4NYYA

Structure of vibrio cholerae chitin de-n-acetylase in complex with acetate ion (act) in p 2 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
405
structure length
405
Chain Sequence
TPKGTIYLTFDDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Deacetylase DA1
total genus 145
structure length 405
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nyyA02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nyyA01
2E67A 4NZ3A 1W1A1 4NY2A 2C79A 1W1B1 2CC0A 2XU2A 2J13A 2QV5A 1NY1A 2VYOA 2C1GA 4L1GA 3CL6A 4NZ4A 2C1IA 3S6OA 4WCJA 2W3ZA 4F9JA 4LY4A 3VUSA 3CL7A 1Z7AA 3RXZA 5JMUA 4M1BA 4U10A 3WX7A 4NZ1A 2NLYA 4V33A 4NYYA 5BU6A 4OUIA 4NYUA 1XW8A 2C71A 2Y8UA 3HFTA 1W17A 2DFAA 2IW0A 2I5IA 4F9DA 4NZ5A 1V6TA 3QBUA 4HD5A 3CL8A
chains in the Genus database with same CATH superfamily
1OYCA 4I7VA 1TE1A 4GQRA 3G1XA 4MDPA 4R7JA 3IIXA 1GORA 3OBEA 1I0DA 1XRSA 4C6BA 3C8NA 4IQJA 2RAGA 4DO7A 3PHAA 3L29A 1OX5A 4LV9A 4GNJA 1V3HA 2NQZA 3M0YA 3UETA 1AQHA 4JFVA 5HMDA 3BAXA 2WMIB 3E9AA 1JPMA 1YKWA 2O7QA 1RCOB 3SCVA 4V28A 2VQTA 3JVAA 3L4WA 3MMTA 2NT0A 5I78A 3SECA 1N7KA 4KMQA 4RDVA 1O60A 2PURA 5A6JA 4DJFA 4H19A 4IFKB 3VM7A 2G3IA 2F6UA 4EANA 2WZTA 4B5WA 3HPZA 4KCVA 2YYTA 4DBWA 1KM1A 1SR9A 4E8CA 4H7CA 1HKVA 5I3GA 4F0KA 3QQ1A 2W66A 4L9YA 2RGMA 2VDGA 1GNXA 4EKJA 4G2DA 4EE9A 3SCNA 1JCXA 4A8NA 1LL4A 3BWWA 2Z24A 1PVNA 5BMWA 3HV8A 4B5NA 4Z2IA 2PGWA 1IZCA 1Z6KA 1XSIA 2G3FA 2DT3A 3CZLA 3T09A 3VZZA 4IJEA 2HS8A 5AOUA 2D20A 2NX1A 1OCJA 4K8HA 3VGEA 3QHMA 3DDMA 2X40A 2P5NA 5BW6A 2R91A 1W0MA 2R1PA 2JKPA 2Z1BA 4Z0SA 3MV11 4HK7A 1TR1A 3GXPA 1S5VA 1Z48A 1NOUA 1KCKA 4PCTA 3QZ6A 2BVWA 2DZUA 1CNVA 3G1SA 4O4WA 2QQ6A 3DX5A 1JUBA 4KWOA 2VC6A 1SMDA 5FJJA 3K1GA 1RR2A 3UJEA 3SY5A 3B8SA 3ITXA 3NZQA 1CXWA 4JIEA 3GH4A 1BF6A 3U4FA 4C6IA 4AEEA 1V3MA 2HISA 4B5UA 3THUA 1FWAC 3GTXA 3TOPA 1R9XA 3W7MA 1OG0A 2WYSA 4FPSA 3E74A 4H6QA 5F2IA 5DMYA 2XWDA 3I3BA 3G1DA 3CU2A 5FL0A 1J18A 4JFUA 5C0QA 4QJ4B 4J3VA 4DLFA 2ACUA 3WH7A 4PA8A 2PGRA 3KDNA 4WOQA 7REQB 5HMSA 4N6EA 1TCDA 1F9CA 3RR4A 3SIMA 3QQWA 4KFNA 4A2SA 1R86A 3MTWA 2YZ5A 1V4YA 2WHJA 1R7OA 2RDTA 2XIQA 2YKKA 4Q8WA 1GXDA 1YPXA 1JRBA 4K8EA 4H8VA 3RILA 3AMGA 1QI0A 4S3DA 3M0LA 3QPZA 3VFCA 1IT8A 4BEUA 3HG3A 3GC4A 5GVJA 3SRKA 2Z2UA 4FNRA 9CGTA 3WQGA 3QR3A 1JUKA 1SSDA 3B0XA 3DBNA 3FFSA 5I3JA 3AIBA 3CT7A 2PZ0A 5A95A 1TV2A 4JN6A 3GDTA 4TO8A 3OGVA 2PGEA 3OYXA 3LTYA 1EPVA 1EXPA 1J5TA 3QBUA 1IEIA 5H8MA 1WZMA 4NJJA 3IUDA 1E1CB 2EG6A 4JHOA 3NOYA 4ATLA 3TJIA 4LUTA 3BLDA 1ONWA 1F3WA 5F2MA 4XG1A 3U9IA 3PY2A 3C0SA 1J0IA 1N8WA 3UJ2A 3MI2A 4RZBA 3B0VC 1XINA 2ZTKA 1F61A 4QEHA 3KBNA 3IIZA 3GXFA 1S1RA 3C0JA 5T9CE 4N9CA 4O10A 3OA3A 2W63A 3C6CA 3P80A 3UGVA 4M6QA 1HL2A 1Z41A 2H8XA 3H22A 1JJKA 1IIHA 1K70A 2Y70A 2VCCA 3W7PA 2FGLA 1MRAA 1PKNA 1Q3NA 3NQFA 1CT5A 3DFHA 3GBEA 4GYKA 2QVNA 2EAWA 3IJDA 2E8YA 2Y2JA 2ZDSA 1AJ0A 3ZS4A 3W3OA 1JGIA 1KRAC 2PP1A 3KBJA 3UXIA 4UMAA 2PDWA 1EP2A 3RR1A 4KW2A 3UF9A 3SDOA 1E55A 4D71A 3W72A 3M1ZA 4QJ3B 4HNNA 4A4AA 4H3DA 3B05A 1JQVA 2J66A 2RKXA 3DU0A 1HP4A 4UTKA 3H2OA 1XIDA 1XYCA 3BE7A 4HSNA 1K9TA 2C71A 3V1HA 5KEZA 4W9TA 3UWEA 4PMRA 5FF4A 1J8VA 5ABTA 1VS1A 3VDBA 1D3GA 1XDLA 4N6FA 4CN1A 4R3UA 2CU0A 4WSHA 4JYDA 1GVEA 4YL2A 3KRUA 2JGYA 3I4EA 4TOQA 2Y2MA 3VMPA 1EIBA 3QRHA 3FX4A 1EJRC 4MOZA 1LJYA 2WMIA 2OGYA 2OYMA 2YB1A 3N4FA 3OEXA 3MCMA 5G1YA 1SJBA 4FNSA 2V6AA 1SU5A 3PZIA 3WNPA 3CK5A 3ONCA 4JTRA 1NDZA 5CG7A 4WXYA 2G95A 1G9HA 3PZUA 1E9LA 5E0FA 1RQHA 4HT3A 3P60A 4CQCA 2UY5A 4O12A 1UWQA 2ZA1A 3SEPA 3PK7A 3W83A 1HW6A 5EFDA 2Q8ZA 3AIQA 2DVTA 3FEMA 2BP1A 3ERPA 3M6DA 4ZQCA 2QJHA 4MWAD 5A8NA 3ZO9A 4P2VA 1MEHA 1XC6A 3L5LA 4UR8A 1XGEA 2GGJA 5AHIA 3RCNA 3W74A 1U1HA 3PJXA 4L9XA 5K4XA 3E38A 3WLLA 2X8RA 3QY7A 5AYZA 3U2ZA 2NQLA 5D30A 5GJNA 5H8UA 3TN5A 2YDSA 4YYCA 1CLKA 1XWYA 3EX6A 1YNQA 1ISVA 2E09A 1EDTA 2NW0A 1ZJBA 2WCGA 2VWSA 4YJ5A 1ISWA 1BYBA 5A6TC 2FVMA 3LM7A 4WDTA 2XDFA 4ADSA 4AD3A 4MGGA 1DJGA 2YXXA 1XSJA 2Z1XA 4JTDA 7ENLA 2CLKA 1J96A 1CIUA 1T5AA 1O66A 3ZVHB 4CU8A 3DAQA 4Q4QA 1HJVA 5BOOA 4IG2B 1EJXC 1KTNA 1H0IA 5HBFA 1CYGA 2QDGA 2DZPA 2BGSA 4XZHA 4AVOA 2EKGA 4PEEA 3CQJA 6PTDA 2VHLA 1XYMA 1KXQA 1U22A 3EX2A 2WVVA 1R38A 3IJ6A 3M07A 3B8WA 3NO3A 3UCCA 2TYSA 4DI8A 1DWGM 1DJQA 3M5XA 1MEIA 4BZYA 5DLCA 3FA4A 3E2QA 3DKLA 1F3TA 3ZQ9A 1O94A 4GNVA 1JD7A 2PD9A 3L5AA 1OGBA 3VVGA 3MKVA 3WQOA 3OQ8A 1W3TA 3LZ5A 2G5WA 3VNJA 3KHDA 1GTHA 3EA2A 2QCGA 2Z0IA 1AQMA 1ICPA 4KRUA 3URNA 4Q8UA 3WD1A 4PMXA 1TPC1 3GR7A 5A69A 3N29A 4UQBA 1CEOA 2OG9A 1AMKA 1EBGA 1S46A 3DHUA 3RO6A 3CAQA 4TVUA 2VZTA 2CLHA 1HT6A 