4NYYA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 2 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
405
structure length
405
Chain Sequence
b'TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 145
structure length 405
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyyA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyyA01
3QBUA 3VUSA 4F9DA 1NY1A 2C1IA 2CC0A 2I5IA 4HD5A 2QV5A 1W1A1 4U10A 2NLYA 2Y8UA 3WX7A 1W1B1 5BU6A 1V6TA 3CL6A 4NYYA 3CL8A 3S6OA 4LY4A 3CL7A 5JMUA 2IW0A 2C1GA 4NY2A 2J13A 4NYUA 4F9JA 1XW8A 2C71A 3HFTA 3RXZA 4OUIA 4NZ4A 1W17A 4L1GA 4NZ1A 4V33A 2E67A 4WCJA 2W3ZA 2C79A 2VYOA 2XU2A 1Z7AA 4NZ3A 2DFAA 4NZ5A 4M1BA
chains in the Genus database with same CATH superfamily
4HB7A 3GXFA 3RF9A 3AMCA 4NAEB 3G0UA 1M04A 3O1NA 4GYPC 3WBYA 1NOWA 1TELA 5GQBA 3KAOA 3D5HA 7TAAA 3R1ZA 1G9HA 1WZKA 3BOXA 3G22A 3MBDA 4Z1BA 2MANA 1LG2A 3B0XA 4OJ5A 2PZNA 4IWWA 3FFSA 1GG0A 4K2SA 1XYZA 4GOAA 4V1YA 5A6SA 1A49A 2HVMA 1H7WA 2QDGA 3WQ6A 4XD5A 1M9HA 3N13A 4ZFMA 3PUOA 1XLFA 1Z7AA 2GGIA 5TAOA 3UJFA 1WO2A 2DV0A 4QHRA 5D05A 1ADDA 4BQ2A 4ZE4A 5XINA 1RK6A 2CZ5A 2XGIA 4LAOA 1XYLA 4WQ6A 5JBEA 1KRBC 3SGGA 1DJYA 4ZQPA 3W6LA 4Z2HA 4WDWA 2XD5A 3W7DA 5CAHA 1G01A 1YKWA 2Z1XA 2F61A 2VRQA 1Q6DA 1UZ1A 4JIPA 3VFLA 4PUEA 2BVDA 3W82A 4NX0A 3S1WA 2A21A 4JTRA 1RP8A 3ZS4A 4Q8UA 1B2YA 3KZPA 1TE1A 3OW1A 4FLOA 1LWHA 3ITOA 3ABSA 1EHAA 1W5OA 1LLOA 1U5HA 1K7EA 3UXLA 2CLOA 5KZDA 3W4RA 4O18A 4DX3A 1DWFM 4Q6XA 3LXCA 5LIWX 3GO2A 3QKEA 1KXVA 2XSXA 2Y6ZA 1GK8A 2I16A 3V16A 1NU5A 1SYTA 4B15A 3W2LA 3P7YA 5I07A 3UP8A 3PJUA 3AIRA 2PDHA 2HE5A 4WXYA 2P0OA 3GXMA 4HZ8A 1CCWB 3VGFA 1LROA 3WNPA 1UJPA 4PCFA 5SWUA 2R14A 1UWRA 3F2DA 4GUIA 3MI6A 2OYKA 1G4SA 4ACYA 3GSMA 2DH3A 3NO3A 4L9ZA 2OODA 3S8HA 2ZZ6A 4JICA 1A5AA 5ABTA 1GG1A 1W2VA 5CPSA 3GG8A 3VIHA 1REQA 3QKZA 4PH6A 3DHFA 1NDVA 2NX1A 2PTXA 2A6LA 4ZODA 3GFXA 2OELA 1LLWA 5BRBA 4UMCA 5JBDA 3MKVA 1XJBA 3USBA 1V7YA 3IIOA 2ZIDA 3IVUA 2NLYA 4N42A 3GIPA 4Q8VA 5EPDA 4TMBA 3ES7A 4QIUA 5IFPA 5HQEA 2IKHA 4K7VA 1V3JA 1KWKA 1U83A 3KL0A 6TIMA 3THUA 3TDFA 1R85A 3GTXA 4BR1A 2XZ9A 1ZRQA 5CG0A 1W3JA 3RHGA 3KBWA 3N3MA 2RHGA 3T07A 5A95A 3RM8A 4UTFA 8XIAA 2ZE3A 5DELA 3LUTA 3R94A 2YCLA 5I24A 1EEXA 1FWNA 2FVMA 5J8LA 2WLZA 3GTNA 4JL2A 2PGWA 5FJPA 1UQZA 3M5XA 3DENA 5MKGA 4ZEPA 1UQYA 4L4MA 2F38A 4JEQA 2CLMA 2I57A 2B31A 1V6XA 4BEQA 3TYCA 3UGRA 2GSEA 4LCQA 1B54A 2Y2GA 5FEWA 1LBFA 1XFBA 4ZXLA 4AZ7A 3PSVA 4RXFA 4IP7A 3R12A 5G4WA 3V5CA 4CCZA 1BWLA 4MNJA 3GXIA 1KR0A 1PTGA 3VVGA 3HB9A 2VGIA 4B5WA 2EQDA 3BC9A 3EX4A 1ICQA 3SCNA 2GGJA 4BF5A 3FHAA 4UFLA 4BI6A 4HP5A 1ZGDA 3OB8A 4NZCA 2V30A 1FWTA 3CYVA 1YRRA 3CIWA 3GNDA 1W32A 3HTWA 1PV8A 1A0EA 3EZ4A 4GBDA 3UU0A 4FNTA 1EJWC 4S3EA 2UY5A 5G1YA 3G0XA 3Q45A 4HYRA 1OVDA 3L66A 5JIWA 4X0NA 3DFNA 4AIBA 3PB2A 3NNTA 4XKYB 3KM8A 4ICCX 4UMAA 3L5LA 4GIAA 1E0UA 3N04A 3UZJA 3A21A 1P1MA 3QPEA 3L26A 4DF2A 4P7LA 2VX6A 3FA4A 4H9MA 5JBFA 3LHZA 2FHFA 1Q2RA 1IT0A 1RCOB 4L9XA 1CDGA 4XWUA 3TFXA 5CKSA 3WMLA 1XLAA 4WEVX 2BVYA 1US0A 5KZMA 1MUCA 1Q4WA 1FQ0A 4E3TA 2CWNA 3HPAA 4LY8A 3TN6A 4FSAA 4IG2B 3SRFA 3EWDA 4XX6A 2Z2UA 1XF0A 4EPDC 2PZ0A 1TX0A 4K36A 3EX2A 2WVTA 1Z8AA 5T26A 3CEUA 3GNXA 1RV8A 4A4AA 4C6IA 1KKRA 3CU2A 2JEPA 5DEZA 1JCLA 5CSUA 1RR2A 1HO1A 1UPPA 4AISA 1P0BA 2CBJA 3KRBA 1YU3A 3ZT6A 3QW3A 3EWCA 3SCUA 4AD3A 3KBNA 1GOWA 1I2OA 5CXPA 4A21A 3AYRA 4JN8A 4Y9NA 5LA0A 4UQAA 5EBAA 1YU1A 3QHMA 2A3CA 2Z1WA 3WD0A 3PSWA 3NQEA 2J88A 1AW1A 3U4FA 3MMWA 4H9UA 3XISA 3TN3A 1CXHA 4LUTB 3H4GA 1BD0A 1LT7A 1I75A 5AVNA 2EF9A 4IQJA 1O95A 4LRTA 3ERPA 1JYNA 1FH7A 4U2YA 4XV0A 3EKLA 1C7TA 3E49A 3RK8A 3GLCA 4DJEC 2DH2A 4LGXA 3H4XA 5BRPA 3LDVA 1MNZA 3WLKX 1YLVA 2OLHA 3ZT7A 2RKXA 3QZ6A 4MB1A 4E8DA 2WV8A 1SW0A 1RLCL 4MJ4A 5GPRA 1JZ7A 4LJ3A 1FWBC 1WDRA 1IEQA 3C2OA 2DGAA 1ZU8A 5G5IA 3W27A 3ZOAA 2UBPC 3VIMA 3ENLA 3UNTA 1YX1A 1E6PA 1O12A 3N4AA 1SFTA 3TTOA 2ACUA 5EMMA 5L6UA 3CWHA 1SSDA 1GZ1A 2ZDSA 1VH7A 4TUFA 2QUUA 1R9YA 1EYWA 4NX5A 5D9OA 1YNPA 5FEZA 1Q13A 1TPEA 1RY0A 4Q4MA 4HSNA 1XM3A 2BBFA 5C9UA 1FCVA 2NSXA 4K38A 3TC7A 1MDLA 3KRZA 1POJA 4REQA 5KTLA 3GHRA 3WDRA 1W3KA 1HO4A 3KZSA 3MY9A 2CKRA 2YCKX 3CL6A 2VT0A 4DVOA 1L6SA 2E25A 1OF6A 3MS8A 2ZRYA 5G2WA 4LU0A 4FX8A 2YIHA 1HN1A 2D2GA 4ZGYA 1QMLA 4MDOA 4NUWA 4NF7A 3ABQA 2V38A 3WLPA 4NKCA 1HJSA 1XGZA 1Q5MA 1DL3A 3LPOA 2A4AA 3KX6A 3VIKA 4ACZA 1EJRC 3DFOA 1TX2A 1VR6A 3WZ0E 1J5SA 2CETA 4JNZA 2AAMA 2ZA1A 2WZMA 1TIMA 1HKWA 3PZMA 3MPGA 5CZKA 5HOSA 1W1A1 1KM4A 4A22A 1Q6OA 3UYIA 4MPKA 2E0PA 1PBGA 5EMKA 3FN9A 1H61A 3TN5A 3GXNA 1GT8A 5T91A 1XUZA 3ZJ8A 1MEHA 2MUCA 3BCJA 3GUWA 4GCAA 2OXNA 3A3HA 1XGEA 4GI6A 3AI0A 1P1XA 4O14A 1O5KA 1YYAA 3SUWA 1HW6A 3CAVA 2VP8A 1B31A 3RO6A 3IIXA 4JN7A 2VGFA 4QQ3A 2ZTKA 4MKNA 3R0DA 4GIYA 3BAYA 2EG8A 4LOCA 5CBBA 1TV7A 1JDEA 5BYWA 1WOAA 3STGA 2ZBTA 4CD4A 3VNZA 5FEPA 4HA4A 2YBVA 2YFOA 3PN8A 2PRLA 1BTMA 2MNRA 3W88A 3APYA 3PZGA 3XIMA 2QS8A 1QW9A 1WKDA 1CGYA 4Q8MA 1TTPA 4LUIA 1UASA 1CZ1A 3ZT5A 5K9XA 2CC0A 1CB2A 2QXWA 1J6OA 4XAFA 5G1TA 4UFHA 3W24A 5A8MA 3V5OA 2FKPA 2Z26A 3M0VA 1Q2SA 3QMRA 