAA 2E9BA 1MNZA 1ITXA 4QDMA 1BEUA 2VDGA 1DJWA 3M16A 4DJFD 4DWSA 1DQXA 5F2MA 1LYXA 4KFNA 3WQEA 1TQJA 1W3JA 4AC7C 4QLKA 1RK5A 2DSZA 3GK0A 3IWPA 4EK7A 1JG9A 2XVNA 3LN3A 3LUTA 4UCGA 3WF0A 1MRQA 1KLYA 2AQVA 2QIIA 1IWBA 3PWAA 2CCRA 1ITQA 3A4WA 4D1IA 4OJOA 1E71M 4S3EA 4JGDA 2PLMA 2PE4A 3PF3A 3ZR6A 3H8AA 4E3VA 5M3WA 2CC0A 3MVIA 2Y5SA 4RE2A 4B3LA 3LA4A 3MI3A 1UBSA 1X1NA 7ENLA 2DEPA 5F1UA 5I07A 5KZDA 4JL2A 1IYXA 4QBXA 4C6IA 3EWCA 3GXTA 3G6MA 1VIWA 3FKRA 4MTVA 3FKKA 3QSRA 4E0CA 3GVVA 2XN1A 1JD7A 2GQAA 3K1DA 1EPVA 3TQ0A 4IJRA 1EH9A 3M6DA 4B5SA 1E9ZB 3UWQA 3WQVA 3BGJA 1W6TA 1MI3A 1ZZMA 2PB1A 1JRBA 3EGJA 3QR3A 1NARA 2XZ7A 1OZQA 3EDDA 4YU1A 1UBPC 1SW3A 2BY0A 4L9YA 3ZVHA 3TYEA 3NL6A 3WK0A 4Z1AA 3REQA 4FXSA 4AY8A 4XD6A 1V3MA 2NUYA 3FV9A 4V2XA 1B3VA 5DXXA 3PSWA 1TFVA 3G8EA 5BROA 2ZC8A 4CD8A 3TNOA 1TV8A 4U3AA 2PDXA 3L66A 4OECA 1JDEA 1R38A 4EVZA 3DH7A 3G1SA 5CGQA 1SVDA 3W7PA 3ARUA 3BV4A 4FIQA 4UOQA 2CWXA 1JCLA 1I60A 1PKNA 3RG6A 3DI0A 4DJDA 3CH9A 1OT2A 3WD1A 5I09A 2CLOA 4DUOA 1O12A 2OR2A 4OKDA 1PEZA 1JFXA 4UTWC 3BURA 3N11A 3TZNA 4XSMA 1FWNA 3OA3A 5G4EA 2WVVA 2WPGA 6TAAA 1NP0A 4GX8A 1XC4A 3TA9A 3WMCA 3ABXA 1ISWA 2QMJA