4PSRA 2DP3A 4M6UA 4MZ1A 1EEXA 4Q4OA 1EZ2A 1UIOA 1WDPA 3DG3A 3E02A 4O57A 4UFKA 3EOOA 4AEOA 2VRKA 2NV1A 4AZCA 1Q2SA 5CPLA 1QBAA 3AS0A 3IJ9A 3BJFA 2GLKA 4IXXA 5HR7A 3UEQA 4H7ZA 2Z25A 2RUSA 2BDQA 4HU3A 1JDFA 5K9XA 1TTQA 2EPNA 3RJXA 1ELSA 3G1RA 2PDHA 1HX0A 1I2RA 3E0FA 2J47A 5D37A 3ARTA 3WH8A 2A3LA 2YCIX 3TJXA 3ZM8A 4L56A 3ABQA 3H4XA 2G8ZA 2ZZ2A 2YFNA 2OYKA 3NIYA 3VIIA 3KWXA 1U33A 3TNOA 3UP8A 2J6XA 4R33A 3OVQA 4BQ3A 4F40A 3UPWA 1D3CA 2INZA 1TTPA 2X09A 5U7SA 4UBPC 4HU0A 3C61A 1CLVA 1YDOA 4DRSA 4DZHA 5CJ5A 4HCDA 1SJCA 4GE8A 4UTMA 1WAUA 4Y8EA 2BXYA 1DHKA 4LVGA 4GH9A 2D0FA 3M47A 1QWKA 1RD6A 9RUBA 3TH6A 3RYSA 1Q85A 3PVFA 3DFSA 4GVGA 3VDHA 4PBEA 4UTTC 2WKGA 1B9ZA 3EYPA 1S3TC 1Q63A 5LIYX 2BGNE 4AX6A 4LV4A 3KBWA 3LHVA 3GHTA 3H7UA 3ZT6A 2ISDA 1NEYA 3V5CA 5CG0A 2B7QA 1A5MC 3EX3A 3BLIA 3U0HA 4MNKA 5H91A 4R34A 4ERAA 1EDGA 2ZRZA 4NYUA 4QAIA 4FOKA 4LF2A 5F2LA 2WAGA 3S5YA 3T4WA 2NX3A 1FWCC 4JBRA 3RCMA 4ROQA 5IBXA 3VKDA 4DF1A 2BTMA 3GXMA 1DJXA 2D22A 5CPMA 3DGBA 3WUBA 3SRFA 3GFXA 4UFMA 1O4UA 4GUJA 5D2XA 1N82A 1A5UA 1TWIA 2XN1A 2DZSA 1EJSC 2ZCGA 4RZ4A 1IV8A 3CQHA 2C79A 2ZZ7A 1XLIA 3VX0A 3MDWA 3B0UX 3AMKA 4PTXA 3MO7A 1TRDA 1VHNA 3IEBA 4JX6A 1UOKA 1GZ1A 3MUAA 2PA6A 3Q37A 5GJMA 4TMBA 4JX4A 1SQ7A 3C3NA 2P3EA 2E68A 4ZQRA 1LZOA 4A3YA 1OB0A 3T2QA 2O7SA 1QOXA 3ES7A 2Z27A 4XVDA 4AD1A 2WMGA 3SQSA 3GB6A 4DPPA 4HJWA 1DTNA 3CZJA 3E12A 1CK7A 3TTOA 3OZOA 3GG8A 3VU2A 3DGRA 2CLPA 3G1VA 4AHOA 2DIKA 4LXFA 2XH4A 2ISVA 4XIAA 3O8AA 3ID7A 3V0SA 3H24A 1Z44A 1RA5A 2FGBA 4E2OA 4MUZA 2X0HA 5C7VA 3IVSA 3EKGA 2GJPA 2XFWA 2MNRA 3KTCA 1EC7A 3P82A 2ZUVA 4ZOBA 2OSWA 3DCPA 2VOTA 2VL4A 4XZBA 4YVPA 1L0PA 4ZB2A 3WUFA 1Q66A 1TVPA 1ECEA 3MWAA 2YA0A 3HPXA 5J5RA 5DRIA 4M5PA 3WLTA 2HTMA 1A5NC 3B8IA 3LCGA 1K4GA 3KCLA 1G4TA 2HPMA 1P6WA 3V4BA 4CNTA 4LAKA 3PUDA 1E1FA 3W00A 2PF0A 1RY0A 5HUOA 1PZ0A 3Q45A 4BF5A 3COTA 1ZBCA 1G5AA 1Q8AA 1VRXA 2I16A 4OJ6A 4PTWA 3L2IA 1NDWA 1PTAA 4LSBA 2FHBA 4C6DA 4IQEA 3T0TA 2VGBA 1XLBA 8RUCA 1PZ1A 1RAKA 3QQ0A 1I4NA 2H8ZA 3CMGA 3NAVA 3RM4A 3L12A 4LUIA 4H8NA 2OB3A 1XRVA 4GNKB 4PODA 2Y2QA 4AD2A 1WQ5A 2DDXA 3AIUA 3PJWA 3QGAC 4NY2A 2XGIA 4CCCA 1R30A 4UFIA 4C60A 3URAA 4X9SA 3HQOA 1Q2RA 2OELA 1NOWA 3HA1A 2W92A 1I6NA 3B4UA 4HCHA 2OYLA 3T40A 2AAMA 3NUKA 3WDHA 1EGVA 2E6AA 2J7CA 1FWNA 5AYYA 3LA4A 4XKYB 1AJ2A 5TBOA 1OCBA 4UNLA 1E72M 2NVAA 1OGGA 3KTSA 4XVEA 4RNIA 4AU0A 1E8BA 2CXGA 3G24A 3FHQA 4AZ7A 1D7FA 3AMLA 3T0DA 3LENA 3L7RA 4UXDA 2QCLA 2GUUA 1EQPA 3OQEA 5I06A 3V5FA 2CESA 3OA5A 2DSKA 1OC5A 3N3FA 3WLKX 5D9MA 4YTQA 4GUGA 2B7NA 1JCLA 2WSYA 3LY0A 1D8CA 4LAMA 3RLUA 3W82A 4GD0A 3PF3A 3NQAA 3CB8A 2Y24A 5C55A 3AXMA 1RV8A 3W7OA 5GNYA 3NJ3A 1V7YA 4PCSA 3G6LA 3M43A 3CUIA 3W2LA 2Y2NA 2FFCA 3RX3A 4FX8A 2F2KA 4GBDA 4C6EA 1FWEC 4ZEPA 3MI6A 3CXOA 1XR2A 3APTA 4E4FA 5BXRA 2HWGA 2W91A 1LQ0A 2NUXA 5MKGA 1W91A 1LLWA 3NDZA 1QW9A 2JIWA 1PSCA 3HJEA 3HN3A 1HJQA 1XIFA 5D2WA 3E0IA 1WOBA 2JEPA 4GACA 1Q6DA 2A0NA 4C1LA 1DP0A 4IGHA 3BMVA 3ALGA 4TVCA 3LSBA 4FXFA 1R2RA 3ZIZA 4ORIA 2W0UA 3UERA 1VEPA 1OD0A 1RD5A 3BG5A 3PBWA 5HMEA 2R6OA 4NZCA 4HD5A 3LBOA 2AQWA 3TDFA 4AG0A 1FFRA 3QEZA 4YYFA 1UW9A 1X1ZA 2PLCA 2WVTA 3UESA 1VH7A 4WVXA 2QJIA 1KRBC 4HTYA 3W7LA 4LG2A 3TZNA 4JFTA 1V6YA 4GI6A 4LEQA 3GIQA 7XIMA 2D2OA 4FEZA 4Z2HA 5JVLA 2Z29A 3W29A 1ECQA 4LYQA 3S6TA 5AC8A 3H7RA 4PC8A 3W1QA 2E67A 1OJXA 1PIFA 3KRSA 4W93A 3TU9A 1W1B1 4MM1A 1JFHA 4E0CA 2MANA 4IIEA 5GPRA 1MUMA 2Y2OA 2EPOA 4WJ8A 5DMNA 1OX6A 1XYFA 3KOYA 3KBMA 1E0WA 3OIHA 1BXCA 3RGTA 4QRNA 1BGGA 3HFTA 2VEKA 3P2VA 5G4EA 2Y5EA 4JEQA 4DO5A 3TW6A 4JQAA 1V02E 4B2DA 2ZZ3A 3MVIA 1B57A 4RUBA 1XP3A 2G50A 1Q4NX 3EPNA 3BUVA 1U1JA 5HJYA 2ZUSA 4JPGA 3N2TA 5AY7A 3CO8A 2FH6A 1RBLA 3AS2A 3TMQA 4NP7A 4DNMA 4NJGA 3W7GA 4LBUA 3WL1A 1M7JA 3SN1A 4J28A 4S38A 4PMNA 4U5KA 2ZKMX 1HKMA 4KS0A 1S39A 1QVBA 4C7DA 5XINA 2GDVA 3S9YA 4WKAA 5BRBA 4FIQA 1BXBA 1X6NA 3W22A 3L0KA 4S3GA 1JG9A 3ITYA 3T8QA 1JEZA 5DMMA 3MP5A 3BGJA 1VFLA 5CPNA 3WNMA 2WMJA 3GK0A 4RZ5A 2TPSA 3WL0A 3OLEA 2J27A 3EB2A 1W5OA 1QHOA 3LDVA 2PDFA 1ADSA 1YXDA 2WVUA 2PDBA 1T8QA 3EAUA 1SMAA 3M5YA 3WQVA 2VC7A 2J8FA 2R14A 3TAKA 2BBFA 3D3AA 3AYTA 3NFUA 2HQAA 5CSSA 2W27A 1VYSX 2DT2A 2YXGA 4AC7C 1W1VA 4W4QA 3NR0A 2FZ9A 4FSAA 3LBCA 2ATMA 1I2PA 4UB9A 1QBBA 3DI0A 4DELA 3T9PA 1ZALA 2HEJA 4QITA 2QR6A 1CXHA 3W7JA 3W1NA 3MHUA 1DEDA 1WBJA 4X0VA 2GDQA 2ZUNA 4JKMA 4LVDA 1RPKA 1B3YA 1ZLPA 3HM7A 4US6A 4L6OA 2X2GA 4IBFA 3PAJA 3W2NA 3G0SA 1J93A 4MB5A 4MKSA 1YU4A 3POCA 4Y9OA 3L23A 3KWSA 1W6TA 3QYSA 1WOAA 4B3LA 1DXIA 1ITQA 3NQDA 1WDSA 4JD4A 3VNZA 2I9UA 4RX0A 1GOIA 4AF0B 4OBRA 1FOBA 