4NYYA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 2 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
405
structure length
405
Chain Sequence
b'TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
molecule tags Hydrolase
source organism Vibrio cholerae
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
total genus 145
structure length 405
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyyA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyyA01
1NY1A 4NZ1A 2C1IA 1XW8A 1W1B1 2W3ZA 4LY4A 4OUIA 4NYYA 2J13A 4V33A 4M1BA 4NYUA 4WCJA 3HFTA 3S6OA 3VUSA 4F9DA 4NY2A 1W17A 2C79A 2E67A 4HD5A 2VYOA 1Z7AA 2DFAA 2NLYA 3CL7A 2C1GA 4L1GA 4F9JA 2Y8UA 3WX7A 2I5IA 4NZ4A 4U10A 2XU2A 4NZ5A 2C71A 2QV5A 3CL8A 3QBUA 1W1A1 3CL6A 2IW0A 4NZ3A 3RXZA 1V6TA 5JMUA 5BU6A 2CC0A
chains in the Genus database with same CATH superfamily
4C6LA 1YTKA 2AL2A 1YU4A 4HNUA 3GIPA 2ZXBA 4IT1A 1JCTA 1WZLA 3AHZA 3CV2A 2FTYA 5BRPA 1E15A 3CASA 4U3AA 4U10A 1IEWA 3UA4A 1NDZA 1AA1B 1LWJA 3MHGA 3ANUA 5DT5A 1W3IA 3QSTA 4N0RA 1U1HA 1TMLA 4XAZA 1SFSA 2WMIA 1ISVA 4PBEA 2DT1A 5I02A 3EDKA 1WP6A 4JNMA 1XLAA 3DFTA 2OPJA 3LPOA 3CB8A 1W1PA 4HNTA 4FXJA 4H41A 4H04A 2VDGA 3W75A 4MZ8A 3K2GA 4JTHA 2O9RA 3R8HA 2FPTA 4QJ3B 1TCMA 4J3UA 3W3OA 2QCLA 1VQTA 4ZL1A 1DVJA 1N82A 3M5VA 2BBFA 2VRQA 4KEZA 1WZAA 3RG6A 2H3DA 3NZPA 3EX4A 4UOJA 2FVKA 1Q6EA 3GDKA 3POCA 1K8CA 2PDMA 3P5ZA 1J2WA 4C6JA 1P1MA 3S2LA 1OADA 1V3KA 1QHPA 4DF2A 2CBUA 5HPCA 1PDZA 2QCMA 1TVNA 3TUUA 4EXQA 1XXXA 2CWNA 4RDVA 3EOEA 3L27A 2XFRA 4GFSA 4IBGA 2GQ3A 4JN6A 2DSVA 3C52A 2PRLA 7TAAA 4TO8A 4X61A 1QW9A 4ZOCA 1I75A 3ONCA 4H9TA 7REQA 4RZ6A 2XH7A 4B15A 5DCDA 2Y8UA 3SEPA 2YYTA 1EEPA 3MPGA 4O14A 3BSGA 3HF3A 3L4XA 1XYAA 3GXTA 2VEIA 4ERAA 4C91A 1CGYA 1E5JA 3PAJA 5EY5A 3LHTA 5M1TA 3LB0A 2OOGA 2YBUA 1BYCA 2DPEA 4K39A 1P6BA 1R9YA 3CUIA 5LNSA 4YTQA 4OU1A 1GNXA 3HG2A 3VCRA 3C56A 3CXOA 4FX7A 4CVUA 2OEKA 5A2AA 3GU1A 7TIMA 3W2KA 4OV4A 1QK0A 1L8PA 1ODUA 3IPWA 2Z1VA 4J3WA 3B0UX 1TPH1 1OHLA 3A3HA 3BGGA 1XC6A 3G1SA 3GZ3A 4IWWA 2VHLA 2A85A 5D30A 4JKMA 2FGLA 3SCNA 3WBAA 1DORA 2QCDB 4CVWA 4Q8OA 2Y70A 1NIUA 3QHMA 1XLEA 1FWDC 5AZ1A 4OBTA 1B3ZA 1TTQA 3VIGA 1V3MA 3EMCA 3BK0A 3UNDA 4XZMX 4X63A 3WELA 3O7UA 2GQAA 3U6WA 3GXMA 4DJFD 4JTFA 3O0KA 3DKJA 4GY7A 1TJ2A 2EPHA 3ITXA 3N6JA 4RDZA 2Y7DA 4F40A 1HJXA 1GZJA 3MUZ1 4L1WA 2H8ZA 1VPXA 3CAKA 3MP5A 5EMJA 4Q6JA 2TMDA 4A8LA 5ABEA 2KAUC 3SUUA 3E6EA 4FOKA 5I5RA 3OZYA 2PTWA 2GFTA 1H7OA 3WMSA 1UKOA 4LUYA 1TWIA 3LZ5A 3DG3A 3OQEA 4XX6A 3RPMA 3HFYA 2Y2KA 4PMRA 3MHUA 1XG3A 4QE1A 4WSJA 1UD5A 1BSLA 3M7SA 1KNWA 5C6MA 2HPIA 2AL1A 1PB0A 2VKZG 4AWEA 4B3ZA 2Z0IA 3UY7A 3DDMA 3MO7A 3STCA 3T0BA 3FHAA 4RR4A 4KWOA 2DJXA 3GFYA 1XS2A 3BVJA 3VKDA 4O1BA 4JIPA 1ZGDA 3WY1A 1XCWA 1DWHM 2A2IA 4NQ1A 2PD9A 3M0IA 1W9XA 4MNKA 2EPLX 4J3TA 1C91A 1LLZA 3CLMA 2GJRA 1J96A 2Y4SA 3AAMA 3W1AA 3UR8A 3ARTA 2IW0A 3C8NA 4DJFA 5H91A 1BSIA 1T5AA 1J4EA 4RKAA 4DELA 3N18A 3NPXA 4IJEA 3AHYA 2QAFA 3R25A 1UWUA 3B8WA 1EP1A 3QY8A 3OYXA 2I5IA 3WF4A 1QFEA 3W74A 3G1DA 1DTNA 2C15A 1V6XA 3FJ4A 3FYYA 3WQEA 5A8OA 4GOAA 1W6TA 1PS9A 2JEPA 1XR2A 5KEZA 3ATZA 4A3HA 2DSUA 3T6CA 4QISA 2P0OA 3NL2A 1RA0A 1PDYA 4GH9A 1KGWA 5LIYX 3RCNA 1MQPA 4O57A 2CLMA 4HCLA 3P8JA 1ZY9A 3LMZA 4BF7A 4B5UA 4DZIA 5MF5A 1WOAA 1C29A 2Y2OA 2V81A 2W91A 5I23A 4GPNA 3H4GA 5JBFA 4IH3A 2HK0A 3UF9A 1R9XA 3KL3A 3CL7A 5I78A 1X38A 4B16A 5EFDA 1TPFA 1I2RA 1RHCA 4TIMA 4IX2A 2E0PA 4IBCA 4OUEA 4MYXA 1KFLA 1PEZA 3A64A 2ZX7A 4B5VA 3PBVA 2QXWA 5GNZA 5K7JA 2YPIA 3WFZA 3VIPA 3OG3A 1OFOA 2OYMA 3R0DA 1YEYA 1HVXA 3G8RA 3W00A 4ZSUA 4A4AA 2YR1A 5HUOA 2Z1KA 5A1AA 3AI0A 1K7XA 4WKHA 1Q6RA 2Z26A 4C1NA 1YKWA 1VFSA 3NO5A 3GHRA 2QCHA 4AEFA 4Y6GA 1TRDA 1JZ4A 5ABFA 4GYPC 4HVXA 3V75A 3VGDA 4B4FA 4B5NA 1G5AA 3UW6A 1FDYA 2V3DA 1W1B1 3TWBA 3F4CA 1NTHA 4JTQA 4NVTA 3M43A 1H61A 5KZEA 1ZBWA 2ZICA 3APTA 1A3XA 3MVTA 7REQB 4OT7A 2HVNA 1JUEA 4TX8A 1E88A 4RE4A 2P0IA 3PWIA 2ZZ7A 3OVPA 3DOPA 1X6NA 2ASHA 3TJXA 3S2NA 5AHLA 2FZDA 2G95A 1XBVA 1FHVA 4WJXA 5LIUX 2XIMA 2D24A 4DWSA 1I45A 2QGHA 3EWCA 1GTHA 1HL9A 5CJNA 4JS3A 5HMDA 5CLWA 3E0VA 3GG1A 3AWOA 3MKCA 3MUCA 2R1NA 4LV9A 4MHBA 5BWFA 3W26A 3VFCA 5A5WA 1W5MA 2BV9A 1VBJA 4HKPA 2YCKX 3MP3A 4WDTA 3U7VA 1MW3A 3W25A 3VIHA 1W56A 3TQ0A 1W9PA 2DIJA 1LG2A 2XUCA 1GQIA 2OX1A 2FGBA 1OF8A 1K8YA 1SQ7A 1REQB 4IIEA 4PMQA 3CYJA 2DW6A 1Y5VA 3GNOA 3QLDA 1B57A 1UP2A 1EGMA 5G4WA 1SZEA 1TR1A 4AUBA 2BVWA 2VOMA 4NYUA 4A2SA 4GFIA 5IOBA 3TFXA 5D9NA 1UG6A 1AH4A 2A5HA 2VEKA 4AXKA 4ZQPA 4QEEA 3E5PA 1T8QA 1S2WA 4CNTA 1EBHA 2DSKA 4U33A 3QW3A 3WNLA 4JTCA 4HP5A 3TA6A 2FZ9A 4Q8TA 1AL8A 4MJMA 3WNOA 3B8UA 1KKRA 4ZO7A 1T7LA 1FDJA 4UFMA 1JD9A 4UFLA 2NQ9A 1ICQA 3ZLHA 3F5KA 5EMUA 1CW2A 4AG0A 2D3LA 4X2RA 3JVAA 3W9ZA 4IOTA 3INPA 3G1XA 3L4YA 1XIFA 4M1RA 4H2HA 2XIIA 1LT8A 3T7VA 4LAOA 3TW6A 3IJQA 3DG6A 3IEBA 2ALRA 5CPOA 1VKFA 1LLWA 2BGNE 1FWIC 4X3ZA 1VPQA 3KVLA 4UXDA 2DY3A 1XYCA 4H1ZA 1J7MA 2RHGA 1YX1A 1E6NA 3FA5A 2HE5A 3L4WA 2UY2A 1X7FA 3HJZA 4IQEA 4M0XA 3OW1A 3ABZA 1JPHA 3W1MA 2D22A 4H00A 2CIPA 4AZCB 2HCVA 4B90A 3UJ2A 3U2ZA 2YB4A 3C2OA 1CK7A 