4NYYA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 2 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
405
structure length
405
Chain Sequence
TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 145
structure length 405
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyyA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyyA01
4NZ5A 1W1B1 3CL8A 5BU6A 4NZ3A 2C1IA 1Z7AA 4L1GA 2CC0A 4NYYA 3RXZA 2NLYA 2W3ZA 4M1BA 4HD5A 3VUSA 4NZ1A 4OUIA 1NY1A 2XU2A 4NZ4A 2DFAA 2E67A 4U10A 4V33A 4F9JA 3WX7A 1W17A 3HFTA 4NY2A 4WCJA 1W1A1 1XW8A 2VYOA 3S6OA 4F9DA 3CL7A 4NYUA 2C79A 2QV5A 2IW0A 3QBUA 5JMUA 2C71A 2Y8UA 3CL6A 1V6TA 2I5IA 4LY4A 2C1GA 2J13A
chains in the Genus database with same CATH superfamily
1JL8A 3M0VA 3QMRA 1UD6A 4DBSA 1TB3A 5F4XA 4HU8A 3RRXA 3A12A 4S3BA 4HK7A 2NX3A 3UG5A 1X8CA 5GJPA 4OBTA 2PC8A 3HJEA 3OZMA 3AALA 5HWJA 2VRKA 5EMYA 2GSJA 3MHGA 3ANUA 3CM4A 4DB7A 3W86A 3UESA 1MQQA 2ZUSA 4IG2A 1KXVA 3SGZA 4X2PA 5H6HA 2O7SA 1AQHA 2DUZA 2J8TA 3PSWA 4HNLA 4IBGA 3BE7A 3PZQA 4O50A 2WAGA 2DSZA 4JTCA 1IEIA 1DKWA 2QMJA 3FJ4A 1CGVA 2PURA 3LHTA 3WD0A 5E70A 5LNSA 2ISSA 3RAOA 2ZX7A 3RN6A 2Z29A 3IIZA 2FJKA 4PBEA 3T55A 4TU1A 5CSYA 4URIA 1DXEA 3KBJA 4BI6A 4J3ZA 1IXNA 1YXCA 3N19B 4NAEA 2ZZ3A 1QK2A 4LW7A 4DO5A 3IIXA 1PKYA 3VDHA 1A5KC 1S5TA 5D2TA 4C60A 2ZCGA 1M03A 2J8GA 1S5MA 4YTUA 1NJJA 5EFFA 3NQAA 3BTNA 3P2VA 3G22A 3L2IA 4M1RA 2ZRUA 3USZA 3W7NA 3L2LA 5FI8A 2Y88A 5IHRA 1U83A 2GVGA 2GOKA 4V2XA 1ELSA 3WBWA 5EKYA 1XUUA 4LBSA 3BCFA 1ONXA 2RGLA 4ZB2A 4DBWA 2NUXA 3MTWA 4Q8VA 3CTLA 4CU6A 3O07A 4YPJA 2KX9A 2O9PA 1MNZA 3GR7A 4GNJA 2D49A 1W32A 3V5FA 1W9VA 1E55A 4PCFA 2PF0A 3LBMA 3RITA 3SUSA 5A1AA 2UY5A 1KXQA 2PF8A 3LN3A 3RU8X 3LDVA 4JQAA 2C0HA 1BTCA 3VFCA 1AODA 3HGJA 3U2ZA 1XLJA 3B8UA 3NURA 2Q3RA 4JCLA 3IGUA 1V8EA 1SJAA 1CT5A 3AFBA 2ZE0A 3ZZ1A 4S3FA 5JMUA 1UUMA 3QHOA 5C8BB 2H8XA 4AZBA 2PZNA 1ZJBA 3GK0A 4FOKA 3FAXA 3N2OA 4M0XA 4HD5A 5AB3A 2V68A 1BKSA 4PTDA 3BCJA 3V1HA 3WJYA 3OZPA 5CQ1A 1RP9A 3GH4A 4GXWA 4QXIA 3WDQA 2W27A 3WK2A 2QV5A 3AXKA 2QUMA 4FIRA 3UG3A 4N9DA 3H2OA 3VZXA 2BY0A 1C9WA 4GHAA 3SGGA 2G4FA 5HJLA 1GKQA 2DSKA 5JIWA 3RG6A 3NQMA 2Y2OA 2NV1A 2IW0A 3OLDA 1ZJAA 2NWSA 1X38A 5T8GA 1JZ3A 1ENUA 2GVEA 4H2CA 1NP0A 1GG0A 4EX4A 5AFDA 3WLMA 1VEMA 3TU9A 1R30A 1QUMA 3L21A 1KGWA 2DT0A 2GGJA 3UG8A 1XHGA 2HXUA 3L27A 4HNUA 5GPRA 1OQFA 1BFNA 3MUXA 5DELA 2BZNA 3TSDA 4X61A 2FZ8A 5D2VA 1V0LA 4DYJA 2C13A 3SCUA 1JCXA 2A1YA 1JZ6A 2WYSA 3ABXA 3FEMA 5REQB 1BXBA 1OM0A 3BURA 3TWBA 5G2IA 4I6KA 3TC7A 3MS8A 1THFD 2VWTA 1UUQA 4NIRA 1JF5A 5JIPA 2J75A 3L68A 3MP3A 3TCSA 2VFFA 3PAJA 2OELA 2JF6A 1O7AA 1OBAA 1IZJA 3G1SA 3R79A 4QTGA 3TZFA 1A4LA 4UR7A 5HMEA 1ITCA 2VRQA 3CUZA 4KQNA 4OTKA 3C4UA 4F0SA 1EJWC 3ME3A 2HRWA 4JHZA 4GD0A 3TTOA 4GY1A 3AMDA 4C90A 1KXTA 3UBPC 1XYCA 4FO4A 5A69A 3LYEA 2QZRA 3VUPA 2E9LA 3KX6A 1OFQA 3BAJA 4E4FA 5DMLA 4H7VA 1OEPA 5EMLA 5BPVA 1G01A 1U2YA 1YPIA 4WOZA 2JGQA 1T41A 3NZPA 4AYSA 2Z25A 5KMYA 3CH0A 1VBGA 3TLQA 3UFYA 3CK5A 3P81A 1KRAC 2E6AA 3RCNA 3KLKA 4QAWA 4IBCA 2OR2A 4ONVA 2YDSA 4X0NA 2V5LA 4JDYA 3LQLA 1LLZA 1OC5A 1R2SA 2PDGA 2ZRZA 2VZTA 4GY0A 3QXBA 1M7OA 4IP5A 5DBTA 3CHFA 3G1AA 3F5LA 2VVNA 4N9CA 3U4AA 3MI2A 2AQOA 1ZLPA 4W7WA 1MFVA 3LPPA 2QIIA 3FSUA 2G3JA 3PTMA 3MJYA 2PMQA 2R14A 2IXVA 1FDJA 1E3ZA 4CQCA 2QKFA 4JFVA 1FH7A 2UY2A 2BODX 1K70A 3OVPA 1MXSA 4ZO8A 1M3UA 4QHRA 3B0XA 1BVZA 3O3RA 2ZUNA 5AC7A 4F66A 1GTHA 4ACZA 2A79A 4L9YA 2VGIA 2TAAA 1L6SA 5LNRA 1XDLA 3BCDA 2YZRA 5FD0A 1OSEA 3V36A 4TX9A 1EH9A 2E9BA 3LLFA 4H9UA 3AC0A 3SCPA 4LPCA 5E9AA 3GTNA 4B5UA 4IT1A 3H21A 1CENA 3T09A 2WVSA 3QC0A 2WNZA 1SR9A 4FEZA 3KXQA 2EPMX 2V9DA 3F1QA 4CN4A 3MMUA 2ABAA 2QCCA 4G9PA 3K1DA 1PKLA 3AIEA 2VFGA 3RLGA 4BEQA 2QXWA 2YIHA 2OFJA 1K1DA 2ZA2A 3IK4A 3REQA 1TSIA 3MDWA 4LG2A 1DJWA 4HU3A 4MTVA 1OZQA 1CXHA 5LIKX 1LOQA 4RXFA 3PHAA 4CGTA 1VRXA 2C71A 1OY0A 4ZXOA 5CKSA 4RDZA 2C1IA 1ALDA 2J25A 5AYXA 3GC2A 3SCOA 5B7YA 1S2WA 4NX0A 2FHCA 2QT3A 1R9XA 4XO6A 3NTYA 5A6BD 1DORA 4U2ZA 3EKGA 2FJUB 3ARSA 2CC0A 4U31A 5C54A 1FWAC 3IJ6A 2DZTA 1T0OA 2QF7A 2D2GA 4LEQA 1NAL1 2HE8A 1WCGA 3L5AA 2HISA 5T9BG 4AZHA 1Z3NA 3CUGA 5ABTA 3FFSA 4UTWA 5BRPA 2VGBA 4Y9AA 4QIUA 1YKWA 3S42A 2FB3A 1FFRA 2VVSA 3TYDA 1MYRA 5FF0A 4BHYA 1FWTA 3PULA 1M41A 1H7NA 4WIWA 3JRKA 2W66A 2YB1A 4MYXA 3WH5A 5FEXA 5A6LA 1KTCA 3KRBA 4H8VA 1AUSL 4IIGA 4XG1A 3W1LA 2QIWA 1DIDA 3IJDA 1YEYA 4G6CA 2E8YA 5DANA 4P5UA 2WNQA 1CB2A 1KQZA 4QFUA 5CSSA 3MQLA 1N7KA 1I1XA 2MNRA 5I6SA 3IGSA 3K2GA 1O95A 4QROA 2XVKA 5I3JA 3WNOA 2Y2PA 4J4KA 3PJUA 2H9AA 1A0DA 1RV8A 3C5QA 4J3WA 3Q2DA 2F2KA 2ZXDA 5I23A 3TXVA 3KBMA 1EDTA 3KDNA 3F4DA 4ZMGA 2PWUA 5IDZA 3QYQA 1YQ2A 1W3JA 5FAGA 3GX9A 4I7VA 4IPPA 3W7PA 2WMHA 4IBBA 4HCLA 1EQPA 2WO5A 1OF8A 1GQNA 2E5BA 5BCAA 4JTFA 2EG8A 2PTYA 2VURA 3KHJA 4DUWA 4LVBA 1ZP3A 1V7YA 2ZTJA 3AYSA 1H41A 1Z8AA 1AA1B 1EP1A 1TV2A 3B9DA 3V1PA 2FGBA 3W37A 4MVAA 4TX8A 3WNLA 3GBDA 1VP5A 3HGOA 2NWRA 1XYBA 3W7DA 1CYGA 3CZEA 3AXXA 4WSKA 2Q02A 3S8HA 1GJUA 2I5GA 3EZ4A 1US3A 2YPIA 3OZOA 1TV8A 1HGWA 3QHMA 1F3TA 1VQTA 2YDAA 3EAUA 3L66A 2VEIA 