3MV01 3EWXA 3OZYA 1QOQA 4M24A 3M5VA 5G2WA 4H83A 1IEQA 5CGQA 1C93A 3CMJA 3F5LA 4PL2A 4BS0A 4ENLA 4EXBA 3QV7A 3M44A 5G1MA 4DWSB 3WDPP 4UR9A 1G4SA 1F3XA 2VC9A 1WKFA 4H9ZA 1FHLA 1L8PA 1U83A 5E0KA 2GQ3A 2H3DA 3QTPA 4L4LA 3SCTA 3TYCA 2V3DA 3TOYA 1KFJA 1UB3A 2R24A 2P0IA 3RITA 2CLFA 1UCWA 3VUPA 1GEQA 1E0XA 3IVUA 2XN0A 1ZNNA 1LORA 1LRTA 4PULA 4DJDC 4EK7A 2WZEA 1UMYA 3VKAA 2CZFA 4M80A 2ZICA 1G7UA 1GVOA 2QCCA 1EX5A 2QPSA 4HU8A 4HB7A 4KKXA 2OSYA 3B8TA 2A2IA 2PDIA 5IDZA 3H54A 5HPCA 5CEWA 2I7GA 4W89A 3LM3A 5ABFA 4OZOA 3TONA 2FB2A 1X8FA 1UJPA 2P0OA 2NQ5A 1JZ5A 1EC9A 2Q6ZA 1NH6A 3T08A 1LBMA 1TPVA 3E49A 1HGYA 4J40A 1SW3A 1H63A 2V5LA 5HJLA 2ZZ5A 1XIJA 3QW4B 1DJYA 3TVAA 2NQHA 1ZTVA 3BICA 3NDOA 1FCVA 1VFTA 4TU1A 1R9ZA 2VR4A 1ITXA 1EGMA 5D9NA 1E70M 3I6RA 4HMCA 1AH0A 5DCDA 3BGGA 1D7KA 2VD8A 2EPKX 2D2JA 3B9OA 1GVIA 4YMZA 3W1RA 3PS7A 5CC5A 3VIHA 3MMUA 2OO0A 4QNWA 1J0JA 4Z0JA 4HHMA 4K7YA 3IK2A 1NAL1 1QPRA 2QIWA 5JIWA 1VD6A 5ENLA 1YLVA 1M6JA 2QCDB 5I79A 1V0KA 4I6VA 3GYCA 3OHMB 2CZEA 3UGRA 2IKIA 2BFGA 2F61A 5C71A 3WDQA 4EPEC 3GSMA 4J3TA 3QMTA 2X7VA 4G5DA 3BOLA 1TPWA 2VGIA 3KTXA 3DYOA 3GIYA 2OZ8A 3WFAA 4O11A 3IIPA 1HNYA 3NZRA 2UV8G 2HBVA 4G9PA 3IGXA 1W37A 4YCPA 2GGHA 2HVNA 3V7PA 3WH9A 3GNOA 1I45A 2W3ZA 1VHCA 4K3ZA 1B3OA 2SFPA 2B81A 4WIWA 2PTZA 1B3VA 4MYXA 1LQAA 3IJQA 4IGSA 2ZUMA 3H26A 4M8UA 1NDVA 2PRHA 3CLWA 1W5PA 2QJGA 1W9XA 2XIMA 4LS0A 5JQ9A 1CENA 2P10A 3GAKA 2XFYA 2Z26A 2YA1A 2PDKA 3ZYZA 3LERA 2YSWA 3QGVA 4OFCA 1V6TA 4JKKA 3HGJA 2ZX7A 2PP3A 3N6HA 2IXUA 1OFQA 2HDJA 4AD4A 4GUIA 4O18A 1K77A 1Z9AA 4OIFA 1W1TA 1EUAA 4A8RA 3PJUA 1UZHA 1NP0A 2C7FA 3UWQA 4ZXLA 1EJUC 3NQEA 1W56A 2A3BA 3DC8A 3U5UA 4QGCA 1T40A 3VPLA 3ONBA 3NNTA 4IFRA 2EEXA 5I00A 5HJXA 4NAFA 4EP8C 2Y0FA 2FVKA 1LWJA 1Q7MA 2BHUA 2A6NA 3ARSA 4Q6XA 3GTFA 2ZX8A 2WKJA 3DI1A 2CLIA 3PUGA 2G37A 3P0XA 3ZSTA 1F3EA 4XAGA 2CBUA 3HZ3A 1ONEA 3PWIA 4LCQA 1B3ZA 4ZQOA 3WH5A 4W85A 1CGXA 4JL1A 3VX1A 3REQA 4MMWA 1WUFA 1X38A 3B03A 2CITA 1PDYA 3MUZ1 4G7EB 2P3ZA 3ZWSA 4ASTA 1KGUA 1TV8A 4Y8FA 1R3TA 1JYVA 3ZJ8A 1R0MA 2QPUA 3W1AA 2WJEA 3MBDA 3H8AA 1DQXA 2ZC8A 4X61A 5ABGA 4C1NA 4EACA 2W67A 2Y2PA 4XUGA 1JDEA 4A3QA 3A5VA 2Y8VA 8A3HA 3LCWA 3CPGA 2PD5A 2XWEA 4ONVA 5CBIA 1NP2A 3W7DA 4O14A 4QJ5B 3K8KA 3GR8A 1I9CB 3A12A 2GZXA 3ANYA 4CQDA 2JGQA 1N8IA 2QGHA 5KITA 5C9UA 1AJZA 1R47A 4RLIA 4ML4A 4CQ9A 4NAFB 3LRKA 4I9TA 3R1ZA 1FDJA 2Y2GA 3W1UA 4QCFA 1IR2A 1CDGA 3LXBA 4FP1A 2EG8A 1SO6A 1YE4A 3NPXA 3QJAA 1J5SA 1P5BA 3WF0A 2EPMX 2WMKA 3VOFA 2R82A 2POTA 2Y7DA 3CWOX 2OKTA 2Y8UA 2AKZA 1C8VA 2O9RA 1VFFA 1EF2A 1R8LA 3CBWA 2X30A 1XFCA 1XQLA 2VNCA 2EQDA 4IMEA 1PX4A 2DIJA 5D32A 3QV8A 4ZFCA 3STFA 1MFVA 2IKJA 1XGZA 1WAWA 2WZMA 2INFA 3P0WA 1XIBA 4KEMA 1RHCA 3O9NA 1F2JA 2DJXA 1PAMA 4L5ZA 1IXNA 2J7FA 3BPWA 3VTRA 1UUMA 4DY1A 2V8ZA 2J7GA 4ZA0A 1XCXA 3MI3A 4F3HA 2AGTA 3CQKA 4U3CA 5CXPA 3HV9A 2YA2A 4Z1DA 2QS8A 1K6AA 4LALA 4AZCB 4Y9AA 1V77A 3E5PA 1OX4A 1V6XA 4MSSA 1XIMA 4A3UA 4IBIA 2E25A 1YIXA 1FXQA 1WZLA 1U1UA 4HNTA 5FAGA 3UG8A 1BQCA 5XIAA 3WMCA 1SFSA 1YXYA 1W3NA 4J2PA 3USBA 1HO4A 1E6QM 2ZXDA 3C4UA 3CQ0A 4WR3A 3ZJ6A 3I65A 1UD8A 3QPEA 2UY2A 1QCWA 4AX7A 4ACZB 2ZRYA 3CZGA 3FVMA 4JZ5A 3EKLA 1XIHA 5JXQA 1K1DA 2XTKA 1JI2A 3WF2A 2QCDA 1WV2A 2ANUA 2Q3RA 3WBEA 1X7IA 1SM9A 3UZZA 1UZ1A 3F2DA 1MSSA 2W61A 1XYZA 3DHFA 4F48A 3KVKA 3KP1A 1JXJA 1E6XM 3L68A 3GKAA 3L4UA 3IRDA 4DM2A 3BAKA 2J8TA 4E2BA 2NT1A 4M81A 3CPRA 4GFSA 3VMNA 4MFDA 3L65A 4LW7A 3WF4A 2CLMA 2WK2A 3WYZA 4QROA 4QE4A 4FOUA 2Y5JA 1EHAA 2EXOA 4HIBA 4UQAA 4CD4A 5A6BA 4L9ZA 4IICA 2G3JA 5M5DA 2WVVB 7CGTA 3W2MA 4GI9A 2RH9A 1JR1A 5HAOA 3AI0A 4B3ZA 1KBIA 4F2UA 1W9DM 4V2XA 3QZAA 4PUKA 1EP3A 3R13A 3UJSA 4IG2A 2A21A 5BXTA 1OEPA 3BOFA 4QLJA 2NZLA 5M1TA 4NJKA 3W37A 3HF3A 4GZJA 3PZMA 3NQMA 3R5EA 1ITCA 2J7HA 3CH9A 2ZIDA 1PCWA 1KGXA 4JTJA 4L7ZA 3WO8A 4IZGA 3L9CA 3AIVA 3V5OA 1TPB1 3OPSA 3G8EA 3CUZA 1O5KA 1VGAA 4WSKA 4Q6JA 4QEEA 3KZPA 4UZSA 2X1SA 3T8LA 4IMFA 3KCOA 1GTEA 3GD6A 1SO5A 2VR2A 4RXGA 8XIAA 1NVMA 1PS9A 4NSBA 1TJRA 2IPJA 4ALDA 3HB9A 4F9JA 3MANA 4UTUA 4MB3A 5CPQA 2ZRXA 4HNOA 3W2UA 3V3WA 2E7FA 5FEZA 2VURA 3QM3A 4UTJA 3OOQA 2PWGA 1X39A 4CQAA 3ITGA 1H7XA 2J13A 4D8LA 2D2HA 4I9AA 1EO7A 2ZZ1A 4PB4A 1Q6EA 4LOCA 3NQBA 4S2BA 1JQXA 1E4IA 2IUZA 4URIA 3H53A 3A21A 1OT2A 3A4JA 4OE7A 4O1FA 4Q4KA 4F0LA 3INPA 1ME8A 5HQEA 3EMCA 3ZLGA 3T7VA 4OT7A 2FZBA 2JF7A 1JDCA 1X6LA 5TF0A 2Z7GA 2V5JA 1FVPA 1NF0A 5C9WA 1QHPA 1YNYA 2HNEA 3R11A 4DVOA 2I17A 1A53A 1BRLB 1A0EA 3HPFA 1WDWA 2Z6JA 3F03K 1ENUA 1GJUA 5KZ6A 1YADA 2A6LA 4WY0A 3D5HA 2ZX5A 3JZUA 5BWFA 4RNFA 2GWGA 2FJUB 4HJFA 