4DM1A 2CXEA 4Q7NA 4XAGA 2WBGA 1M68A 3SY5A 3WSUA 5DLCA 4CCCA 3ORWA 1O4UA 5AKQA 1L6FA 3WQDA 1BG4A 2G3JA 3ZOAA 3BWWA 4F0SA 2PDUA 2VM8A 2XHYA 2E77A 1M03A 3IGUA 4NZ1A 2CCRA 1ZENA 1REQA 4GIAA 2H9AA 4QG8A 1Z89A 3LCWA 1GZGA 2QCGA 4ROPA 3HPAA 1IIHA 3LEPA 3GR7A 5IDZA 1N8IA 1U83A 1GVOA 1H4PA 3BC9A 3NG3A 1LDCA 2VZSA 3QN3A 1MQRA 1T41A 1E1FA 4WY0A 3NO3A 3N3TA 1ONWA 2G0WA 4AX6A 1YMYA 2RH9A 3ALGA 2Q02A 4OHQA 3KZPA 4RX0A 1TWDA 3OZOA 2X1RA 4XSMA 1FFRA 4GG9A 3SFWA 2XJ7A 1OEPA 3UXIA 4AZGA 3L67A 3I3DA 3KEHA 4U5KA 4JDBA 3EX6A 2QJJA 3TCSA 4NAFA 2GL5A 3RX2A 1UD6A 3W38A 1SSGA 2PC8A 3M46A 2WM0A 2VWTA 3DUGA 2YOCA 1CXLA 1GKQA 1LZOA 3W88A 3UT0A 2QKFA 3BPWA 2V2DA 4RE3A 3QRHA 4US5A 1KFJA 1C90A 1GOWA 3TAKA 1C7TA 2ZBTA 1DJZA 4J3SA 4B92A 5CGMA 3UZJA 3PJXA 3WQPA 2WPGA 1HNYA 3RMEA 2OLHA 1OFPA 4GA8A 3F4VA 1K6WA 1KGXA 4Q4KA 1SO5A 5CG7A 5BWAA 4I5UA 1EC9A 3VCNA 3BQ6A 1PDCA 5E70A 5C8BB 1E1CA 3VGEA 3NVTA 4M19A 3HQ1A 3KS6A 3W07A 3PVFA 5I24A 4M8UA 4ATLA 1KTNA 3RCMA 2J9ZA 5D8WA 2VTFA 1T8XA 4S2BA 2PWFA 3F2DA 2VEPA 3I7QA 3WBWA 4R88A 4XD4A 4LVAA 3SIZA 3PPGA 2XM2A 3ZXWA 1R46A 2AKZA 3N04A 4OJLA 4M80A 4ZSTA 1B5TA 2O9PA 4D6HA 3JU2A 2C19A 5E5CA 5FJUA 5G4EA 4LY4A 5L9FA 1OX4B 5CPNA 4UTHA 1QBBA 4GVIA 4U28A 1S1PA 3PBUA 4LC8A 1A5CA 1VP5A 3T40A 3EX2A 4GJJA 1C8YA 3SB0A 4HHPA 4GIRA 3C6CA 4JIIX 2C1IA 4WJ8A 3R0UA 1GKPA 3P81A 5HDRA 1QNVA 1TX2A 4NRSA 3W87A 1IWPA 1PYFA 2CETA 5HANA 4DX3A 3OP2A 3G18A 1D3CA 3W7GA 3LGGA 3H2OA 3MP4A 1RBLA 4W5ZA 4AF0A 2W4XA 2FIQA 3IIVA 3LHUA 1PX4A 3CUXA 2DUXA 3OOQA 3BSHA 4Z1DA 2DT0A 4DJED 1KW1A 4O50A 1LL7A 1KCXA 1BYBA 5CC7A 4DBEA 1Y8BA 4E3TA 3LM3A 3CYVA 5GJNA 3W37A 1KLYA 4YTSA 3A4XA 4G9PA 1MRAA 4RV3A 1W8GA 2CERA 3APGA 3HURA 1EDQA 4GINA 4WQ6A 1T40A 3S5OA 1GCYA 3FJNA 5T9BG 3FW6A 5AFDA 2D69A 3W7JA 1R9ZA 3E2RA 4ZQNA 4BKNA 1ZJIA 2QMJA 5G1TA 3VDGA 3O16A 1GONA 4CCZA 2XU2A 3CH0A 4HT3A 3OGSA 1FWJC 3AIEA 3LDVA 2OWXA 3PTDA 1V6TA 1EUAA 2NVDA 3KCLA 4MGGA 4HJWA 1C92A 2YW3A 2EG7A 2BSLA 2Y89A 2CKSA 4H3DA 8TIMA 3UQNA 1F7BA 4IIHA 2OLSA 1MWOA 3GZAA 3F4DA 1PTAA 4Q4PA 4I5XA 2CU0A 3W27A 5LNRA 3ZJ7A 3AS1A 2OSYA 5D2WA 2PGEA 4R7JA 4JICA 1KM6A 2OYLA 4W5UA 4HK5A 3IJ8A 3EWZA 2Q8XA 4HMDA 4X2PA 1R3WA 5D2TA 1UZ4A 2GQ9A 1F5ZA 3A13A 3WMBA 3S1VA 1XYBA 3OVRA 2BP1A 4ECLA 5K9DA 3W28A 1P0NA 3GSMA 1V4YA 2J88A 1FP9A 4WCJA 4AEOA 4ICMA 4C6DA 3VZZA 2VUNA 5M03A 4YWIA 4IGHA 4GKTA 1UH3A 1VBGA 4EAMA 2YDAA 3W73A 3TOPA 3DHPA 3NQ2A 3GH4A 3MUY1 1JZ6A 1UD8A 4W86A 1CLVA 4L6HA 1Q6QA 3EEGA 1W2PA 2YDSA 1KTBA 1P6CA 2Y62A 3K4AA 2QJMA 2WMJA 3GQYA 2UWXA 5I7GA 3L21A 5JBDA 4ZR8A 4W93A 2PGWA 3LHVA 3FYPA 4MAZA 3STGA 4GH3A 1LBMA 2EF9A 4N42A 1GQKA 2X0HA 1FDZA 4LYRA 2B4GA 1AQMA 4KIEA 4NAFB 3TYAA 1G4PA 1AZ2A 4WSHA 1P4CA 3L4ZA 2QZRA 3B4YA 2J8FA 2PWVA 4AD4A 2IQ0A 2JKPA 2QDHA 5D05A 3AALA 4IBDA 1F3WA 3NQ7A 4DZHA 1LORA 4B3KA 1JVNA 4AWUA 1G4TA 3P67A 9RUBA 4DO5A 1KC7A 1S2CA 4EPKA 4GUHA 3PG8A 4PTWA 1RQHA 8CGTA 3LBCA 2E5CA 5BOFA 1WAWA 2XTKA 1C9WA 4Q8QA 1VCVA 3W7DA 1Q6FA 1QOXA 2DZVA 4C1KA 3DH7A 4O1CA 4D6CA 2ZRVA 3IVTA 3NVDA 1V0LA 5HMSA 3VA8A 4LV4A 2Y2WA 1UW9A 3BV7A 4LGXA 4ZGYA 4MTVA 5FKYA 5FIPA 2QDDA 3AO0A 2BHZA 3QHNA 3UP8A 1JYVA 2ZA2A 1FWHC 2WK2A 1RVKA 1IIGA 1Q3NA 3Q2DA 1UKPA 4DM2A 3C2RA 1FHDA 3CWOX 4BWLC 1NWSA 2Q09A 3FDKA 4MLJA 2A79A 1AQHA 2O4MA 1CECA 4NXSA 3D5HA 2ONEA 2ZADA 4P7LA 3W76A 2RJGA 1S39A 5C9ZA 3TZNA 4UWMA 1DE5A 2DP3A 1JYNA 2X30A 2Y2IA 1QNSA 1E56A 4FA3A 3IVSA 1K1DA 3AXIA 1EQCA 2B7OA 4TX9A 4IP5A 1J11A 2PP1A 1BEUA 1OFQA 3W6LA 4C60A 1GUVA 4OJ6A 2J9XA 3M1ZA 4C6NA 3O6DA 2VELA 5EA9A 1TO3A 4IBKA 2W63A 4PTVA 4NU7A 3QV7A 4J3XA 3GR8A 2POZA 4H9VA 5CBBA 5C55A 2Z25A 1ZAJA 3BANA 3NQAA 3PF3A 1OZMA 2BVTA 4NZ5A 2PWGA 3A3WA 1V93A 3NL6A 3EYPA 1LUCA 2TSYA 3FN9A 4LQ1A 5A69A 1C8XA 3G1RA 2BY1A 5E1QA 3ARZA 1TIWA 1GOQA 5A8PA 1VZWA 3RLGA 1AVAA 3UZXA 2D0HA 3UD6A 4WR3A 4Q7IA 2XYLA 2H8XA 2VCBA 3H7UA 4AD1A 2YJQA 4IJFA 1SJAA 1OABA 2WAGA 1CWYA 1K9EA 1WYIA 4GIYA 5CPTA 4TVUA 3B04A 2ODOA 4PUMA 4DJEA 3M0XA 1KQZA 4E4FA 1GTEA 3PZGA 4ML4A 1QUMA 3KS5A 3I3EA 3W82A 5F2IA 2V38A 1P0BA 4ICNA 2WCGA 1LBFA 3ZWTA 2V5JA 1UIOA 1XDMA 2IKGA 2RAGA 3IV8A 5ABFB 2X7WA 2GGJA 2YBTA 4PMOA 4IGMA 3QLLA 4E6MA 2Z7KA 2VQUA 3VNLA 1I9CB 3ITYA 1A0CA 1BFNA 4LC6A 2BTMA 1K4GA 2XVNA 3WK3A 3M0YA 5AC7A 5I6SA 4W8AA 3SCVA 3KDOA 4H7CA 3NQDA 5M2FX 4PTNA 3QMRA 5LIWX 3L9CA 1GYLA 1OINA 1TA3A 3LBOA 1E9ZB 5E0FA 2AAAA 4JTLA 3N2BA 4MUPA 3EOSA 1R7OA 3UZYA 2GQ8A 4HU3A 3BURA 5F4SA 1DXFA 3BG5A 5A6LA 2WSRA 5I3DA 4JX4A 4WRHA 4J27A 3GFZA 2GJLA 1FOBA 2YBVA 3U5UA 3QC0A 3SR7A 3Q45A 2I9EA 1PUDA 4D6DA 4TTUA 2ZWYA 5B7ZA 4BI5A 1EWDA 4HHMA 3DFPA 4HU8A 3QV8A 4LALA 3GYCA 2H3BA 3IRSA 2ZA1A 4HTBA 2E6YA 1OK4A 2A6NA 1K9DA 1WNOA 2FB2A 4K6AA 3T42A 3SY1A 1W2VA 4UR8A 1Q6DA 3VD9A 1V6WA 3FA3A 5XIAA 3MSRA 2JK2A 4E0CA 4GD0A 5TD4A 4IFOA 1XLLA 2HS6A 2J7FA 3PWAA 2A1YA 3UWEA 4YVXA 3SI9A 4UQCA 1ML1A 3V35A 5J04A 1SJBA 4UFIA 2J25A 1C93A 4X9SA 3PUEA 4JFUA 5D2YA 3E0WA 2E3ZA 2QQ6A 3EWBX 1Y7VA 4XV0A 3CEPA 3KM8A 1RQBA 2YLLA 3H6OA 3TU9A 1EL3A 4ACYA 3A9BA 4XKYA 3T09A 1UKTA 3N4EA 1SFTA 4XUGA 1TTJA 3FVDA 3UVAA 2ZZ2A 4IBBA 2I57A 3AHXA 3LV6A 1FWSA 1E3ZA 1W8SA 