2PLMA 3V3WA 2OEKA 2VQTA 4TV6A 1OK4A 1UIOA 4B92A 4LB4A 4H19A 3GB6A 1K6AA 1WPCA 2ZVIA 2OSWA 3W2UA 4GA8A 5BWAA 3MZNA 4XSMA 4JYFA 5A6SA 2DVXA 5DBUA 4WJ8A 1GCYA 5BRBA 3HQOA 3PWIA 3LTPA 2DT3A 3S2CA 1NTHA 1E9YB 2XFWA 3BOLA 1OABA 2AAAA 2PGWA 1ZUAX 1AL8A 1AH0A 1N8IA 3GXPA 1HN1A 1VHNA 3IIOA 2G41A 4W5UA 1YMYA 3WELA 1YDOA 1YUEA 5A8OA 4ZSTA 1P6CA 5DY3A 4UTUA 3KWXA 4G8TA 4GI9A 4A3UA 4ZOBA 2E1WA 3TOYA 3VAVA 1ZS2A 3H4XA 1MNSA 1E5JA 3FW6A 3EX4A 1PUDA 1PWLA 3KRUA 1A49A 1CWYA 1NDYA 3AMLA 2FH6A 2DZBA 5FSEC 1LOSA 1JD9A 4TVUA 2WSYA 1QOXA 4BWLA 3WN6A 3SURA 3R10A 4C91A 3AS3A 1R5YA 3LTYA 4MWAA 1QNOA 1TRDA 3WQGA 1UD8A 3TQKA 3DG3A 4GNKB 3F5KA 2BP1A 5I06A 1KBBA 3PANA 5D2WA 4NJJA 1UP0A 2CLEA 1KRBC 4H04A 3JUGA 1ZNNA 2E6FA 4NAFB 4D1IA 1ODZA 3G18A 1U22A 3I7RA 2R91A 3W22A 1PHWA 2ZZ7A 1HKWA 1Q6OA 3CAQA 1P43A 1PV8A 2VR4A 3FKKA 4DPQA 4MUPA 2PWHA 3CZKA 3O1NA 1EGZA 1SJDA 4CNSA 3DBPA 4EK7A 2XIJA 2A21A 3WMBA 3A9BA 4GLEA 1LG2A 2WWCA 3LRKA 2EXOA 3GIQA 1JFXA 4H9ZA 3L28A 1W1A1 4ZO9A 3GU1A 3SW6A 4JOMA 4A8IA 3GKAA 2E7FA 4F2TA 4US5D 2ACUA 4QR6A 3CPUA 1HUVA 2I56A 3PNZA 1NEYA 3DKLA 2C8NA 3KBWA 4P7NA 3KHDA 3GDRA 3QV7A 1MFUA 3NGJA 5KZMA 1KBLA 1ITQA 2DSWA 1PDYA 4WKHA 5D30A 2YYTA 1F8MA 3KVJA 3MYPA 4NNAA 4OHQA 3WK0A 2J7DA 4DBUA 4IBFA 1J0KA 1LZOA 5DN1A 2X0YA 3LG3A 3U4FA 1LBLA 4NZFA 1OX5A 1UR4A 4CU7A 1H11A 2QMKA 3NQ7A 3RK8A 3AIRA 1XL9A 4E2BA 3VDGA 5L9FA 1DTNA 2QUUA 3RPTA 3ANYA 4QAIA 2D2HA 1GHRA 3C2VA 2DJLA 3N2BA 3L2AA 1R7AA 3WMCA 1VYSX 2QDDA 4I6VA 2A3HA 5LZLA 4AZ7A 4GI6A 5E0CA 1W5QA 4H6KA 4DZHA 3WEOA 4GYPC 2OEMA 2GFTA 2WSPA 4PTVA 5KZEA 4LUJA 2CBIA 3BK0A 1P0KA 1RR2A 3QQ1A 1DJYA 2Z0IA 4X22A 4IFKB 3RO6A 2G96A 2DH2A 3FN9A 4O19A 3N3MA 1W3LA 4FOUA 1IXPA 1WDQA 4N6EA 2NXIA 2XVGA 1YDNA 5GNZA 2C6QA 4UMCA 1W9BM 4X9YA 3HIJA 4IZGA 4LUSB 3SJ3A 4LRTA 2PWDA 2DVUA 1MQRA 2QF8A 1A5UA 2P0IA 3GXFA 3ITVA 4XVEA 4ZOEA 3MY9A 5CG0A 4YYFA 4H83A 1DJNA 5KZ6A 1JULA 3OLGA 3MCNA 3VIPA 1WAWA 3NL2A 3WENA 1BXNA 1OT2A 1I60A 1QOQA 1UWIA 4HN4A 3NQEA 4BCEA 2PSNA 1JVNA 3EMZA 5LNWA 2Z1BA 5HMDA 3IRSA 2EBNA 3GXNA 2EG6A 1VBRA 5BW6A 4G7EA 3NWRA 4IBJA 1KXHA 4O15A 4RPQA 4LWWA 1XGZA 2WLZA 3M0XA 3LBCA 1H2JA 3K4WA 1W3KA 1YNQA 4IUGA 2HCVA 2XGIA 1KD0A 3TW9A 1TV4A 2F6XA 3NYZA 2G0WA 3VOGA 2YCKX 3UR7A 1Q13A 4LJ3A 1XCXA 4EXQA 1EF2A 2JBMA 2WB5A 4YS1A 9XIAA 4M7SA 3OTRA 3TWAA 5DXXA 2X0HA 3E2RA 4UNKA 2VEMA 3KBSA 5AECA 1H0GA 2PRHA 5AC6A 3TP4A 4HZ7A 3M4HA 2J4GA 4TR9A 3BSMA 4KEMA 1X1NA 2UV8G 2PP3A 3JZEA 5ABFA 4XKMA 3W7IA 1UROA 4WDUA 4ZQOA 1W91A 1GGOA 4V28A 4Q8TA 1VR6A 1Z69A 3MZ2A 4DLFA 3LOTA 1H49A 4IQJA 4JIIX 4ZE4A 3KW3A 2PDPA 1E6NA 1OGSA 3AISA 4YMZA 5FJOA 2E8ZA 5HWNA 4L64A 3TQPA 1VFFA 4AD0A 2R94A 1Z7AA 1Q4NX 3E5BA 2PDNA 3BG5A 4DNMA 3P14A 3UVIA 2YXGA 4G5DA 3CH9A 5IFTA 2P53A 5HJYA 4A6GA 3MYOA 4LAKA 2IKIA 5JH2A 1XBZA 1QMLA 2DY3A 3OJGA 3PFMA 5E93A 1PX4A 3GY1A 2IKHA 2ODOA 4RE2A 2HTMA 3CL8A 1JIBA 1H7PA 3VILA 2VKZG 2XZ7A 1EO7A 3RCYA 4D6HA 1XIDA 1RK6A 2X0SA 4Q4OA 1POKA 4F48A 2JQXA 2RHGA 5KTLA 1C9DA 4PRTA 2BTMA 2DJXA 4A35A 4ACYA 4C6LA 2NVDA 1GVYA 4L7ZA 3N9SA 3PP7A 5C9XA 2XTKA 3K8LA 4LALA 3LRLA 3P67A 4GHLA 3LA4A 5AZ0A 3KDOA 4QG6A 1AMKA 1DJIA 5HBFA 3L5MA 1IT0A 1P7TB 5E5CA 3RPMA 4IH3A 3IV8A 4HMNA 4GQGA 4BEUA 3CTTA 4H9TA 3PTKA 3GE7A 3NO5A 3NQCA 2WQDA 3PBYA 2BHUA 1BHGA 3QW3A 4I90A 4GKTA 5HANA 4LCQA 4MLJA 2AGKA 1RSCA 5JQ9A 1L8PA 1XC6A 4MZ1A 4IP4A 2B31A 1OFAA 5LKYA 1XI3A 4QCEA 1CXWA 2QNEA 1Q2SA 4A8RA 4S3GA 8A3HA 1EWDA 1HGYA 1F61A 3NEHA 4DO7A 1P1MA 2WMKA 1A5SA 3BV7A 1M53A 3UGVA 1E4NA 1DQUA 3NG3A 2GJXA 4HYRA 3PBGA 3PB2A 3FVDA 4O18A 6TAAA 3P0WA 3VOJA 4NI3A 1DBTA 2BWGA 1TTIA 2P8BA 1DJXA 3A13A 3L7RA 3TYUA 2DQWA 2QHAA 3ARPA 3O0KA 2V5DA 3OP2A 1F3XA 1WDWA 2XFYA 4MLRA 5I00A 2DU2A 3P60A 1VFOA 3KOFA 3BGGA 1EGMA 1DIEA 3VD3A 4WF7A 1OX6A 4LAUA 4M6UA 2ACRA 3DFOA 1ECQA 3VNMA 5CZSA 1EZ2A 5FF3A 4LAZA 1UYQA 1V3IA 2A6NA 1T5AA 1CGXA 4HOWA 2GVJA 1PS9A 4XD3A 2O4QA 1SMDA 2X41A 3LTSA 1NQKA 1S2CA 2JFEX 1A5AA 4BZYA 2CZEA 2FB2A 3DFHA 2V5CA 2VP8A 3EPNA 3FX4A 2XSBA 3LZ3A 1OVDA 3TYCA 2OLHA 3HG2A 3GFXA 2OTDA 4GNVA 3ARQA 1OWQA 3VGHA 4JD4A 4L61A 3VD5A 1E71M 2VR2A 1LTDA 3GNNA 1H09A 2WJFA 4HGXA 3OLIA 3IAQA 4W7VA 2OYLA 1J0JA 1LQ2A 2CESA 3QHNA 1O94A 3BOXA 3GLCA 5BZAA 3WCZA 4UCGA 1XS2A 1XSKA 4MUZA 3TMQA 3CHDA 2WV8A 3PF3A 1CEOA 3IGXA 2WXDM 1M5WA 2Y8KA 3UEQA 2EF9A 2YBUA 1VIWA 5FKYA 4XAPA 3V35A 2YA2A 3W1AA 4NXSA 2FZMA 2V5OA 1JDFA 1HJVA 3N17A 5H1WA 3C0SA 4K36A 4L80A 4LRSA 2XIIA 1OFOA 4L4MA 4KEUA 4Z2KA 2R1LA 1AW2A 5F1UA 5FJTA 2ZRVA 1RJQA 2YJQA 4C6FA 3LNPA 1FH8A 1UOZA 4EOUA 4B5WA 3MBFA 1PIGA 4HSHA 5HQEA 2NW0A 4FX7A 3L25A 5JXQA 1EF3A 1ZJHA 2QYGA 1G4PA 1JUBA 2YLLA 4QJ3B 2HROA 3SCQA 3TA6A 1C8XA 4D2JA 3S5OA 4QEEA 3WNNA 2H90A 3CIXA 4FX6M 1IYXA 4P8XA 4D1JA 4LYRA 1YBQA 3WIJA 3I10A 4Z0SA 1A3HA 1TMHA 4JDBA 1J0YA 3TXZA 1LOLA 2D3NA 4PRWA 3FOKA 1HP4A 2JIWA 3KL5A 1DE6A 1BG4A 3NM3A 1H7OA 3GW3A 4POCA 5HMSA 3W7EA 4Q4KA 2XYLA 3W24A 3BG9A 1V3JA 3CL6A 4WXYA 2FGZA 4H41A 3O6AA 2F9RA 5JBEA 3KRSA 1S5NA 2QCGA 1TA3B 3LRMA 2PTZA 4CD6A 1V0KA 4QBXA 3AHYA 1KM3A 1UR1A 5T9CE 1E6QM 3W53A 3ZLHA 1IXQA 1BSIA 4C6OA 4ZSUA 