2PDMA 3G1YA 1K9EA 1HG3A 1Y65A 2PWUA 1TPFA 2QCEA 1UC5A 1Q45A 1NU5A 1XICA 4FHAA 2GFTA 4Z1YA 5HQMA 3RHGA 3MZNA 3MP3A 1S2VA 4DQWA 1BWLA 1LDCA 1J11A 1GHSA 3LPPA 4F66A 3ZR5A 4AVNA 3WK3A 5A8QA 3II1A 3WFZA 3CL8A 2DZWA 3LPGA 3UY8A 1F8MA 1KWGA 3LTPA 4L64A 5DXYA 2ESCA 4PGLA 1DXFA 3VGFA 1VZWA 1NSJA 2OEJA 3ZR6A 1ZPTA 2V5DA 1MZRA 2WHKA 2ACQA 2XSXA 4JY8A 4F2BA 4YNGA 1E0UA 2J24A 2EGZA 2ZQ0A 3LCFA 4JTTA 3CWHA 3EDJA 4MF4A 1GPWA 2XJ7A 4FK9A 2Y7FA 5FKYA 2GYIA 1SO4A 1FWJC 4PYSA 3BVJA 4OJOA 3G0XA 2X1TA 1EXBA 1FCUA 1ZU8A 2CKRA 4C6JA 4NZ3A 5FJRA 1YUEA 5FJIA 4EF8A 4IIBA 1P43A 1E6ZA 2HE8A 4LX4A 1M68A 2IQ0A 4XUYA 3LNMA 3SGUA 4NASA 3SRHA 1OYBA 3TV8A 5AC4A 4HPJA 1A50A 3PB2A 3GC2A 3QZEA 5FOOA 4L65A 5LIKX 2AL2A 4MZ8A 5DEZA 4NNCA 3WBYA 1UQYA 3STGA 1GQJA 3QV9A 3VIGA 4WDUA 1XCWA 4J5NA 4NX0A 5AHMA 3VKCA 3HQ1A 3EB3A 4M51A 3GFYA 3KBSA 4CNPA 1IHIA 2PTYA 3UWVA 1IEVA 3LRMA 4ZVJA 2TMDA 1H7WA 3AMDA 5BOFA 3MKCA 4RE2A 4S3EA 1NY1A 2VO5A 3CNYA 3PZGA 2FLIA 1YE6A 2QUUA 4PRWA 4GX9A 4DWDA 3M0XA 2ODOA 3OW1A 4N2YA 2QJJA 4TV6A 4UZUA 1NFPA 3TLLA 4W7VA 3UFYA 2V69A 3R2GA 3GG0A 1Q6OA 4IIGA 3WN6A 1T41A 4RV8A 1C8XA 5DX7A 4ATWA 4NZ4A 1J0ZA 3SGZA 3RM9A 4K7VA 2PDPA 1BG4A 4QAWA 4RDZA 3VD7A 3VIMA 4PRTA 4B16A 1ZJAA 4H6EA 5RUBA 2BSLA 4KWWA 2I5QA 4HOZA 3MU7A 2Z1KA 5HR6A 3NPWA 1WBHA 3FJ4A 3LCXA 1J2BA 4XAFA 4MIMA 3B9DA 4NZFA 2QEZA 1FXPA 4FIRA 4BK9A 2QGYA 3UYIA 4U33A 3KS5A 1TZ9A 3TA6A 1XD0A 1GOOA 2WJZA 1HIZA 1OF6A 2XVGA 5DXXA 4YWIA 2V30A 3GFZA 1VBUA 5IFPA 1BTMA 2X05A 4F79A 1G4EA 4XBSA 1MI3A 1MDLA 5EPDA 4BI7A 4TTGA 2C91A 1BPLB 2WSQA 4F0HA 1F6YA 4JY9A 3MA8A 2CHNA 2P8BA 1GW9A 1NWUA 1Z7AA 2REQB 1UD5A 1GOQA 3I7QA 4JAWA 1YX1A 4AZ5A 3SBFA 4FX6M 4P7OA 5TIMA 3UWYA 2Y7GA 4GX8A 1CXKA 2E5BA 1GVSA 1KM6A 1R7AA 2PBGA 3KRZA 3MCNA 4E8DA 1XV8A 4NILA 1F5ZA 3IUIA 2VFEA 1EWDA 4U2ZA 4OJ5A 2QV4A 2YZRA 3R6IA 3KLKA 3NSMA 1B1YA 1WZKA 1EOKA 4PCFA 1TTJA 4ROPA 1H51A 1UR8A 1YTDA 2EJAA 4GHLA 5F4SA 3B40A 3S8HA 3F7JA 1HJWA 1QASA 3BLLA 1R46A 5LA0A 1W1IE 2QCHA 2FDSA 3RRXA 1ML1A 5E5CA 2DZBA 4IBEA 3WQ8A 3BZJA 3AUJA 3VILA 3PZNA 4IBDA 5HMFA 2YDQA 3QSRA 2Q8XA 2GOKA 3C0LA 4JR5A 1U5HA 5IRPA 4K36A 3EB4A 1ODZA 3AZRA 3ABOA 3P14A 3K8MA 2ZA2A 3HGSA 3VYLA 4ZQPA 3LI0A 3VZXA 1VYRA 3DESA 2GDUA 4ZODA 4JTIA 1BTCA 1XKJA 3QF0A 4GG9A 2V68A 3U57A 3O05A 2CYGA 3UG3A 3WELA 4TMCA 3OVPA 3I7RA 3PNUA 3GDKA 1JUEA 4DYKA 2TRSA 3N04A 4J4KA 4NHVA 1FBAA 2RDXA 4ACYA 2P53A 3QFEA 4BWLA 3ATZA 1LWHA 1H7PA 2WKLA 2YCJA 4W8LA 3A22A 3M0ZA 4A05A 3MHFA 1GJWA 1J12A 1POJA 1A3HA 2HBXA 3GXNA 3LLDA 4IX2A 3VIFA 4V27A 5JBFA 2IQTA 1UH4A 4YIWA 2GUYA 5EMKA 2C1HA 1VBJA 3VNIA 2YL9A 4JCLA 2WBKA 3KHJA 3IV3A 3ENLA 4QIUA 1HVXA 1WPCA 3LV6A 4ZENA 3OBKA 1ZQ5A 3N12A 1O12A 3KAOA 3CIWA 3C0QA 5CZTA 2PZNA 2FFIA 1XPGA 1W5QA 1BD0A 3PUEA 3NA8A 3S46A 2VOMA 1UP2A 3SSJA 5G2HA 1GPFA 3F1QA 3WLNA 1GEHA 2A5HA 5AECA 4RE4A 3WLIA 4U3AA 1HUVA 3NSXA 1R3QA 3EWUA 5K7JA 4PMZA 1K6WA 4NVTA 5A1AA 1VJZA 3A24A 3S9IA 1TWDA 1FWHC 1VFSA 3GHRA 3U48A 4GFIA 4LVFA 3W4RA 2CXEA 4G1KA 4C6LA 1T99A 4FI4A 3AC0A 4CVWA 1E71M 2FTPA 3HPSA 4Y9NA 5FACA 5J5DA 1JZ6A 3W24A 1CB2A 4NX5A 3S3GA 3WQ5A 3OG3A 2VFHA 4HMEA 2E6FA 5D2VA 3H2AA 1F6KA 1TELA 1QO5A 1UC4A 4BF7A 1XC4A 4R27A 2VUNA 1UG6A 4R9OA 4V1YA 1ONXA 5K3VA 3W28A 4C1KA 2HZGA 1VPXA 3QV6A 4LU0A 3H2EA 3TYEA 1KO0A 5KMYA 1SW0A 1M04A 1QDSA 1IT0A 2PGFA 3PZ9A 4OTKA 1YDYA 1JZ8A 4LUYA 1TJ1A 1Q6CA 4C6MA 1G6CA 4JHMA 3FKRA 2D0HA 1TVLA 2RTSA 4FS9A 1XLCA 4FLSA 1FWSA 3RU6A 3GQYA 2FJKA 2I56A 2DY3A 3AWNA 4MNJA 3M16A 1CWYA 4EAYA 1TRIA 3H23A 4TTUA 4B91A 3P81A 1AQFA 5BXPA 1TREA 4GWEA 1M3UA 1VAHA 4DBDA 4TV5A 1PDZA 4KIEA 4I8YA 3BQ5A 4KESA 1LOQA 1QNSA 1OX4B 1IT7A 2AQVA 3PBGA 1VEMA 1OFBA 3VMOA 2R94A 1KBLA 2ZADA 3QXBA 2E40A 5AHFA 2QMKA 2D2GA 2V0TA 3I10A 5D03A 5CZJA 1AQ0A 4NIRA 3QC0A 3FDGA 2XH7A 2DPEA 1PUDA 4HNCA 3UXKA 3O6YX 4F8XA 1KCXA 1CPUA 4D6DA 5FCZA 3GWQA 2QHAA 2NXHA 4GINA 4U4MA 1XBZA 2L5HA 3LTSA 3PULA 3H6OA 9XIAA 4JFSA 2YYUA 1GVRA 2UBPC 4J1OA 2BOGX 1B3XA 4IOTA 4ML9A 1DJHA 4OWGA 2V9DA 4DLMA 3L26A 3EWBX 1QI4A 1R3YA 1K7FA 2YDRA 3HMJG 1X98A 2VMFA 2VENA 1V93A 3GS6A 3F5JA 4W87A 5HINA 2Y2LA 1L6JA 1H2JA 3UY7A 4UFJA 4QCEA 3SCRA 3E0VA 3BAYA 4TQTA 2AAAA 4XSMA 5CPOA 4L4PA 1VFUA 5DBUA 3LLXA 3W7KA 1MRQA 5C5YA 4I5UA 3RMEA 4PRRA 1OWQA 3LSCA 2PRMA 4H9TA 2X41A 5AVNA 1XIEA 1VR6A 5A6SA 2IS7A 1ZENA 3MS8A 2ACRA 2GUBA 4BKNA 3MJMA 4QSFA 4Q8OA 3T81A 2V63A 1XBYA 3UZYA 3JS3A 1F73A 5G5IA 2FPVA 3BG9A 3M4HA 3P5ZA 1RY8A 3OVRA 4O28A 3RLHA 3ZT5A 1JNEA 4AZIA 3ICJA 1QT1A 4O1DA 4OUEA 1R85A 4W5UA 5E1QA 2V3GA 4LRSA 2R9RA 4EX4A 4EWND 1S2UA 3GE7A 4M0XA 2CFFA 1BWVA 2YIHA 2CZ5A 