3RUBL 4AD0A 2ANUA 3QEZA 2JQXA 3H70A 1VEMA 2X42A 1N8IA 1Q6FA 3HBLA 3G1XA 5HWNA 1K02A 1S2VA 3FA3A 4FXRA 1NOUA 4IJBA 4A2RA 4DJFC 4IQLA 3AZTA 4WRHA 4Z0JA 1MEIA 3I4EA 1R3VA 5ENLA 1H7PA 3IGSA 2WZHA 3T42A 5BU9A 3ZVHB 3IJIA 2WMFA 1DWJM 3I3BA 5BPVA 2I5QA 1F4AA 4UR8A 4Y96A 4MM1A 3G18A 2Y8UA 3FJNA 4O52A 2QDEA 3ARTA 4R9OA 3TV8A 4EE9A 1VFFA 1GVIA 1E9LA 1R3SA 1FWCC 1S5MA 4KFOA 2Y7DA 3P93A 4ZB2A 1VJIA 1DPMA 1K7FA 5GNYA 3ANUA 1K6WA 3OLEA 4NNBA 1RD5A 4F2BA 4GXMA 1JZ8A 2PP0A 2D0FA 5HMSA 5KINA 3P61A 1TJ0A 2OGYA 4M6PA 3UY8A 3HQOA 1O5RA 2GQ8A 3R58A 1JR1A 3BOLA 5A2CA 4PL1A 3RITA 2YJQA 4JL1A 3A4WA 2QNEA 1PWLA 4DHGA 2YZRA 7A3HA 1VBRA 1BVZA 1JYWA 3PZ9A 2ZUWA 3ABRA 2EPNA 2RDUA 1GQNA 3D6NA 3I6EA 3O8AA 3OEXA 3L12A 1OK4A 3WQEA 3CUFA 5DY3A 3AS1A 1B3WA 1UD4A 4GIEA 4L4PA 4EVZA 4X0VA 1WKEA 1RAKA 1QCWA 4LUSA 4PSPA 4G1NA 1GONA 3OLGA 3WJZA 1K3UA 3CTLA 3B8UA 5I3KA 3VGBA 4ZQMA 4B9ZA 5BOEA 4XO6A 2WAGA 2EJ1A 1VLIA 4F0KA 6REQA 4LS0A 3O2LA 4US5D 1IR1A 3K30A 2VEMA 3SI9A 1U1HA 3S1UA 3WLIA 3B8DA 2ZUVA 2XIIA 3GNNA 3VE7A 4MZ1A 4DXXA 4KKXA 1EL3A 2A79A 1GTHA 1E40A 1GYNA 1ISWA 1ELSA 2IXVA 3L0NA 2XSAA 4BQ3A 4FOJA 2Y2OA 5LA2A 3L4VA 4UNIA 4GUJA 2OZ3A 2DUAA 3U6WA 1JCMP 2TPSA 3E0WA 4ZO7A 5DY2A 2E6DA 5A6TC 1GZGA 4CEXC 2AAAA 1J0YA 3LEPA 2A3LA 4J4KA 2WHLA 2FFIA 1SJBA 3WQFA 1TG7A 1A5MC 3T2OA 2YB1A 1I1XA 5CPNA 2PGEA 2JIWA 3A64A 4PFMA 1YTEA 3O07A 3WBXA 4PE8A 1WQ5A 5F1UA 1VIWA 1EPXA 4DRSA 4WUIA 1DBTA 4JQ2A 1PB0A 4Z2GA 3SY5A 3UG4A 1G69A 3COTA 1QTWA 3KWXA 2A3HA 4P7RA 1OIFA 3WEMA 3M0IA 3CMJA 2PDYA 1LWJA 4MADA 3NQMA 3ARWA 1DOSA 4MFDA 4RNFA 1Y8BA 3I65A 3GIYA 4XKYA 3N73A 3A5FA 3DYMA 4C1LA 3HJZA 3Q94A 4XKMA 5C7VA 2A3AA 3CPGA 4PB3A 2J9ZA 4C6LA 1XYAA 1FOBA 3GK0A 3SW6A 5IRPA 1OJXA 4HNLA 4IBDA 4LC6A 4PMVA 4V15A 5HPOA 2W91A 3U5UA 4K1WA 1EJ7L 4M8UA 4F66A 4AVFA 4JIHA 4TXEA 4MNKA 3DU0A 4KCWA 4Q8OA 4HGXA 2QIWA 2E6YA 2BASA 2XVNA 5A69A 3QOKA 1UBSA 3EB4A 4CQDA 4H9YA 2QEZA 3U5YA 2ZUTA 1E9ZB 4LUJA 4G2DA 1XLGA 2JKPA 2Y7EA 3WH8A 6PTDA 3WQPA 2QCEA 4LSBA 4IG2A 4DI9A 1OK6A 1Q66A 4B90A 5CBJA 4N7QA 1EA9C 1P48A 1F6PA 4N6FA 5HJLA 3L29A 1UR1A 1YNQA 1XPYA 3V0TA 2FMNA 1PJ9A 3DG6A 4D8ZA 5EL1A 3M7SA 2JE5A 3M0KA 4S3FA 1B3OA 3WL1A 2NV1A 3H24A 2XFYA 5I2UA 3TCEA 1CECA 2WSYA 1IWPA 2OT1A 2YCEA 1GKRA 3U48A 3OIHA 4IJCA 1M7XA 4EWND 3HZ3A 3B3DA 3U2OA 4DUXA 5A5WA 1M6JA 3VCCA 1ZCCA 2BXZA 1ZAIA 4UWMA 1XC4A 1NVMA 4JHOA 3OQ8A 1GQLA 3NVDA 4S1FA 4JFVA 3PANA 1V4YA 1TR1A 5C2GA 2CLPA 3NSXA 1JI1A 1TSIA 3MDWA 4GZ7A 5EFFA 4MWAB 2VOMA 3JW7A 3AZRA 2DZUA 3GNPA 4GZIA 3S5OA 3ZVIA 1PZ0A 1CW2A 5C8BB 3VX1A 2OSXA 5U7SA 4FR1A 1E6NA 1RA5A 5K2ZA 3ZXWA 1US2A 1H50A 1VCGA 3MP5A 4UTUA 2GJXB 2G97A 4O1DA 3S9IA 3S2JA 3E2SA 3JS3A 3BLIA 2YFNA 4GABA 1EHNA 4AQLA 4WCJA 1XCWA 3NQFA 2Z6JA 1BF2A 1KFJA 3SN0A 3FJLA 5TIMA 3H2EA 3AQUA 1G7VA 3H55A 1SZFA 1EX5A 2DZSA 4FP1A 3U8GA 1YDNA 4F2UA 1DXEA 3IK4A 2DSWA 3UWUA 2PU1A 4L56A 4YVVA 3YPIA 4E8CA 3EDJA 4H8HA 1DXIA 1S5WA 1LWIA 3I3EA 3MZNA 4A3HA 3APGA 1LDCA 1V3KA 4QE5A 4E2OA 2SFPA 2QPSA 2QJJA 3SN1A 4DNMA 3B03A 1TWWA 5JH1A 4F0HA 1OZQA 2WVUA 1PSCA 1V0KA 3NM1A 2OYMA 1PX8A 3W37A 5BXRA 2QMKA 1E1CB 3UEQA 4GQBA 5DMNA 1GGOA 1SFSA 3PNZA 5CGQA 2G3MA 1M7OA 1KM1A 5BZAA 2ZYFA 1EO5A 4GHAA 3QN3A 1H11A 2GYIA 4N4QA 3KS4A 3MHGA 1XD1A 4HNVA 4B3LA 2HTMA 4RDWA 4XIAA 3T0BA 2QV5A 4US6A 1JDFA 4M80A 2XTKA 5A3HA 2E09A 3DGBA 3NQBA 4F40A 1FP8A 2F6UA 3TUUA 4HYVA 4G6CA 4HCLA 1DJNA 4ZE5A 4AY8A 3BW4A 3KWSA 4WDTA 4ADSA 1AFSA 3KRSA 4A3QA 4I90A 2R1PA 1DJIA 3BGGA 4KW2A 4RK8A 3W7IA 4FB7A 4PR4A 1E0TA 3FKKA 5BOOA 4RNIA 4UBPC 2AGKA 3AC0A 1IZJA 1GVOA 2ZZ1A 2PP1A 1CTNA 3W7PA 4D6EA 4ZOAA 2ZXAA 2QCNA 3WDIA 4OECA 1JF5A 3SUTA 1AJZA 3TU9A 1UBPC 3U2ZA 4ZMGA 1XINA 2ZICA 4PSRA 4RZ4A 1E6QM 4TQTA 3EX3A 3MB9A 3QLLA 4HK7A 1BLIA 3IGHX 3ID7A 1V6TA 2FJUB 1XLJA 3BMVA 4JY8A 2L5HA 4UOJA 3UXIA 1GNXA 3DEQA 2Q01A 3WG6A 4RPPA 1PYMA 4UFMA 1KXTA 3MHUA 4BJHA 4RNJA 1N55A 4ZSUA 4QROA 1GPFA 2X7WA 2O4MA 2QF7A 2E4TA 3RRXA 2XJ7A 4GISA 5DX7A 2VO5A 4UR7A 2D49A 2UV8G 1TUXA 3GU9A 4S3DA 3AAMA 4C5YA 1QHZA 2IPGA 1FWGC 1W1TA 3AOFA 2Y5EA 1POKA 4U31A 4NSBA 1SO4A 4IQEA 1H49A 4HU3A 3ZVHA 3V4BA 3R8HA 3L25A 5DMYA 1H09A 5MF5A 4KT2A 4PFHA 4TX9A 3WBWA 4B3KA 3Q2DA 1PTAA 2FH6A 4UTMA 1W3HA 4M56A 4Q7BA 3W1UA 4WOQA 1C9WA 3N4EA 3WH5A 1AH4A 4W93A 5I3JA 3W26A 2IS7A 1Q6QA 4J5NA 4HN8A 2XM1A 4TR9A 4RE4A 1QATA 2R6OA 4FLSA 1OSEA 2FGZA 1A4LA 4V28A 3VMNA 3FCPA 1LBLA 2QCMA 4GVFA 1PIGA 2VEFA 4H6QA 1VP5A 1T99A 3A13A 3L7RA 3VNDA 2AQWA 2QPUA 1IEXA 1C29A 3NFUA 3TX9A 4MYAA 3R6IA 2VDGA 5F2IA 2BGQA 2P50A 4O0ZA 1GCYA 3LHTA 2QPXA 4Y9PA 1DJWA 4YTSA 1RALA 4GHLA 4AVOA 1PWMA 2WSPA 4P2VA 3N6HA 4X60A 4IFOA 3P62A 3TTYA 3L68A 3M0MA 4WR3A 1VRXA 4LB4A 3BICA 1QRQA 3CHDA 3R8RA 3H6OA 2BOGX 3IEBA 1EUNA 3NO1A 4WF7A 1F61A 2UY4A 4Z2IA 3FEMA 5ECUA 1CLKA 2DSVA 1PAMA 3WK2A 3VOFA 3KCLA 1NSJA 3ANYA 9CGTA 1SO5A 2OWCA 1VFSA 1SM9A 3LX9A 2OQYA 3RILA 1OCQA 3UCQA 4X9SA 4ZA0A 4PUUA 1KA9F 4YXGA 1J93A 3HGOA 4KMQA 4F3HA 4S3AA 1Z42A 3UYCA 3FJ6A 3VKBA 1XQLA 2ZX7A 4H01A 4J40A 1ZP3A 3NPVA 3DFQA 4LVDA 4V2XA 3A4AA 3WD2A 2GVLA 1XIHA 5D30A 9XIAA 1W3IA 1QVBA 3BW2A 1UIPA 3PG9A 