4LUTA 3QC3A 4PCPA 4BS0A 2BLEA 4UTFA 4AF0A 3W7OA 3SBFA 4C65A 1E9IA 3M0MA 3JZUA 4GACA 3R11A 3I65A 3T0CA 4K38A 3AIBA 3CO4A 4O0QA 1PYMA 4QLKA 2QJHA 4KEZA 4UTKA 2G50A 4A8LA 4HNCA 1Z9AA 1WB0A 1JJKA 4EP8C 1N2VA 3LD5A 5C6MA 1VS1A 3UXLA 2BXZA 3G5EA 4EANA 1Q8AA 1W2VA 5KETA 2OYMA 3S3GA 1O5QA 3W00A 1MDLA 3WQ6A 3CUFA 4QJ5B 4AVOA 3C61A 4GYFA 3MJMA 2Y8UA 3IIVA 4F4RA 3PZGA 4K1GA 1QBBA 2OLAA 3OVQA 4AW7A 4LS1A 4KPLA 1UPPA 1QHPA 4CD5A 5LA0A 1OJXA 4S3JA 1X39A 2WKLA 2YZ5A 1J6OA 5GVJA 3W74A 4M6VA 4LUSA 2OVLA 4GE8A 4IBIA 2EJ1A 4MY9A 4GQQA 3W0KA 3COTA 4AZIA 4W8BA 4DXVA 4EKJA 4BWLC 4MFEA 1HX0A 3KCLA 1UQYA 3TAOA 4NZJA 3TW7A 1U30A 4AUBA 2Z00A 3W75A 3VNLA 4K37A 1CNVA 4G1NA 3W7HA 4NUWA 1XIBA 3RPDA 1L2UA 3EXSA 1M01A 5GJMA 3KE0A 1EC8A 3BDKA 4RDYA 4AD1A 1NOWA 4O11A 3CV1A 4WOQA 1VFMA 1PB0A 1H63A 2WC7A 4AQLA 4ZB5A 1Z32X 4GPNA 3NUKA 4H6EA 1CIUA 1AVAA 2PA6A 2ESCA 5DXYA 1MVYA 1E6PA 4LQ1A 2E40A 5DO8A 1YRRA 2V8ZA 3LI1A 3AHVA 3S6OA 3DXIA 4D6CA 1C8YA 1BVWA 2E6DA 5F7UA 1GVEA 1QATA 2Z7GA 3UT0A 2QR6A 5T26A 3WDRA 2QLYA 2IXUA 4ZFMA 4RW5A 1VEPA 2BS9A 4FK9A 4Z2JA 2PDMA 3BANA 4BI7A 2H6RA 5CJNA 2D3LA 1LBFA 2P88A 4CCCA 2VQUA 4AFYA 4JX5A 4HQVA 3NNTA 1D7FA 1NIUA 2HQAA 3TA9A 3TNBA 4UQBA 7A3HA 3M5VA 3UR2A 3WKZA 3BW3A 3G6MA 4AISA 1V6VA 5AYYA 3GRIA 3LHZA 1JPIA 3GIYA 3A24A 1YHTA 1PE1A 4Q8OA 3NQ8A 1QHZA 5HULA 3IJ9A 3ZR6A 3HPAA 4CN6A 4ZFCA 1H0IA 2WPGA 4MFDA 1EZWA 4EF8A 1TV5A 2F6KA 4QDPA 1PDCA 1E1CB 2XUCA 4NL1A 4U33A 1EYWA 2Z6JA 1FWHC 3NR0A 3U2CA 1LLWA 3VIKA 1ZPTA 3K4DA 1XPYA 1TQXA 5E0KA 3P3BA 3G0UA 3T0BA 9XIMA 1PO9A 3HQ1A 5G4HC 3TK7A 3U48A 1NFPA 1F4AA 2P3ZA 2BXVA 1GQLA 2FFIA 4LS0A 2FTPA 2YFNA 3D5HA 3BPWA 1X1OA 4GINA 1XINA 3OQEA 3T6CA 3VM7A 2WW5A 1FOBA 4C6DA 2DT2A 3K13A 4AH7A 4H00A 5D8WA 1OHLA 4QS5A 5FL0A 1D3HA 2G4JA 5BOOA 1P7TA 4RNFA 5LNVA 4KCWA 3MMWA 5HR7A 5LIYX 1LM1A 3MKCA 4DO4A 2Y7FA 1Q7QA 3WL1A 4AHPA 4PBFA 1ZBVA 3D47A 1B9BA 1XX1A 3QY8A 3NCOA 1SZNA 2PE4A 4GC4A 3OLEA 4PUJA 1O5RA 3P8JA 1K4GA 2NUWA 2XN2A 4MYAA 1US0A 2WMIB 2CZVA 2OZTA 3ZMRA 1ZL1A 3KS4A 4MAZA 1NELA 1K9TA 1W0MA 3CUHA 2J9YA 4RNHA 4AZ6A 3S1UA 2VCBA 1VFHA 3SCSA 1QAPA 4DVOA 1LUCA 3CLMA 3IEBA 3OGRA 3UZXA 1MUMA 3ARXA 3P5ZA 1KC7A 2E25A 1A3WA 1SO4A 1XG4A 3DERA 2FZNA 4D6JA 3J7HA 4AD5A 1UKQA 4X63A 4YHGA 1R0MA 2XN0A 1J5TA 2HEJA 2AL2A 4LSBA 4UFJA 4JGDA 4XX6A 3SUTA 3FAWA 2XIOA 4UTJA 3VIFA 4HB7A 3E49A 2HVNA 4D6GA 4CVWA 3N14A 2V3FA 4JTAA 1E0XA 4A3RA 4AWSA 2G95A 2EAWA 3H2FA 4FF5A 1QCWA 2PZ0A 4E6MA 3CT2A 4JFUA 4G56A 4REQA 2HPIA 1EXPA 4I5RA 3WDJA 1KFLA 1IGWA 5A2AA 5KZDA 4S23A 3ZJ6A 3LXCA 1F6PA 1PZ0A 4IQEA 4DJDC 3PZOA 1ZY9A 3I3DA 3H2MA 1XGEA 5CC6A 3ARRA 4O28A 3N2CA 2CWNA 2FTYA 1KRCC 3UA4A 4B3LA 2BDQA 3VX1A 3IJ7A 1ME9A 1FXQA 4MPQA 2ZUWA 2FZ9A 3ZIZA 1GEHA 2TRSA 2Y24A 2Z26A 5FACA 3VDCA 1IIGA 4C7FA 4MB5A 4GYKA 4HTBA 2OKOA 2P10A 5I03A 2EEXA 3ZVIA 5BROA 3HM7A 2GUBA 4GIRA 2PRLA 3M0KA 1K6WA 1DOSA 4GI4A 4DAIA 3TFCA 3TR2A 4MAVA 3GYEA 4JYDA 3PM6A 4P2VA 2VT0A 4JTSA 1WDPA 5FCZA 3M07A 4H7CA 3LSCA 4LGXA 4O4WA 4HA4A 2QUNA 4NZ4A 3XIMA 3R12A 4ATWA 2OQHA 1BPLB 1HNYA 1UASA 3PJXA 1P6BA 5GJNA 1BWVA 4E2VA 8CGTA 1QI5A 2OX4A 1B3OA 4PFMA 4IMEA 1V51A 2ZRYA 2QCDA 2WVUA 1I2NA 4M56A 1KCLA 4XAYA 1WDSA 1S2UA 3VM5A 3UP8A 5LGXA 1BF2A 1G5AA 1QI3A 1SW0A 3WY1A 3ZWSA 3T2OA 4LY4A 1J01A 3TIMA 2Y7GA 5C71A 4H7ZA 3DUGA 3ITCA 3QV9A 3VUSA 4QDMA 4U28A 3W27A 1UWTA 1E0UA 4C5ZA 4OECA 1REQB 4R7WA 3LHVA 3GYCA 4Q4SA 3VCRA 4XD6A 2YSWA 5DCBA 2OWXA 3G77A 3XISA 3II1A 1W1B1 1A5CA 2DGAA 1KM5A 3CMFA 1C29A 3TKFA 3AYRA 1Z42A 3BAIA 4DJFC 1MEIA 1B0IA 3GHRA 5AC4A 4CCZA 1KNWA 1B1YA 4F0LA 3L12A 5A8GA 1PIFA 1TPC1 3ZQ9A 2WCAA 3VIOA 3OBEA 3LS9A 3WFZA 4S3DA 1LRNA 3BOFA 3GTHA 3IUHA 5CLTA 5HK4A 3W7LA 2PBGA 2DZAA 2OZ8A 4IISA 4HZMA 5B80A 4H3DA 4O53A 3W2MA 2IPJA 4UIOA 5LA1A 3QSRA 4GJIA 3B8IA 1V5XA 3G8EA 4ZEPA 3FEQA 1VZWA 2ATMA 1UZDA 2WVVA 3DGRA 3AZTA 3KWSA 1XIGA 1TCMA 4ZE5A 2Y85A 4JBRA 1BTMA 2GDVA 2QCHA 1JDEA 3W1NA 4WY0B 4WUIA 3VYLA 4IGMA 4KCVA 3MI6A 1R3QA 3N73A 4ZOAA 1VRDA 1C92A 1JDDA 1YTEA 1S39A 2E4TA 4Z2HA 4XD4A 1UG6A 5M3WA 1I8JA 4PN2A 4GRSA 1QOPA 4PMXA 2DZWA 1W31A 4CUCA 1PKNA 1E56A 1ONEA 1S1PA 3AU2A 4A4AA 2ABBA 3W7KA 4A21A 3RM9A 3INPA 1R38A 2B7NA 5IHSA 4GG9A 3ZVHA 4UFMA 3AS2A 3GIPA 1W56A 1C7TA 3R0DA 2BG1A 3ZR4A 3UXDA 5K9XA 2BXYA 3TC3A 5K4XA 1M9HA 4RJEA 1CGUA 2IPGA 3ORWA 3GTIA 5G2HA 3ITTA 4GCXA 1XWYA 1RD6A 5CZTA 2ZRXA 1GOXA 3EKLA 2OT1A 4NZ1A 2Y5EA 4XZMX 1IWPA 3N3FA 1BRLB 3W7RA 2E28A 4PUKA 3AIQA 3T07A 5CSRA 4DWSA 5D33A 5A6BA 1OIFA 1EIBA 4R85A 4N4PA 2BASA 1C90A 4R53A 4G1KA 1R86A 1YNPA 2R6OA 4AIBA 4D9PA 1UR3M 3UWQA 4HU4A 4ZQMA 3FGCB 3SQLA 1WYIA 4C7GA 1PSCA 1H1NA 4GIEA 3SSJA 3FS2A 1XKYA 4MZ8A 3N9KA 3S5ZA 1JDAA 3QRHA 4DZIA 3H12A 4ENLA 2ON3A 2Y8VA 2YL8A 4ORMA 1FHDA 3GHTA 4AY1A 4U4MA 1I2QA 2Z28A 2HVOA 1XPGA 1QO6A 4UFIA 1TPUA 3LHYA 1FHVA 3NPVA 4Q8QA 1QNVA 2D0GA 3CT7A 1CGTA 1Q6CA 5F2MA 4QLLA 4K39A 1ZU8A 1D3GA 2PU0A 1XIJA 1TREA 2G5WA 4QS6A 1JFHA 3TYBA 4CVUA 3E2QA 4FHAA 1LJYA 1LWIA 2OO0A 3MO7A 1RJRA 5ABHA 3BUVA 4UQ9A 3W71A 4OJOA 3AJ7A 5MHBA 3IJIA 4EE9A 1LRQA 3PY2A 1FWCC 2OYKA 1P0BA 4JAWA 1FWNA 1G1YA 3P74A 3L4ZA 