2R1MA 2HV5A 1QXLA 3WD0A 3VCNA 4XZNX 1SFTA 3B9AA 5BU9A 4PCNA 5LYRA 1W54A 3GZAA 1LOSA 4FMVA 4KT2A 2DEPA 3KVMA 1S5TA 3BAIA 4R88A 1W3HA 2Y4SA 3EMZA 5FI8A 3W2JA 3ZWTA 3HBLA 4H9MA 1VENA 1P7TB 2ZVRA 1UR4A 4A29A 1YW1A 4N02A 3N73A 2NVCA 3A13A 4BY3A 3W7RA 3RXZA 1B0IA 1I2QA 4JXCA 1RVGA 2OWXA 3S1WA 1SJDA 3F4VA 7TIMA 3IUHA 3WLQA 4FLOA 2ALDA 4JYFA 1HXJA 5LXXA 3RF9A 4K68A 2ZE3A 3U7VA 3IGHX 1FCBA 2GQ9A 4CUCA 1XFBA 1YU3A 7PTDA 3WLSA 2OJPA 2H9AB 1QNOA 4WKHA 4LS2A 1PIIA 4QDPA 5ABHA 3RUBL 4X2PA 1A5AA 4Q4SA 2V3FA 1EKOA 4X0NA 3QTGA 3IGSA 1JPIA 4WHBA 5DQPA 3FEQA 3GNPA 1XCFA 3UVIA 1UZDA 3K4AA 1N55A 3AJ7A 4Y90A 1EEPA 4G7FA 1G0CA 2PU1A 4C5ZA 3WF1A 3CEPA 3M5ZA 4JTQA 4GPNA 4MZYA 1KKRA 2D49A 1V51A 2WC7A 1QRQA 3FA3A 5FJPA 3GO2A 3GY1A 3I3DA 4IP7A 1S2CA 3O6CA 3JZEA 4W86A 1R9YA 2KX9A 5GQBA 5HNTA 1JZ3A 3CYVA 4GGHA 2J79A 3CQIA 1H1ZA 5J04A 4J27A 3TYBA 4Q8QA 2ZX6A 5FA5A 4FR6A 4J3SA 3LCIA 1S1PA 2OQLA 5HOSA 4HZMA 1MW1A 4IT1A 1R2SA 4DI9A 3S2MA 2JBMA 1W1A1 3N19B 4GXWA 3VGGA 3MHGA 4AIOA 3WDRA 3WQPA 2E9LA 3PTMA 1XLAA 1P4CA 2WANA 5B80A 1DPMA 4H01A 3TSBA 2VX6A 4KH2A 3QR1A 3VO0A 1ZUAX 3FW6A 4C7GA 2JKAA 3SO7A 3TYUA 4BI5A 3UZXA 4IPPA 1W2VA 4ZOAA 5GJPA 3AIWA 2QCFA 3ATYA 4MPQA 4BA0A 1HO1A 3BGAA 3ARYA 1PKMA 1R3RA 3O2LA 1VQTA 2VCBA 1GOKA 1W3IA 2Z2AA 2R1KA 3WK1A 1Y0EA 4M6PA 5CKSA 1DYSA 4EXQA 2ONEA 1AG1O 4XIMA 3FKKA 3QR0A 1QK2A 4XD4A 1UUQA 5JH2A 5ABFB 3NQ2A 3L27A 3C2EA 3DH7A 3P62A 3F2CA 2GVGA 3W6LA 3R8HA 5E0CA 1HKWA 4FR1A 1O5RA 1TPDA 5CPTA 3LOTA 1Y5WA 3CAKA 1Z89A 5IDIA 2BX7A 3G18A 5CZSA 3SCPA 4PTMA 3TTYA 4TX9A 4XZ9A 2FDMA 3KS4A 2WLZA 1KS0A 4A21A 5E6YA 4U10A 3EWYA 3G5EA 2QDDA 1HKIA 1OFAA 3S42A 3DFOA 3W02A 1FH9A 3NQ8A 1CZ1A 3VGHA 3WLMA 1FQ0A 1WX0A 4Q8TA 1Q6RA 1DWFM 1SSGA 3TZFA 3VGBA 1I8JA 2WOQA 1OGSA 1POKA 1U5VA 1F7BA 2C15A 1RCQA 2YL8A 1K3UA 4JIHA 4LH8A 4IPNB 1KCZA 1UA7A 5T8GA 3EX4A 4B2DD 1KR1A 5FIPA 3T07A 1AK5A 2F6XA 4RPPA 2NV2A 1MW3A 1XLHA 2IMRA 4UWMA 1XDMA 2D1ZA 4KGLA 5HNRA 2Y62A 2A1YA 1XG4A 3PG8A 2W4XA 3K4DA 1DE5A 2GGGA 3BLEA 5I2UA 1AD4A 1ADOA 3ABRA 3CUHA 5KZMA 5C6MA 3WNNA 5PTDA 1VFMA 1JFXA 4LUTB 3DECA 1XM3A 1E9IA 3N3TA 2PWEA 1QU4A 1LL7A 1PTDA 3ZT7A 4JOMA 1MUCA 4OJLA 1JRCA 2WC3A 3TYDA 3WBWA 4IL0A 1W2PA 4MUPA 3L0GA 4HA3A 3KVJA 4IBCA 1BWKA 2YDAA 4KWVA 4Y9PA 1XLGA 1JD9A 3MSDA 3WJYA 3EMQA 3IJ7A 4O8AA 4MHBA 3O16A 4Z2GA 4AVFA 1TV5A 3IJLA 4XTDA 3AXKA 1AODA 3UXAA 3M0VA 2OO6A 1EPXA 3LEPA 1XD1A 3A3HA 4QS5A 4F0SA 3HURA 4JTCA 4ZQMA 1J0YA 4GKLA 1UR2A 4GQQA 1S2WA 3RDKA 5HWMA 3BARA 2Q02A 4ZR8A 4GVHA 2OR2A 3T78A 4CEXC 4IBJA 4HYVA 2PDYA 4FNPA 4E6MA 3USZA 3RLGA 1BG9A 3DZ1A 1LBFA 3AIRA 4OV9A 4BR1A 4HN8A 3T0CA 4B9ZA 1JPDX 3G8RA 4KWSA 5FEXA 3HMCA 2VR5A 3GXIA 2EBNA 3WLJA 5LNUA 4PTNA 2ZRUA 4P7QA 3UU0A 3FNDA 1TV7A 4MWAE 3GVWA 4MAZA 4S3KA 3LBMA 2YW3A 2Y85A 2E1WA 1ED7A 1P48A 1R3SA 4XKMA 1QAPA 3J7HA 4X2RA 1SJAA 4HN4A 2YL6A 3OLIA 3SAZA 3WQWA 2AQOA 1V3IA 4IQDA 3WMSA 4IBBA 3ABXA 3N25A 3LLFA 4W7UA 3SQMA 4H2CA 3W25A 1H7RA 4AY8A 4Z2LA 1W32A 4F2TA 4B5VA 3DFQA 3VIJA 3AWOA 3IIOA 4Q8NA 1EWEA 2DW6A 2Y2WA 4BWLC 5AVHA 5MF5A 3ITOA 4Q8PA 4BJHA 1TR9A 3BSMA 1HVQA 3FSUA 3RCYA 4HHHA 1K8YA 1Q13A 2ZA3A 5D9PA 1KLZA 3WBAA 3KP0A 2TSYA 2J88A 4OQVA 4WY0B 3KFTA 2CW6A 3SJNA 2GVJA 3WEZA 1XLLA 2Z1VA 4X63A 4A8IA 3SUSA 1K4HA 4P8VA 4NXSA 2VI0A 2PPGA 2OTDA 1T0OA 1UIPA 1V02A 3BANA 1H50A 5T26A 1UROA 3BDKA 3GHUA 2VRJA 3ARVA 1ZCCA 3BAWA 1BYCA 2DGAA 2CHRA 1EUNA 3DFPA 1DQUA 2V5BA 1XL9A 2VFDA 4D2JA 1Z8AA 4MPKA 3V36A 2OT1A 5K4ZA 2CBJA 3FKEA 1WDQA 5KZDA 4B5TA 1F76A 2FZDA 5BCAA 3GAYA 3U4AA 3U2EA 4AHQA 1GQLA 4KF1A 1PX3A 1AVAA 1XJBA 2XUCA 4ORMA 4ERGA 3MMWA 5IHRA 5KETA 1HL9A 2WCAA 3VIKA 3W81A 3RIKA 3S83A 2HXTA 2P8CA 2PCEA 3K5XA 1EZWA 1KA9F 1OFRA 2OLAA 3BW3A 4CCDA 4C7FA 1NTHA 3F2BA 4JTHA 3NL5A 4EF9A 2XM1A 3HOJA 4ATDA 1CXEA 4QNLA 4JNMA 2YCEA 2NWRA 4N9BA 2PDLA 2DJLA 4FNUA 1O5XA 3PSWA 5BRQA 4D8ZA 1TFVA 3M0KA 3EOUA 4PR4A 3B8VA 5A2AA 3SFWA 2HK1A 4IBGA 1KRMA 1RP8A 3F4DA 3KOZA 1JPKA 1WDRA 1TB3A 1SO3A 3WLOA 1EDQA 3I6EA 4S3FA 3O07A 2POZA 4DEFA 4MWAB 2OZ3A 4D1JA 4GA8A 4UCFA 2CERA 5D33A 2ZRWA 1TG7A 4AC1X 2WNQA 4DJED 4EOUA 1ZFJA 3HG4A 4WF7A 4R85A 5C9XA 4ZOEA 5EMMA 1YTEA 3KEHA 2PRLA 4BCEA 2Q01A 3QPYA 1JZ7A 4WZHA 3QKZA 1G69A 3SY8A 3AMCA 1P0KA 3STCA 2WHMA 4WQ6A 4IJFA 1OF8A 3KE0A 4H41A 2JE5A 3GU1A 4AY1A 3O7UA 1GZJA 1EFZA 3KS6A 3CV1A 4GISA 1W3LA 1W9BM 3QMRA 4MJZA 4N9DA 1LCOA 4RKAA 4O1AA 3PG9A 1QW7A 2VM8A 1CXFA 1MNZA 3VCRA 3VGDA 1KXTA 4YTRA 1CECA 1H1NA 3OHIA 4GY0A 1T7LA 5ECVA 3AHVA 1G1YA 4C6KA 4PMVA 4POCA 4DPQA 1KTCA 2NX9A 3K2GA 4PTVA 2VEFA 4XO7A 3AFBA 4AWSA 4EWJA 1VIZA 2E5CA 3IANA 3TW9A 4PB5A 3DKJA 