3DHFA 4GH1A 3T8QA 2J4GA 3URAA 3UERA 4K38A 5CSRA 1VJSA 2AL2B 4F9DA 2OO0A 5TF0A 4WY0F 2DVXA 3KOXA 1HTIA 4ACZB 3P6LA 1MDRA 1HKKA 3WQFA 5CH9A 3RRAA 1YU0A 2OCZA 4M5PA 3GXIA 1H1YA 2D2OA 3ITCA 5AZ0A 3FEQA 1EUNA 2R1LA 3RYSA 2O0TA 2Q6ZA 3FS2A 4LG2A 4NZ4A 1RD5A 3F4NA 1RD6A 3VNJA 4AISA 3H26A 1KRCC 3BW2A 2G4FA 3D0CA 1P43A 3SQSA 3P80A 3FJ6A 4H6KA 4AIEA 2VRKA 1MNZA 1OWQA 1XCFA 3R8RA 2A3CA 3E96A 2JBMA 4W85A 3S5SA 4DYKA 3ZM8A 3U57A 4NJKA 2CPUA 4FOJA 5CQ1A 1DJHA 3SW6A 1EC8A 1XGDA 5D38A 1TTIA 3W7PA 1LTDA 4MWAB 3A5VA 3LN3A 3CMGA 3KBWA 4G6CA 4L61A 2TRSA 3F03K 2YXGA 4GHAA 1RVGA 4O18A 4DUOA 3RHGA 2PDXA 3BMVA 1B3VA 3PTQA 2OMAA 2FQIA 1JCYA 2HISA 5I00A 2NT0A 1O5XA 4AC7C 1R3VA 1WXZA 3W29A 3FFSA 4JYFA 4WSKA 3F2BA 3HGJA 1HT6A 2DT3A 3EB3A 2ZZ1A 1P7TA 3R5EA 1A5NC 3K13A 3VINA 4O0KA 1POKA 1MEIA 3FVMA 4FNPA 1OGSA 4DJDA 4JX6A 3S46A 2WQPA 1M7PA 2FZ8A 3UZ5A 3WMLA 1MW1A 2ZRXA 1U33A 1YTDA 4LTSA 1UUMA 1QOPA 4RK8A 1TWWA 4BZYA 3TR9A 1DV7A 4A05A 1JZ8A 2YCEA 1QVBA 3FAWA 1PZ3A 4K37A 1I60A 1GW9A 1MZRA 2BLEA 2PCQA 4I8DA 2FFCA 1MEWA 3WBEA 4PC8A 1EZWA 3AYRA 3E9AA 4C6CA 5C9XA 4U5IA 4QHRA 4DZAA 4K1WA 4DPPA 1H3GA 4HSHA 4LBRA 1JRBA 1FVPA 1S5TA 1PE1A 1PTDA 4PCPA 3E38A 3HFTA 4C6MA 5DX7A 4GO9A 2G4JA 3E0IA 2ZC8A 1TB3A 4F9JA 3MI3A 2AAMA 3LNPA 3QZEA 4AYSA 4Q4QA 1CENA 5AYIA 4N4QA 4EWJA 3CV6A 1UR9A 3B9OA 1QK2A 3WD2A 5DMMA 2WCSA 3D46A 2PI6A 1DIKA 5HUPA 1M9HA 2F84A 4HZ7A 3W1PA 2OG9A 4PSPA 4NNCA 1YUEA 1B0IA 3SJ3A 2WKLA 1M5WA 1YDNA 2D49A 1VIZA 1Q8JA 2ZDRA 1HL8A 4Z08A 4GACA 3VO0A 4WDUA 2X1SA 3VE7A 3H53A 1WDDA 2W0UA 1NELA 4D1IA 3UWYA 4UTFA 3NUKA 2RJHA 3KWXA 3WQ8A 4CU6A 1Q6GA 5FAJA 1P5BA 3DFSA 1BLIA 4DNMA 3KBNA 4LAZA 4HQVA 3AMCA 1PKNA 3RXZA 3USZA 2D2HA 4W7UA 3UGRA 3WK0A 2Y2JA 1KCZA 1SZNA 4GGHA 3DFQA 3R11A 4OFCA 1OK6A 1ECEA 1LM1A 1EIXA 3CZ8A 1QU4A 3O06A 4QQUA 1VFFA 3GTHA 4RXFA 1FKXA 5E09A 3NZGA 4AZ6A 3LTPA 1O12A 4EF8A 3KP0A 5HMEA 3L0GA 3WQCA 1JXKA 1PWLA 3WENA 4W7WA 2XWDA 2Y63A 1Q6OA 2F38A 2ZRUA 1XJBA 4F0HA 3LERA 3VILA 2PCEA 2J7DA 3NOYA 1PKLA 8RUCA 3ARQA 2FZBA 1KM4A 1RP8A 3EDFA 3AMDA 3AIUA 4GO8A 4A3RA 4LUSA 3WEMA 1TPVA 3OPSA 1O94A 4DJFC 4UTKA 3ABSA 2P88A 1JJKA 2QDGA 2CLKA 2ZYFA 3POHA 3IAQA 2OQHA 3ZR6A 2VC6A 2ATMA 1O6IA 1L6YA 1OC6A 2VZOA 3WFAA 3VDCA 2Z29A 2F2KA 3THQA 3O6YX 3PTKA 5LSMA 1CLKA 2GVJA 3P5YA 3AMKA 2PWDA 4WK9A 4WDXA 1CXWA 4Y9AA 5A6BA 1WKEA 1TZ9A 1IGWA 3KBVA 4A6GA 3LRLA 4O28A 2WVUA 3GO2A 1OX5A 1NQKA 4BF9A 2Y2QA 4B9YA 3BW4A 2XFWA 3JS3A 2ADAA 1D9EA 2QDEA 4ZE4A 2IKIA 1EXBA 1GQJA 4JQAA 2CWXA 4MY9A 4FF7A 3O6AA 2HJPA 1CXKA 3L28A 1KO0A 5MKGA 2A3EA 3K4WA 5ABGA 2DZSA 4FHAA 1HP5A 4RL3A 2EKCA 4GQGA 2JIWA 4E4PA 1XQKA 4O0ZA 3B9AA 3NWRA 4WOQA 2W67A 3NA8A 3MUIA 4N9DA 4TOQA 4GVHA 1XLCA 1DXIA 3GHSA 4XBKA 3NDYA 2PLKA 4C5ZA 1RY8A 1Q2RA 2V8ZA 1VAHA 2GVGA 3AMLA 4C65A 5HNTA 4LB4A 3WIJA 1VR6A 3N3FA 4IXHA 3GDRA 2GK1A 5DT7A 2J74A 4IMGA 1G01A 2GUBA 5IDIA 3DHUA 5FF7A 5LHFA 2OEJA 4L4OA 4MPKA 1GVQA 3OGRA 4XZBA 2UBPC 4ATWA 3N9RA 3W7IA 4P7OA 2PPGA 1JFHA 3RNDA 1V79A 4P7QA 1X98A 3ISIX 1QHOA 2QF7A 4ICCX 4LYQA 1TPWA 3FYOA 3K46A 3QMTA 1EDGA 1W5QA 2DIEA 3FXYA 3TIMA 4DBUA 4N2YA 1WZMA 3UXDA 3NXLA 4HMCA 4JPGA 2BVDA 1UWRA 1UROA 2FKPA 4FALA 3HJEA 2QS8A 2IMRA 2WZMA 3LCLA 2E4TA 4M7SA 2OB3A 3KVMA 5AHEA 2WZEA 4HCDA 4UFJA 2BGSA 2VQTA 5I3HA 3I6EA 4Q4MA 1R85A 1KBKA 2PODA 5TIMA 1EX1A 1AJZA 2XWEA 3ARSA 2NQ5A 1DQXA 4DWSB 1H8PA 4LX4A 1E0TA 2J77A 4F0RA 4KQNA 3CTTA 4IQLA 5EMKA 4QS6A 2L5HA 3CV1A 1EPVA 1I2OA 4LUJA 4YVPA 2XZ7A 2ZVRA 1XKJA 2E8YA 4DLMA 3DFHA 1H5YA 4LRTA 2NXGA 2YB1A 1AD1A 4QE4A 4S3GA 4NJJA 5A6AA 3G8EA 3WD3A 3P3BA 1RH9A 5FEPA 5BRQA 3MT1A 4CN6A 4OKDA 3M6YA 1SVDA 3OJGA 2Y5JA 5HK4A 4EE9A 2DSZA 1HUVA 2ACQA 4QLKA 4AIBA 3OG2A 4B5SA 4MWAC 4NUWA 1ZLPA 1VYSX 1R2RA 4KRUA 1LRNA 3B0YA 1BYDA 1EH9A 3VD4A 3QPEA 4UZSA 3VKJA 1TVLA 1KKOA 2C16A 3AQUA 3LCGA 3A12A 4AD5A 5ABHA 6REQA 4HGXA 2VD8A 1UR2A 3G0XA 2PB1A 4UMCA 3EB2A 3LRKA 2E28A 4FXFA 4IPIA 3W2NA 3R58A 3KCJA 4DI8A 3NYZA 4NXKA 3LCHA 3P2VA 4IMEA 3IUIA 2ZTKA 3E3HA 3FDGA 4QCFA 3AS3A 1L2QA 4EF9A 1Z32X 3DESA 3ES8A 3MJMA 4W89A 3MI6A 3LI1A 1U30A 1XBZA 1IZKA 5DFAA 2O92A 3S0CA 2BMBA 3RRXA 2BX7A 3EPNA 5AVHA 5AC5A 1E9YB 4F0MA 3JR2A 4PCFA 1WKDA 3HMJG 3CPRA 2V5OA 3TYEA 2PMQA 1DQWA 5D33A 3RR4A 2WWCA 1J18A 1E9LA 1L6WA 2NT1A 3W24A 1KD0A 5IFTA 3VIIA 3AZSA 2JF7A 1V0NA 3BJSA 4JY8A 2VOTA 3F2CA 1EF2A 3H21A 4LVGA 1PWMA 3DCPA 4N9BA 3O3RA 1QJWA 2XH2A 5CKSA 1GJPA 4GC4A 3TXVA 4NY2A 2G97A 3BJFA 3EOUA 5A94A 3ZR4A 3SRKA 3TYDA 5C7VA 4UQ9A 4ZODA 2FPVA 2ZZ5A 4RW3A 3SCPA 3LMYA 3PZQA 5HWNA 4J28A 3NGFA 3CMFA 3TYUA 1BRLB 1A5BA 4PMDA 4X0VA 1K3UA 1FWAC 1NFBA 4GYFA 3W2LA 3PY2A 3FOKA 3CIVA 3IV3A 1EP2A 5PTDA 1X96A 2DZXA 3W0KA 4QNLA 1F61A 4CN1A 1TJ1A 1F05A 3AHTA 2IOUA 2OEMA 4BCEA 5H2ZA 4IP7A 1W0MA 3BLOA 5DEZA 3M64A 3ITTA 2X0YA 3CK5A 2W5FA 1XLHA 2GJXA 2X2YA 2YFNA 3MTWA 4L6DA 4G8TA 4A3UA 2CLPA 1B4EA 3K1DA 3RLHA 3V36A 1IEXA 4XO7A 5EMYA 5DRCA 3CC1A 4TMBA 4AFYA 4HNVA 2BXYA 4MSSA 4V2XA 1MNSA 1O95A 4XVDA 4TQTA 3TWAA 2CHOA 4YLWA 4UCGA 5JH1A 1QDSA 1M04A 4FLSA 3IGSA 3VUPA 3QGAC 4QRNA 3UBPC 4OUIA 5CZ0A 5C2XA 1ZS2A 1KFWA 4HTYA 3I7RA 1CDGA 2HS8A 3QW4B 