2J24A 4L1GA 4PL2A 2YL6A 2FGLA 1RAKA 4ERIA 3U7BA 1JPDX 3OODA 2QEZA 3UPWA 4ZGYA 3GG1A 3OHIA 1HJUA 3W84A 4K8HA 4ZODA 4LAMA 1R6WA 3RF9A 3U57A 4S39A 3UD6A 3KOZA 5FL1A 5K9DA 1WXZA 1OGBA 1OGGA 3TC6A 3VNIA 1A4MA 1B30A 3U6WA 5AHEA 3CAVA 4YTTA 2R1NA 4UR8A 2EPOA 4LU0A 4PYSA 1DPMA 1QW9A 2PGFA 4WY0F 5M1TA 3BAXA 5CPOA 3N6HA 3ZO9A 4PTMA 7TIMA 2XD5A 4WR3A 3S83A 1MQPA 1UHVA 4NAEB 1F3WA 5AYBA 4KRZA 3DHFA 4NQ1A 2QJGA 4IMGA 5H91A 3CB3A 1YE6A 3W85A 2WM0A 2OGJA 4OJLA 1O4UA 1FP9A 1JCLA 1M65A 4ERAA 2Z1XA 3I6RA 1RK5A 3CU2A 3UYCA 2QUVA 3TJLA 7PTDA 3F4WA 1V3MA 2UY4A 1W9DM 4FNSA 4D71A 3VE7A 5CJMA 3CJPA 2REQA 1W1PA 5H8MA 3HPSA 3YPIA 2X8RA 2E9MA 3MT1A 3RIKA 5IM51 2WMIA 4IJCA 3WLOA 1GKRA 1TVNA 2PTDA 3RHGA 1OF6A 3ITGA 4ZOCA 3NZGA 4DF1A 3UNDA 1QFEA 4KERA 4UB9A 3R8RA 4UTIA 4QE5A 2PODA 3QZ6A 1HZYA 4JQ1A 1H5VA 1QJWA 1QWGA 3VKDA 3ITOA 2O56A 5G5IA 1K8CA 3ARWA 3EDJA 4M1BA 1FUYA 2VX6A 3LPFA 3T78A 3GG8A 4H9MA 5LYRA 2BG5A 5IOBA 3SCNA 3TYZA 2VHLA 1RP8A 4IUOA 1Q5MA 2NVAA 1J7MA 1HT6A 7REQB 4RNJA 2R9RA 4N2YA 3A21A 1TTQA 1UA3A 4KRUA 2WMFA 1UOKA 1E1FA 1TR1A 4X2RA 1VD6A 3W2LA 5A6KA 5BNKA 2J7HA 1BAGA 4GQ0A 4DBEA 1GOWA 2P3EA 1D7KA 5I07A 2QPSA 5JBDA 3DG6A 2OO6A 2QPUA 3B0YA 1DJQA 1W17A 1V6WA 1J12A 3GH5A 4US5A 5LHFA 1SPQA 3M9YA 3SN0A 2RDTA 3OHMB 2Y2NA 3KS5A 2PEVA 3WDIA 3L29A 4A8NA 1SJCA 4LY8A 3URQA 4OJ5A 2NSXA 3WQPA 3TVAA 4AIUA 4C7DA 2X2GA 3MV01 1RJPA 1V6XA 2W61A 1IEQA 1QW8A 2Q71A 4RDWA 5C70A 3W6LA 2O92A 4YVVA 2HS6A 4KETA 1UKPA 3VC6A 4WJEA 1BEUA 1KKRA 2AMXA 1V79A 1MO0A 1W9PA 3VINA 2VJXA 4GISA 4PMUA 2Y1HA 4HHPA 4S2BA 2INFA 3T0TA 1UW9A 4JEJA 3W38A 1S5WA 4IJBA 4RR4A 3HQPA 4PUDA 2CHOA 1WBJA 4M6PA 2NV9A 2OWWA 2E5CA 3LHWA 3KP0A 3W82A 3STPA 3M6DA 4OJYA 4XZBA 4C6EA 3L0KA 1HXJA 2ZA3A 3O8AA 1UJQA 2J7CA 4M80A 4GFSA 3NQDA 3IVSA 4V1XA 4D8AA 3PPGA 3F4NA 3W28A 4XBKA 2HV5A 3H7RA 3WF1A 3AHZA 1AL7A 1GONA 1UBPC 4QSHA 3IIPA 1KB3A 4GMEA 1LQAA 4YTRA 2X1TA 3I7QA 4AXKA 4WGHA 4M19A 1AH4A 2Y62A 3WLRA 3A3XA 3S5SA 3P84A 4PTNA 3RYSA 4J3XA 4QQ3A 3CZLA 1OZMA 1L6YA 1P0EA 4X3ZA 3BMVA 2GLKA 3DAQA 4PODA 5EBAA 4E0CA 3C6CA 4B5NA 1R3WA 3LCXA 3HF3A 3ABZA 3WD2A 1UC4A 2YGYA 1AQFA 1ZP4A 5KSWA 1V0NA 4OV4A 1WDRA 3RRAA 3IPWA 5F4SA 4XTDA 4AIOA 1FWDC 3A5FA 1JGMA 4KH2A 5BMWA 2ZQ0A 3EXTA 3XINA 1HF6A 4W84A 2VTFA 4AD3A 2OOGA 3DH7A 2C19A 1TRIA 3OA3A 2WHKA 4CEXC 2RJGA 4AY7A 4QGCA 1CDGA 1DJZA 4RX0A 4FLOA 4GX9A 1V02E 5D2YA 4JTTA 3V5CA 1WZLA 8TIMA 4BA0A 3UWUA 5D38A 5IBXA 1P48A 1Y5VA 3GUWA 5MF5A 3WQEA 1W3TA 4DY1A 1BYCA 3RNDA 1R47A 4ACZB 4ZZ9A 4DEFA 1Q7MA 3S1WA 2VOTA 3MPGA 1CGWA 2F2HA 3LXBA 4C6NA 3KZPA 4B15A 1R3TA 1ESWA 1W3IA 3QKEA 1IE7C 4NRSA 3HOJA 3E12A 3VKJA 4PMQA 4H6QA 4R9XA 4NZCA 3TE9A 1OYCA 3THAA 1EBGA 5LIUX 1SVDA 2PDFA 2RDXA 3LB0A 3M5XA 1B3WA 3SAZA 3EMQA 1P5BA 3BGAA 1SSGA 1XRTA 4WDWA 3H4WA 1E15A 3D0CA 2VGGA 3U2EA 4Y8EA 3NSXA 3REQB 2J78A 2XFRA 4K8GA 1SO3A 3WF4A 2FN2A 3CXOA 2PWEA 3QZEA 3LPOA 3GTFA 2HK1A 3FYOA 3LERA 1S46A 4XD5A 4DIAA 3HPXA 4MNMA 1XUZA 3S5NA 1BRLA 2VFIA 3FCPA 3EEGA 3GXTA 3E3HA 5CG7A 1TX2A 3B40A 4W9TA 3EOLA 2RTSA 1UB3A 1V6UA 1Y7VA 2D73A 2QJJA 3WJXA 4V1YA 2B4GA 4HMCA 3LGDA 1JXJA 2DZUA 2A4AA 2HJPA 2ZFAA 2GQ3A 2Y2QA 1AZ1A 3M7SA 2B7PA 3TV8A 5CPQA 1UWUA 2ZX9A 1V4YA 5I7GA 3P62A 1JCNA 5FJIA 2CNCA 3VD9A 2FIQA 4XZWA 1ISYA 5HQLA 4HNOA 4JL2A 3VOHA 1EPVA 4PTXA 3W26A 1RQEA 2V5KA 2QDGA 4WQ6A 1Q63A 1RBOB 3F2BA 3CIWA 1C3FA 4CU8A 1FQ0A 2QJNA 3S1VA 3S6TA 3ZOAA 4ZQCA 3R58A 1SJBA 1B9ZA 1KR0A 4HN8A 2VEFA 2NXHA 4H8NA 4KMQA 2PUZA 1ZGDA 2Z2UA 1DIKA 2QW5A 3AYVA 3SUWA 3RFAA 4HOZA 1S1RA 4U3CA 5LNUA 3C2RA 1YIXA 1ZSXA 3HMCA 5D2XA 4Q22A 1OD0A 5CZJA 5FOOA 2ALDA 3DYPA 4TXEA 2FVKA 1CBGA 3ITLA 3KVLA 1NP2A 3G1VA 1UWSA 1SSDA 1HW6A 2YCIX 2C15A 2H9AB 2L5HA 3KOWA 4E3TA 4HK5A 5FF7A 2VENA 3MWCA 7ODCA 2EKGA 3C0LA 1F2JA 1L6FA 5D8ZA 1ZAIA 2KZHA 3NPUA 3DECA 2WZHA 4D6FA 2P76A 5FEZA 3G1YA 4HOXA 2YKKA 1VPYA 1JZ7A 1JD7A 1CK7A 4JY8A 1Q66A 3BW4A 1PJ9A 4I7WA 1C91A 3AMGA 5DCEA 2CKSA 3F03K 1NY1A 3O05A 3PR2A 3VNYA 4RKAA 1OIMA 2D1ZA 3I6TA 1JG9A 3MHFA 1RHCA 2Z4GA 1GW1A 2C0AA 4RK8A 5CBIA 1KLYA 3UVAA 4M81A 1E0VA 1S3TC 1T6MA 1XD0A 3M7WA 5H8PA 4JNMA 4P7LA 2B0MA 4WZHA 4F3HA 4JQ4A 4JQ2A 2VEGA 2FVLA 4MWAE 1IZCA 1DHPA 5HR6A 3BAWA 2PTXA 3F5JA 5HINA 1QPQA 4C6MA 3GFZA 1EHNA 1MWOA 4LC6A 2GYIA 4ZBCA 4UQDA 3LM7A 3VMNA 1G67A 4A22A 1TVLA 3QLLA 2PDUA 3N34A 1JF6A 2XGZA 4DJEC 3VIGA 3LUTA 3RJYA 1UP2A 4O1DA 3UZYA 2CLKA 1OYBA 1LYXA 4UUIA 3PK7A 4ERGA 3QSTA 3L65A 3IJ8A 1FHUA 4JIEA 5CJ5A 1DXIA 4DF2A 2YLAA 3CEUA 1TIMA 2Z6IA 1WOBA 1B3VA 3OQ8A 1WV2A 1JGIA 1QNSA 4E5TA 3GC5A 4KF1A 1EO5A 5TF0A 3HN3A 3SCVA 4OV9A 4J3TA 3KL3A 2VFEA 4F9DA 1W9XA 2AMGA 1U5JA 2I1OA 4ML9A 1EJXC 3SIMA 1UH4A 1XBYA 2V67A 3UZWA 5I5RA 4UFHA 2VR5A 1OFRA 4KWVA 2JALA 3TSMA 3LU2A 2JEPA 4MWAB 3WUBA 1FCUA 1VFTA 1G9HA 1AJ0A 3R43A 5DCDA 1XYZA 2Z24A 1QXLA 1X6NA 1EWEA 7REQA 4UTTC 1O66A 2QGYA 2OX1A 2VD8A 4IPIA 4DYEA 1RBAA 2XIQA 4DUVA 2INEA 3H26A 4RZBA 3WH7A 5I3FA 2NVCA 3ABRA 1TIWA 4GUFA 2R1PA 1GVIA 2V2CA 4P7OA 3MQTA 4UTHA 4NJHA 2X2YA 1IR1A 4MIMA 4J2PA 4A3HA 3IUIA 3U5UA 2WVTA 4M5PA 5KEZA 3GVWA 3U9IA 1NM9A 2YA0A 1E1EA 4YTQA 1LWJA 