1EJTC 1NQKA 1MXSA 2XD1A 2J7BA 1EOMA 3PUOA 3WD3A 3VDAA 4KWUA 4E2VA 3GYEA 1P7TA 1UHVA 4EVZA 4DYJA 2X0YA 1A5KC 3T42A 3B0PA 3ISIX 5A6AA 1OINA 4B9YA 4ACZA 4MB1A 1ZAHA 3B0YA 3W7EA 5I3DA 4G6CA 1E3ZA 1JAKA 3LGDA 3MPGA 2WMHA 4DWSD 4ZO8A 2WNNA 2QUMA 2D0GA 5T9BG 3C52A 4DJDA 3KOFA 1NWRA 4GJJA 3R79A 1OADA 4GIRA 1W8SA 1ME7A 5D05A 5DCEA 4AD0A 4AMCA 3WD4A 2EO7A 2Q09A 5LIXX 3D0CA 5F1UA 5M03A 1NJJA 4H1ZA 2UZ9A 1CXIA 1KM0A 3FGCA 1XF0A 4XTIA 3CTTA 3NEHA 1KBKA 2PFHA 4QTGA 4FX7A 3VD5A 3HG5A 2CETA 3M0HA 5EA9A 3UWUA 5TNVA 3M6YA 1A0DA 3W88A 1W1ZA 1RLCL 5TAOA 3ZFHA 4V33A 3W53A 1J9YA 4EPKA 1A5LC 1H5VA 5A8GA 1C91A 4W8BA 1GQKA 3D3FA 4ICMA 4GQBA 5CSRA 3TP4A 3F5KA 1THFD 3TR2A 3W1XA 1RJQA 4R5EA 5DT5A 3LX9A 4RE3A 2ISSA 3IGUA 3TXZA 1IXOA 1XUUA 4MJ4A 4LQ1A 4HBKA 5CJMA 2GVLA 3T1GA 4DJEA 3BOXA 3QKEA 2MUCA 4HZ7A 1DQWA 1LT8A 3KUMA 1XIGA 1GG1A 1P1XA 3VNDA 4ZTXA 5G4WA 1K8ZA 3WLHA 1EH9A 4PTDA 4RW5A 4O15A 4UTTA 4AQLA 1W9PA 3ARRA 3PP7A 3P6LA 4X22A 2V2HA 1E56A 4GXPA 1ZP3A 4N0RA 3DUGA 4L1WA 4LRTA 2OODA 4UUIA 1PEZA 5C2XA 3TROA 1V79A 3L4ZA 3BJSA 3BSHA 4HHLA 3GVQA 4NG3A 4NL1A 1T96A 3R0KA 2DZXA 3SGGA 3LMYA 3KW3A 2I1OA 2ZX9A 2AL1A 5FF2A 5LNVA 2NQJA 2WV8A 4MAVA 4HOXA 4D1IA 1L2QA 1E6SM 4E4UA 5A6KA 1WA3A 4CN4A 2BB0A 2A7RA 1KBJA 2P50A 3WQDA 2VKZG 4G7EA 1Q6LA 1Y8BA 1PZ2A 1PWLA 2OGJA 2FGZA 4LCRA 4C6CA 1OIMA 4Q7IA 3L4TA 1Y5XA 5F4XA 2IKGA 3U5YA 1QJWA 2CZVA 4QDWA 4LPCA 3THDA 4MJ2A 1HZYA 4KPLA 1GUVA 2ZOXA 2VZOA 1AUSL 1XLMA 1SR0A 3MUCA 2WNWA 2D3LA 4M6VA 1JCJA 4WKFA 1OSEA 1UD6A 3MKKA 3ITCA 4DZAA 3G2GA 3FN9A 1DV7A 3ARWA 2OU4A 3L25A 1Z32X 2YLLA 4E3TA 1LYXA 3EGJA 3AJXA 3AU2A 3SUWA 1S5NA 1BAGA 3WEOA 1NFBA 4ZCWA 1DJWA 3K4WA 2WJDA 2PBOA 2AMGA 3ARQA 1XGDA 3CGTA 2EF9A 2TODA 2ZYFA 4LYKA 3UR8A 4BF9A 3A3WA 4Q32A 4AHPA 3QY8A 5LGXA 3OGSA 2RDUA 1ZS2A 4CD5A 4BHYA 3V75A 3SUUA 1QI2A 1R2TA 1XS2A 2WB5A 3W23A 3LV5A 1AZ1A 1LWIA 2OT0A 4RJEA 3SM0A 4XISA 4DUVA 3W73A 3ZMRA 2WSKA 1JXKA 5EGRA 3QW3A 5AC7A 2Z1SA 4IX0A 4U28A 1UJQA 3KCJA 4EPBC 2Q71A 3EBVA 4LVBA 2BVDA 2HPIA 3O6DA 4LF1A 2IPFA 3V0TA 1E4LA 1ZZMA 1YU2A 2OCZA 3GHSA 3BV4A 3E2SA 3UPMA 1TMLA 2WZIA 3U2CA 3R8GA 2GJLA 2DUAA 4AISA 1RBAA 4HMDA 1OC7A 4GVFA 4B4HA 4MWAC 2AMXA 2PU0A 3S2CA 2OX1A 3JRKA 4BQ4A 3G0UA 5I02A 3WD2A 5AHLA 1H09A 3ARXA 3CB3A 3UPBA 1NM9A 2J9XA 4IQLA 5D04C 1OM0A 4JYEA 1B31A 3MSGA 4UCGA 2ZZ4A 4KCTA 2HNHA 5CPSA 3BSGA 4WGXA 3EZ4A 4DJFC 5I5RA 2XVLA 2XIIA 1NWTA 5JH1A 1QPNA 3B04A 5K9DA 4JCMA 2ACSA 4DBEA 5AHNA 2V81A 3IK4A 5AC5A 3BURA 1BSLA 4NI3A 1JCNA 4UFHA 1EYWA 1VBRA 1CLXA 3W70A 2C8NA 3S2JA 3S0CA 1H60A 1CXLA 5B7ZA 3O06A 3FJNA 4OVXA 4IJRA 1VCGA 3B8DA 3KLLA 3LHWA 1U5JA 2EHHA 1SVDA 4ICNA 1A5OC 4NXKA 9XIMA 3WSUA 5FSDC 4HU4A 1OZMA 5FJTA 2Y8KA 1H49A 1QO2A 1O68A 1SZRA 1CGVA 4E4PA 4ZMGA 1HGWA 1I1XA 3W6MA 1B9BA 4DJFD 2CNCA 3GW3A 2GGIA 3R94A 3O0KA 4YVVA 3W38A 2B31A 3BMWA 4AMAA 2X16A 1Z69A 4GZIA 2F84A 4IP5A 4JNYA 1UWSA 4O0QA 2PWHA 3CUGA 4K2SA 5HANA 4PMOA 1UR3M 2YCLB 3QOMA 1JYWA 3HJZA 3WBXA 5D4YA 5FD0A 5CSUA 3VE9A 2DSZA 3E0WA 3F4NA 3B4YA 4LYPA 3A6OA 3T44A 4AIEA 1ZCOA 5CQ1A 5CBJA 6TAAA 2ALRA 3S47A 2CBIA 2C3ZA 2BXVA 2QZRA 3GUWA 3C3UA 4ZGYA 3CL7A 5A5WA 3W07A 1E4MM 2BG5A 2NSOA 5EBUA 2BXZA 1C3FA 3DENA 3FJ6A 4MDOA 4YHEA 2IW0A 3DFTA 5JBEA 4HTBA 1C9DA 1SFJA 3GM8A 3GDLA 5BYWA 1N8FA 1F8IA 3M46A 2WJFA 3NZ1A 3TJ4A 1ZBVA 3BCDA 1ME9A 1UMLA 4JQ2A 3RJYA 3TIMA 3FY1A 1OK4A 1FWGC 3GG1A 6CGTA 3HPAA 2E77A 2JE8A 2QW5A 2XGBA 1UKQA 4QJ1A 3T05A 3OU8A 1EAKA 5HWJA 3SJ3A 1YDVA 3TA9A 3UJFA 2BV9A 2NV9A 3LPOA 2VRQA 4ZSUA 1UD2A 1L2UA 1VCFA 3PTKA 3GDBA 2HRWA 1SPQA 2C0HA 2YW4A 3IARA 3SURA 5DY3A 4MY9A 3E1F1 1UH2A 3UR5A 2UY3A 1QI3A 3WENA 2AKMA 1FP8A 1O5QA 1TIMA 2V5OA 2O0TA 1KFKA 3ITVA 2V82A 4Z2JA 3GBDA 1IYXA 3NCOA 4Q8MA 2E6DA 3R89A 3C2FA 4WXZA 1L6GA 3H2MA 5EB8A 2QCMA 1MO0A 3GXDA 4R9XA 5HA7A 1Q5MA 1N2VA 5LNWA 3SI9A 1QNRA 5I3FA 1PYMA 4LB3A 4QQUA 1VJSA 1GQIA 3PBVA 2QVHA 1DWHM 1FWDC 4GRSA 3SR7A 3G3DA 1Q7QA 3ABSA 3EA3A 1ISYA 1PL9A 1TWZA 4MJMA 3GNRA 2W6RA 3BK0A 5AYXA 3B9EA 2GWNA 3O3RA 1J0HA 5E70A 4J3XA 3FYYA 1V03A 3RRAA 3F4WA 4RL3A 1RQEA 3QSTA 4PUJA 4LANA 4M56A 4IIDA 1TYGA 4CQBA 4JKLA 3QMSA 4DF0A 3W1LA 4CGTA 2VXNA 3ANUA 4QP0A 1ZHAA 1S5WA 4XAYA 3NQCA 2DZAA 5HATA 1OZQA 4HOWA 1G4PA 4DBSA 1VB9A 3IJ8A 2IPWA 2EKCA 5HWNA 3WLPA 5CBBA 3MBFA 3MYPA 1LP6A 4M1RA 3CPUA 2ZVIA 3S1VA 7A3HA 1FX6A 2VUYA 2QAFA 3PWGA 5AN7A 1EIXA 3EDKA 3U6WA 3TK7A 1KM2A 4NYYA 3NQ6A 2ZRVA 3VXGA 4S3CA 1QI5A 3DERA 1E6RA 5BXSA 1WKDA 4M19A 5L6UA 1QHZA 1VFOA 2C18A 1M53A 1JZ2A 4O0KA 2YFOA 1FWWA 3RK8A 3VNMA 2J4GA 1XH0A 4Z42C 2J74A 3KOWA 2FYMA 2O9PA 4CD6A 3S6DA 4IIFA 1TJ0A 3CH0A 