2PURA 3EWBX 4QJ1A 1QWGA 4S3CA 1O68A 1ZPTA 1AD1A 1FWJC 4BI7A 3EDKA 4E2DA 3N15A 3IUHA 1DJGA 3WF3A 4A3UA 2R1MA 3DZ1A 4IIHA 4Z08A 5GJPA 3ZLFA 3LCFA 1R3WA 3E2RA 5DCBA 3R43A 3KBJA 3DYOA 2X1IA 1GVFA 4XZNX 1RJQA 1B57A 5LGXA 1Z69A 1SR9A 2GGGA 3QJAA 5E9AA 4HPJA 3GBEA 1XH1A 1KO0A 3WF4A 1U1JA 4XTIA 4EP8C 1H7XA 4GPNA 3W07A 1XS2A 5K9DA 4DWDA 3UJ2A 4CCCA 4IM4A 2RJHA 1ZL1A 2NT0A 3TW6A 5E0CA 4L64A 2XVPA 5A8OA 3DHUA 2AQVA 1IGWA 4EIVA 2E5BA 4HBKA 1VFLA 5DRIA 2HMCA 5BWAA 4MUZA 2DFAA 1H51A 2FLIA 1EP3A 2HWGA 3JVAA 1VC4A 2CFFA 3G1RA 1U5JA 2OX4A 3MW7A 3GNOA 4JIQA 5A6BA 1BFNA 3F4NA 3ITGA 2QJMA 1FRBA 1MRQA 2VFHA 5T9BG 2CLIA 3W0KA 3TLLA 2Y7FA 1EP2A 3M0XA 3W75A 3BURA 3WUEA 2VL4A 2V81A 1Y7VA 3CHVA 3OODA 5AN7A 3GC2A 1DJXA 3GVRA 3NDZA 3ALFA 4F0SA 3STCA 1FHDA 4RNHA 1OFAA 1TRDA 3S1VA 4H1ZA 5I3GA 1UUOA 3I6RA 4PC8A 1UC5A 1U5VA 4MWAA 3EPOA 3EWYA 4AYSA 4IJFA 4W88A 4H4IA 3KDOA 4KRTA 4CQ9A 2X05A 3S83A 3W71A 5AC8A 1DQWA 3TYZA 2TSYA 2QZRA 2EHHA 3BLPX 3GW0A 2WM1A 3E0VA 5LYRA 2FB3A 2OB3A 3TQPA 1CGVA 2G37A 1FY6A 1OFEA 1FWIC 1BYBA 4QR6A 2GJXA 3QSRA 4IP4A 3TJIA 1ECEA 1VEOA 5EY5A 4KRZA 1OY0A 2PLCA 3DC8A 1THFD 5C54A 1JGIA 2AL2B 1PZ1A 4QCEA 1OFPA 3KVJA 5C2XA 1H1YA 4PODA 2J4GA 1HXJA 5B80A 4IFKB 1K8CA 3OVRA 3WJSA 1TWIA 5CGTA 4I5RA 3C2EA 4C7DA 1W3LA 5HUPA 1Q8JA 2BWGA 3VKAA 2EAWA 1EGVA 5D02A 1UH3A 3CLWA 2DZPA 3PAOA 3M5YA 2NWSA 3WLSA 4RDYA 2BODX 3NEVA 5H8UA 2NSOA 1W1ZA 4FIRA 4IPNB 2RDXA 2E40A 4ES4A 1E1CA 1A4MA 4JIEA 3O6YX 2A5HA 4CVWA 1E6XM 1TJRA 5GNXA 3WUGA 2X7VA 3QSTA 3AUOA 3W28A 4LG2A 3QPZA 1TUFA 1BVNP 2CHNA 3CHEA 3II1A 3QTPA 3HQPA 3EYPA 3TR2A 5CZ0A 4J3ZA 1VPXA 1O4UA 3WNKA 1LQ0A 1F2JA 1OQFA 4KS0A 1D2KA 1RSCA 1VYRA 1GPWA 1SZRA 1WKYA 1RCQA 1SGJA 4Q8NA 3LY0A 4QDMA 1PCKA 3GYEA 2FYMA 1RA0A 3QW4B 1UD2A 2CZEA 2DJLA 4C6EA 2D22A 3HPZA 4X22A 2X2GA 2FDMA 4BF7A 3R7MA 4XZWA 5CG7A 5L9FA 1D3GA 1FH9A 2FJKA 4IBBA 2V3EA 1V6YA 4HT3A 2RDTA 4Z17A 2KZHA 4QM1A 3N2MA 2HSAA 3ZJ7A 3AUJA 1GOMA 2FTPA 4J7RA 5TD4A 3W1XA 4PTXA 1WPCA 1KQZA 3F5LA 4HZMA 2HNHA 4GX9A 1T6MA 4WVXA 1X6LA 3IGXA 4HOXA 4GZJA 4OU1A 5REQB 4TX6A 1WZAA 1R7OA 3QOMA 3VZXA 4C6PA 1YIXA 1EWDA 2WK2A 3SCVA 1DIDA 1K9FA 2PDUA 3N19B 1R3QA 5F2GA 4DBDA 9XIMA 1CPUA 4H6KA 3UR5A 2DZBA 1UB3A 3BZGA 3TA9A 1I0DA 1WZMA 2VCAA 3QR3A 3EMQA 2CHOA 5E09A 3W3OA 1TPFA 4XBKA 4DJED 2OSWA 1CWYA 4FLRA 3S5YA 4RX0A 1VKFA 4K6AA 3G1YA 2PDIA 3F7JA 3W7JA 4GRSA 2RJGA 3B9OA 1MYRA 1QNOA 3VUSA 2F6XA 2GJNA 2PDLA 3C0SA 3QY6A 4CD6A 1Z41A 5AVHA 1ISXA 1NM9A 3M6DA 4B5XA 1EGZA 1NFPA 2VGGA 3TAKA 1ZALA 2PC8A 3D3AA 1N8FA 3CPRA 4IX2A 5CPQA 1D3CA 3L4UA 1V02A 1ZJIA 1IV8A 4FK9A 2GUYA 2WBGA 1YU0A 1GKQA 3NO5A 4U4MA 4AUBA 3U2EA 2DDXA 4L1WA 4HPXA 4B2DA 1CNVA 3TVAA 3QY8A 4PUMA 5DQPA 4NILA 3W25A 4HTBA 4Z2KA 2HDJA 1AODA 3LYEA 4HMCA 3PF3A 1CXFA 1CBGA 2XYLA 1I4NA 3MUAA 3OZPA 5CC3A 2Q8LA 3QM3A 3LLDA 2G4FA 1MWOA 3WD1A 4NZ4A 2C6QA 1P6BA 2VI0A 4D1IA 3S1GA 5HANA 3WD4A 3HG3A 4D8AA 3V0UA 2CZDA 4K39A 1P0NA 2HVNA 3VKDA 2ATSA 4FAMA 1J4EA 3NL2A 3N2CA 2EPHA 1WXYA 3FW6A 4MGGA 4MLRA 3EOUA 3WK3A 1MQPA 4HZ6A 1OABA 3CZEA 2IPWA 4JYEA 4BKNA 1JZ2A 4HJWA 1GW9A 4XD6A 1ONEA 4EPBC 1JAEA 2ZUSA 3LQGA 2OLSA 1YTDA 3ZMRA 3HSHA 1ENUA 3GTHA 3H2CA 3QMTA 5F1VA 3GR8A 2IUZA 3PPGA 1R3TA 2Z1SA 3CB3A 3LK6A 3CMGA 3NR0A 1SVDA 4Y7EA 1L6YA 3DHDA 5J04A 2EO7A 1CK7A 2A1YA 1KTBA 3ZFHA 1KBBA 1CEOA 1QOQA 1JD7A 3AS2A 4U5IA 5CBIA 5MHBA 4E3VA 2VD8A 3NQCA 3VCRA 4XZHA 2FTYA 3VOCA 2G95A 4GWEA 1S5TA 2OLAA 1L8PA 1MDRA 1XSKA 5D33A 4Q8PA 2EPMX 3QHNA 3IJ7A 2Y70A 2ONEA 1IXPA 1ZQ5A 3SCRA 1SQ7A 4GACA 1LCOA 1XUUA 5FOOA 1E71M 4R9XA 2Z6IA 4UCFA 1DJQA 2XIJA 3DAQA 2OJPA 1TZ7A 3QR1A 1UHVA 3VIJA 4LV9A 4O1CA 3IRDA 1GHRA 3LA4A 4OOUA 1B3YA 1AQFA 4GFSA 4FLQA 3MCOA 3K2GA 2ZWZA 4YTRA 4Q8WA 3SQSA 3HF3A 4DJFD 2FB2A 1FHLA 3PJXA 4JTQA 4EWJA 4ZOBA 4NZ5A 2E8ZA 4WKFA 3HGJA 5CPLA 4OZOA 2JCHA 1MSSA 4I6KA 3MZ2A 3F4WA 3W00A 2YDAA 3C4UA 4HHHA 2YOCA 4O1EA 1AH0A 1S2AA 2NQ9A 5FF0A 1P6CA 3KHJA 3OZMA 2PE4A 1OGBA 2LLEA 2V3GA 4HTYA 1GVEA 3HV8A 1XH0A 1ITUA 4NXSA 3W1NA 4LYKA 2XN0A 3EAUA 2PTDA 4KCUA 2YSWA 5IHSA 4HKPA 3ZR6A 2QR6A 1NP2A 3KE0A 1X8CA 3VTRA 1IZKA 2DORA 2Y2WA 3GG7A 3VC5A 2RUSA 3CL8A 2DY3A 2INEA 1W54A 3RAOA 4JX6A 4RR4A 3AICA 1WDWA 3W9ZA 2Y2LA 3MQLA 3AWNA 1NDZA 1J0IA 2J77A 1KCLA 4XZIA 4M7SA 3P84A 3N9RA 3NL5A 2VWSA 1QWKA 4I9MA 4TVUA 3W1TA 1KM2A 1TPB1 4D72A 3WQ8A 2Z2BA 3WEOA 1RUSA 4HNNA 4P7QA 5CLWA 4GQ0A 1PIFA 1IIHA 5CCZA 4HA0A 4AY7A 3AXMA 3G1HA 1PL9A 3BAKA 4S38A 4DWSA 1JEZA 3EX6A 1KXHA 1XICA 1Q6GA 3CS2A 3MV11 1NARA 3P82A 3SECA 3RR1A 5HMFA 1EBHA 2VNCA 1B90A 1EJXC 1OD8A 2W6RA 1ZAHA 1PHWA 1HUVA 1I45A 4OKDA 3KUMA 2EXOA 3MKCA 3DC0A 3E96A 4GQGA 5DRCA 2W5FA 4QXIA 1E4LA 4FNUA 4XUYA 5LIKX 5C9WA 1HJXA 5D4YA 3HG4A 4IIGA 3LBOA 2YL8A 3PNUA 3G1AA 2AL2A 4H6EA 4LF1A 1YUEA 1UWQA 2J7CA 3DECA 3P0XA 1B4KA 5F4XA 1EGMA 1V79A 3B4UA 1M7PA 4EK7A 2Z4GA 1NFBA 4CD8A 1S5VA 2D1ZA 4IFKA 4Q22A 3VE9A 1IGSA 1MO0A 5I78A 5AC7A 4UUIA 4H9ZA 4JGDA 1UR0A 5DXXA 1YADA 4PRRA 4W9TA 3OTRA 1FVPA 3VDGA 4R3UA 4CNPA 3WQDA 1JJKA 2YL5A 4S39A 2W62A 1I0BA 2O7SA 4YVXA 5F2LA 1OG0A 3LQLA 2WKJA 4JYDA 3W6MA 4EANA 4IIBA 3EXTA 2QULA 