4K8GA 3L4VA 4FF5A 1B9ZA 4EP8C 2EBNA 2V2HA 3IGHX 1HXJA 4NASA 2Y8VA 4PB4A 1QATA 3RAOA 1DJGA 3RLUA 2Y7EA 1OG0A 4LNYA 1IEQA 2Z1BA 2ZZ4A 4NP7A 4R33A 4O52A 1UA7A 5TAOA 3WDIA 4DUVA 4Q8UA 2QUTA 3LPFA 4BQ4A 3LYEA 3ZFHA 1QPNA 3SQLA 3N2XA 4C90A 1V3JA 5LIXX 4JTUA 3I6RA 4ADUA 3B8VA 3GBDA 4MWAD 3VMPA 3S1GA 3NQ6A 4UTJA 1H09A 4PUKA 2EJ1A 2CLLA 5ABTA 3FGCB 2FJUB 1A53A 2CLIA 1R8LA 3S6DA 1ZAIA 2FZMA 2D20A 1Q45A 3C2EA 3RO8A 1G69A 3DYMA 3MW7A 4WXYA 2P10A 3ZWSA 3BUVA 1B2YA 2VGGA 3A24A 3WUFA 3VOHA 4R27A 4PMVA 5AHNA 9XIAA 3STFA 2YA1A 3NQ8A 4F2BA 1GWJA 3DU0A 3UGVA 1O7AA 3WQ5A 3AU6A 3VUSA 1W5PA 3OGVA 1Y5WA 3LHZA 5REQB 4GUGA 4C6EA 4QSFA 1YU3A 4OOUA 1M41A 4PA8A 5CC5A 4LBUA 1QPQA 4IL0A 4ML9A 4PYSA 2DT2A 4YTRA 2VC5A 3N4FA 4G56A 1HKWA 2NWRA 3FX4A 1WOBA 4JTJA 2E25A 1T6MA 3M16A 2IQDA 2RDXA 4AAJA 2V69A 3VE9A 3W7EA 1Z7AA 4GI6A 2TODA 3IUDA 1KM0A 1DTUA 1A80A 3WNNA 2ZC1A 1FBAA 2OZ3A 1SSDA 4HSOA 1GEQA 1E4NA 1JXJA 3BTNA 4B2DD 1HF6A 1M3UA 2WNQA 4O13A 2QGYA 4AZBA 2G3MA 1UYQA 3EPMA 1HFBA 2GWNA 1HL2A 4KFOA 2QJGA 1GJWA 2OU4A 3T4WA 4Y9OA 4MIMA 2EG8A 3DGRA 1BPLB 2I1OA 1V77A 1E8BA 1KBLA 5AYXA 1H11A 1KWKA 4JYEA 4U31A 3VIOA 3GC2A 2PF8A 1NEYA 4NI8A 1ZJHA 4Q4OA 3W7CA 1L6GA 4L56A 4AVOA 4HK7A 1XYFA 1OCNA 3IJ7A 1ME7A 4K7YA 4HPJA 1YDYA 2WC7A 4JTDA 3VNZA 1X8CA 2P8CA 2BDQA 2PUZA 5FESA 1R2TA 3DFYA 3QR0A 2GDVA 3WF3A 3HOJA 3FA4A 1NJJA 5MHBA 3S2MA 3OQ8A 1YNYA 4FPSA 3LHWA 3BLPX 3AIRA 3H70A 3TW9A 3MB9A 2EG6A 2O7QA 1TJ0A 2ZOXA 4MMWA 3ARUA 2VR5A 3QZAA 5GJMA 1THFD 5BMWA 4BS0A 3W1NA 3WLKX 3DBNA 3JRKA 4EK7A 1RCXB 4RNJA 4UR9A 1TWSA 3F7JA 4AHOA 3GDTA 2V0TA 4Y9PA 2V9DA 2GSHA 3UPMA 4OTKA 4GUJA 1KS0A 1VJIA 5DO8A 3QOMA 1B90A 3MZNA 4QJ4B 5F1VA 4PCSA 3RFAA 1DXEA 1DIEA 2INZA 1VRDA 1F3TA 2PTDA 1JI2A 3H2NA 2PTXA 4UNLA 2F7FA 5D32A 4GNJA 1NP0A 2WVVB 2PGRA 1BKHA 5E6YA 3GY1A 4S2CA 2PS2A 4R7OA 3VMNA 3MU7A 1LOLA 3SRDA 3CWHA 3VDHA 5GPRA 6ENLA 1U2YA 2D0FA 5I3KA 1TE1A 1BHGA 1XFBA 2ANUA 4PMXA 1JDCA 1JCNA 3FXGA 4KMQA 2ICSA 3H55A 3B03A 1TV4A 1H0IA 4RNFA 1WDSA 4LANA 1EIBA 1TKKA 2G37A 2QCNA 3UPWA 1HJQA 2PDWA 3BQ5A 1Q66A 3MO4A 1Q7QA 1YNQA 3WF0A 4GX9A 5TNVA 5K2ZA 2AMXA 3N6HA 1ZUAX 4HD5A 3BGAA 3BLIA 2VCAA 3ZJKA 4JZ5A 1KTCA 3L0NA 4BWLA 4JFSA 4I90A 3CQIA 2JGYA 4NSBA 4UTWC 4QE5A 1CGWA 4XAFA 4IUOA 3MSDA 3N2OA 4HB7A 5FF4A 3VIFA 5J8LA 2XVKA 3ZS4A 4YJ5A 1QWGA 2OELA 1KXTA 3OBKA 1HVQA 1ZRQA 1OFDA 4FEZA 1ZBCA 5HAOA 2EO7A 2HSAA 4L9YA 1OQFA 3UJEA 1QI4A 3QY6A 3GTNA 1IXNA 3CL6A 4PEEA 1HJUA 3U2CA 2G8ZA 4FXRA 4LUSB 3V0TA 2VVSA 2Z1SA 3ZLGA 4UOZA 5LNWA 3QKEA 1CBGA 4GZEA 5U4NA 1EHAA 4LU0A 3SAZA 4Z42C 3KLLA 3O63A 2PGFA 4LWWA 3VU2A 2BASA 3IS4A 2EQDA 3W7HA 4MKNA 1E6QM 3VD5A 2E8ZA 1VJZA 1GHRA 2E7FA 1KFKA 3RU6A 1XD0A 1IYXA 3IGXA 2WXDM 3G3MA 1YIXA 2NX9A 3ZVHB 1L8NA 2P5NA 4HZ8A 4WD0A 3G3DA 3EDEA 3HG5A 4HPGA 4UOQA 4I8YA 1TMHA 4QS5A 2D73A 3UCQA 4V15A 5T8GA 3URQA 2VDHA 1LQ2A 4KFPA 3C2YA 1W17A 2R1MA 1AW2A 3QOKA 5DMNA 1CZ1A 4AC1X 4GIEA 3W1XA 1JYWA 1S2UA 3ZJ6A 3D6NA 4HJFA 5A8GA 3TROA 3N29A 4HN8A 4PSRA 4HZMA 4LF2A 5DMYA 3NZQA 1EP3A 3BAIA 3P84A 3GH7A 4F4RA 4KERA 5A3HA 3NSMA 4HOXA 1R3QA 4YU1A 1H7NA 2X7VA 4OBSA 4HPNA 1OD0A 1HN1A 3H2MA 4LS2A 5D02A 2ABBA 2ZUVA 1D3GA 3GRIA 1EO7A 4I5RA 2KX9A 1IWAA 1G94A 3L5AA 3V1HA 4LXFA 3Q4DA 2P76A 2UZ9A 3HONA 1ONXA 3S5NA 1VENA 1KCLA 1BWVA 1UIPA 1P0DA 2XD5A 3SSJA 7PTDA 1TQJA 2QCCA 4FI4A 4PRWA 4UUIA 1XLGA 3NURA 3BAWA 2DGAA 4MDOA 1NQ6A 3N11A 1B3OA 3OA5A 2QW5A 3GNRA 2GDQA 1ZU8A 1EX5A 4KW2A 2OXNA 4DPQA 3ANYA 1MUWA 2RDWA 4NNBA 1G6CA 4ZB5A 2WZIA 3N25A 4QSHA 2V5DA 3TTQA 1XIGA 1GOMA 1TRIA 3UZZA 3CU2A 3UR7A 2WQDA 4PRTA 3LV5A 1G1YA 1FCQA 1XH1A 1UUOA 4KWWA 1BXBA 2CHRA 2H6RA 3VC5A 1OFEA 3W1LA 4GYJA 5CZTA 1LRQA 1RSCA 3M0MA 4QDPA 1UZ1A 1SUXA 1BTCA 3JUGA 1W9DM 3MANA 4E8GA 3NM1A 2HVOA 1RXOB 5GNYA 3GG7A 1V7AA 2LLEA 4YMZA 5LNUA 2GSJA 3WK2A 1CLXA 1X6LA 4L5ZA 1AH3A 3EA2A 5DY3A 2Y61A 3WLLA 3GU9A 3B8SA 4MPQA 5LA2A 1IV8A 3GVWA 3R10A 3EXTA 4HOWA 1F2JA 3KCOA 2E6AA 1VLWA 2J13A 2WSYA 2I17A 4XQ6A 1TJRA 1I4NA 3SECA 1OG6A 3L2AA 4JYDA 2DQWA 3K30A 4UC5A 3PZIA 3UETA 2NX3A 3VIKA 5HATA 3BXWA 4MWAE 4LFYA 2YSWA 4S3BA 3EXSA 4H8NA 3NIYA 5LNVA 1DWIM 3UCCA 3BOXA 1PKMA 4R7WA 3IWPA 5CPMA 5D03A 3WNKA 1DJIA 3WFLA 1EPXA 3VOCA 1D3HA 2B7QA 4Z1BA 4OJ5A 5U7SA 4EXBA 3DZ1A 1JNDA 4C6PA 3LU2A 4GBUA 2FFIA 1CXFA 2NLIA 1V08A 2F61A 3QSRA 4A8IA 4UQAA 1UH2A 5I2UA 4KEVA 1VCFA 4H9MA 4GHRA 3TMLA 4I9AA 1BXNA 2PTZA 2VZUA 4PFMA 1UR8A 2CBVA 4Y90A 3K5XA 1UHVA 4FS9A 4I7UA 2R24A 3MDUA 3VC6A 3G1YA 2W79A 2VR4A 1XIBA 4DB7A 1DQUA 3EXRA 4Y9NA 4GNKB 4WOZA 3KBSA 4C1NB 4LAUA 3TOYA 1B54A 3PN8A 3CHCA 3BLLA 4YPJA 1TPB1 2C0AA 2FFFB 2Q3OA 5F4WA 4GHLA 4WKAA 3WQ4A 2D2GA 3V16A 1XP3A 4W8BA 3DFOA 1NAL1 2YCIX 5DF0A 1ZZMA 5I77A 2ZUWA 1ITQA 2Z1XA 5HBFA 6PTDA 3KUMA 1UASA 2Q3RA 1KBJA 2J9YA 1UH4A 4RE2A 2EPKX 1F4AA 3R43A 2J7GA 3MSGA 4QFUA 1F07A 4PUEA 5FI8A 3PM6A 1SZRA 2Z2BA 2V67A 5AYBA 5FJPA 1W1IE 4FNTA 4XZ9A 1FWGC 4WIWA 3THAA 1BRLA 4ZZ9A 3MZ2A 3UEQA 3EWUA 1GVEA 2WZHA 3C86A 4FR1A 3LPGA 1QW7A 5XINA 2QIIA 3QVQA 1XINA 4LNCA 2JCHA 5BYWA 4BY3A 1X97A 3KS4A 1SO4A 1KFCA 1Z6KA 1JUBA 1W1VA 3B8DA 5I3FA 4Z2KA 3QQ0A 4K1GA 1ZBVA 1YW1A 