5FJUA 1GVFA 4IMDA 2VELA 5CSYA 1KM4A 1LROA 4Y96A 3WDIA 2CCRA 4Y2WA 3ANVA 7REQA 2VFFA 4NRRA 3W7CA 3MUIA 1QPOA 1YPFA 1JGMA 1Q4WA 3POHA 3TC3A 2CPUA 5AYBA 3GR4A 1LRQA 2EPHA 4DJDD 1XYAA 4DZ5A 4P5UA 1J79A 1JCTA 3WDJA 4QXIA 5FJOA 2WZHA 2RJHA 3MWCA 4E8GA 4MLRA 3SY1A 1KFCA 1MMFA 4N4PA 3HTWA 2D69A 4AZGA 4AD5A 1UD3A 4RDYA 1QATA 3CL6A 1RK6A 1YBQB 4AYGA 1XX1A 3A47A 3G3MA 2V2DA 1OFPA 1BYDA 1GYLA 1AW5A 1Q6QA 3WK0A 2OLHA 1E6NA 4MNMA 3NXFA 3HIJA 1MNSA 4XV0A 3AICA 5A8MA 1PZ3A 4LBSA 1W3KA 1ISZA 1WYIA 1XH1A 4O54A 4PL1A 4JTUA 5F2GA 1IZJA 1LUCB 2PUZA 2OFJA 1RLDA 4LVAA 1U30A 4QR6A 2R1LA 1GHRA 3AISA 4OUIA 3N6JA 1FDZA 3GTNA 4JIIX 1AL7A 1YEYA 4XAZA 3UCDA 3IVTA 4H9UA 1W9UA 1ZRQA 2FMNA 2VCAA 2YCLA 4B90A 1L6SA 4FZIA 1E0TA 2VT0A 1EA9C 1VJIA 2FMOA 3OVGA 3FV9A 3L2LA 1IEWA 3TW7A 1CW2A 4IF2A 3N2OA 3W6YA 4IPIA 1HFBA 1PV8A 3OBAA 3TX9A 2C0AA 3FXGA 3A4XA 1BRLA 1C9WA 4HCLA 3EXTA 4K38A 4JEJA 3LXAA 3BQ6A 1UR0A 2XU2A 3QYQA 2DQXA 3LS9A 1ESWA 3MT1A 4L1XA 4XBKA 4N9EA 3PN8A 3AS3A 2YBVA 2GQAA 3GVVA 3LCLA 3H12A 4LUJA 4AIUA 1NARA 2PC4A 1EP1A 3I4KA 8XIMA 1O6IA 3EX1A 3AYSA 1CGYA 1XYLA 2PEVA 3ZLFA 4H9XA 3AXIA 4PB3A 1V5XA 1UPMB 3NYDA 4GYPC 2XVPA 2DV0A 1H8PA 1R5YA 4LWWA 4DX3A 2BS9A 1PKLA 3N18A 3HGRA 2YPIA 4Y9MA 4ZE4A 3BCJA 1KNWA 3KX6A 1KQZA 4O53A 4L4MA 4IH3A 3PTDA 1GZGA 4IPJA 1AMYA 1M7XA 5A2CA 4K37A 3YPIA 1IWAA 4DUWA 1UUOA 3H7VA 2G3MA 4CCZA 3OZMA 5EKYA 4MTVA 4AAJA 1O7AA 2PLJA 4FNTA 2WWCA 1FH8A 5HUPA 3S1UA 2CC0A 3OZPA 1C92A 3M64A 4O50A 1KFWA 3RLVA 1P0BA 5ABEA 1RCXB 3SCUA 2WWDA 5BRPA 4OV4A 2PWDA 3TMLA 4QFUA 4HYWA 3FVDA 3Q4DA 5TD4A 5CH9A 5A94A 3VNLA 3L66A 1QMLA 5LKYA 1SZNA 4GQ0A 4CKQA 2V2CA 4A3HA 3TSDA 1KGWA 1W1PA 2FHCA 2FZ8A 1C7SA 3PJTA 2E8ZA 4DHGA 4FLRA 2F2HA 3D46A 1XSKA 4YPJA 4P61A 3NG3A 3B97A 5GNXA 3W7NA 4LBRA 3LQLA 2DW7A 3PC0A 3TTEA 3NVTA 1M5WA 2PMQA 4A2RA 2J7DA 1UWIA 1A0CA 1Q7ZA 3WNKA 1RUSA 1LG2A 2QNEA 3G6MA 3PPHA 2A85A 4ES4A 4G56A 1BKHA 1PKYA 1VC4A 2X7WA 1G01A 7ODCA 4O1CA 2FFFB 1AD1A 1REQA 2WVSA 1KV8A 5HULA 2Z4GA 3D6NA 2VD9A 5LSMA 2F9RA 4ZO6A 4WEVX 4GYFA 2DVXA 1GKPA 2XISA 3K8LA 4KRZA 2WBGA 3NXLA 2WC4A 2VVNA 1GYNA 4A6GA 1QO6A 1UPPA 1UYQA 3A9IA 3NL6A 4MLJA 1UKTA 1A5SA 3I68A 5JU6A 2P1FA 4A22A 1UBPC 2XG9A 1OHLA 2Y1HA 3HQPA 1GKQA 1VPYA 4DB7A 3W87A 4JIPA 2GGEA 1W5MA 3HG2A 4CNSA 4JQ4A 2ZXQA 4S39A 4FXRA 3GU9A 1BQGA 1J4EA 3MO4A 3WUGA 4IL2A 3MQLA 2VGFA 5EBAA 3STPA 4XX6A 1M7PA 3B3DA 5EMYA 3T0BA 3N17A 2OWWA 2Z1WA 1P6BA 2GVEA 1ALDA 4FB7A 1VLIA 2W5FA 4JGDA 4GK8A 4PH6A 4IHCA 4UQEA 3WJXA 1M7OA 4C90A 4NZ1A 3H2NA 2D3NA 4HGXA 4DAFA 1E40A 4J3WA 3U2OA 3T0AA 1GT8A 4UOZA 1XRFA 3I7SA 1PPIA 3VOHA 1IF2A 3KL3A 3EXRA 4K6AA 2ATSA 4CLMA 1DTUA 2HJPA 2QMJA 4KEVA 5KINA 1H3GA 1FWRA 2BASA 4JTEA 4QG8A 4GIYA 3PANA 3Q65A 1FHVA 4ZBCA 3MP4A 5D8ZA 2PDJA 2DUZA 1SW7A 3AALA 5I3IA 1BSIA 2NQ9A 3SFKA 1G67A 4GJIA 1L6WA 3GNDA 1RP9A 1QR7A 2XFRA 1JCYA 4F4RA 4GC3A 3TYZA 4QQ3A 1US2A 5LA2A 2JK2A 1GONA 1KBBA 3CUFA 3EDEA 3WEMA 3KS8A 4OU1A 2P88A 3NO5A 4L1GA 1MUWA 4JFWA 1KXHA 4NQ1A 3S4TA 3W86A 4JTFA 4Q4PA 1FWBC 4UTIA 3TR9A 4KIRA 1GVYA 4JDYA 2J6VA 5MHBA 1DJZA 1IXPA 2DVUA 1WCGA 3MB9A 1XLKA 3W26A 3P84A 1X1NA 5D2TA 3UJRA 3ARPA 2VFIA 2VGGA 5TQLA 1SZEA 5I07A 4DN1A 2A3AA 3RPMA 5BU6A 3ZOAA 2ZTJA 4U31A 1D3HA 3CO4A 3N9RA 4DUOA 1TA3A 6A3HA 3EWCA 4DYEA 3FIGA 1HJSA 2B7OA 3FGCB 3LYEA 3GLCA 3SADA 2PTXA 1XHGA 5CJNA 1BLIA 2PLMA 3PM6A 1L6FA 3A4WA 3MY9A 3FYPA 1E1EA 4UC5A 5A6LA 1IQ8A 3REQB 4YN5A 3VNYA 2DSWA 4ZQNA 3WQCA 1XW8A 4UOQA 1YU1A 3LZ3A 3LI1A 2VX4A 2G3NA 2XINA 4XO6A 4HPNA 3FS2A 1NF7A 3WIJA 4LUSB 3RX2A 3LHYA 1I60A 2J75A 1JI1A 4I9JA 4KEZA 1ICQA 4B5XA 2DH2A 1H62A 4E38A 3AO0A 5A6BD 4FF5A 1RQBA 4LNCA 6ENLA 3BW4A 5REQB 5FF7A 1ZBWA 2WXDM 4FALA 1BKSA 3AAMA 3EPOA 4B15A 1WXYA 3LXCA 3UR7A 1F05A 1KLYA 1A49A 1CB7B 5IBXC 2WPGA 3P61A 5H2ZA 4RR4A 3O63A 2V38A 5CC6A 3DFNA 3R58A 4BQ2A 2PI6A 1BEUA 1OCQA 2YCKX 2CWXA 2XD5A 5AYIA 3HO8A 4RE0A 1Q65A 2E5DA 2DORA 4WLCA 1CGUA 4XWUA 3Q58A 4O19A 1DHPA 3S9ZA 4X60A 2VP8A 4W5ZA 1QW8A 1ZY9A 3NSNA 3TWAA 1EJ7L 1SGJA 1NQ6A 1OY0A 1KCLA 1IGSA 5LHEA 2IOUA 3AHXA 3DYPA 1W3JA 3H55A 4ERIA 3PPCA 5KSWA 4P7LA 4UR7A 4GHRA 4WD0A 3VD4A 1MQQA 1R6WA 3NPVA 3NQ7A 5DANA 1KRCC 1D2KA 3UXLA 1SFLA 3HU7A 4J3UA 1KTBA 1C8QA 4MWAA 3LHTA 3CT2A 2JQXA 3GNXA 2CHOA 5A6MA 1TTIA 3I6TA 4JIRA 4PUNA 4Q4RA 2JCHA 4GO9A 4O4VA 2OKOA 4P8WA 2Q3OA 1MFUA 4B92A 3W71A 1IEXA 1UR9A 2WM0A 3WG6A 5I03A 4G1NA 1EJWC 5FEPA 2A3EA 4O17A 4QX4A 1EBHA 3GTIA 4AH7A 3N1AA 1PE1A 4QE5A 1TUXA 4D6FA 4QDMA 1HQTA 1TPH1 4AF0A 2J9ZA 4M1BA 2G96A 2H90A 2VJXA 3L4XA 2HCVA 4QG9A 3ARUA 4QSHA 1TSIA 2I5IA 3EKZA 2BG1A 1FHDA 4H6KA 3RG6A 