2BV9A 4J1OA 4C6FA 5FAJA 2PDKA 4HNCA 5A94A 1W5QA 4I3GA 4QNWA 4ATDA 3WNLA 1J8VA 3UCCA 4W7UA 3NSMA 2PB1A 4CD5A 1IWAA 3LV6A 3P2VA 3LERA 4MAVA 2FFCA 2EBNA 2IKIA 1EQCA 3EXSA 1T8XA 2PD5A 1VFUA 4HQVA 1HZYA 1ZCOA 3VCNA 5LIXX 3U7VA 3AISA 3QYQA 4H7VA 3H2MA 4GXPA 5JQ9A 5HINA 1HL9A 3LGGA 5G2HA 4HVXA 4WXZA 4R27A 2C14A 3CAKA 4M82A 3NOEA 2QGHA 2JKEA 4X63A 4PMJA 1UW9A 5HNNA 3NZQA 3GKAA 1OFOA 1TE6A 4WK9A 1KFKA 3WMBA 1J10A 2O0TA 4LWWA 4YJ5A 1OGGA 2PDNA 4ZZ9A 3MP4A 2BG5A 3SURA 4IMCA 3W7MA 2E7FA 2Z1BA 3GKFA 1WYIA 3TSMA 1PHQA 1G5AA 3ME3A 4W84A 1JZ5A 3D47A 2E3ZA 2Y61A 4D6CA 2V5KA 1IEIA 4RL3A 1A5UA 3GRIA 3BJTA 2VDIA 4ALDA 2Y0FA 2V5DA 3FVMA 2QAFA 4ERIA 1E43A 3GVQA 2DIKA 4E4UA 3RGTA 4R7WA 2INZA 2PSNA 2PGRA 4HU0A 3F2BA 2J7HA 2CBUA 1T96A 2VX4A 3B0VC 1UUMA 2XIQA 1XLIA 1OINA 4UR9A 2HBXA 3R79A 1Q7QA 4TVDA 2FZDA 5AYIA 4GYJA 3W85A 1AG1O 3E74A 4I7VA 2VTFA 1X7IA 5A1AA 1V51A 4IIEA 1Q65A 1MQRA 3G2GA 4B5UA 3DKJA 5CC5A 3UWYA 2QVNA 3I68A 1A3WA 1J7MA 1FDJA 4JOMA 5DT5A 4NQ1A 4EPKA 4KWVA 4HJFA 1CLVA 3WK0A 5MKGB 1KFCA 4WKAA 1YXCA 4E6MA 4NJJA 4H9XA 3ANVA 4DO6A 1SJCA 3G1FA 1OZMA 4BQ5A 2O9TA 1YMYA 2XISA 2ZC8A 4RZ6A 5CPTA 3R25A 2QDDA 1V02E 3OGVA 4CVUA 4AVNA 1VFOA 3LNMA 4W85A 2OMAA 5D2WA 1BXCA 4AXNA 2VELA 1H0IA 4UZSA 4ZQCA 2X0SA 2NXGA 5TF0A 1GTEA 5AECA 4JKKA 3GH5A 3A6OA 3FDGA 5FJUA 2ZWYA 4MNMA 4NIRA 1F73A 3PG8A 4BA0A 2OOGA 4I6VA 1W8GA 3BGJA 3IV8A 5LIUX 4C7FA 2HJPA 1X6NA 4H00A 3XINA 3B0YA 3ARPA 1NDYA 4FMVA 2PF8A 5K4ZA 4H9VA 2BY2A 2I9EA 3OBAA 3QZAA 3TONA 4KBXA 2P0IA 4GO9A 3M1ZA 2H9AB 3ZIZA 1QUMA 2VZOA 3GTFA 4WSKA 4NY2A 3I3DA 4AY1A 5C70A 2VC6A 2Q8XA 2PDPA 2G96A 3V7PA 4DZIA 4XISA 2INFA 5C5YA 2NLIA 4FA3A 3CZJA 2J79A 3M6YA 4Y8FA 3ZZ1A 4LAZA 3WH9A 4LBRA 1J9YA 4GVHA 2G41A 4IP5A 1UOZA 3M07A 3DN5A 3A5VA 1JAKA 2OZ0A 1XG4A 2CEQA 2FGLA 2WWCA 3ZWTA 1ITXA 1X98A 1QJWA 1LM1A 4ONVA 2V68A 2I5IA 4AWEA 1H4PA 1R5YA 3S47A 2QAPA 4MB4A 1AZ2A 1KNWA 2JALA 3GXPA 2E1WA 5A8GA 1GJUA 2XPKA 4XO7A 2YB4A 3LZ5A 3STFA 2VYOA 1SZGA 3MSGA 3I7SA 1GZJA 4ATLA 3SRKA 3T9PA 3ABZA 2Y2QA 3QV9A 3N11A 1XRSA 4J3VA 1W1B1 1SUXA 4CN4A 1PYFA 3H2AA 3BG3A 1B30A 3P74A 3JU2A 4ZCWA 2J24A 1HJVA 4JDYA 2D69A 4M6VA 4JIIX 1LBMA 3HMJG 2X0HA 4U10A 1KCZA 1Q6RA 1EH9A 4PTMA 3UCDA 2P5NA 1FUYA 2VR5A 3A4JA 3QY7A 4GFIA 3NL3A 1JRCA 4JTDA 1TQJA 4DBUA 4FF5A 3M0YA 1YE4A 1X6UA 4DLFA 3VGDA 1Y65A 1F3TA 1QBAA 2KX9A 5T9CE 2BMBA 2E5DA 4DN1A 1PE1A 4AU0A 2HS6A 4MJ2A 2WM0A 1IHIA 4G5DA 3SFKA 3VZYA 4A29A 3QXBA 4XQ6A 2A7PA 2PDGA 3L4YA 5GJMA 3G24A 2W0UA 1G7UA 2ZRVA 1UOKA 4GINA 3VDAA 1O6IA 1OC7A 2GWNA 3NDOA 4KEVA 3WF0A 2DZTA 1BXBA 1QR7A 4HPHA 3WSUA 2W67A 3WQOA 1MW0A 4MY1A 3MTWA 4A6GA 4POCA 1L8NA 1FCQA 4AHOA 3QLDA 4ROQA 1CYGA 2WMIB 3W2KA 3B8WA 3VOIA 1YNYA 3IIZA 3SUSA 4PMUA 4V27A 3E1F1 1QT1A 4FF7A 4LNYA 3M7PA 2ODOA 1HQTA 2VM8A 3VPLA 2EPLX 3FGCB 1F05A 1OF8A 3TR9A 1ML1A 1WB0A 3W74A 3R13A 4RXGA 5AHLA 7PTDA 5A6AA 2OKTA 1PKNA 4JZ5A 1VBHA 5AYBA 3AS3A 1AJ0A 1S3HA 2I7GA 4G8TA 2I1OA 2Y8VA 4PMQA 5DCEA 2CCRA 3PUEA 3ONBA 4GNKB 3FYOA 4AIUA 3W83A 1R87A 1H5YA 2VFIA 3W02A 1TB3A 4H04A 3URAA 5K9CA 2J47A 3HONA 4HHLA 3H2OA 2GL5A 1EBGA 1R3RA 1C9DA 2BGNE 3QGAC 3L67A 1ZZMA 4A3RA 3TLQA 1VCVA 1Z9AA 2QJNA 3QMSA 1ZS2A 3AJXA 3TTQA 2ZCGA 3PS7A 4KGLA 2X16A 4NI8A 4MZ8A 1A5OC 2BP1A 1RQHA 2OTDA 1OCBA 2ADAA 1X1ZA 3MO7A 2FMOA 5ABGA 3EB3A 3AMKA 3QV6A 3NYZA 3N3FA 4JX5A 3FAXA 2GZXA 3WNNA 2E67A 3S9YA 3P5ZA 4DYJA 3UZWA 1QPOA 3GXDA 3OGRA 4MSSA 2ZXBA 2Y63A 3SFWA 2ZRUA 4JFUA 4M3PA 2CNCA 2HK1A 3DESA 3PBVA 1ADOA 3EA3A 3W7GA 1AIWA 4RV3A 2OEJA 3CHFA 1UJQA 3TJLA 2XFRA 1ME7A 3C8FA 1I9CB 3N2XA 4QG8A 5C55A 1H5VA 4OIFA 4W5UA 3WELA 1KW1A 4UXDA 1SFJA 1VJZA 4IMAA 5HR6A 3TOYA 4DF1A 3GNRA 1UZ4A 4UTTA 3SGZA 4C6JA 4LVAA 3VUPA 3Q65A 1SU5A 4TX8A 5GNZA 3UWWA 1LRTA 3GDMA 4AG0A 5HBFA 3IVTA 4QAIA 4HPGA 4PB5A 3WQ5A 2G3IA 4LW7A 3MVTA 4OUIA 2XH7A 4LCRA 2WOQA 3BAXA 3LD5A 5FF3A 4CKQA 1WXJA 2FHCA 1XHGA 3E6EA 4BF9A 2YBTA 3MMUA 1EXPA 3FAWA 4AHPA 4WY0B 1LQAA 3MSRA 4FPSA 2DJXA 1BRLA 1TKKA 3GB6A 3CWOX 1C90A 4I5UA 3W86A 1QU4A 2HRWA 1V6VA 3GD6A 4E38A 3PUGA 4JS3A 4QNEA 3EWZA 1RJPA 1RBAA 4IBGA 2XVLA 4TTGA 2PWUA 1S1RA 3LRLA 3AXIA 2PDFA 1EA0A 3VILA 3QQWA 1V7AA 3DOPA 2EKCA 4GD0A 2P3EA 4KEZA 1DP0A 3MSDA 2Y7GA 4EX4A 1LRQA 1E5NA 4AD2A 4LAKA 4XZMX 4DPQA 5AZ1A 4ZB5A 5H1WA 1F5ZA 3ARUA 1XRTA 1E0VA 2C1GA 2YL9A 3T7VA 1KB3A 4NT0A 2V69A 2YKKA 3EWUA 1V5XA 3AIBA 1FDZA 3OLIA 4JTHA 1NWSA 3TKFA 3FY1A 4L4OA 1B4EA 2DVXA 4PUNA 4QITA 3UR2A 4BY3A 2X8RA 5C9XA 3TXZA 2C8NA 1E6SM 2DSUA 3AMLA 3ITTA 4QLLA 3W22A 3KOZA 3L27A 1EKOA 1TTQA 4GH1A 3UJSA 1EO7A 2E68A 3IAQA 3T4WA 5HK4A 2BVWA 3GDTA 2WBKA 3V1PA 4O1BA 2QGYA 1AMYA 2QMJA 1EQPA 5I02A 1S46A 3GYCA 3HPFA 4UTIA 4MJZA 2KAUC 4GC4A 2VC7A 2NUWA 4LUSB 2Z7GA 3W2NA 3WQGA 3WLTA 3O15A 1DWGM 4O8AA 4XAPA 3NSNA 4IBCA 1F6KA 4XZLX 4FALA 4YHGA 3BCDA 3BSGA 2OZ8A 3OHMB 2CHRA 2F84A 4JTCA 3WBAA 2Z0IA 3L4WA 6REQB 1ZJBA 3RJYA 1UMYA 1D8CA 2NUXA 1T40A 2Z7KA 1UR9A 4XZ9A 3OU8A 1YU4A 3V3WA 1F9CA 4G9PA 1BWKA 1X38A 4S23A 1J5TA 3KDNA 1V3HA 5JXQA 3WQ4A 1KBIA 3SR7A 4F0MA 1R0MA 1GEQA 2JKAA 4L9YA 4PULA 2GOKA 1UKOA 3KS8A 4UIOA 2P8BA 3QTGA 1J79A 5XIMA 