2CZEA 4XSLA 1DIDA 2D23A 4NF7A 1UD2A 3CUGA 5HNUA 1S2TA 2ZCGA 1PIIA 4ES4A 1VHCA 2ZTJA 3T05A 4CEUC 3SFKA 4EXAA 1W1ZA 1P1XA 1G67A 1KA9F 2XSBA 3O15A 1EAKA 4GZJA 3ZSTA 1VB9A 4V27A 3O07A 3VKCA 3QQ1A 3U2EA 1I6NA 1LLOA 2VGIA 3WJZA 3OU8A 3GVRA 4QP0A 1B30A 2NQJA 1QPRA 1F3EA 4C6QA 2HXUA 2G41A 4PBGA 2V5BA 3LGDA 5FJRA 3GNDA 4Q6XA 1W3TA 2Q8ZA 3JZEA 5LA0A 2GVLA 3SN1A 2VD9A 1M53A 1XBXA 4YCPA 2AOSA 2W6RA 1IR2A 1YU2A 5ECUA 2ZZ3A 1G9HA 3WJSA 1EJXC 2FN2A 1EOMA 1TMQA 3P93A 2Q01A 4LOCA 2HBXA 1FWNA 1FRBA 3LCXA 3U2OA 1EWEA 1XFCA 1ADDA 1EF3A 2QCDA 3RR1A 3VKKA 3A5FA 5HXMA 1LOSA 4L80A 1NDVA 1UUQA 3D47A 4PFHA 1GG0A 3G0SA 2CFFA 3LPPA 4TV6A 4QITA 4KT2A 1BGGA 1L6JA 3EOLA 3WLRA 3LLDA 4PULA 3CZEA 4JQ2A 2BHUA 2BZNA 4UMBA 1FY6A 1JULA 1QNPA 4NJIA 4TU1A 1AODA 2CZVA 1JFXA 4MNLA 1SJCA 4JHOA 4B9ZA 1ENUA 1AUSL 1E9IA 1Z42A 4UQBA 4O54A 4RCXA 1AK5A 1NFPA 2C18A 1RZMA 4BHYA 5I03A 3UWUA 2ZRWA 3PB2A 1R30A 1VC4A 3W71A 3PJUA 2DUAA 4CD4A 1RK6A 2QJIA 4ROQA 1K4HA 3K8MA 3TXZA 4CQCA 3GUWA 3AUJA 4OZOA 1K8ZA 2QF8A 4WHBA 1NOUA 4TX6A 4K8EA 4CD7A 1LL4A 3CV7A 3NR0A 4O4WA 5CSYA 1TFVA 4DHGA 3BLKA 4G2DA 1KLZA 3WLOA 1YNPA 3RITA 1CIUA 1Z44A 2J79A 2E1DA 3VM5A 4FOUA 5CJMA 1RPXA 3WQOA 2VFEA 1FWTA 3FK4A 4L65A 2O55A 4R34A 1ZALA 1EA0A 1E40A 4UMAA 3AISA 4OOZA 4XD6A 4XD3A 4Y8EA 3FKRA 1I2PA 3BO9A 5FCZA 4A3YA 2ESCA 1VBHA 2F6KA 3ZO9A 4ZO8A 5KTLA 1QPOA 4H2CA 2QUNA 4BF5A 4GCAA 2WNNA 1R3RA 2PDHA 2VXNA 4PB3A 4AWSA 3CMJA 4GBDA 1JDDA 2Z2UA 1RQEA 2ISDA 5D09A 3S9ZA 5AHIA 3WLTA 1BXCA 1EEXA 1XRSA 3VPLA 1VPYA 2HDJA 3T0AA 1VFOA 2QV5A 3O0FA 3II1A 3KX6A 3H23A 4F48A 1HQTA 3EWXA 4X60A 3HPSA 2VWSA 3NZ1A 4A35A 4NYYA 2GDUA 1TX0A 3WYZA 1VH7A 3HGSA 3CTLA 4ERIA 3MKKA 1WE5A 1JZ7A 3NYDA 3LG3A 4LEFA 4OJYA 3CT7A 3G2GA 1JRCA 4FNRA 1UWAA 4O1AA 1X7IA 1BYAA 3SCUA 3KOYA 2AMGA 2AQOA 3KRUA 1DOSA 4HHLA 1GXDA 1R3SA 5FL0A 2IKJA 2IPWA 5A6KA 3B3DA 2X0SA 1E0WA 2HE8A 1WBHA 2C14A 4K3ZA 1SZFA 1EHNA 4H6EA 3HQNA 5DBUA 3NPVA 3A3XA 1XLKA 1VFUA 3H7RA 1E70M 2V3GA 3N6QA 4GQQA 1R87A 1ZSXA 1YADA 5HINA 1K9FA 4YWSA 1PX8A 1PO9A 3M6DA 1EYWA 3AJ7A 3P0XA 1VBUA 3VKAA 1MEHA 4JX5A 3KTSA 2ZUTA 5DANA 2NUWA 3A9IA 3L12A 1E6RA 5JXQA 4DI9A 4KWVA 2GLKA 3OA3A 2GZXA 2HQAA 2QUVA 4XKYB 5KMYA 3UWZA 4JR5A 1I2NA 4O4VA 2RUSA 5LZLA 2C71A 3NPWA 3CL8A 1TJPA 2VX4A 3GXFA 3A4JA 3N4AA 3HSHA 2VX6A 4S39A 3TYZA 4JEQA 5EYWA 1N55A 1UZDA 4B5TA 4J2PA 4D71A 3VKBA 4IMAA 3T55A 1KQYA 2GGIA 1WX0A 2WZTA 1S3TC 1UP3A 4LPCA 2I5GA 4P8XA 4HSNA 2WYSA 3B9DA 1EJTC 3MCNA 1CTNA 2ZE0A 2D1ZA 3SUVA 3N2TA 4BEUA 1YXCA 3PZVA 4D1JA 4Q8PA 5M3WA 1W1TA 2OJPA 3R2GA 1BWLA 2PDJA 4JNZA 1RCQA 4C7GA 3HG3A 3H8AA 3GLCA 1NDYA 2ZRZA 2FHFA 4YHGA 3HPFA 2X1IA 3MSYA 1US2A 5A8NA 1JIBA 4MOZA 5A8MA 1N2VA 3KTCA 3E0FA 2WB5A 4O8RA 5HJXA 1XH0A 3PNZA 1EJSC 1JF6A 4MB3A 3AXXA 3AZTA 2NQLA 3SBFA 3WLQA 2QULA 3B06A 1V3LA 4ORIA 3MWCA 3DYPA 1QASA 1I0DA 4JTAA 1AMKA 2OX4A 1JQVA 4KIRA 2TAAA 7ENLA 4S1FA 1OVDA 1PHQA 1ELSA 3IJDA 3NDOA 1KBIA 1WXYA 3IIOA 3WQWA 3SM0A 1R0MA 1XICA 4W87A 3EKLA 4TXEA 3VD7A 4B4HA 4B5WA 1KBBA 3LXBA 3ENLA 1E0UA 1X1ZA 1A49A 3UA3A 4AY7A 5E93A 3O9NA 5HNRA 1FQ0A 4XG1A 4KCVA 1TV5A 2VGBA 2Y2GA 3VAVA 4X9YA 3FLUA 2J8GA 2QPSA 1MXSA 4ZTYA 4Y9MA 4PRRA 4XZWA 3MY9A 1M7XA 2ZX6A 3GUGA 2C6QA 5JH2A 4MNJA 1PCKA 3H4XA 5KINA 3DI0A 3CGTA 3VGGA 2PF0A 3AYSA 4GQ0A 3AOFA 1CT5A 4XAYA 1ME9A 1JZ5A 3QXBA 4H4IA 5F1UA 2PD5A 3W22A 1EJUC 3S3GA 5D2VA 5CPLA 3FNDA 4LSBA 4O16A 3MYOA 1DHKA 5BRBA 1XBYA 3IANA 2V68A 1E4MM 1L2UA 2YL6A 3LRMA 3PBYA 1JGIA 3CHFA 4RNHA 1HO4A 1NP2A 2NWSA 3WH7A 2YL5A 3LZ3A 4Z1AA 3AUOA 1W1A1 1BQCA 2WNWA 5CG0A 1EC7A 4IJBA 2ZRYA 1E6SM 3PK7A 4EPBC 3M5YA 4AHPA 3P61A 1FWCC 3EKZA 2J24A 1WZKA 3VD3A 3F5LA 4R9OA 5E0KA 3CNYA 4IPPA 3H12A 4QG6A 4HA4A 3NL5A 5CC6A 4MUZA 1RPKA 1W31A 3A47A 3N19B 4PN2A 2J75A 2PDNA 2ZDSA 1YU1A 4IIFA 4ZFMA 3GVVA 1YPFA 3ZJ8A 3S5ZA 4JIQA 4S3AA 4I3GA 4YCOA 2QVNA 1B4KA 4TVDA 3PULA 1GVRA 1W9BM 3ELFA 3TAOA 2QR6A 2WHLA 1FWRA 3AWNA 4LH8A 4DVOA 4Z2LA 1UOKA 2HVMA 2GGGA 2YFOA 4G7EB 2BODX 1U1JA 4FSAA 1CGUA 3IJIA 2KZHA 2RKXA 4WZHA 1EGVA 3NQFA 3W2MA 1MMFA 5EBUA 5K3VA 1TVPA 1EQPA 3S1XA 3TDFA 4XTIA 4FNSA 2REQB 5EB8A 3HO8A 1OM0A 3RJXA 1OFRA 1UWSA 2PP0A 5A2BA 1J9YA 2FDSA 4DRSA 1TSIA 2ATSA 2ZXDA 2VFHA 3TYCA 4P8UA 3WJXA 2NVAA 8XIMA 3RF9A 1H2JA 7CGTA 3MCMA 4J1OA 2PP3A 3KE0A 4AZ7A 2Y85A 1GEHA 3TJLA 1DBTA 4R3UA 1MXDA 3VX1A 1WPCA 2Y5SA 1GPWA 1EKOA 2XZ9A 4M56A 3VNMA 4CNOA 1KXQA 4KPLA 4NHVA 4XVEA 1H7XA 5KETA 2J78A 3HIJA 1GQLA 2GVEA 2X2GA 1EJ7L 4DN1A 1IEVA 4AZ5A 1UR0A 3RGTA 6ALDA 4OE7A 3ECQA 4NI3A 1W91A 5BU9A 1BF6A 4RV8A 3DGBA 3TX9A 2HEJA 4FLOA 1VLIA 5HR6A 4M6UA 3CZGA 4UTLA 4C6BA 4WGXA 2OQYA 2WOQA 2H9AB 4D2JA 1XIMA 4K68A 4RDWA 1F4HA 5FAGA 1MO0A 1UPPA 5FSEC 1Z9AA 4DY1A 3W70A 4JFTA 2AGTA 5CJ5A 2NXIA 4P61A 3TW7A 3VX0A 2EKGA 4NZ3A 1SFJA 3TE9A 1X6UA 2PDQA 4J7RA 3CJPA 3LQLA 4ZMGA 1QPKA 4MY8A 4NRRA 2VEMA 4MJZA 4C7DA 4E2DA 5ENLA 4MKVA 1FP8A 3W85A 1J10A 1ADOA 4MAVA 4EKJA 3CZLA 3NDZA 4O11A 4CQ9A 4DYEA 1U5JA 4I9MA 3IJLA 4PMNA 2RTSA 2ISWA 1VD6A 2O56A 2WJZA 4GY1A 4HA1A 1GVFA 4BI6A 3HA1A 3GIYA 3WL1A 1XDJA 2YZ5A 3PUOA 2BB0A 2DFAA 2ALDA 3R89A 5GJPA 2ZX5A 3LCFA 5BCAA 5K4XA 