3N4AA 3N2TA 4GH1A 2WCGA 3UU0A 4FAMA 2D23A 3APGA 4DZAA 4FR1A 2DUAA 4UBPC 4GOAA 1LROA 2VC5A 3MUZ1 1UKOA 3GDBA 2DVTA 2PLJA 3SI9A 2EPLX 4AZCA 2BY2A 1LRTA 3MC5A 2ZZ6A 1E9LA 1LDCA 1O6IA 3VGBA 1AQ0A 2BSLA 2ZC1A 1J96A 3EPOA 3A4XA 1VJIA 4E3VA 4UOJA 5C9UA 1IWAA 1PDZA 2D24A 1TCDA 2CZFA 1TE6A 1AFSA 3UJRA 5AC8A 1OK6A 4H8HA 1EEPA 3N25A 1QNQA 1NWTA 2I7GA 1B3YA 3LEPA 4XIAA 3DCPA 2VWSA 3PVFA 3EDDA 1AMYA 3MKVA 3BZJA 2AQVA 4GJJA 4FSAA 3QOMA 3KBNA 1S5VA 1G6CA 5H2ZA 4JX4A 1UD2A 4WVXA 1EJTC 4IMAA 1HJSA 1A0CA 4ZCWA 4NYUA 4JTQA 2FFCA 4YTSA 2UZ9A 1KBIA 4UZUA 4W5ZA 4IIDA 1HO4A 1SMAA 2BY1A 3H7UA 4IFRA 4PSRA 3E0IA 1F76A 4DX3A 1VJSA 1GZGA 3MSGA 3LHUA 4YCPA 2Y2KA 1E43A 1R8LA 2DEPA 3S2JA 3WQFA 4IF2A 3A47A 4AC1X 1V6TA 3URNA 3P93A 1KA9F 1R87A 4IJFA 4GQBA 3EWWA 4XUYA 4I8DA 4JIQA 4ZO7A 2VFDA 4XZIA 1VJZA 3B9OA 3WZ0E 5A8MA 4NJIA 1WUEA 3VA8A 1PL9A 1KM2A 2QULA 2XD1A 5DEZA 2OLSA 3H24A 2A7PA 4R88A 2A3AA 3H2NA 4Y9PA 1SW7A 2ZXQA 3LMYA 1J4EA 4RE4A 4KRTA 1OB0A 5EU9A 2HPMA 3DYOA 4WSHA 1GVQA 5G1YA 2A7RA 2YW4A 3GHUA 2EQDA 1H51A 5D02A 3GM8A 4O14A 3KTXA 2QCMA 4Q4MA 2A0NA 1RLCL 6A3HA 1ME8A 3FKRA 3WG6A 4H2HA 4J35A 1H4PA 3NQFA 2J7EA 1HTIA 3EOOA 4F2UA 4G7EB 1Q6LA 3ALGA 3NZQA 1GYLA 4HYWA 4MHBA 2ZX8A 4HPHA 1EUNA 3OEXA 3V5OA 1HVQA 1KO0A 4O1CA 3VNKA 5GQBA 2JK2A 3FXYA 4JNYA 4HMDA 2VUNA 1NWUA 3NL5A 2Q09A 2OT0A 5AYZA 7CGTA 2PWFA 2O55A 3THDA 2Y2WA 4NNBA 3S9YA 2BVDA 2X30A 4JFSA 5CBBA 3W88A 3N15A 1Q6RA 2X05A 2PAJA 3CC1A 2XPKA 2XGBA 3CO8A 5E09A 3PSVA 4DHGA 4K68A 3BXWA 1ZRQA 4LVAA 3FJ6A 1CI1A 1WDDA 2F38A 1GVOA 5AHIA 3BG3A 1TPB1 5DMMA 3UNTA 3KM8A 5ABFB 3NQVA 3GXDA 3WBYA 1EJ7L 3PC0A 1KLZA 1HJXA 1DWJM 1O60A 1XD1A 2BNJA 4PL1A 4DUOA 3PWAA 1DJHA 4PMDA 4Q6XA 4W8AA 2PDHA 1V02A 4GC3A 1YTKA 4IJEA 2DIJA 3R5EA 4FP1A 5HNTA 4ZO6A 3NL3A 1CXLA 2GPTA 3MI3A 3G3MA 3FHQA 4IPLA 2I5IA 3SGUA 4D6IA 5K7JA 1P0DA 4OJ6A 3WD1A 2YOCA 1LT8A 3KS6A 1U1UA 3R89A 4DJDD 3TN3A 1D8WA 5LXXA 4PEKA 1PHQA 4MPKA 1AQMA 1W1IE 3LY0A 3GD6A 2W5FA 4C6KA 3Q67A 2QDEA 3EB3A 2Y2JA 2BBFA 1QWKA 3BLOA 2Y2HA 5EFDA 3OYXA 1NU5A 1TZZA 1KFKA 2ZWYA 5AHMA 4AIEA 3GTXA 3BQ6A 3ZT7A 1Y65A 1KFEA 4IGSA 5FJPA 4IM4A 2WBGA 1UKSA 4Q8PA 3O6CA 1LP6A 4QG8A 2A2IA 3AROA 3B0VC 3VGDA 4YU1A 4NYYA 1Q85A 2P1FA 3MKKA 4OUIA 2KAUC 3LM3A 2XWDA 1E4MM 3MO4A 4N42A 4G7FA 1O68A 5A8QA 1EJVC 4CNNA 3B8TA 1QHOA 4OZOA 3MA8A 4XBSA 3DHUA 1TTPA 4V15A 2ZA1A 4M3PA 3FXGA 3AHTA 1EAKA 1XYLA 1A5MC 4AWTA 4DXKA 1PX3A 3E2VA 3S0CA 1CECA 1Z48A 2WK2A 3QGKC 3UY7A 1UPMB 3SY1A 3C8NA 2O9OA 3PS7A 5LXEA 4E38A 1MDRA 3UXKA 3V7PA 2GJXB 2FH8A 4PA8A 4UZSA 3ZWTA 2PDQA 2ZDSA 4I3GA 1DEDA 2C1GA 3UJSA 5KITA 3W7QA 4WEVX 1VKFA 2NQHA 4MNJA 4RL3A 4JIPA 3R0UA 3MWAA 2ZZ5A 1KW1A 2CZDA 5XIAA 4C5YA 1KFWA 4Q8WA 4BQ4A 3M41A 1FVPA 5AC5A 1J2WA 4O57A 5G1MA 2B81A 5EMMA 1FKXA 3MSRA 3UXAA 5FJRA 4CNOA 2VC9A 1E6XM 1BQCA 4TV5A 4DJFD 3SQSA 1VCGA 4UTLA 3EX3A 3NGFA 3FK4A 1UP3A 4RLIA 1XH1A 1RVGA 4PRRA 3ZS4A 1B57A 5F2IA 1TVPA 3P80A 5DRCA 3PBUA 3AOFA 2NQLA 4O0KA 3WO8A 2V5BA 4EF9A 1QRQA 2OOFA 3LPGA 5A8NA 4WKFA 2V2HA 2WOQA 4GVIA 4PMZA 3TW6A 3H22A 4FS9A 3D6NA 3LENA 3UYIA 4O12A 2HS8A 3GNOA 3T08A 1XH2A 4E2OA 1HL9A 3AMCA 4AD4A 3VPLA 4JTRA 4QNLA 4C1NA 3W72A 4NKCA 1PVNA 2HK0A 3SFKA 6PTDA 2WCSA 1TKKA 4B16A 1SO5A 2O4MA 3B0UX 1I1WA 4KFOA 3PPCA 4XSLA 3BMXA 4IPNB 4GBUA 1XICA 3V75A 2VL4A 1AZ2A 1K8XA 1UH2A 3TONA 3T4WA 4UC5A 4BF7A 1TPWA 4MKNA 4MZYA 2G3FA 1JPHA 3N11A 1CLKA 3KVKA 1FWSA 3O7UA 5I3KA 2FHFA 3W73A 4NZ5A 3DI1A 4F0MA 4IIEA 3IARA 3VGFA 4DRSA 3NSMA 3NZRA 4AWEA 4KCUA 4ZQPA 1IQ8A 3OYZA 1GYMA 3VIMA 4ADTA 4FR6A 1V93A 2XINA 3T81A 4HVXA 4JR5A 1AIWA 4WK9A 1L8NA 3B8DA 2ZBTA 3KUMA 3QKZA 1YBQB 2PP0A 4AX7A 4Y9NA 2VX5A 3S9IA 3RCMA 3SSZA 3VMOA 4IBDA 4A3YA 3NQ2A 3KCJA 4MY1A 2PCQA 1SFTA 1FCBA 5CAHA 1QPOA 4NILA 5HPCA 1A53A 3TN5A 4ALDA 1WAUA 3QTPA 4BKNA 1HVXA 1DL3A 1YNYA 2OSXA 1EHAA 3W7GA 1IV8A 4QDWA 1Q65A 1LL4A 4LVDA 1XLEA 4CCEA 4JY9A 1WBHA 3W83A 1SYTA 4S3KA 3A3WA 1QASA 1QR7A 3VKBA 3S9ZA 1O5KA 3IAPA 1PCWA 5LIWX 4OKDA 3QV8A 3CZJA 2GVLA 3LGGA 1W5PA 6CGTA 3GUGA 3SCRA 3GVGA 1X1ZA 3D3AA 4BQ5A 4LUTB 4WJXA 4J2MA 1HJQA 3N04A 4AU0A 3EX6A 4AF0B 4O1BA 4OWGA 5AHNA 3WMSA 2FHBA 4GVGA 3WLHA 2NT0A 8XIAA 1JQXA 1N82A 2VC7A 4CD8A 3WLSA 4CKQA 4LH8A 4Z2GA 4GI8A 4JHOA 1LLOA 4CN1A 3HU7A 5HNRA 3LCGA 1JZ4A 4XQ6A 4HMEA 2O0TA 3EPMA 4LCRA 3NEVA 3OVRA 3MANA 3EWYA 1R3SA 1I75A 4WGXA 3SCTA 2FVMA 3VNZA 1JEZA 1ICQA 5DF0A 5MKGA 2WZTA 2ZTKA 4C6BA 2A3CA 3CV7A 3WD3A 2ZXBA 3W3OA 4UNIA 4AC7C 1VIZA 1XH0A 1EGVA 4PMOA 1JCMP 4NASA 3W76A 5EMKA 3BJFA 2OWCA 3HFTA 1O12A 2ZZ2A 3BC9A 3LV5A 3M46A 2A85A 2DZVA 1JUKA 5CGQA 1FHLA 1XLLA 4QLJA 1KM6A 1XYFA 4N6FA 2AL1A 3SR7A 2BVTA 2O9TA 2ZVRA 1SM9A 3MV11 4HT3A 4W86A 2QGHA 4MY8A 1XV8A 1G4TA 2J79A 5C55A 5HAOA 7ENLA 4XIMA 2GGHA 1JYNA 4X60A 2J66A 3NJ3A 3OVGA 2EPNA 1XR2A 1RPXA 1I45A 5FF2A 1CCWB 1LL6A 4HPJA 3ERPA 4DM2A 4DYKA 3QEZA 1JI2A 3E02A 2GWNA 3R8HA 5J5DA 1ZB5A 1Y8BA 3DDMA 1YW1A 1DQWA 1KM1A 2X40A 1FCVA 2WMGA 2QPXA 2V69A 1JPKA 4DXXA 1KGUA 2YW3A 5CGTA 3NA8A 1DQXA 2VCAA 4XV0A 4HHLA 3NPXA 4H8UA 1RBLA 4LUYA 1DWGM 1FWFC 1JZ5A 4L1WA 3ARUA 3VGGA 2D2JA 3PZMA 5AZ1A 3HV8A 4ZR8A 