3AYSA 4Q4SA 4GY1A 4F2TA 2V82A 4ERGA 6ALDA 1SZNA 4M5PA 2X1TA 2DPEA 5E0KA 4CCEA 1TTIA 1GYLA 4GMEA 1NY1A 4UNLA 4NNAA 3MCMA 2Y89A 4MB5A 2ZQ0A 2WNQA 4GYFA 3D3FA 2X1RA 1R9ZA 4K8GA 2BLEA 3BJFA 5D04C 3WLLA 3V35A 2H9AA 2DT2A 4QG9A 2VJXA 1Q85A 1XLLA 3ES8A 5IDZA 3NZ1A 3MSYA 2VUYA 2ISWA 2GFTA 3NIYA 4MLJA 4LVGA 1GWJA 1FA2A 1JPKA 5BXPA 4QG6A 4RLIA 4FOUA 2V8ZA 4HK5A 4OQVA 2WHJA 5H91A 3VINA 5HWMA 1HJUA 1GVYA 3H2NA 3NGJA 4XG1A 2J7EA 1GJWA 4O54A 4YWIA 4JTAA 3B05A 4TOQA 4UMBA 1LT8A 3U9IA 1BG4A 3ZJKA 5CPMA 4AZIA 1L9WA 4O17A 3CO8A 1R7AA 1QBBA 1PZ2A 3C2VA 1CI1A 3H8AA 4DF0A 5FCZA 1EDQA 4IMFA 3DIPA 2IMRA 5LNRA 3LNPA 3N2TA 3TW9A 3TE9A 3TK7A 3STPA 1W0MA 3SCPA 1MRAA 2BNJA 4KEMA 4YIWA 2O92A 5FKYA 8A3HA 1DWIM 1W9PA 3SY1A 1DHKA 2CLFA 2R1LA 4JYFA 4RPQA 4DUOA 3GZ3A 1JDCA 1E9YB 2VD9A 4ZTYA 4XAZA 3HQ1A 4QJ5B 1XBYA 1ODZA 4JTKA 3GVWA 5J5DA 2ZX9A 5HULA 4CNUA 2C91A 3FK4A 3IJDA 8CGTA 3DFHA 1Q6LA 2NVAA 4EPEC 2W79A 3E3HA 3EEZA 4WX2A 2A7RA 3MO4A 4D6JA 1YE6A 4QLJA 2CITA 1W8SA 2PWEA 3S2CA 1VHCA 2NT1A 4IX0A 1TMQA 1J96A 4QFUA 3MQTA 1GW1A 3CHCA 3VNMA 2ZFAA 1KKOA 1E1FA 2V5CA 2Z28A 1ZJHA 3GY1A 1OG6A 3VABA 4JNYA 4U33A 2DP3A 3TWAA 3VNLA 5BRQA 4GHRA 3PZNA 1OX6A 1P6WA 1TTJA 4IBEA 4MY9A 2RTSA 3RCMA 1CIUA 1QK2A 3ORWA 1H1NA 1QPQA 1VPYA 1ZBVA 1UPMB 4L1GA 4URIA 3T44A 2DU2A 1YW1A 4GVIA 1PDYA 1MEWA 1R9XA 3MI2A 5DMMA 3ZO9A 3M41A 1T0OA 2GLKA 1UH2A 4F48A 1DJHA 1GVQA 3LCHA 3MUY1 4UTLA 5H2ZA 1WNOA 4LS1A 3QGKC 1JCJA 3C56A 4NASA 3FNDA 2E1DA 1FFQA 4V33A 2WMIA 5I0DA 1GOXA 4O1AA 5HR7A 4WGXA 1UWSA 4KF1A 3ITLA 2DIJA 4FOKA 2V67A 4RZ5A 3TC3A 2CZVA 4NJKA 2POTA 3OG2A 1GEHA 3ITYA 1FTXA 3TTEA 3VYLA 3WH7A 4US5A 2XDFA 3P8IA 4YNGA 1Q6EA 3FGCA 1UWAA 5FF4A 4HNOA 4ZO9A 3N6JA 3BW3A 1TYGA 3GC5A 3CASA 5EFDA 1LOLA 1VCFA 4NU7A 4JQ4A 1MW1A 3PPCA 2PPGA 1D7KA 1TO3A 5I3IA 2D23A 4FEZA 4EXBA 2IW0A 3GU1A 1EFZA 1S3TC 1DE6A 1GOOA 1QI3A 3E9AA 2VXNA 4ICNA 1UA7A 3WLMA 3E5PA 4GUHA 1TPH1 1CXKA 1YHTA 2TRSA 1HL2A 3SCTA 1F76A 4HK6A 3SBFA 2FTWA 3BUVA 3O16A 1NH6A 1TJPA 3LTSA 3S4TA 1ISYA 1K7XA 2PDBA 4G7FA 3LSBA 3TTSA 2EG7A 3ABXA 2NXHA 4WJ8A 4XBJA 2QCLA 2V5JA 3AALA 1S1PA 1C3FA 4U5KA 1XLHA 3B8SA 4Q32A 1YPIA 4UOQA 1E9IA 3KP0A 3PWIA 5E6YA 3VM7A 1ICPA 1O5XA 4OOZA 3UZXA 1E88A 2Y5SA 5JH2A 2WW5A 1JPMA 1MXGA 3OJGA 1H41A 3TZNA 3DH7A 3JZUA 3M16A 5FJIA 3LM7A 3W7CA 3QFWA 4UFIA 4OV4A 5F4WA 3S5NA 3W38A 1XP3A 1WAWA 2PDMA 1DIOA 3TIMA 3TC6A 4A8LA 1XLMA 3R2GA 3RJXA 3B9EA 1BHGA 1C7SA 1WE5A 1X7FA 1R3YA 1RPXA 3FX4A 3E0FA 1M68A 5EU9A 3JZEA 2Q3OA 4BI5A 3CH9A 3VK5A 3GDKA 4WLCA 2FPTA 3CUHA 2QUVA 1FX6A 3RPMA 1FWSA 1KLYA 3W7RA 1SJAA 3WQVA 4O4VA 3UBPC 1LLZA 4CQAA 4FNPA 2HBVA 3M0HA 1P5BA 1VEPA 2XSBA 3WK1A 2E6FA 4C65A 4OJYA 5CSSA 4WY0A 3VM5A 4NG3A 2D0HA 3DG3A 4QX4A 4Y9AA 5BOFA 5M2FX 1OC6A 1QPNA 5K7JA 3LHUA 2NX3A 4ENLA 4DNHA 2A3EA 3TWBA 3BLEA 1RVKA 2OT0A 1HVXA 2R1KA 3OA5A 2OQHA 1JPHA 1A0CA 1JD9A 5D2TA 1W17A 2PLJA 3PWGA 3OP2A 1NWRA 4AF0B 3T2PA 2O9OA 3LHVA 4IGHA 5D37A 1XYMA 1DVJA 4ZVJA 2O4QA 4HYWA 3MYPA 1F07A 2P1FA 2B81A 4AEOA 3MCNA 5LNSA 2W27A 3IIPA 2P76A 4NRSA 3R89A 1CXWA 4IBIA 5XIAA 1J11A 1S2TA 3LOTA 4AZ6A 3FHQA 4B3ZA 4IZGA 1AD4A 1D9EA 2TYSA 2W4XA 4XD4A 3H12A 2OGJA 1LQ2A 3WJWA 4IH3A 4IJRA 5ABEA 4AX6A 1O1ZA 3ELFA 1JCYA 4U2ZA 1WBHA 1RXOB 1OGSA 1HG3A 4AX7A 1XKYA 1MFUA 4JNMA 4O0QA 2V9DA 5BU6A 5AYXA 3RPDA 1A53A 2D3LA 3NZGA 3G6MA 1FP9A 4W86A 2GJRA 1ZLPA 1AQ0A 1A5LC 1U30A 2ZXDA 3FVDA 1DORA 1ZUAX 2J78A 2YXOA 2EGZA 3N17A 3P60A 4A8NA 4ERAA 2OSYA 1CT5A 1XQKA 4YMZA 1CXLA 3H2FA 4PUJA 3NURA 1PO9A 3ARXA 2BVTA 2GVYA 3UWQA 1RBOB 3EEGA 3AMDA 5I6SA 5BXTA 4HOWA 2POZA 1BWVA 2BTMA 1TV5A 1TRIA 1TVLA 2D2OA 4QDPA 4YN5A 4AMCA 5CZSA 2BDQA 3AJ7A 3M7WA 4DAFA 3BL3A 4JTLA 5A8NA 4GY0A 3OQEA 3LCWA 1BKHA 2J8TA 1B3XA 1NWTA 4C7GA 2VHLA 3CMFA 1AJ2A 4ZQOA 1NOFA 2R91A 2GQ9A 3UPWA 5AB3A 3EX1A 2GK1B 4MAZA 4MNLA 3IWPA 3LSCA 3N2OA 3NQAA 2VMFA 2ON3A 1NIUA 2VR4A 4KQNA 3MC5A 3B8IA 4LXFA 2A6NA 1W1VA 2ISVA 4O11A 2YZ5A 1MNSA 2CERA 3PZIA 3LRKA 4Y9MA 4IPLA 1XIMA 3IUIA 2RH9A 3N4FA 4PMXA 3RLUA 3DDMA 3LMYA 4PGLA 2QCGA 3O6DA 3NQDA 3GG0A 2QLYA 1E4NA 1W9UA 5LXXA 2OO6A 1VRDA 2PDQA 4JAWA 3W2UA 2YA1A 4K8HA 3KOWA 3RR4A 2XH4A 4Q8TA 1E72M 5IXEA 1JI2A 4FR6A 4CQ8A 3H7VA 3GX9A 1W37A 2OZTA 3VZZA 4DJDA 3O06A 1MMFA 1IXOA 2C7FA 2F9RA 3N6QA 2H3DA 1TA3B 1OHLA 3BARA 5M5DA 2HPMA 4P8UA 3KRUA 2W63A 4MKSA 4B92A 1XIEA 3GDLA 1TFVA 1UR2A 4DJDC 1JDDA 7REQA 4GI9A 3EDDA 1KFLA 1TJ2A 3U0HA 3S2MA 3WNOA 2J9YA 3K46A 3W70A 4LBUA 2H8XA 1WUFA 2P10A 2XH2A 1CX9A 3LHYA 3PJWA 4O16A 2WWDA 2OKOA 4PEEA 1Z44A 1PTDA 3SIMA 1JL8A 3ECQA 2Q71A 2OQLA 4UNKA 3TXVA 1RY8A 3A3XA 4JKLA 1DIKA 1VIZA 2NQJA 1G6CA 1UA3A 1FH8A 2PDXA 1J0ZA 3V36A 3E12A 3BXWA 1QOPA 4X3ZA 3LENA 5HDRA 3R11A 3S1XA 5TNVA 1ZBKA 1WKFA 3K1GA 5AHNA 2PLMA 4LF2A 2NXIA 1W5NA 3W7EA 1SJDA 1HIZA 3KBVA 4M19A 4NYYA 2C0HA 5AYZA 1JXKA 3B97A 5HNUA 4OJLA 4PMNA 5D09A 4ROPA 2YCIX 4AHQA 2AKMA 2HXUA 3C52A 3A9IA 1OD0A 1A47A 2WANA 3QH2A 3SM0A 3W73A 4DYEA 5ECVA 5DBTA 1ICSA 5A2AA 2UWXA 1WX0A 1SO3A 4E8GA 1J0HA 3EBVA 4IGMA 4NZ1A 1JUEA 2RDWA 1MVYA 1ZAJA 2PDJA 3HQNA 2ZZ4A 1PKLA 2F2KA 2X09A 1F8MA 4LYPA 1YBQB 5HMDA 