1OBAA 1KXHA 4AVFA 2V3FA 4A21A 1XQLA 1TE6A 3GG8A 4W84A 4UNIA 3BZJA 3VIMA 3CAWA 1S2VA 3TQVA 4ALDA 4CQDA 3PUGA 4D6GA 3HN3A 2F6XA 2XN1A 2Y88A 4GYPA 3LD5A 3V18A 2E68A 2V5KA 5T9CE 3Q58A 5IXEA 3TN3A 1PZ1A 4LUTA 3UXLA 2J7BA 3SCTA 2B7PA 3WQVA 4C6FA 2Q8LA 1FKWA 3QYSA 3H24A 1M01A 3HQOA 2X05A 3P62A 2FHBA 1YPIA 1RA5A 1IGSA 4ZQOA 3IIXA 2DIKA 4DJDC 2GK1B 1ESWA 2JE5A 2DZWA 4K36A 2JGQA 2WJEA 3BMXA 5EL1A 3GXPA 3P82A 1NVMA 3IUHA 1NOWA 4NIRA 2NSXA 4KRTA 1U22A 3GH5A 4ONVA 1XC4A 3WDQA 3NNTA 3O2LA 4EIVA 1Z69A 1OGBA 1VS1A 4BR1A 2FB3A 4PTDA 3U7BA 1IE7C 3WF2A 4E8CA 2IPGA 1IXPA 1V6VA 1J6PA 1QI2A 2WC4A 4WGHA 3T44A 3TK7A 1UR1A 2XVPA 3Q94A 3FKKA 4MF4A 4MZ1A 4JTIA 1LWHA 1T96A 1ZAHA 2DORA 2R14A 2WPBA 1P7TB 1BAGA 3BSMA 1V51A 3S1UA 1B1YA 3AS2A 3ZZ1A 4PTXA 4OJOA 2CBJA 3TMQA 2E6FA 5HMFA 4LT9A 2A7NA 2AQWA 1QAPA 3RIKA 3WBXA 4WXZA 3KLKA 1ZJAA 4DBSA 3W1QA 3PPFA 3CIXA 1E72M 1LQ0A 3OZPA 3ABOA 4H6RA 3GXNA 4J3ZA 3CH9A 1HKJA 3W01A 3FIGA 1G7UA 3SUWA 1F76A 5FEWA 3ZQ9A 2I16A 2RGMA 1UQYA 3GG0A 3ABXA 3W72A 3COTA 4Z2HA 3T1GA 4N9EA 3SQMA 5EMMA 1EXPA 3GX9A 4O8AA 2B0MA 3L25A 4XZNX 1OD8A 1ADSA 2YCLB 3BE7A 3NTYA 4U4MA 3VNKA 5A2CA 5HJYA 1H7PA 4ZEPA 2VJXA 5BW6A 1DJWA 4IPJA 4HK6A 1CGXA 2UY4A 1E71M 3AXHA 3H2AA 4PUNA 1Q6CA 1QNRA 2HRWA 2QPUA 4GY0A 4QR6A 4NX5A 3VMOA 1ISWA 4PUDA 3SZ8A 1XDLA 2JQXA 1ZTVA 3ARWA 3U9IA 5DRIA 1TV3A 4R53A 4NT0A 3URBA 2ZXQA 1VEOA 3P74A 2BS9A 1NU5A 3GKAA 3B97A 2BG5A 4CN4A 2PDCA 3QPZA 5CXPA 1AW5A 5K9CA 1S2AA 3B8IA 3S8HA 3OYZA 5A6BD 2XGZA 3I10A 1O68A 2VURA 2I9UA 2OFJA 1S3HA 2HZGA 3CAQA 4IICA 2CNCA 3PPHA 2DDXA 2Y2LA 3N73A 3WLSA 1UR3M 4FLRA 3BW3A 5LXXA 3ZSSA 4Q3MA 5CZKA 2JFEX 3ITVA 4S3CA 3OIHA 4MB4A 1XF0A 3VTRA 4E4UA 1RV8A 3VI2A 3PFMA 3THUA 2E1WA 3BICA 1SGJA 5JVLA 1PZ2A 1FX6A 2NQZA 3W6YA 2A4AA 4TTGA 3TNBA 4BEQA 2A3HA 4JHMA 3W84A 1CEOA 3T4CA 1V02A 3E5BA 1O60A 3TQPA 3UZWA 3SCRA 2Y0FA 3RM8A 2OO6A 4OWGA 5JUVA 4LS1A 1QRQA 1ODZA 4ZO6A 3O8AA 4UTTC 4F8XA 4A3QA 4PH6A 6TAAA 4AZIA 2XGIA 3WUBA 3WD0A 4GUIA 9CGTA 2CLOA 4GI9A 4L1GA 4PGLA 2EEXA 5CLTA 3ITOA 4FNQA 1M7JA 4C6KA 1XUUA 2ON3A 3D3FA 1NH6A 5C5YA 4GE8A 3MDWA 4O1DA 4FIQA 4JTSA 3HB9A 2I7GA 4IIDA 2HXTA 4S3EA 1IR1A 2BNJA 4O0QA 4AMCA 3OHIA 3N1AA 3V0UA 5G5IA 3OO2A 1DWAM 2XH4A 4FR6A 5LGXA 2OWCA 2FYMA 4L64A 3DN5A 5IM51 2ZKMX 1SJDA 4IISA 2P3EA 2HK1A 5D8ZA 5HQEA 4XIAA 1BVWA 3ZLFA 2C1GA 8XIAA 3NQMA 2WSPA 3GDMA 3G6MA 2X42A 3FKEA 3VOFA 2DVUA 4KWSA 4ORMA 3K4DA 3CZKA 2X40A 3RILA 1DPMA 1JGMA 2Z7GA 1MXGA 3AJXA 1JQXA 3P8IA 1SZGA 4RZ5A 3V7PA 1F3XA 3WUEA 1OC5A 5M17A 3VIJA 3WF1A 1IT8A 3TYBA 1DIOA 4NKCA 3ZT6A 1H63A 3B0PA 3RJYA 4DLFA 3N2CA 1LUCB 4PTMA 3RMJA 1YDOA 5D9MA 1BD0A 4OV9A 3WJWA 1UBSA 3R94A 1BKSA 4UTMA 4JOMA 1Z48A 4FK9A 2REQA 2Z24A 3V0SA 1OJXA 5AYZA 2GOKA 1HKVA 3G1HA 3GK0A 4AY1A 2R1KA 2NLYA 3C2FA 1MVYA 2UV8G 3XISA 4ZBCA 1PV8A 2BVYA 5KITA 1GVYA 5F2GA 1OYAA 5DN1A 3GW0A 2A6LA 3AZRA 1TPEA 4Q33A 4J5NA 4CNPA 3M44A 3SCOA 3FAXA 1QT1A 4IIGA 1M6JA 2J62A 3NJ3A 3FHQA 4LAKA 3QKZA 4H9ZA 1IZCA 5XIMA 4HYWA 4QG9A 2B81A 2PFHA 4I7WA 4IG2A 4XKMA 4W4QA 3ATYA 3GIQA 1LCOA 1H1ZA 3TC6A 2OZ8A 3WDHA 2ZX9A 5KZDA 3EX3A 1X39A 4V1XA 2OWWA 3QFWA 3O6CA 4HCHA 4GMEA 5J5RA 3SUSA 3RPDA 3KOZA 5C9RA 4EAYA 1TPUA 2WANA 4P2VA 2J7HA 2HNHA 4YNGA 5EFFA 1PSCA 4E2BA 2BXVA 5LXEA 3IIPA 4AIUA 6XIAA 4L4PA 1TQXA 3GU2A 3NGJA 1EB3A 3QFEA 3RX3A 1RR2A 3VYLA 2B7NA 2J66A 5F4XA 4M51A 2YXOA 3E12A 5K4ZA 4PR4A 2XH0A 2WHMA 3UG4A 4LJ3A 3G0UA 4AF0B 1B3XA 1HKMA 1XLFA 1AJ0A 3RU8X 1TR9A 4GI4A 3TVAA 3WLPA 1XGZA 1U1UA 4Y96A 5BPVA 2C8NA 5DCEA 4RZBA 3VK5A 4JD4A 4AW7A 3W2JA 5DXXA 4N4PA 1WO2A 1NWRA 3UG3A 3S2JA 2QCFA 2WMGA 3EAUA 5HR7A 2Z00A 1S5VA 1I1WA 3I65A 3OODA 3AU2A 2P8BA 3CZJA 4LF1A 3GVQA 4XUYA 3N12A 3S5YA 2QAPA 4D72A 4B2DA 3VFLA 1DEDA 5BOEA 2EPMX 3KVJA 2BFGA 4GXWA 5CAHA 2VX7A 1SO3A 4CUCA 2FZNA 2R8WA 5AECA 3NEVA 4QLLA 1R5YA 2F9RA 4AH7A 2IQTA 3R4IA 4FB7A 4GXMA 1EJVC 2G5WA 1OCQA 1SU5A 1S38A 3JZUA 1ITUA 3N17A 3BCDA 3C5QA 3FEMA 4WUIA 1AQFA 2BOFX 3PHAA 4RZ4A 3GVGA 1Q13A 2QNEA 1W37A 4PMZA 4PE8A 4A22A 3OLDA 4JN8A 1QOQA 1I2QA 3BAKA 4Z2IA 2JEQA 5JIPA 3UU0A 5CSUA 1XW8A 3EDDA 1XUZA 4G5DA 1ISXA 3IAPA 3KWSA 4E2VA 3TEVA 3TN6A 3WH9A 4V1YA 2FTPA 2DVTA 4DO6A 2XGBA 2OKTA 1AW1A 1E6XM 1VCGA 1NOFA 4JIRA 1YDVA 5J5DA 4H9XA 1NY1A 1GYMA 4IFRA 2WVVA 5C54A 1YLVA 3CHVA 4WDWA 1GVSA 3OZMA 1ZJBA 2X1TA 4HNNA 8A3HA 5A95A 4L7ZA 1X1OA 3WQGA 1H41A 4Z2JA 3M5XA 4BQ5A 3MBDA 1MZHA 1RP9A 3T0DA 1XG4A 4QXIA 1EA9C 1Q63A 3HV9A 4CLMA 3GD6A 2Y2MA 3E0LA 3FSTA 3W7RA 4HU4A 3WLMA 1V3IA 4WY0B 3WH5A 2VEGA 3WX7A 4QJ5B 4UTIA 1UKSA 2DUZA 2YCLA 3NQVA 2PDLA 3MA8A 3OVGA 3A22A 2PZ0A 1W3HA 3WDJA 4LCRA 1B31A 3B8TA 1L6SA 4YIWA 5C70A 2PDBA 3G77A 1A47A 4DBWA 4DXXA 1PX3A 1V0KA 3ARRA 1KWGA 2DH3A 1JI1A 2PTYA 3B05A 1LQAA 3AROA 5C71A 4Q4RA 4BJHA 2R91A 5I79A 4ACZA 4D8AA 4QJ1A 5F2MA 2XD1A 2DZTA 1Q4NX 2ZE3A 1X8FA 2R1PA 4LAMA 1ZNNA 4IHCA 3T78A 7ODCA 3VNDA 1BVZA 1V03A 3N2MA 2FMNA 4U2YA 1RBOB 2OZ0A 3U3HA 4XD5A 3WO8A 2EGZA 3MWAA 1GGOA 2PA6A 4RLIA 2G3FA 2NUYA 4BQ2A 2WLZA 2FMOA 2WMFA 3SDOA 2PDGA 5G2HA 1W9UA 9XIMA 1XV8A 1GK8A 1B9BA 3GKFA 2Y8KA 3L7RA 3UJSA 4F3HA 1X1NA 3BARA 4MFEA 1RJPA 3G24A 