2XU2A 1FWBC 3W23A 2Z1WA 1KFBA 2PLKA 1AD1A 1T96A 2CBJA 2WZMA 1UWAA 2Q8ZA 1HL2A 2V3GA 2YL5A 1JPMA 2OZ3A 5PTDA 2I57A 2VX4A 3SFWA 3GVQA 4P7RA 4GHRA 3E74A 4L9XA 5CLWA 1PTDA 3WQDA 2J7FA 1VCVA 3E0WA 1F7BA 2WANA 4TMBA 1G4SA 4QISA 3WLPA 2GQ8A 1Z41A 1GK8A 3WK3A 3BL3A 3EDFA 5CPLA 3FYPA 4J7RA 3WFAA 1OADA 3SY5A 4UFLA 4R27A 2AGTA 3ZSTA 4RZ4A 4FZIA 3G8RA 1XLKA 5CZ0A 4AY8A 3WLIA 4HA1A 4EWND 4J9JA 1HP5A 3PZUA 4U5IA 3FLUA 2A3BA 4JICA 3WSUA 3H70A 1TTJA 5HWMA 3R13A 3PBMA 1NDWA 4UWMA 1HG3A 4GYJA 1HKMA 3MVTA 3NIYA 1IHIA 2W62A 4IIFA 2ZWZA 3RX3A 4Q8UA 5L6UA 2ZIDA 3S1XA 6REQA 1B4EA 1W1ZA 1EP3A 3P5YA 2OQYA 2OMAA 4JYEA 3TTYA 7XIMA 3B8VA 3UPBA 3B0PA 4NI8A 1H1YA 4H9YA 1ME7A 1V3LA 4JIRA 2YCLA 1ZJIA 1DTUA 3BLIA 4F9JA 3GG7A 3MHUA 5F2LA 2C1HA 3VVGA 4F79A 4UOQA 1GPFA 1JCYA 3B9AA 2X16A 4FALA 5HUPA 3BSHA 1ZCOA 4IL0A 3AXMA 1J6PA 1O5XA 3ZJ8A 1HQTA 3AJXA 4KESA 3QFWA 4J1OA 3NOYA 4H1ZA 1KBKA 4IMCA 3CMGA 3DC8A 4CLMA 1X98A 3ITXA 4HPXA 1L6WA 3TCEA 1FA2A 5AKQA 5K3VA 4CQBA 1V6YA 2A3LA 1OFBA 5E0FA 4UCFA 4PTWA 4JXCA 3QPEA 3T4CA 1XCWA 3VO0A 1J9YA 4NJKA 4JFTA 4YJ5A 3FYYA 3OGVA 1F07A 3W6YA 4E8DA 2JF7A 1UC5A 3ARYA 2FTWA 2GJNA 4IFOA 2YB4A 2BGQA 2J7BA 4H4IA 4I9AA 3VI2A 3WF3A 1SZEA 3N6QA 1IWBA 1J11A 2PPGA 1L0PA 4LOCA 1PPIA 3TMLA 3OIXA 1HO1A 2X1SA 2Z7KA 4L6HA 4BI5A 1TELA 2J74A 3QFEA 4Q8NA 1LUCB 3DZ1A 4M82A 2XM2A 4IIHA 3WDHA 3N3TA 3NDOA 3S46A 1MRAA 1I9CB 5TAOA 4HYVA 2VEKA 4GYPA 2X42A 1V03A 3KBVA 4H01A 4LCSA 1ZBWA 2AL2B 2XZ9A 3AUJA 4GJ1A 4QITA 1NH6A 5HOSA 3UJEA 2JEQA 3PUOA 4EVZA 4JIHA 4LC8A 5EY5A 2QCNA 1KM0A 4Y96A 1YDVA 3CLWA 4GZIA 3UERA 3P82A 3JU2A 2CEQA 4REQB 1J0ZA 9CGTA 3WD4A 4MMWA 2GJLA 2PP1A 3TOPA 5EBUA 4B5TA 2PI6A 5CGMA 4PMYA 4W4QA 1H7XA 4IWWA 1CLXA 2OQLA 4GX8A 4B5XA 3KP1A 2WPBA 3W1XA 3M0ZA 4GBDA 2ASHA 6ENLA 1A47A 3AS0A 2ZX6A 4HTYA 2C14A 3VFLA 3GVRA 4QRNA 4L1XA 4X9SA 1FWEC 3DI0A 1OX4A 3BLLA 2H8ZA 1XBVA 5TD4A 1XDMA 3S2LA 1GUVA 1VPXA 2CLLA 1Q6EA 3QY6A 1I0DA 4L65A 2GK1A 3EWUA 1UCWA 3FV9A 2GL5A 3W2NA 4I9TA 3H8AA 5E6ZA 3L0NA 1WXYA 3QVQA 1LT7A 2PDIA 2VD9A 1IIHA 4FXFA 4AVFA 1UD5A 1YLVA 4N02A 4XKYA 3WEZA 4UTWC 2PDWA 2J77A 1XLCA 3AS1A 3GAYA 1H7RA 3H23A 4QSFA 5SWUA 4LBUA 3BSGA 1P0NA 4GGHA 5CSUA 2QCDB 1BKHA 3WK1A 1WKDA 4PCNA 1W9UA 1SU5A 2J62A 1CPUA 5ABEA 3AQUA 1YPFA 3ANVA 1JAKA 3CQKA 9RUBA 4HHMA 1XLMA 2PLCA 2TODA 2GGEA 3WQ5A 4Y7EA 1EP2A 1Q6FA 5K2ZA 5CC5A 1F74A 2HBXA 1PX8A 1TJ0A 1WX0A 3H53A 5D9MA 5H8UA 3HTWA 4LV9A 2WSRA 4W8LA 1W8SA 3B04A 4PCTA 1KV5A 1R85A 1PTAA 3HURA 1XLHA 1MW1A 1NWSA 3TUUA 1AW1A 3RDKA 2GOUA 3NSNA 5G2WA 1GW9A 2HWGA 3LCIA 5A6JA 4B9ZA 5HNUA 4I8YA 3UF9A 1YXYA 4ZTYA 3PZNA 5K9CA 4LNYA 3A23A 5FJUA 5BRQA 6TIMA 3ALFA 4ILSA 3TROA 1C7SA 1UIPA 1GZ1A 5HNNA 2JKEA 3POHA 2BMBA 3KFTA 3GNXA 3EWXA 2PFHA 3DC0A 4O1AA 4PULA 1GHSA 4UNLA 2X09A 4ORIA 5GNYA 2NXGA 2XVLA 4RXGA 4R34A 1NF0A 1V0MA 4PH6A 3GNDA 5EYWA 5D05A 2R82A 3FSTA 1UJPA 3GNPA 1EA0A 1NDZA 5G4WA 2WJZA 2YCJA 2WVVB 5BXSA 4AEEA 3ZT6A 2PGRA 2PWGA 1XKJA 4Y6GA 3R8GA 1ITXA 3N1AA 3CWOX 4D8ZA 2XFFA 3WLQA 3PFRA 2ACSA 2RFGA 2DV0A 3AIWA 1D8CA 2VUYA 3T9PA 3ARVA 3F4VA 3NO3A 5J04A 1KWGA 5C2XA 3UZZA 4ZTXA 4X0VA 5JUVA 1R3VA 2CCRA 3A5VA 2CYGA 5BMXA 2VI0A 4KCTA 3H4GA 1SZFA 4GFIA 5FSDC 1DXFA 4TTUA 2CITA 3ZVHB 3GSMA 3C8FA 2GWGA 3NQ6A 3IANA 3RILA 4RW3A 5C9WA 1B3ZA 3KRZA 3O2LA 5I24A 2G3MA 2UY3A 1YU3A 2CBUA 3L0GA 3A4WA 3UPMA 1TWSA 4UMBA 1L2QA 3SRDA 5A3HA 1W2PA 1LQ0A 1E4LA 4ZVJA 2MANA 1K7FA 2XVNA 4KT2A 3UJFA 2CLMA 3DOPA 2CPUA 3ZLFA 4HSOA 4MWAC 4W89A 4DWSB 4I7UA 4AX6A 1FWIC 1GVFA 3RR1A 4YXGA 1K77A 2GGGA 1DWIM 2OPJA 1VEOA 4IMDA 3G1RA 3UZ5A 3PN8A 2GJRA 4B2DA 1GG1A 4MNLA 3PB0A 4P8UA 4GK8A 4UMAA 3VABA 3G24A 4R3UA 1VFSA 4IGNA 2E09A 2TMDA 4AMCA 4B5SA 2ISDA 4EIVA 1C8VA 1TQJA 1IEXA 1ED7A 2CHNA 2OKTA 4PFHA 1GOMA 3OO2A 4DJED 4CCDA 4HKPA 1B4KA 1HKIA 2QCFA 2NZLA 4Q8MA 4Z17A 4MOZA 4TUFA 3GFYA 5A6TC 2J7GA 4I9JA 1RZMA 1ONWA 4LYKA 4JQ3A 4PUUA 1RQHA 1CW2A 5CC3A 4ES4A 4LF1A 4PUMA 4DWSD 3TTEA 4MNKA 3D46A 2Z2BA 3AYTA 3DG7A 3W7JA 2HMCA 3W4RA 2FMNA 3AUOA 2PDBA 1XIHA 2WHMA 1NARA 2BFGA 3STFA 1GNXA 4ROPA 1VCFA 3GDMA 3CQJA 1FDZA 2SFPA 3ZJKA 2AOSA 5A6MA 1P6WA 3W1UA 3VZYA 3TQVA 3THCA 1PZ1A 3DFYA 3K8MA 2RKXA 2XWEA 1VAHA 1W8GA 3OA5A 1A5BA 3QJAA 3DYMA 3MB9A 2P8CA 3DU0A 4JNZA 1PYFA 2PD5A 4KW2A 3S1GA 1ADSA 3ZM8A 2CLOA 1TUXA 1GOKA 5CPSA 4LFYA 4ATDA 1ADDA 1CTNA 2BVWA 5D37A 4HP5A 3EBVA 1NOUA 1TWZA 3SUVA 5I3GA 1KFJA 3OZYA 5HXMA 1XLAA 3M64A 2WWDA 1YE4A 2NT1A 4FNRA 3UXIA 3BQ5A 3W6MA 3VE9A 4JTLA 4NZ3A 4YVXA 3KVMA 4PUWA 2QJIA 1TE1A 1X8FA 1QNPA 5A95A 1EEXA 2P5NA 1ISZA 1R2RA 4OVXA 4XUGA 2PB1A 4HBKA 2XN1A 3PJTA 4Q7BA 2Z2AA 4R5EA 1F05A 2EGZA 5I3HA 2XISA 1ZZMA 4TOQA 2W67A 4P7QA 2EKCA 1OCJA 2ADAA 2VNCA 3W07A 5RUBA 1UD3A 3URAA 3LV6A 3V16A 3PBVA 4A29A 5AN7A 2E77A 3L4TA 3IUDA 1WE5A 2ZZ4A 3W1TA 1UR9A 4PZVA 2RGMA 1E0TA 3O16A 1MI3A 1JZ8A 1ZAJA 3WLTA 3EOSA 2REQB 1U5VA 3W70A 1YADA 1JYVA 1UH3A 4DZ5A 2C18A 4B5VA 2NV2A 5AY7A 3M6YA 3IS4A 8RUCA 4IL2A 1G0CA 4LYQA 2I5QA 4FIQA 3S2MA 2VX7A 3E2SA 4GXMA 3TJXA 4EPEC 3E96A 1VBHA 1GZJA 4PMVA 2FYMA 4QG9A 4F8XA 3UCDA 2O9RA 2PD9A 4AEFA 1XLDA 2W63A 3L26A 3T8QA 1UR2A 