1XCXA 2YW4A 5HAOA 1PKMA 1WDQA 1XIJA 4KCTA 3KTSA 4H41A 2EEXA 2NW0A 2J9XA 4GIRA 3VD7A 4UTWA 2PD9A 2WJZA 4GNJA 2G3NA 3MUZ1 2CZFA 1VBJA 3W72A 5C9ZA 1P7TA 2R82A 3NWRA 4QCFA 3REQB 6A3HA 2Y2HA 4NJGA 3A24A 2DIEA 4QTGA 3SN4A 4NYUA 1UMLA 2GQ3A 3W7HA 2Q02A 4DEFA 2HS8A 3L2MA 2AQOA 1Q63A 4Y9OA 3NCOA 3T2QA 4J3UA 3F5KA 1QI2A 3LLFA 4H8VA 4W5ZA 1OFRA 4JFSA 1GOKA 3OVPA 1TPUA 1KRMA 3UGVA 1JNEA 1BSIA 1GXDA 4L6DA 1AA1B 4Z0SA 1KM5A 4O1FA 4QSFA 1FKXA 3B06A 2I56A 1K77A 4PYSA 4L4LA 1WA3A 4OTKA 5JVLA 1HFBA 3M9YA 1O1HA 1EWEA 4HU4A 2WMKA 2CPUA 8TIMA 3ARYA 1R8LA 2WC3A 8RUCA 1W9DM 1TWSA 3KVMA 1M3UA 2BFGA 3AHXA 4TVCA 2UZ9A 2OFJA 1JFHA 3W84A 1FBAA 1NTHA 4DZ5A 4Q7NA 2Y2IA 2OCZA 5JIPA 1ZBCA 3SQLA 3TYBA 4EAYA 1DWHM 2PGFA 4HIBA 4ZTXA 1M65A 3INPA 3STEA 1WP6A 3AHTA 5F4SA 4JD4A 2WQDA 3MJMA 2FFFB 2BS9A 2PTZA 5HJYA 3M64A 4NJIA 1M7JA 4EOUA 1DJZA 2QJIA 2E9BA 2BXYA 1MZRA 3G6LA 4LEFA 3V0SA 4TIMA 3L4TA 2WNZA 4KWOA 2PRHA 3T05A 2W61A 3PBGA 2P88A 2YDRA 3C8NA 2NVCA 4PBEA 4AH7A 3L4XA 1X8FA 4ZQRA 4IUOA 1CXEA 3BG5A 1ZFJA 1XR2A 3P14A 4Y90A 3RDKA 4Q4OA 3NGFA 3LN3A 5G4EA 3PBWA 4JTFA 4DLMA 5LSMA 1U22A 1FWWA 4MF4A 5BMXA 1G4PA 1NEYA 4FO4A 5DANA 1H62A 2BSLA 1XIGA 4LBSA 5CJ5A 3UXDA 5I06A 3VKJA 2RGLA 2XVGA 2Y62A 3EWXA 1RQEA 3LPGA 1TPWA 1AH3A 4PMYA 1HJWA 1VHNA 3IIVA 3P0WA 1VFMA 4I9TA 3GFYA 1LL4A 4GH3A 3T08A 1QDSA 1R2RA 2CYGA 3CAQA 4ZO6A 1TJ1A 2WQPA 2QHAA 3ATZA 3N3TA 1GQJA 1OT2A 3QFEA 1IT7A 4WKHA 2WMGA 3T8QA 4M29A 4X2RA 2VX5A 3NPUA 4C60A 4PA8A 1QHOA 3GAKA 1TQXA 2HXTA 4NXKA 3BAWA 3ZSTA 4ZO8A 1DIEA 4GUGA 3PAJA 1ZHAA 3GTIA 1OYAA 2XVKA 3AYTA 3RMEA 5I23A 3UNDA 4CU8A 2H8ZA 3T0AA 2X30A 3MA8A 1R86A 5LNUA 4I7WA 4R34A 1D8WA 2QYGA 1ZENA 4AF0A 1WZLA 1V77A 1K8XA 1OYCA 1GVSA 3G3DA 4R53A 2J13A 1XV8A 4GKLA 1JZ3A 4YS1A 1XPGA 1EIBA 1BAGA 3UXKA 4E5TA 4B4FA 4ICMA 3TZFA 4JFTA 1HKJA 2Z24A 2PMQA 3GR7A 3VXGA 1KD0A 1I2QA 3WMSA 4D6IA 4QQUA 3OPSA 4X61A 5B7ZA 3NAVA 1S2UA 2PCEA 3VMOA 4M7TA 3VIPA 4CLMA 3TNOA 1ED7A 1ONRA 3MUIA 3V18A 1OB0A 3PZVA 5I03A 3BE7A 3KLKA 2PWVA 3VOJA 3CGTA 3SZ8A 3P67A 1MXDA 4TU1A 3VOHA 1RJRA 4UQCA 3V1HA 1AW2A 3D46A 3CPUA 2VFFA 1JQXA 3W1PA 1LP6A 4GBUA 4IOTA 5AYYA 1SO6A 2OEKA 2XFFA 1BQCA 4AEEA 4ZQNA 2XM2A 3U2CA 3NUKA 4OUEA 1H7OA 2DQXA 4XZBA 3I4KA 3VDHA 3HMCA 3Q4DA 2FVKA 1TZ9A 4M51A 2WLYA 3IJQA 1TPC1 3U4AA 3UWZA 4U3CA 2ZVRA 3SCSA 1N8WA 2AGTA 3E2QA 3BANA 2ZTJA 2BGSA 4KWUA 2O9RA 5LIYX 4OBTA 4KIRA 3T6CA 3OZOA 1DEDA 3AIUA 2GJLA 3B9DA 3M0JA 4OBRA 4J3XA 4H19A 4N6EA 1C8XA 3F5JA 2QCCA 2GK1A 3G1SA 1FWRA 3RCYA 3GH7A 5FJJA 4JKMA 4HPNA 1HP5A 1SW7A 1TV8A 2BY0A 1NJJA 3ATYA 1XG3A 2EPOA 1OFBA 5D2YA 4F9JA 1KFBA 1KM0A 4B5SA 3OGSA 4GI4A 3HGSA 2QJGA 4RW5A 4L7ZA 2V3FA 1AQHA 1YDYA 1I2RA 1W9VA 3ALGA 1B3ZA 2ALDA 3N34A 3TMQA 1XYCA 1TV3A 2E8YA 3CQ0A 4AD5A 2V3DA 3W7OA 2Y8KA 3EGJA 2VC9A 2DQWA 3RYSA 2FIQA 1W5PA 3GBDA 4N4PA 4FHAA 3SUUA 1K8ZA 2YA2A 4KCVA 3M5VA 1W91A 2Y5JA 4LB3A 4Q4RA 2C1IA 3MBFA 1H63A 4W4QA 3UERA 6CGTA 3H22A 3HM7A 5CC6A 1XLKA 2J75A 3A3WA 4D6GA 1TA3A 4O0KA 1H60A 1K4HA 2PAJA 2WNWA 4BK9A 1V3MA 5BMWA 1K9TA 3WFLA 4HMDA 4S3GA 3QQ1A 2ISSA 2WXDM 3PTKA 1W1YA 4XIMA 4YVPA 2XIMA 4AW7A 1HGYA 3G8RA 4PCNA 4BQ4A 2R8WA 5E0FA 3KOXA 1PXGA 1GQIA 4DB7A 4WD0A 4QJ4B 2R94A 4AXKA 2W92A 3PP7A 3ZYZA 3RXZA 2PS2A 1YPFA 5HXMA 4A8IA 5BWFA 2B7NA 2WMJA 1LRNA 1BVWA 3GXTA 3QVQA 1JFXA 3K4DA 4IPIA 3TMLA 3WMCA 4MKVA 1HX0A 2C3ZA 2DZAA 1KQYA 1FWHC 1O7AA 2ZZ3A 1QO6A 3QGVA 1XCFA 3G5EA 3AO0A 1H7NA 1UZHA 2A2IA 5EMJA 2QCDB 4DJEA 1BEUA 1YXDA 2ISDA 2J7BA 1W2PA 4PUWA 2GQAA 3TJ4A 1ADSA 3UR7A 2XINA 1UROA 1F74A 1RVGA 1AUSL 4ILSA 1QNPA 1XDMA 2Z2AA 3GG1A 5E5CA 4DM2A 5IFTA 3WDQA 3ZM8A 3MVIA 4AWUA 3V75A 4ZSTA 4LFYA 4QGCA 1KCKA 3NQ6A 2OYLA 1JXJA 3TP4A 3NTYA 1EP1A 4DM1A 1U2YA 2V2DA 2ZUUA 3SEPA 4MTVA 4H2CA 5CC7A 1VLWA 2AL1A 2ZRXA 3UY7A 1RZMA 3C5QA 5CPOA 1I6NA 1VGAA 5I3DA 1BGGA 1JCNA 3L9CA 4KFPA 4O28A 1EEPA 3GUGA 2YXXA 4YTQA 4YTUA 2AKZA 2PI6A 2YPIA 1UWUA 2QCFA 3K8KA 1OBAA 1TVNA 2NV9A 4DWSB 2I17A 1YBQA 4IL2A 4DELA 2XHYA 3RM4A 2Z25A 2OVLA 3U3HA 4W89A 4MJMA 2VENA 4CQCA 1OX5A 3AIEA 4DUVA 4HD5A 2BY3A 4C6KA 4J2MA 4C1NB 1QI0A 4RE3A 4MWAC 1VD6A 2QQ6A 1PVNA 3L5MA 2XN2A 1YDVA 3RLGA 3CZLA 5I00A 3REQA 1G94A 2QUMA 1HJQA 4YTTA 3VIFA 3I7QA 1UUQA 2JGYA 2PU0A 1P4CA 2V5OA 3W01A 1B9BA 4Q3MA 1K8YA 2ABAA 1GYMA 4RE2A 3RLVA 3F03K 3E02A 1NF0A 4W7VA 3FXGA 3ZR4A 2Y2JA 3UW6A 2RAGA 2ISFA 3R8GA 1OWQA 3WH6A 4D2JA 3ARQA 1K03A 3G1DA 5G4HC 1L0PA 4NZFA 2CW6A 3NXFA 4NAEA 5HQMA 3K4WA 4P7OA 1DYSA 4QE4A 2DW7A 5FF2A 1Q45A 3MP3A 3BWWA 5EMLA 1A5KC 3WF2A 4DZAA 5JU6A 4GXWA 4AC7C 5CZTA 1EOKA 3U57A 5LKYA 4C6QA 1Q6CA 3GHTA 4W8LA 2Q6ZA 2B7PA 1WDDA 3GHSA 2VQUA 4TV6A 5GVJA 2PRMA 4LVFA 1XRFA 2OO0A 3IV3A 3C6CA 1OX4B 2TODA 2XG9A 3OHIA 3VIGA 4PCTA 2WC4A 4ZB0A 1KTNA 3AZSA 4FNSA 2R24A 2E9MA 2Y88A 2FHBA 2GUUA 4O10A 2HK0A 2PF0A 3L5AA 5AZ0A 3NA8A 4UFJA 1A0DA 4I8YA 1G1YA 4BZYA 3P3BA 1KRAC 1TR9A 4S3JA 1UR8A 3A47A 3PPFA 2GSHA 3S5ZA 4DJFA 3MHFA 3FA5A 4M1BA 5LGZA 3PY2A 2OOFA 5D38A 5IHRA 2VURA 2QV4A 3KEHA 2BHUA 1MFVA 4HHMA 3SCQA 2VRJA 4FX7A 1Y5VA 3SUVA 1JYVA 1Y5XA 1H7RA 4QRNA 4JCMA 4A35A 3IJ8A 3S0CA 1O94A 4IIDA 3G77A 1ZNNA 