4F2TA 2P3ZA 3T2PA 4CNSA 2O9TA 5IHSA 3QYQA 3MS8A 1XSJA 3H2FA 4M6VA 4GZ7A 1AZ1A 1IQ8A 3VNIA 2GGHA 3PZTA 3NQEA 4XZLX 2ZZ6A 3TNOA 1VFLA 2MANA 2YIHA 3W4RA 1XWYA 3S6TA 3MMDA 4I6VA 3TSDA 3M0LA 4AY8A 4DUWA 1AMYA 3O1NA 4IGSA 5IFPA 3ZVIA 4UTWA 4PCNA 2O9OA 4AWTA 4ZB0A 3KL5A 3PC0A 4PZVA 4OJPA 2E9MA 3S42A 1GKRA 4F79A 3M0KA 1XLDA 2W9MA 1I8JA 1QNOA 3EWYA 5BOOA 2YGYA 1K02A 1Y65A 3AIWA 1K03A 3WCZA 1TYGA 3UJRA 4YL2A 1RJRA 5BU6A 4CQ8A 1SR9A 3OIXA 4M1BA 4GWEA 2VFGA 3W7QA 4OECA 3CAVA 5TBOA 1TG7A 3TV8A 3M9YA 2QCEA 4IMCA 1JL8A 1J2BA 3GTFA 1CXIA 3TR2A 4L4LA 3KHDA 4LEQA 3W7LA 2NV1A 3U0HA 4E3VA 4XBJA 2XIOA 1SMDA 1E43A 2E67A 2NSOA 4U3CA 3EPOA 3V5OA 1NSJA 3XIMA 2HTMA 1MYRA 1EFZA 4BQ3A 4B3LA 2I56A 2Y7FA 5G2WA 3SUTA 1DKWA 3SGGA 1UP0A 1PJ9A 3PBMA 2XINA 2VZTA 5LHEA 1N8FA 3MUAA 1Y0EA 3EWWA 3UR5A 3HGRA 1V8EA 2VZVA 3W86A 3CPUA 4IG2B 1DWFM 3L4TA 4XZHA 4ZA0A 4XZIA 1U5VA 1R7AA 1WXJA 3K8LA 3W7MA 5DY2A 1F73A 2GJXB 4INFA 3KRSA 4JL1A 3WEZA 4ATDA 4F2UA 4M81A 1GHSA 1XLMA 3AHVA 4L9ZA 5FEXA 2NZLA 3AS0A 3G5EA 2YKKA 1F9CA 3R6IA 2XDFA 4JHZA 1RUSA 1PIFA 4JFWA 4LBSA 4GNVA 1RALA 4ZTXA 1NARA 4IPNB 1A0EA 2B31A 3PAOA 1FWFC 1HZYA 3QF0A 4GYKA 1V6YA 1D8WA 1RK5A 2WCAA 3T2OA 2VMFA 1S5NA 5AHMA 1UJPA 1XH2A 1XKYA 2G3IA 1NFGA 4AVNA 4J9JA 2ZQ0A 2WJFA 1FCBA 4ZCWA 4DWSC 4AIOA 2PU0A 1GOKA 2QEZA 3BG3A 3KRBA 1MRQA 2PBGA 3KBJA 3L0KA 3PSWA 3N3MA 2WHJA 1KR0A 3L66A 4LCSA 3T8LA 1VIWA 4MYAA 1YBQA 1A0DA 3MI2A 2DW7A 1I1XA 2XFFA 5CSSA 5HQLA 3PP7A 3P14A 1J12A 3CQJA 2V82A 4RUBA 3A23A 5G1MA 1W5OA 3ALFA 5FACA 1MFUA 3KAOA 2F6UA 3CHEA 4MB1A 1GOIA 3PBGA 1BTMA 4FMVA 3MUXA 5DQPA 2W66A 2D3NA 1HG3A 2C7FA 2C0HA 4Y2WA 3VM7A 3VXGA 3RCYA 3L29A 2VI0A 1A5KC 4R9XA 4L1XA 4UIOA 1TTPA 4IQJA 2INEA 3J7HA 5FJIA 3SIMA 4DWSD 1YTEA 1PIGA 3WNMA 2E9LA 3FV9A 4FP1A 2V6AA 1OY0A 5JBEA 5BZAA 1VEMA 4S3DA 4ADSA 3W23A 4WVXA 4CD8A 4Z1YA 4WLCA 2MNRA 2WKGA 3UWWA 4YXGA 3ARVA 2BY0A 2H90A 1EJWC 2DZBA 1J01A 1I0BA 3L2MA 4XISA 3EA1A 3W83A 3M7WA 2DQXA 4QNWA 4EX4A 2A7RA 3PR2A 4IL2A 4HPHA 3LUTA 4TR9A 2ZX8A 3S9YA 3HQPA 1UBPC 1UB3A 3IIZA 3WZ0E 4YVVA 3WDPP 2Y2NA 2AGKA 4N9CA 1UC4A 1NF0A 5HULA 4MY1A 3MC5A 2A7PA 1LOQA 3GDLA 4IMFA 3EEZA 2R82A 1BGAA 1QR7A 2VDIA 4HNCA 4H8UA 3AMGA 4JIEA 4UFHA 4QDMA 1ZHAA 3KOWA 3W1RA 3ME3A 1TWZA 5L6UA 5G2IA 4HMNA 4G7FA 3ARPA 1XYZA 3B9EA 4NL1A 1WKYA 4NJHA 2DZPA 1UJQA 1TV2A 2YLAA 3ZYZA 1R38A 2XSAA 1PXGA 3I6TA 4DF0A 4A29A 3M5ZA 3ZR5A 4BK9A 3U4FA 4MDPA 4D8ZA 1JDFA 3A4AA 2GJPA 1KM1A 5CEWA 2V63A 2BOEX 1WDQA 1P0KA 2PWEA 3BOFA 2RDTA 5E0CA 1QI0A 2JKAA 1F6YA 2POTA 3BCFA 4DWDA 3LSBA 3SN4A 3OBEA 4JQ1A 1AL7A 3BZGA 2XIBA 1A3HA 4O1FA 4M7TA 4L6OA 4CD5A 3CT2A 1C3FA 1JCLA 4HN4A 3PBWA 1GG1A 3MMTA 2A21A 1UWQA 5T26A 1JPKA 5CZJA 4JTGA 1Z3NA 3QMSA 2Z6JA 5I0DA 2PLMA 5GVJA 4G7EA 2OKOA 3V3WA 3CLWA 5BROA 1F6PA 3VOJA 4KETA 3R8GA 4HNLA 5FD0A 1A5AA 1CB7B 1CX9A 1TZ7A 3MVIA 1E1CB 5G1YA 3KW3A 3ITGA 2J47A 3EB4A 3C4UA 1W3LA 3LTSA 4JY9A 4YTUA 3EMQA 1QI3A 5JU6A 4KKXA 4EVZA 1ZB5A 2HMCA 1RLCL 4GISA 3IJ6A 3F5JA 2FGZA 2INFA 1Q85A 1Q7ZA 2D0GA 3V5CA 1KCKA 5CGQA 3VOGA 1F8MA 2Z28A 3CQKA 2OQLA 3QZ6A 4HBKA 3MKVA 4RPQA 1PBGA 4BA0A 3AIQA 5C2GA 4ZQCA 3RX4A 2UY3A 3WKZA 1A5LC 5AVNA 2P53A 2C3ZA 4GZIA 5DCBA 2VC9A 2GJNA 4F66A 4JQ4A 3TKFA 1AD4A 3WLHA 4EPEC 4RNIA 2YW4A 5LA1A 3QBUA 2PDIA 4ZOAA 1V5XA 3EOOA 3HGOA 4FX8A 1EZ2A 4PB5A 3CO8A 1JG9A 3W02A 5BXPA 2IS7A 5B7YA 4N6FA 1WB0A 3P60A 1FH9A 3KTXA 1O5RA 3HZ3A 4PMJA 1US0A 4QEHA 3UR2A 1J0KA 1VFTA 5H1WA 3I68A 2QUMA 2UWFA 1RY0A 2XSXA 3XINA 2AQVA 1FWEC 2NXHA 1SW0A 4HYRA 4MFDA 3AXKA 2IXVA 2HBVA 1KGUA 4NILA 5D4YA 1XPGA 3WEOA 2VFIA 4D8LA 2JKEA 3ITLA 2J27A 3RK8A 1ZCCA 2HPMA 2QYGA 5FF2A 1UD4A 1ONRA 1H50A 1R47A 4FNUA 3OEXA 4LVFA 4O53A 3DHDA 4ZQMA 4ASTA 3QGVA 5TQLA 2XM1A 5B80A 5A6JA 1D2KA 4QM1A 1ED7A 3ANVA 3CO4A 4XIMA 2G50A 2QUUA 5IBXA 2XIQA 3HM7A 4C7FA 3U4AA 5HJLA 2Y7GA 1XIHA 3T0TA 2PU1A 1GOOA 3LENA 4QIUA 4ADTA 3BH4A 1QO5A 5BXTA 1OIFA 2E5BA 4TVCA 4AYGA 1AJ2A 3SN0A 4AHQA 3IJ9A 4YHEA 1A5SA 3RN6A 3LBMA 1A5MC 3U8GA 4C1LA 1Z41A 3MHFA 3NSNA 1GT8A 2OLAA 5EGRA 3F4WA 1WUFA 2ZVIA 4LVDA 4GQRA 3BOLA 2ZXAA 3NO1A 5EKYA 1IXQA 2P1FA 3GYEA 1EO5A 1CYGA 1XRFA 1JF5A 1J0IA 4OGZA 2IPJA 1W5NA 3QEZA 4M24A 2ZFAA 4RDYA 2YA0A 1QNQA 2OYKA 1EDTA 3NSXA 3QGKC 3BDKA 3M41A 5KZMA 3LLXA 4IX0A 4AD0A 2OGJA 1E55A 3MV01 3E2VA 3E2SA 5E6ZA 4HHHA 1D8CA 4IGNA 4AD3A 3S6OA 3GXDA 4Q32A 4FLQA 3T2QA 1TZZA 2GVYA 1Q6LA 4P5UA 1TIMA 4I9TA 1XIIA 2ZWZA 3PZMA 2WO5A 5HQMA 3B0XA 1IWBA 1TA3B 4AZHA 3OLGA 1MQQA 1FA2A 3EGJA 3CB3A 4LYKA 4PBFA 3C2VA 1LYXA 4JTRA 1K6AA 3EBVA 2BG1A 1XM3A 3W53A 2F2HA 3ZT7A 3NL3A 1LL6A 3GNNA 5LYRA 3EDJA 6XIMA 1JZ3A 4NZCA 3OLIA 2Y2PA 2FVMA 4XO6A 3S47A 1VGAA 3WL0A 2YA2A 1J5TA 1K7EA 3M47A 5H8UA 2ZA3A 3T9PA 4HZ6A 5FF3A 4NJGA 1FXQA 4PODA 2X09A 3W7OA 2CBIA 5JIWA 3RM9A 4IIBA 3U5YA 2GGEA 4BFAA 2Z27A 1O5QA 4FO4A 1XX1A 4GK8A 3KOFA 2FLIA 3M07A 1WCGA 4DEFA 2PLJA 3I3BA 3NZRA 1TPC1 4POCA 3KP1A 3LI0A 3CIWA 2FHCA 3QM3A 3TONA 3LCIA 1R86A 3STEA 3QHOA 3TC3A 3WLNA 4LW7A 3C0JA 4CCEA 1FH8A 5C0QA 1IF2A 4QLJA 1PPIA 3L4UA 2X8RA 1K8XA 2RGLA 3UESA 1Q65A 2HV5A 1XRVA 2PBOA 5RUBA 1TCDA 3L5MA 3L68A 4JGDA 4KFNA 1R2SA 