2NX1A 1I2RA 5BXTA 5U4NA 1IXOA 1M6JA 4QJ1A 2WM1A 1X7FA 1A0EA 3N6JA 3B97A 1PTGA 1XF0A 4O54A 1F5ZA 2B7QA 2W92A 4O52A 5EB8A 3WNPA 4ZENA 2W91A 3GDKA 1MW0A 1DHKA 1AG1O 4QJ4B 3C86A 1W5OA 2CLFA 3UWWA 2Y61A 2XDFA 2FMOA 3W25A 1UWQA 1IEWA 5IFPA 5CXPA 4GO9A 3WX7A 3C0QA 5A94A 1NQ6A 3BJSA 3UWVA 2FZDA 3UGRA 3B03A 1YPXA 4MKSA 4OOUA 4I5XA 3CPGA 3MSDA 3ABQA 3R6IA 2WNNA 5BU6A 3U7VA 3W1MA 3T8LA 3ABSA 5A5WA 2G8ZA 4C6JA 2XG9A 4A2SA 2OJPA 3QZAA 2Y2MA 4MKVA 4EAMA 4CQ9A 1FWGC 1IT8A 3C2OA 4GGBA 4J3VA 5F4WA 4GCAA 4ICNA 3OG2A 1YU1A 1E88A 4EXAA 1H5YA 4P8VA 2A5HA 3RLVA 3VMPA 2OG9A 2RUSA 1K3UA 4Y9OA 1BYBA 1SQ7A 3R7MA 5CZKA 4ZQNA 1RPKA 1DWHM 4XAZA 2JE8A 4OJPA 2DH3A 3M0JA 3L4YA 3O0FA 3WLLA 2C7FA 3P0XA 3W01A 1YU2A 1NVMA 3O6DA 2RDWA 4FXJA 1N55A 3AICA 2GQAA 3OGSA 3EOUA 1YDYA 4GUHA 3ATYA 3WLKX 3LK6A 3BWWA 1I2PA 2Z1VA 2AAMA 5D09A 3WJSA 4RV3A 1I4NA 3ELFA 5HATA 1JNEA 1N8FA 3K46A 1G94A 3HQNA 4ML4A 3W9ZA 3SCWA 2XHYA 4MGGA 4PB4A 4RZ6A 2DQXA 3EA2A 1UR0A 1NFGA 4ASTA 2I14A 3TTQA 1GPWA 3L4UA 5B7ZA 5BWFA 4KS0A 4CD4A 1VYPX 1H3GA 2X1IA 3WNMA 1GT8A 2XSAA 4RZ5A 1JAEA 1MEHA 4IQLA 1FWRA 3WL0A 5REQA 3UQNA 1Z44A 3MUAA 2DDXA 1PXGA 4WLCA 2VZUA 1H8PA 2J88A 4BFAA 2E67A 2V30A 3JW7A 2ZDRA 2V63A 4JZ5A 1VFLA 3M5YA 6ALDA 4ROQA 4E2DA 2HZGA 4B3ZA 2RAGA 3EA1A 1WA3A 4RE3A 3IVUA 3AAMA 3WBEA 4LTSA 3B9EA 4C1KA 1UZ1A 4PEEA 5GNXA 1U5HA 3QF0A 1FY6A 1FWWA 4O8RA 3DBNA 2OSYA 1QU4A 3GR4A 3FDKA 4XWUA 3QGVA 2CXEA 2YCEA 2C79A 5FEWA 2IOUA 3G3DA 3W81A 2J47A 1KCZA 1BYDA 4AD2A 4IBEA 1DYSA 1ICSA 4NVTA 1TPVA 3STEA 1PAMA 1M7XA 4JX6A 3HGRA 5JBFA 4PMJA 2CFFA 3TJ4A 4M51A 4ZL1A 4WCJA 4HJFA 5FA5A 4DELA 1WKEA 3WH6A 4GVFA 2QS8A 3H2CA 2QAFA 1L6JA 4TIMA 1K9DA 4QQUA 1GEQA 4Y9MA 1MW2A 4QEHA 4AMAA 4TX6A 2Y89A 1UBSA 2FQIA 4HNTA 4H9VA 4Q33A 3ID7A 3WBAA 3V0SA 2VELA 4OE7A 3M0IA 4UTMA 3SUUA 4LS2A 4HCDA 2R1MA 1D2KA 4KFPA 3DFTA 5M17A 2ZUVA 2FFFB 1NWRA 5FJJA 3V0UA 5D32A 3CUJA 4J40A 4TVDA 1XISA 2D2OA 3CHCA 3EGJA 4OBRA 3U0HA 3RO8A 1KCXA 3UCQA 3GU9A 2VMFA 4Q7NA 3QQ0A 5C9ZA 4GXPA 3CAKA 3RM8A 3WF2A 1V7AA 2FLIA 3UWEA 3HO8A 3NDYA 3KS8A 2OEJA 1HJWA 4OQVA 2XH7A 3RU6A 1OFPA 2ZYFA 4HPNA 3R1ZA 1BLIA 1RY0A 1GQJA 3K30A 2UWXA 2IPFA 3AWOA 1S2AA 1BXCA 4O1EA 5IRPA 4IICA 4MJ4A 2GUUA 3SIZA 1XP3A 1VYRA 2Z27A 4Z08A 1EOMA 1OCQA 2GGIA 3B4UA 4P61A 3W2KA 4DJDA 4HA0A 4FA3A 3EX1A 1OINA 3GW0A 2A7NA 2VZVA 2DZSA 3FA3A 4JEQA 1CXEA 3POCA 4Y2WA 2WJEA 4C1LA 4Q6JA 1B31A 1ZALA 3Q4DA 4S2CA 2WHJA 4NRRA 1K7XA 4EXBA 3HA1A 4L9ZA 3M7PA 3SECA 1GQIA 4YN5A 4F40A 3QR0A 1B3XA 2CBVA 2D0HA 3C3NA 3GVVA 3GQYA 2C16A 4YIWA 2Z1SA 3L4WA 3B8SA 3W02A 2AQWA 5DX7A 1V3HA 3CWHA 1SZRA 5ECVA 4J28A 1MZHA 3LCFA 1XIMA 4O16A 4JTKA 2PU1A 3VTRA 4LEFA 2RH9A 3N2MA 3H54A 4KIRA 1XJBA 1W6TA 4J5NA 3N18A 3DENA 3VGEA 4QNWA 1AJ2A 3E9AA 3T2PA 3WMLA 2UBPC 1WQ5A 3ZT5A 2I9UA 4JPGA 3NQGA 5LGZA 1TJPA 3CWNA 3RX4A 1JI1A 3QBUA 1B54A 1DWAM 2BGSA 4B4FA 4OOZA 3NOEA 4C6QA 4BK9A 5M2FX 3VOCA 2QQ6A 5CH9A 2V38A 3NDZA 3BW2A 3T0AA 1BQGA 3F4CA 3TFXA 2ISFA 1IT7A 1QTWA 3RLHA 5HPOA 2OU4A 4Y90A 5I79A 3WYZA 3M0LA 4Q4QA 4K3ZA 4YWSA 2FPYA 4C6IA 4JN6A 1KRMA 2W0UA 1CB7B 3VD7A 1TYGA 3IGHX 2BY3A 2EPHA 2HNHA 2ZX5A 2Q01A 2Y2LA 4HHHA 4DJFA 2QDHA 1K9EA 3OW1A 2R8WA 1UUOA 4FI4A 3VDAA 3WEMA 2XH2A 3OOQA 1R9ZA 4IBKA 2GDQA 4DF0A 4PE8A 2FPVA 3R0KA 5I78A 4GIAA 3MDUA 3W1QA 3NQBA 1QPRA 1GYNA 4GIYA 1J0HA 1MUWA 3U5YA 1VC4A 1WOAA 1E9ZB 5I3IA 2VCCA 2FPTA 3QPZA 2TYSA 3VCNA 2G37A 2POTA 1TWWA 3GR8A 1TPH1 4N7QA 1S2TA 3B05A 2OB3A 4PUEA 3H2AA 4GQRA 4E8CA 2BOGX 4Z2IA 3UA3A 4Z1BA 3UR5A 4Z2LA 3U8GA 3W2JA 3MUIA 1NOFA 2R1KA 2RJHA 1J93A 2IKJA 4U3AA 2YR1A 1OFEA 2H3BA 1EIXA 3S47A 3WQ4A 5HDRA 5A6AA 2ZOXA 4IJRA 1VBJA 1D9EA 4GY7A 2Y70A 3F2CA 3B8WA 4PC8A 4XZLX 1JDCA 3EXRA 4ICCX 3VZZA 4AG0A 4F2BA 1SO6A 5CBJA 2QJMA 1Z6KA 3OBKA 3LQGA 1FP8A 3K5XA 3LLDA 5DT5A 2Z1KA 2I9EA 2QVNA 4D72A 3G0SA 1R3RA 3NL6A 2JKPA 1FCQA 3IVTA 4M24A 3Q45A 2WSKA 3CPRA 5EMJA 1SFJA 3JS3A 1A5LC 1DV7A 3EWBX 4EPKA 4MJ2A 4MJMA 2BVYA 2E5DA 5LIXX 3M47A 3C52A 2AKZA 2Y5SA 1UMLA 3CASA 2OCZA 1W3NA 1FH9A 4AWUA 1WZKA 4JN8A 3A22A 3WJZA 2VOMA 3QYSA 1VB9A 2OZ0A 4MG4A 5AYIA 3MMTA 3CIVA 4KBXA 3DFPA 4YHEA 3W29A 3IRDA 3Q37A 3C2YA 4EPBC 4DBDA 3GDTA 3ITYA 4BQ3A 1OYAA 4NAFA 4AZCB 4RUBA 2DW7A 3SQMA 5AHLA 1GVRA 1TWDA 4GVHA 2WLYA 3SDOA 4HA3A 4DNHA 1R3YA 5A2CA 3K1GA 4MM1A 1QBAA 2ZZ1A 3TDFA 4AHQA 1CXKA 3HG5A 1WZMA 4US6A 4LANA 2W6RA 1JCJA 1F8IA 1H61A 3C2EA 1SUXA 3ZJ7A 3IWPA 3AXHA 1RQBA 3MCOA 3TAKA 4Z1DA 4IXXA 4IMFA 1UR8A 1JXKA 3SZ8A 3H7VA 1B2YA 3HJZA 4WKAA 3RGTA 1X96A 3MVIA 3WQWA 2PCEA 1W54A 4PR4A 3HG3A 4PGLA 3WF0A 4R7JA 1EX5A 3RMJA 3IJQA 2WSQA 4L4PA 3O15A 3EDKA 2CLHA 1DE5A 5D4YA 2V81A 2Y7DA 3NXFA 5EGRA 3WLNA 4IP7A 4K8EA 4FXRA 3GAKA 4GWEA 3VKCA 4LAOA 3W1PA 4AVNA 1JR1A 3P6LA 1US2A 4IHCA 4FMVA 3S4TA 2J27A 5JVLA 3FJNA 3Q65A 3PUDA 4OFCA 1JCTA 1WKFA 4F0RA 2TSYA 4XB3A 1ZAHA 2IUZA 4WRHA 4CQDA 3LZ5A 1A3XA 2BHZA 4Q3MA 4INFA 1PBGA 3GZ3A 1RA5A 2BOEX 3LMZA 1Z89A 1MMFA 4NT0A 3SO7A 2Q6ZA 1Q6GA 3PPFA 3SEPA 3VC5A 5JH1A 1NF7A 2XM1A 1QW7A 3CGTA 1TWIA 2VM8A 1UD4A 3F7JA 4XBJA 4LV4A 3S2NA 1E51A 2YXXA 5G1TA 1Q6DA 4XVDA 1EQCA 4DQWA 4F0HA 1EC9A 