1TV4A 1UIOA 2TAAA 4R5EA 4ZXOA 3H54A 1Z48A 2AOSA 2HVOA 3PBUA 1GHSA 4EXAA 3M4HA 1B9ZA 3WYZA 1WDPA 2VCCA 1WDSA 6TAAA 1QOXA 1TVPA 3W1LA 1NF7A 4K1GA 3UJEA 3LRMA 2FZNA 1AL7A 1X1NA 1CGWA 3WLQA 3LCIA 1EDGA 3SSZA 1YPXA 3A22A 1HL8A 4CQBA 4JTIA 3TYAA 2ZX8A 1E51A 4H8UA 2ZDRA 1D7FA 1O60A 3AIQA 5FI8A 5I79A 2WVVB 4GI8A 4IT1A 1XKJA 2NVDA 1FKWA 1J0KA 1E0XA 3S3GA 4WIWA 3C2YA 1JYXA 4L65A 4JTJA 5D32A 3URNA 1AL8A 1EJSC 3K8LA 3MYOA 3G8EA 3NXLA 3MUXA 2Z27A 4UFKA 4WJXA 1OT1A 2D20A 3SIZA 1M53A 2FQIA 3L23A 4AWSA 4FXJA 2C71A 2QKFA 1RD6A 2F7FA 3USZA 1E8BA 4MFEA 4OVXA 5H8PA 2G50A 3NOYA 1VYSX 1UC4A 2B7OA 2QIIA 1V0MA 1EIXA 4E2BA 4J3TA 4JIRA 1ZJAA 3BAIA 3HV9A 1W1IE 5DF0A 5FJOA 2PWFA 3NM3A 3ARZA 1J0JA 2GGHA 4YHEA 2A3BA 2ZZ5A 2DSZA 4Q4QA 1KM3A 4IL0A 4UB9A 4IF2A 3S9ZA 4LANA 3SO7A 2GDUA 4F79A 1LL6A 3GR4A 3B8TA 4IBJA 4PBFA 4NRRA 3DXIA 1H1ZA 4KETA 1KR1A 5AKQA 1TZZA 3GIQA 2EKGA 1XYFA 3W53A 1XL9A 3RN6A 3GDRA 2EPKX 1BSLA 1CGTA 3W1MA 3WBEA 2E5CA 1CGUA 5HNTA 1S5NA 3V5FA 3PJTA 3O0KA 3MU7A 1E4MM 4C6OA 2GSJA 3QZEA 1XXXA 2VQTA 2C16A 4XSMA 2WYSA 2GGEA 3FIGA 2XZ7A 1FHUA 1E55A 1A5NC 1E70M 3IS4A 2CLHA 2VFEA 4B91A 2PEVA 1A5CA 5D9PA 5M03A 1HKIA 1XBXA 3CV6A 1EAKA 1JCXA 3U7BA 3L0KA 4YPJA 1A50A 4JHZA 5AOUA 1QK0A 2VCBA 1KXQA 5KEZA 2Z00A 1NQKA 2HEJA 4E4PA 2ZZ7A 4O13A 2CLEA 3AU2A 3GE7A 5KSWA 1QW7A 5EYWA 2OEMA 3TQ0A 1US3A 3RLHA 4IMGA 2Y2PA 4CN1A 4NL1A 3BTNA 3C0LA 5CJMA 4IISA 5KITA 2GVJA 3OVQA 2V0TA 5LNVA 2PWHA 3S6DA 4HSHA 1KTCA 2BG1A 1F4HA 4H8NA 3SRDA 3BQ5A 2HE8A 3LHWA 4D71A 4MUPA 3WQWA 4P8VA 3HGRA 4IPPA 3CNYA 3RU6A 2J62A 2E6AA 2DEPA 3W29A 4C6CA 5D2VA 1QFEA 1P43A 4EF9A 4RW3A 3VD5A 1BTCA 3C0JA 4N0RA 2I5GA 3W7KA 2DUZA 3VO0A 2WCSA 2BY1A 3CC1A 1J2WA 4KRUA 4OWGA 3VA8A 3C3NA 3DX5A 4J9JA 3L2AA 1DHPA 4G1KA 1UZDA 3O05A 3T0DA 1PIIA 5U4NA 3LB0A 2D2HA 2HZGA 5BCAA 3CQHA 4IHCA 2GPTA 2BOEX 2Q3RA 3GC4A 3GH4A 4NP7A 1QO2A 1M5WA 2RGMA 3EPNA 3IANA 3S6TA 4BS0A 4XSLA 4ZOEA 3UWEA 4E4FA 2ATMA 4FI4A 1ONWA 1C92A 4Q8QA 4XBSA 2QCDA 3OZYA 3T09A 2RFGA 2J66A 4O19A 4LUTA 2WPGA 3E5BA 3ZJ6A 4EKJA 1RLDA 2I9UA 5A8PA 3BLLA 4DBWA 1E6ZA 3S42A 4FIQA 1NDWA 4DUWA 3LI1A 1FFRA 1J18A 1KGUA 5FEXA 3LTYA 3PFMA 3PB0A 3EB2A 1XIFA 3HJEA 4JY9A 3DERA 3QC3A 3H53A 3HURA 5DO8A 4UQ9A 2YDQA 4PN2A 2Q8ZA 3UA3A 4O57A 4F0LA 2WZIA 4BHYA 3M44A 1HT6A 3EPMA 3MKKA 3VKKA 2V2HA 1F8IA 3KL3A 5I09A 3Q67A 5HA7A 5M17A 4CCDA 1IEWA 3L2LA 2ZRZA 4RDZA 1E6RA 5DBUA 1UR4A 1PPIA 4PTWA 3CBWA 4ML4A 2YR1A 3SGUA 3UVAA 1XLEA 1JUKA 2DZXA 4Z2JA 2J74A 5CEWA 3MT1A 4KH2A 3KVKA 1G4EA 1KFEA 3FKRA 1NP0A 3E2VA 1EJTC 4XAGA 2IQTA 3K4AA 3K1DA 5FSDC 2E77A 2IKGA 2NZLA 3N9SA 4NJHA 4C1NA 3W87A 4PCSA 2GOUA 2OU4A 1A5SA 4DWSC 1GJPA 2XN1A 4G7EB 5FJTA 2FZBA 4NI3A 5IDIA 4IPJA 4LH8A 3W7QA 3HG2A 3IJLA 4I7UA 2JGQA 2ACRA 1KC7A 3WDJA 5FF7A 1H3GA 2ABBA 4ASTA 4UOZA 2BXVA 3D0CA 4MY8A 3AIVA 1MUMA 5K3VA 3OA3A 2PC4A 5CJNA 5EKYA 1V8EA 2VUNA 1B5TA 4LPCA 3P80A 3H26A 3N1AA 3R10A 4E2VA 4H83A 1JPIA 4CNTA 3IUDA 4C6NA 4AEFA 3NG3A 1BYCA 1OM0A 4N9BA 3BLDA 4LT9A 3OYXA 4GQQA 4KIEA 3FKEA 2CBVA 3RU8X 2J8FA 1K4GA 3LPPA 4OJOA 1Q4NX 1XLBA 5KZ6A 7XIMA 3WENA 2CU0A 4HZ7A 3QC0A 1NAL1 2HQAA 3HPSA 3URBA 1R2TA 2ZA2A 2R9RA 2WB5A 4JEJA 4JXCA 3TOPA 4N9CA 4DJDD 3DUGA 4K8EA 5LHFA 3CB8A 2ZVIA 1XH2A 1JF6A 1JZ4A 3M0LA 1TCDA 3AIWA 3Q58A 1BRLB 4JN6A 4K37A 3SJ3A 1XX1A 3UD6A 4PUKA 1FHVA 2PBOA 1VJSA 3VI2A 4MIMA 1JZ6A 1V08A 2J27A 2XH0A 3WFAA 4IGSA 2V5BA 1BYAA 4IBFA 3PZOA 3L65A 5BW6A 3J7HA 2BHYA 5T8GA 1OX4A 4FXFA 3THQA 3CH0A 2A0NA 4DIAA 2G4JA 5C7HA 4WSHA 4FNQA 1IT8A 2NQLA 3UR8A 4C6BA 4JQ3A 3UA4A 3HA1A 4GYKA 1R46A 2WCAA 2OWWA 7CGTA 1Z6KA 1AZ1A 4DQWA 3BSHA 1VAHA 4XD3A 3A4XA 4RE0A 2XGBA 4LRSA 5FA5A 4HU8A 2BOFX 3BZJA 3M0ZA 1XIBA 3H7UA 2ALRA 1F6YA 3E0LA 1JG9A 4YL2A 1D3HA 3NQ8A 4KGJA 2ZZ2A 3EKGA 1OFQA 1G67A 2ZKMX 3KBMA 2YCJA 3SCOA 3KW3A 3AHVA 4LYQA 2YL6A 1N2VA 4GUFA 3UG3A 4F0RA 3THAA 1TWZA 4UZUA 2CXEA 2VEIA 4GQRA 3RX4A 3EMCA 1OCNA 3AWOA 1GKPA 3GU2A 3TA6A 3KS6A 3ZR5A 1YXYA 3BSMA 3DBNA 3L21A 3PTQA 3RFAA 1E1EA 3FSUA 3W76A 3JR2A 4M6QA 4AIOA 1QI4A 4WOZA 2VWTA 3WLRA 4F9DA 1ISZA 2QCHA 1Q7MA 4MPQA 3NQVA 2X41A 4IXXA 4Q4PA 2OG9A 3BLOA 2AMGA 4AZ5A 1W5MA 3QV8A 4N9EA 3JRKA 2DSKA 3WCZA 3IACA 1EXBA 2WVVA 3T0TA 4J35A 1X96A 2J25A 3TYUA 4GJJA 2DT0A 4CNNA 2FPVA 4GY7A 3FSTA 4AMAA 1MZHA 1MXSA 2NX9A 3T55A 1WAUA 4LVBA 2ZC1A 4JR5A 1WXZA 4INFA 2Y2MA 1IR2A 3FJ4A 1JGMA 1V0LA 4YCOA 1XWYA 4R7JA 2G0WA 1RPKA 4Y2WA 1SMDA 5G1MA 4IJEA 4DI8A 3B0PA 3ITXA 3UPMA 1ECQA 4TV5A 3RPTA 4XVEA 3CIVA 5DN1A 3IPWA 4CUCA 3VAVA 3BLKA 2CKSA 3LCLA 5HUOA 2JIEA 1H0GA 4NAFB 3BG9A 4PL2A 3NQ7A 4L6HA 2GUBA 1UKSA 2YW3A 4A2SA 1VYPX 1SSGA 2O55A 1XD0A 1F3EA 3LBMA 1KWGA 1AVAA 5D9NA 1UH4A 5FL0A 2X2YA 1KM6A 1R2SA 4BFAA 1JULA 3M46A 3UJRA 4ZR8A 4JTGA 2IKJA 3QF0A 3F4DA 4RV8A 3C0QA 5BXSA 3M47A 2ZA3A 2NQHA 3EDEA 1L6JA 2CXGA 2IOUA 5I77A 3EOSA 3BJSA 2G3JA 3KFTA 1SW3A 3WUBA 4W8AA 1UP2A 4LAUA 5FD0A 4TTUA 3CAWA 1VBUA 4HMEA 1EYEA 1PX3A 1CLXA 2I14A 1IQ8A 2D2JA 3T40A 2PLKA 3HIJA 3VU2A 3KOYA 3AS0A 5D03A 2J8GA 1UD3A 2GVEA 3TSBA 3G1VA 4S3KA 2QVHA 4GJIA 1TIWA 3K5XA 3UG8A 1EX1A 5F7UA 4A05A 5DCDA 1CB7B 2PP3A 3W7NA 