2MUCA 4UFKA 3BGJA 3KL0A 5REQA 3H7VA 1H51A 1UC5A 5AHFA 4IBEA 2E9BA 3SCSA 3G1VA 5T91A 3SSZA 4YS1A 2PRHA 6REQB 4C6OA 4DAFA 5FJOA 3NFUA 2JALA 2WBKA 2PC4A 1A50A 2Z2AA 2IXUA 4R85A 4PMYA 3Q67A 3KS8A 4H01A 2CESA 4GJ1A 1MW0A 3SRHA 2V5CA 1JPDX 2EJAA 1G4EA 3WN6A 1GJUA 4MJ2A 4MADA 2VRJA 3BV4A 3CPGA 2TYSA 4O10A 2QT3A 4M29A 2Y24A 2VC7A 4DJDD 3SRFA 4KCUA 4NZFA 1KRMA 1ALDA 3TCEA 4E38A 1DL3A 3T81A 1Q8AA 1SM9A 4D6IA 4IFKA 3STPA 5HOSA 2WM1A 3ERPA 1XL9A 1ZP3A 4XB3A 3TJ4A 1SR0A 1VEPA 4PUJA 1T99A 3R7MA 2ZIDA 3VGBA 3KXQA 1J8VA 4UTTA 4B5XA 4OBRA 1OYBA 4QAWA 3QY7A 3WBYA 2VUYA 4EOUA 1AFSA 3CBWA 5EMLA 1SW7A 1YRRA 4Z2GA 2CLHA 5CCZA 4JQ3A 4LYPA 1ME8A 4IP4A 4MWAA 4Q8WA 2OVLA 4G1NA 4N6EA 4Q4SA 1T0OA 3IACA 2HNEA 4KWUA 4Z1CA 4Z17A 1E4LA 2BOGX 3WK1A 1JNEA 5M5DA 4JTEA 3BJTA 1R6WA 4ZENA 3RO6A 3SURA 3MJYA 1M7OA 5AY7A 4O19A 1VBRA 3SY8A 1B3YA 1F8IA 2XN2A 4CU7A 2C1HA 4IF2A 4IJCA 4M6QA 4V28A 1OF6A 4UZUA 3M0ZA 1W3KA 5AOUA 3PNUA 2A3AA 3LX9A 1WDPA 4W9TA 3K8KA 4JTKA 5HPOA 4KCWA 2R6OA 3PZUA 1IHIA 4I7VA 2FDMA 4GVFA 3TN4A 4CGTA 1JUKA 2IKHA 1H62A 1WUEA 4H9UA 1G4SA 1W32A 4IUGA 2J7EA 3DBPA 1MUCA 2VL4A 1RBAA 4JDYA 3R12A 4V33A 1WDWA 4DO7A 4I9JA 3UVIA 3UXKA 1H7RA 4MG4A 4TV5A 3W81A 4WKFA 3VOIA 1HKIA 1J0YA 2QHAA 1JCXA 4X22A 2F8QA 4YTTA 4JCLA 3MCOA 1N7KA 1DJXA 2VX5A 4JNYA 3C3UA 1QW8A 3DX5A 1NM9A 4URIA 2PRMA 4IBFA 5H8PA 1MSSA 4WEVX 2QVHA 1KRAC 4JBRA 1ISYA 2CKRA 3TQKA 3CWNA 2PSNA 4H8VA 1KRBC 1TV7A 1KM2A 1QWKA 4KBXA 2Z1WA 4H6QA 1UMLA 2G3NA 1D7KA 1H60A 3KHJA 3UG8A 3HPZA 2W92A 1S5WA 1UOZA 2ZUNA 1E4IA 1EYEA 3BAXA 2RDUA 3C0LA 1K77A 2EPOA 2RFGA 3IARA 1FHUA 3QTPA 3MQLA 3GTIA 4LB3A 3SADA 1ZFJA 3WMCA 5BXRA 3QR1A 4A8NA 1HO1A 3QC3A 4UQEA 3H22A 1MI3A 4Q22A 2EAWA 1IT0A 3KRZA 3GHUA 3WUGA 1C8VA 3R79A 3TTEA 2YYUA 5DBTA 3LS9A 1O1ZA 3DG7A 5CZSA 1W1YA 5DXYA 2J6XA 2C91A 5H8MA 1JR1A 1XSIA 3GBEA 3CHDA 4QCEA 1KM5A 4KGLA 1XI3A 4WF7A 1WA3A 5AYYA 1QBAA 6A3HA 3E49A 3VZXA 1KXVA 4LY8A 4Q8MA 4F0LA 1QO6A 3HTWA 3G6LA 3OLEA 3GTXA 2TPSA 4P7NA 2C13A 3OBAA 1FFQA 4QNEA 3R1ZA 4AB4A 4IPLA 4LS0A 3G22A 3C3NA 3ZMRA 1YBQB 4GJIA 5D37A 2DZUA 1Z8AA 4DNHA 1DHPA 4ERGA 3DC0A 2GUUA 5I3JA 3USBA 3UY8A 3SO7A 4REQA 3LXAA 4X0NA 5FF0A 1MDLA 4DO4A 4ENLA 1XD1A 3H54A 3UCDA 3NM3A 4MJ4A 3H2EA 2CYGA 3E2QA 3FJLA 1F6KA 1UPMB 4TUFA 1XCXA 1V6UA 2WJDA 1W3JA 3TLLA 4A8RA 4ZO9A 1O66A 3NEHA 1SPQA 4K7VA 2QPXA 2A3BA 2A0NA 4S23A 2NVCA 1J0JA 1FWBC 2OODA 1J93A 3PJTA 5A6MA 4FIRA 3THDA 1UQZA 4OVXA 4JKLA 1KM3A 3W7NA 4MVAA 5C7HA 2G96A 1JCJA 3CS2A 4C5YA 3M7PA 3GNXA 3WD1A 5BMXA 1A3WA 2O7SA 4D6JA 4QAIA 2VVNA 4P8VA 4IM4A 5AN7A 1RCOB 2WSKA 3NQCA 2NV2A 4O1EA 5BXSA 1L0PA 2EXOA 2XFYA 4HU0A 4LCQA 3EA3A 3PWGA 3E1F1 3UNTA 1ICPA 4UCFA 1H1NA 1ZCOA 3KDNA 3PG9A 3DEQA 1W54A 1O5KA 1UZHA 5JQ9A 1K70A 4KF1A 1XIJA 5D04C 1E51A 4GXPA 4Z0SA 1OX4A 3QQWA 3LQGA 4IFKB 3AIVA 4U2ZA 3A6OA 3LK6A 1VYRA 2CHNA 3SGZA 2VP8A 3SCQA 2VYOA 1PZ0A 1GPFA 2ACSA 5SWUA 3L26A 3KZSA 6CGTA 1SYTA 2UY5A 4IMDA 4S38A 3U48A 3TTYA 1OT2A 1M65A 4S3JA 3PS7A 3EWDA 1MUMA 3IK4A 1HP4A 1G0CA 3AFBA 4K2SA 1R3TA 1ZP4A 4M82A 3PZOA 4JL2A 1QXLA 2AKMA 2SFPA 2J6VA 3GC5A 3DIPA 1NDWA 1CXEA 4PUUA 2V5LA 3V5FA 1YXDA 1LF1A 4KGJA 3N9SA 2OTDA 3GM8A 3W6MA 4KH2A 4CU8A 1P0EA 3DXIA 3TSBA 1CPUA 4XBSA 2YDQA 1W3NA 3ABRA 3ARXA 3PSVA 1KFBA 3C0QA 3G1AA 4XK2A 3N34A 5IHRA 1OSEA 3N14A 1OIMA 1OYCA 4J3VA 3NPUA 4DBDA 4W7VA 1UR4A 2ACUA 4G1KA 2PEVA 1SMAA 2VT0A 1OX6A 4GRSA 2XPKA 1A4MA 1PAMA 2EPNA 4ZE5A 5CPQA 1HGWA 3OHMB 3W7KA 2O4QA 1HGYA 2CITA 5GQBA 3VCCA 3LOTA 2X16A 2YCJA 4F0KA 3LSCA 2CLEA 4DIAA 1OFAA 4QX4A 4NX0A 4AZCA 3ABQA 1YPXA 3NQGA 1C9DA 4XAPA 3WLIA 1F74A 4N02A 2WMHA 2PAJA 3C0SA 3VGFA 1IT7A 3REQB 4N7QA 3P0WA 1XIDA 3BG9A 4YYFA 3AICA 4JFVA 3OVQA 1AH0A 4RXGA 2QIWA 2GOUA 4Q8VA 1YXYA 3QV6A 1KB3A 2CLFA 5HA7A 4PUWA 2WV8A 1FH7A 1IZJA 3L65A 2E6DA 2BY2A 2FPYA 4CNUA 2OGYA 2XG9A 4EWND 1TELA 4AU0A 2P50A 4DYJA 4LRSA 5C9UA 1S1RA 2QMKA 5CPSA 3AC0A 1K9TA 4NZJA 3GHTA 4HA0A 3TN5A 1OFBA 2V3EA 2QLYA 4HYVA 4JXCA 4UB9A 4JIHA 1C8QA 5JMUA 4H9YA 5F7UA 3VGHA 1FHLA 4DZ5A 3LXCA 3GR4A 4FAMA 4CEXC 4YYCA 1BF2A 4DXVA 4H7VA 1TV8A 2NUXA 3S9IA 3GNPA 3WNPA 3CUZA 1QMLA 4ILSA 4KS0A 2OT0A 3RUBL 2DEPA 4P7RA 5C2CA 3LM7A 1DWGM 3QV9A 4H19A 4J35A 4ZB2A 1DE6A 2BXZA 4IJRA 4NAEB 4DF1A 3A21A 4HNOA 1MFVA 1O1HA 1CGTA 3MQTA 2Y6ZA 3BLEA 3VABA 3W1UA 4E8DA 3S4TA 1NWUA 3QJAA 4KEMA 3KBMA 1D7FA 1YYAA 3UXAA 3LLFA 2JIEA 3LHYA 4LUIA 1VRXA 1UWIA 3BLFA 2PURA 3RPTA 3UWQA 4GKLA 5FJJA 4W8LA 5I06A 4Z0JA 3MMWA 3UYIA 2VR2A 5G4HC 3WLJA 1JDEA 4ZXLA 2Z6IA 4GGBA 2QV4A 1RAKA 2PDKA 4AQLA 4QTGA 1UWTA 4JEJA 3GW3A 1HJSA 2XVLA 3T08A 1CNVA 1JPMA 1DYSA 3V4BA 3LNMA 4GI8A 4HPXA 2XISA 3MV11 5GNXA 4D6FA 1FWWA 1ZPTA 2CZ5A 3ID7A 1QCWA 4Q8NA 1VFMA 2WMKA 4LVBA 1BVNP 3APYA 2Y1HA 1KR1A 2YZRA 3GAYA 3UYCA 1J6OA 1SO6A 4AEEA 4S3KA 4GABA 3B9NA 2FVLA 1CI1A 4EACA 1XLBA 2OR2A 3ZVHA 2OT1A 3AIBA 3HU7A 4PL2A 1DJNA 3FY1A 1Q5MA 3OB8A 3FSUA 4L9XA 3S2CA 4MLRA 1XYMA 2WVSA 1FTXA 3HMCA 5C9WA 3AXMA 4RW5A 2DH2A 2V2CA 3DAQA 3HG4A 5A8QA 4MNMA 3M0JA 4DAIA 3S1WA 1J0ZA 5EPDA 3IK2A 3URNA 2WHKA 1LBLA 3GE7A 2JE8A 1LRTA 2GSEA 2CZDA 5LIKX 4C6IA 3TJIA 3DERA 2C79A 3HPXA 4GVGA