4XO7A 3G1FA 3MBDA 4IX2A 5FIPA 3GDLA 2V0TA 4MF4A 4NSBA 2V82A 2DUXA 3SRKA 1Q7ZA 3GC4A 4IFKA 1XGDA 2GQ9A 1W5NA 1H50A 1XLFA 2BHYA 4N9BA 4LB3A 4FNQA 3ATZA 3LCLA 2E3ZA 3WDPP 2IQDA 2ZKMX 4JTJA 4Q4PA 5CAKA 1EL3A 3URBA 1F73A 2PGEA 3VU2A 4NG3A 2ISVA 1SZGA 5U7SA 1WUFA 4AHOA 2E68A 3KZSA 1K9FA 5CPNA 3AWNA 3DFQA 1LG1A 1EOKA 4R7OA 5DY2A 4RNIA 3QGAC 2PS2A 1EBHA 3C3UA 4M29A 3DFNA 1UZHA 3BZGA 3B3DA 1WZAA 1LF1A 3K4AA 4LNCA 4XZNX 3FJLA 1QO5A 4WSJA 3LGEA 1FFQA 4LX4A 4Z42C 3EOEA 1LBMA 3CNYA 2XJ7A 4AYGA 4GZJA 1P4CA 5IXEA 1DIOA 3BMWA 1UZ4A 1KTNA 2VO5A 1UA7A 2CXGA 4TQTA 1GKPA 1F6YA 3QN3A 1V08A 2YDRA 4NX5A 4D6DA 1E73M 4B4HA 1YX1A 2GVYA 5HQMA 3NZ1A 3T44A 3EYPA 1QDSA 3BLPX 1PZ3A 3CYVA 3U3HA 4CNTA 2NLYA 3W87A 4QX4A 3GZAA 3VXGA 1RCXB 4XK2A 3UETA 1XIEA 5IDIA 3WH9A 3ABOA 3G2GA 3OBAA 1YTDA 2VXNA 5D9PA 1GOOA 4J3SA 4YYCA 1X6UA 5C5YA 3APTA 1HIZA 4JTGA 4HIBA 3SB0A 5TIMA 1G7UA 4FOJA 1OT1A 3ICJA 3TSBA 1GJPA 5ECUA 1XRSA 4J3UA 2PC4A 1SGJA 1E4IA 4PMRA 4BF5A 2GUYA 1J8VA 1OG6A 3LLXA 4ADUA 3M5ZA 1TMLA 1E40A 3SY8A 1MW3A 1EJSC 1QPNA 1EYEA 3TZNA 4DO6A 1N8WA 8XIMA 1DVJA 4M6QA 1E6ZA 1P1XA 1E0WA 1RUSA 2X1UA 1ZHAA 1H1ZA 2XVPA 5TNVA 3THQA 3RMEA 3SJNA 3NPWA 1S38A 1S3HA 4YVPA 3C2FA 3CS2A 3ISIX 1DWFM 3FDGA 4A2RA 3VNDA 2YFOA 2Y4SA 1IEVA 2EPKX 1E5NA 1MXGA 5LA2A 1MUCA 1ZENA 3TYEA 4ATLA 5BXRA 4OIFA 5A2BA 1TPFA 3FVMA 1RA0A 4AB4A 3ZLGA 1AJZA 3R2GA 2WKGA 2CIPA 1MRQA 4JN7A 4O13A 1TG7A 1RALA 3FA5A 4OT7A 4L6OA 2GZXA 2R24A 1K7EA 2FDSA 1XYMA 1UMYA 1EFZA 1F6KA 1BYAA 3WUGA 3MW7A 1QPKA 3VD4A 3EX2A 5DMNA 1BF6A 4U2YA 1EA9C 1FDYA 2YYUA 3GXMA 3V0TA 3PZTA 1PIIA 2QAPA 2CLPA 2O7QA 4S38A 1JRCA 4KWSA 1FXPA 3USBA 3T1GA 3HONA 2NQ5A 3WQ8A 2F84A 2JKAA 1J18A 1BWKA 3N13A 1U33A 3E0LA 1BSLA 1VHCA 2JE5A 1E3XA 4CEUC 1HKVA 2PDCA 2V2DA 3QW4B 4MSSA 3ONBA 2Q8XA 5C7VA 3ZSSA 2VFHA 4KWUA 1ITUA 1Y5WA 1VPQA 2HDJA 2YXOA 1HFBA 4LBRA 5FESA 5HJXA 2DW6A 4WX2A 4KEVA 4DUXA 1WXJA 2WHLA 2E6YA 6XIAA 1LL7A 1WNOA 1DP0A 1QO2A 2ICSA 1KFCA 1RH9A 4L5ZA 3V4BA 3L5LA 2IPWA 5C0QA 3M43A 4IXHA 5J5RA 4YCOA 3E5PA 3TH6A 4Z1AA 3KLLA 3PZVA 3ZXWA 4N4QA 3W7CA 2DFAA 4NY2A 4ECLA 3KEHA 1Y0EA 1GQKA 4KFNA 1VGAA 3W7MA 1SR0A 4HK6A 1TX0A 1FX6A 1T99A 1GVSA 4S3CA 2V3DA 1UQZA 3PJWA 1ICPA 3AMKA 2TPSA 2NUYA 3L4VA 1RD5A 1CXFA 4EWJA 4DM1A 2GSEA 2JGYA 4GUJA 3MP5A 1F4HA 3E1F1 2ZRWA 1AD4A 5ENLA 1TPEA 4KGLA 3N29A 1JRBA 2W79A 1RCOB 4L56A 4PBGA 4DWSC 2D69A 3PNUA 2QCLA 3GH7A 3HFYA 3A9IA 2WJDA 3GO2A 3T2QA 4N9EA 1CXIA 4DI9A 1L6GA 4FPSA 1ADOA 4TO8A 4YLWA 3SN4A 4OGZA 4C6PA 4UFKA 4MB1A 3RM4A 3VNJA 4C1NB 1E72M 1O1HA 2FDMA 5XIMA 2Y63A 3CV6A 4HSNA 3N12A 4JTDA 3CL7A 3HBLA 3UJ2A 3UY8A 4IQDA 1EXBA 2I17A 1JNDA 1PKMA 3H6OA 3NXLA 1ZCCA 3MUCA 3QMTA 4PSPA 4JL1A 1R9YA 2WZEA 2NQ9A 3B06A 4PMNA 1TJRA 4EAYA 2XIMA 3EB2A 4ADSA 3EB4A 4P8WA 1OD8A 2DZXA 3GNRA 3EEZA 1BG9A 2V5JA 3PTDA 2Q3OA 4UXDA 3AZRA 2WC3A 3P61A 3PG8A 3IV3A 1BGAA 1MZRA 3GBEA 3IJLA 3RLUA 2BV9A 4Z1YA 1A5NC 3ZYZA 1KV8A 1VH7A 1XSIA 1EPXA 4NNCA 1XQLA 4MWAD 1Q45A 3RXZA 3TX9A 4Q4RA 2VGFA 4LUIA 2WZIA 3FIGA 4FLSA 3M1ZA 2UWFA 2YBVA 1VF8A 3NM1A 1KS0A 2G3IA 1VFUA 2VDIA 3VX0A 3ZFHA 4V27A 1CX9A 2XH4A 5I2UA 1XIIA 3ONCA 2POZA 3OU8A 1Y5XA 4UQEA 3T0DA 3CUIA 3HMJG 4MB3A 2GSHA 1M04A 2CWXA 5EA9A 3VCCA 4AEOA 2W9MA 3AXIA 2DIEA 3UWYA 3H55A 4Q32A 1TV3A 1XXXA 2WNWA 3T42A 1F3EA 1OG0A 3E0FA 5I09A 1ZQ5A 1XSJA 3QOKA 1G4EA 3A64A 4XZ9A 4Z0JA 3GWQA 3WJWA 2Y2IA 1TV7A 1KGXA 5BYWA 4MDPA 2RDUA 1RVKA 2ANUA 1JZ2A 4MB4A 4DPPA 4DI8A 3VKKA 3WLJA 1TJ2A 2EO7A 5F2GA 3QM3A 1EDGA 4G2DA 2MUCA 3FKEA 5E9XA 1XYAA 1FKWA 3FY1A 2QCEA 4W7UA 4C6CA 2FKPA 1TA3A 1XW8A 4XZHA 3N2XA 2D20A 3L2MA 4QP0A 4KKXA 3BVJA 2WMJA 1R7OA 3CZ8A 3CHVA 4AXNA 5MKGB 4I9MA 3VKAA 1XIFA 4GZEA 4PB5A 3UR8A 3G1XA 4K2SA 5HMFA 5DQPA 2LLEA 4GABA 4UQCA 1QT1A 3G6LA 2IQ0A 3HGSA 3N4FA 2E0PA 1TZ9A 5HA7A 1I0BA 3NVTA 1W3HA 4FLRA 2IMRA 3CB8A 3TR9A 4YL2A 5DLCA 2GJPA 4CQ8A 1O1ZA 3N9RA 4B9YA 2WKJA 2PTWA 3UG4A 1ISWA 3CHEA 2ISWA 4M8UA 4B90A 2CERA 4N0RA 4O4VA 3A4AA 4LF2A 1XRFA 4WHBA 4XISA 4Z1CA 4ZA0A 1UKTA 3LCWA 1GXDA 5D03A 2Y7EA 4DJEA 1XRVA 3RR4A 5TBOA 4I5UA 5T91A 1J5SA 1ZBCA 5FAJA 1K8ZA 4HZ8A 3MSYA 4HJWA 1CLVA 1Q3NA 1KWKA 3M16A 4O0ZA 1ISXA 3M0YA 1IF2A 2V3EA 3R4IA 1A50A 4K1WA 2QUTA 5E6YA 3LCHA 3SADA 3NYDA 3W1RA 3KCOA 4BJHA 4HPGA 4FB7A 1WKYA 1KCKA 1G7VA 3BLEA 4E4UA 2F61A 3CBWA 4W87A 4LVGA 2ACQA 1B90A 5XINA 3THUA 4QNEA 3TYAA 2P0OA 3AIVA 2ZUMA 2Y2GA 3VOIA 3SM0A 3LNMA 2VZOA 3DFSA 1W1TA 3SRHA 3GHSA 2VDGA 3SRFA 1JQVA 2PDKA 3WUFA 1IR2A 1XLBA 3MMDA 4UTTA 1J10A 1VLIA 1BWLA 3I4KA 2BX7A 3UW6A 3IK2A 4FLQA 4UR9A 3QQWA 2OODA 1GOQA 4CNPA 3WQVA 3VIIA 3MP4A 3KL0A 2DT1A 3CYJA 4CD7A 3QLDA 1FBAA 4RV8A 4NJGA 4MADA 2V6AA 2PDXA 2ZXAA 3DN5A 1OFDA 1JUEA 1QVBA 4D8LA 3E6EA 3ECQA 4LXFA 4OUEA 2HSAA 3DHPA 6REQB 1EC7A 4QM1A 5DMYA 1H62A 1ZFJA 3BV4A 1PWMA 3DX5A 4BY3A 5AVNA 2VYOA 4DWDA 1X7IA 5AOUA 2CW6A 4ZXLA 2CLIA 3HSHA 1VENA 2NSOA 2NLIA 2YCLB 1SW3A 1XM3A 2A3EA 3R94A 4K6AA 5EPDA 1K03A 1POJA 4QE1A 1MSSA 3BLKA 1Q4WA 4JS3A 2DIKA 1E1CA 3K8KA 1TMQA 2J6VA 2J6XA 5HUOA 3LI0A 2D22A 3NAVA 3BGJA 5BOFA 1EJUC 1XLGA 4ICMA 1TUFA 4L4LA 4W88A 4IG2B 2ONEA 3PAOA 4JFWA 3AO0A