3PR2A 3AFBA 3S2NA 3BGAA 2V2CA 3RIKA 3FDKA 4OV9A 1MW2A 4XTDA 3QRHA 5DXYA 4KWWA 1DKWA 3EDFA 5H6HA 4MYXA 1LJYA 5DMLA 1E15A 2JEQA 3TW7A 3OBEA 7ODCA 2C79A 1YEYA 3LG3A 4JHMA 4Q7IA 1S2CA 1NWUA 3AMGA 1Q7ZA 1ZSXA 1XGDA 4GKTA 3ICJA 1I2NA 1VS1A 3NZRA 1UKPA 2DT3A 1IWBA 3VFCA 2WKGA 1P0KA 2VDHA 3N12A 4QAWA 3WF1A 1XW8A 4PTVA 3LCGA 4JQAA 4XK2A 5FJRA 5LZLA 4L1XA 3BAJA 4LYRA 4RJEA 5IOBA 4WSJA 4JTUA 4RDVA 1GVRA 2BHZA 3QPYA 3Q37A 1PCWA 7TIMA 5ABFB 2QDHA 2Y24A 5D8ZA 1K1DA 4DY1A 2X1UA 4IIFA 3EWWA 1QPRA 4GA8A 3KBSA 5M1TA 3BLFA 1ZB5A 4S3BA 1MI3A 2JE8A 2AMXA 3N29A 2VFGA 3BPWA 4S2CA 4CNOA 4CNSA 2HISA 3AROA 4GO8A 5FAGA 3NQGA 5AY7A 5C6MA 5DFAA 3N18A 5EMUA 3OVGA 4LAMA 3SSJA 4WJEA 3W2JA 3VNYA 3WY1A 5E1QA 1QNVA 3EA1A 4P7NA 1DQXA 4CU7A 2NQ5A 3HFYA 4J3SA 4LX4A 4Y6GA 2PDWA 3BO9A 2F8QA 2IXUA 2G3FA 3C2FA 3QHOA 4D6FA 1C8YA 4UQEA 5E6ZA 3DHPA 3ITCA 3DI0A 1HNYA 3G0SA 1KRCC 1XDJA 1P0DA 3LS9A 3KLLA 4ADTA 3P81A 2F6KA 2J7DA 1FWEC 3SY8A 3N9KA 1ESWA 1YQ2A 3WUFA 4C5ZA 4R88A 1LYXA 2WZEA 3W81A 2VC5A 1ZP4A 2EJAA 2ZADA 4G56A 3LZ3A 4J28A 4AIEA 4B5NA 3HG5A 2BX7A 5AHFA 2Y4SA 3HO8A 1KS0A 3DFSA 3WLJA 1EOMA 2NQZA 4Q6JA 5LA1A 1BKSA 1PUDA 4WGHA 3KTXA 3KCJA 1B0IA 3QQ0A 1H2JA 2ASHA 4ML9A 2VKZG 3KL5A 3CV2A 3NQ2A 3LPFA 5BROA 3S2LA 2Z1VA 4IQDA 4QBXA 3SRHA 4AB4A 3URQA 1UG6A 1HF6A 1B3VA 3R5EA 2WJFA 3I10A 1TPDA 4B5TA 4KWSA 1E56A 1BPLB 3RM9A 2JK2A 2C19A 1IXQA 4MVAA 2CIPA 4ZOCA 4WY0F 2UWFA 3W7LA 2H90A 4CU6A 2DZWA 1LUCB 4XAYA 3PUDA 3GQYA 5JUVA 4Z1CA 4PRWA 4G7EA 4ZFCA 1DWAM 2IPJA 3A12A 1XLCA 3RO8A 6ENLA 1RP9A 4JBRA 1FCBA 1VFHA 2H6RA 3BH4A 1TV2A 3KVLA 3W23A 2QUTA 3BDKA 1T41A 2FPYA 4RKAA 1PDZA 3TYDA 1C93A 1IIGA 2XIBA 4V1XA 4DXKA 2YDSA 4BWLA 2VEGA 1R47A 2YGYA 1WV2A 6XIMA 3TFCA 2B0MA 3LBCA 3CQIA 5A2BA 4UTHA 4JTSA 4BWLC 4PEKA 4PZVA 4AAJA 1RBLA 3SDOA 3LGEA 4OFCA 4MDPA 4BEUA 4I5XA 3VDCA 1I1WA 4UTTC 4W7WA 3CZKA 3O7UA 3CL7A 3B9NA 5CAKA 3BCFA 3IARA 3P8JA 4KPLA 1UKQA 1MUWA 2CLKA 2PTYA 4D9PA 5B7YA 1EJUC 4L6OA 1JUBA 3EKZA 1V0NA 2C0AA 4IMDA 3ZWSA 1TPVA 3WDHA 3GAYA 3FYYA 2Z29A 1ZBWA 4HSOA 1R6WA 4H7ZA 5J5RA 3NL6A 3VD9A 1LORA 3O6CA 1MW3A 2YBUA 4Y8EA 2PUZA 4DYKA 3VC6A 9RUBA 4DBEA 3GWQA 4TO8A 5C71A 1ONXA 5G2IA 3UPBA 4WHBA 3RX3A 2P53A 5KETA 4IGNA 3IGUA 3THDA 3CT7A 3LU2A 1WUEA 4D6DA 5RUBA 4M0XA 4QISA 1I8JA 4HCHA 3CYJA 1XLDA 1XIDA 3M43A 1PDCA 3DFYA 4X2PA 3ZLHA 5I3HA 3B8VA 4GJ1A 3GVGA 3VX0A 2ICSA 2HCVA 2DW6A 1EC7A 3GHUA 2IPFA 3AXXA 4HHPA 3B04A 4CN6A 3WO8A 2PWGA 1DTUA 1KV5A 5CSRA 2D73A 4GX8A 7ENLA 1JDAA 2ACSA 4HNTA 2QJHA 1Z3NA 4HNUA 3SADA 1XISA 3RMJA 2YX0A 4C1KA 4O12A 3GM8A 4XVDA 1Q8AA 2OPJA 3CT2A 1F3XA 2DZVA 4AZBA 2A7NA 3GS6A 3EOEA 3O6AA 2PFHA 5C0QA 2PTWA 1QAPA 3BMXA 1ZY9A 1TWDA 4PMRA 4QS6A 3VIOA 1B1YA 1CXIA 3CJPA 4J27A 5A6BD 1LZOA 3C86A 1AW5A 2FDSA 4MHBA 4ZBCA 2VVNA 3C3UA 3O63A 2OWXA 3PTMA 3WJYA 5ABHA 2V5LA 5AHIA 3DBPA 1XFCA 2WJDA 3OBKA 2C18A 3RG6A 2DUXA 5KMYA 1L6WA 3VNJA 3DFPA 3CEPA 2WCGA 3OLDA 2C15A 2JFEX 4E0CA 3W1RA 4MWAD 1E3XA 4QS5A 5I3FA 1PEZA 1NELA 4NNCA 2ZOXA 5HQLA 2VX7A 4DZHA 2JBMA 1XSJA 4JQ1A 1J2BA 4W8BA 4QE1A 2B4GA 3WL0A 1AMKA 1XBZA 1QHPA 4YLWA 1XBVA 1JVNA 3CLMA 2X0YA 1E0WA 4MB3A 1ITQA 4A3YA 3F2CA 4D8LA 2NWRA 8XIMA 3NYDA 4GVGA 2FH8A 3FV9A 4O15A 2X40A 4GNVA 1LOQA 1JCTA 5EB8A 1K70A 3CK5A 2FZ8A 1QW8A 2GVGA 1PZ3A 3L2IA 1OADA 2P3ZA 3BQ6A 4JPGA 3HU7A 2QT3A 4GCXA 2CLLA 5CQ1A 3L4ZA 3WKZA 2ESCA 1N82A 3KCOA 4QNLA 1U33A 1WCGA 4UTJA 3P6LA 3NPXA 5CSYA 3IK2A 4NVTA 4DO5A 1UP0A 3PVFA 4J3WA 4QDWA 4F8XA 3TYEA 1KBLA 4HOZA 1MQQA 1KFWA 1UD5A 1HP4A 5TQLA 4IBKA 4NAFA 3FXYA 2Q09A 4HN4A 4DO4A 7REQB 3HPXA 3BV4A 2IQDA 2B7QA 4O8RA 3PC0A 5D2XA 4OJPA 3ZQ9A 1KBKA 3WFZA 3TAOA 1RH9A 1V3IA 2C13A 3G3MA 2WVSA 5FL1A 5IBXA 1TCMA 2J6VA 3EOLA 2YLAA 5E9XA 4QEHA 2IQ0A 4LV4A 1LF1A 1PKYA 5HATA 1F3WA 3VGHA 3WN6A 4B16A 3AU6A 4GG9A 3O0FA 3B40A 2VGBA 1ODUA 4B9YA 3WIJA 4I9JA 4LC8A 1FXPA 1S2WA 1UCWA 4QJ3B 5IBXC 1BF6A 1YU2A 1IF2A 3HN3A 1DXFA 3LM3A 3TN4A 4H2HA 1XSIA 3DG7A 3LTPA 1C91A 5A8QA 3LCXA 5D8WA 2GJPA 3PHAA 4HCDA 4U28A 4WDUA 3LV5A 1M1BA 4U3AA 4YYCA 2DVUA 1GUVA 4JCLA 2WSQA 2W9MA 1HVQA 1UR3M 1C8VA 1KLZA 3CUIA 1X97A 1UWTA 4H6RA 4ZENA 2FZ9A 3POCA 2YXGA 1NFGA 3CQKA 1W31A 2VZVA 4PB4A 3N14A 3VNIA 3L28A 1ZTVA 2VOTA 4ORIA 1OFDA 3AHZA 2WJEA 4LS2A 1XIIA 3WD3A 2HV5A 3MMTA 5TBOA 3DYPA 2BB0A 4QP0A 5HJXA 3BV7A 3OIXA 4JTTA 4AC1X 1HKVA 3T78A 2O56A 2ZXQA 5LNWA 3AYVA 1AQMA 4PRTA 4UQBA 3O3RA 1LTDA 1SZEA 3MUCA 4LQ1A 1M03A 5FACA 1E4IA 3CXOA 4AYGA 3JUGA 4PTDA 3APTA 3QBUA 3PWAA 1WOBA 4OBSA 5LHEA 4AZCB 3POHA 4GE8A 1AK5A 4DO7A 2HPIA 4ATWA 4JX4A 1PX4A 5ABFA 4NHVA 2WC7A 1P7TB 2DVTA 2E9LA 5HMEA 1YTKA 3I6TA 3K8MA 3MI3A 3KOFA 1QNSA 2XFWA 4XB3A 3NEHA 4LALA 1FDYA 3RRAA 2YYTA 5GJNA 3UESA 4GK8A 2WHMA 4C6DA 3CUZA 3KTCA 3RNDA 3H23A 4B2DD 1W9BM 2WHKA 3PZUA 2WKLA 1QO5A 2V6AA 4L80A 2REQB 4B5VA 1JQVA 4H7CA 2QF8A 3S6OA 3E38A 3F4VA 1Z32X 3FS2A 3ARRA 1EC8A 1DTNA 5F2MA 3FLUA 3BVJA 4MWAE 1SPQA 2CESA 2VR2A 2VZUA 5I7GA 3WNMA 5D9MA 1L6GA 4IMEA 4H3DA 5PTDA 4YU1A 1IEVA 3VD3A 3AXKA 2TMDA 3P5YA 1G4TA 1UD8A 2OX1A 3CZGA 3WDPP 1VQTA 1L2UA 3LXBA 5C2CA 1Y0EA 4PBGA 1Y5WA 4ZL1A 5CLTA 4NZ3A 1K6AA 3N2BA