1S5MA 4A8LA 2AGKA 4RK8A 3TCSA 1BHGA 4QLLA 1UZ4A 4HK5A 1Y5VA 2GJXA 2OEMA 1QK0A 1FKWA 4EAMA 1IR1A 4M3PA 4DO6A 3T2OA 3P74A 3LB0A 1PXGA 1QNQA 1J6PA 3CM4A 4IGMA 2NLIA 4W8AA 2BHYA 4DNHA 5L9FA 1AZ2A 3EWZA 2FVLA 1OVDA 1R3VA 3CZKA 3K30A 2XH0A 3N2BA 3UD6A 3IWPA 4JTKA 3CUJA 3DYMA 1B3WA 1DXEA 3R0UA 1BVNP 3EPMA 3GZ3A 5DT7A 3N11A 5CC7A 1D9EA 3QVQA 1TPUA 3DIPA 4UNKA 2Y5SA 3FOKA 2B4GA 3PTQA 3Q2DA 3QHOA 4OGZA 4FAMA 3G22A 4TX6A 3V0UA 2A3HA 2Y2KA 2O9TA 1DIDA 3KM8A 5EL1A 4HPXA 4AXNA 1KR0A 4UTWA 2X1IA 4D6IA 4ZXOA 4PMJA 6XIMA 4JNZA 3KDOA 1T6MA 3TXVA 3NL3A 3G1AA 3PZQA 5F1VA 5DCBA 3ITTA 2VC5A 5I09A 1W1YA 4LT9A 2E4TA 1TKKA 1YBQA 1DIKA 7TAAA 3NL2A 3E5BA 3MSYA 3WMLA 5EMLA 1C8YA 5BPVA 4N4QA 5FF0A 4K1GA 4D72A 1VEOA 1JPHA 3C5QA 5LZLA 2OEKA 5C70A 3HQNA 2HS6A 1MWOA 3ORWA 4I8DA 2R1NA 4PBGA 3H4GA 3THQA 4JHZA 4NI8A 1V0LA 3PBYA 1OK6A 3TAOA 1XLDA 3OIXA 4FXJA 1J2WA 3PFMA 4YLWA 1W8GA 3CV7A 1FWIC 4LCSA 1W9VA 1XI3A 3KBVA 2OQYA 4N7QA 3I3EA 1E1CA 3HGOA 5I3KA 1R3WA 2PE4A 1KC7A 2CBVA 2X1RA 2WM1A 4OKDA 4MKVA 4Z1BA 4RZ6A 1SYTA 3WNLA 4UTWC 4UMCA 4BFAA 1FUYA 3VIOA 1GWJA 3MMDA 1XPYA 4Z08A 2J62A 5BZAA 1FWFC 5HXMA 2Z6IA 3XINA 3FYOA 3TNBA 3SCOA 3O15A 4NJIA 1WDDA 3VOJA 3GH7A 5DBTA 2GPTA 3GTHA 3CV2A 2IPGA 1NELA 3UBPC 4CD7A 3L0NA 3MSRA 4XSLA 1WB0A 4KCUA 5CAKA 3W84A 2I57A 1XBXA 4X9YA 2H3BA 2AL2B 4H00A 4ZO9A 4AWUA 2ZZ6A 3ELFA 2XIBA 5JBDA 4I7UA 4S3AA 2JIEA 3R25A 3ZLHA 4LB4A 2Y6ZA 1E6PA 1WZAA 3PR2A 3U7BA 3SN4A 3FHAA 3LGGA 3WY1A 3LG3A 2XYLA 2FIQA 1O1HA 1A3WA 2XFFA 1WKYA 3AYVA 4PFMA 2NXGA 2FPYA 3O1NA 2BHZA 4E3VA 1XXXA 3B8UA 4IJBA 3OTRA 2RFGA 1RJRA 1VLWA 4LC8A 3ZSSA 2B7PA 2PDQA 1H7OA 4MNLA 1DIEA 1AW2A 5LIUX 1TJ2A 1V7AA 2PAJA 4W88A 1TE6A 4I5XA 2Y2HA 2W62A 1TZ7A 3OG2A 2Y2IA 4GI8A 3KZSA 4DWSC 4NT0A 1JL8A 3UT0A 3VC5A 4C6FA 4CN6A 3PZOA 3WJZA 4ECLA 1HKKA 2PDUA 4NNAA 3VKKA 3MVTA 3CHCA 1TWWA 1QNPA 1V0MA 2Y63A 3IRSA 2FZMA 1GQNA 3DEQA 4CNNA 3QLDA 4L4OA 4MADA 1JDDA 1PCKA 2CZDA 1NFGA 3WLRA 3MJYA 4H9VA 3TTQA 5FSEC 1EB3A 1B54A 4CNOA 3GVGA 2O92A 5M17A 1VKFA 1S2AA 2V3EA 3E3HA 3UCQA 2I14A 2VDHA 4AY7A 4IFKA 3UR2A 3VCCA 3NOEA 5IXEA 4IUGA 3PFRA 3IAPA 4LFYA 2O4MA 2JFEX 3P5YA 4OBSA 1ZBKA 1BFNA 4GMEA 4J7RA 4XK2A 4AB4A 1E5JA 2XVKA 4XKYA 2WW5A 3AUOA 2OXNA 3PWAA 4Q3MA 4NAEA 5A8PA 1E88A 1V6UA 3KVLA 4JIQA 2GJXB 4ZOCA 3OLDA 1YDNA 1PBGA 2BY1A 1X8CA 2EPLX 2XPKA 1DOSA 1LL6A 4MB4A 2ZE0A 3ECQA 4IGNA 3NQGA 2XSBA 2C16A 3IAQA 3ALFA 4MKNA 4AEFA 3GDMA 3AOFA 3V35A 2PP0A 2DH3A 4IWWA 1WE5A 4YWSA 2X42A 4GQGA 1TQXA 3NQVA 2VWTA 4W84A 4H9YA 1FH7A 4INFA 3E2VA 2ZDRA 4O0ZA 3CHEA 1PX8A 1LRNA 4XZMX 1GG0A 1DJIA 3DG7A 3CAWA 3FCPA 1YHTA 3TKFA 5D38A 5K9CA 1MEWA 4RV3A 2DSUA 4I5RA 4JX5A 2DZTA 4GHAA 4GXMA 1YPIA 3N3MA 3APGA 3MCOA 3SCQA 2XIJA 3S5SA 1XDJA 3NTYA 3CMFA 3GX9A 1WP6A 1TMQA 4EIVA 3S6OA 4UQCA 1P6CA 3AZSA 3GH5A 1KKOA 1ZB5A 4JTAA 3UWWA 5I7GA 3BLFA 1X97A 5C9ZA 4NJHA 3E96A 1LT7A 2FZNA 1OIFA 4QG6A 3V16A 4C6QA 3RPTA 1JYNA 2QKFA 3W1TA 2FHFA 4C5YA 1ZGDA 3PAOA 1EC8A 3NGJA 1VYPX 3OP2A 4R7WA 2BGQA 1QPKA 3C2VA 4IISA 1TX0A 1K7XA 5LNSA 4JL2A 4XD3A 2ICSA 3FDKA 4XBJA 4QS6A 3M0IA 3PBUA 3CEUA 1RH9A 1PJ9A 4NZJA 1Z3NA 2B0MA 1MQRA 3M7SA 3SCSA 2LLEA 3L2AA 4IJCA 4DIAA 4TUFA 3ITLA 2H9AA 1LM1A 4S3JA 1FCQA 2KAUC 4J2MA 3VABA 4REQA 2FQIA 1UA3A 4GYPA 3XIMA 3VA8A 3NM1A 4FLQA 5BWAA 2EG7A 1A47A 2OLSA 4CD8A 1PTGA 5BNKA 2RJGA 1OT1A 3CZEA 5REQA 1TIWA 3WK2A 3K13A 2PWFA 4JTLA 2Y89A 4CVUA 3ZJ7A 5FEWA 4R7OA 1UP3A 2UY4A 2VX5A 2QJNA 1XLEA 4AZBA 1IZKA 2BWGA 2R8WA 5FESA 2QT3A 4ADTA 4U5IA 4D6CA 1MQPA 4PUDA 5EFFA 4LUSA 4BQ5A 1X6UA 1V0NA 4LAZA 4D9PA 4TXEA 4ZSTA 5H1WA 4B4FA 1AH4A 5I24A 1UASA 5HQLA 3U8GA 2Q8LA 3AZTA 4DBUA 3XISA 4QBXA 3V1PA 2WSRA 1M1BA 1HN1A 4CCEA 4PMYA 4UQ9A 3GXTA 2CLLA 2OQHA 3S2NA 2X2YA 3H21A 1YMYA 3UG5A 3CIXA 4L6DA 2Z2BA 4WUIA 1JDAA 3CJPA 2HXUA 3ZR4A 4K8GA 3VD3A 4AZHA 2ISFA 1TA3B 5I23A 1L9WA 5FAJA 3VFLA 2G97A 3NO1A 2XH2A 2PF8A 1K7EA 1V6VA 4OOUA 5I6SA 5LHFA 3MC5A 4NU7A 4ZB0A 1UKPA 1MYRA 3QFWA 2PSNA 4P8UA 3FK4A 3E2RA 1R87A 3AHYA 2PDCA 4P8XA 2G41A 3W7QA 4EXAA 4LTSA 4U2YA 1LTDA 3QOKA 1SUXA 4C6OA 3A23A 4FA3A 2BLEA 2C14A 2XGZA 2XSAA 2QJMA 1Q6FA 4YVXA 3N6QA 4A3RA 3N13A 2XVNA 3OYZA 4PZVA 3S5NA 1UH3A 3CC1A 3URQA 1XH2A 3GVRA 4ZO7A 1RALA 3EOEA 1ITUA 3HONA 1P1MA 3TQVA 4E2DA 5DELA 2HK0A 3M0MA 2PWVA 4H7VA 3NZGA 2QUNA 1EA0A 5ECUA 4JTGA 4FF7A 1PO9A 4PMDA 4HVXA 3GDRA 4O1EA 1X7FA 3DOPA 4WJEA 1FFQA 3W7HA 4D6EA 2BVYA 1MVYA 4C6PA 1TX2A 1J01A 3UNTA 3TJLA 4DAIA 3RFAA 4Q33A 3GKFA 4GIAA 4KEUA 4XQ6A 5CGTA 1UWAA 4DZIA 1UKSA 4GH1A 2ON3A 5LNRA 1GKRA 2GJRA 4L6HA 5E93A 3M7WA 5FL1A 1DL3A 1F74A 1UQZA 3ES8A 4OBTA 1W17A 4AWEA 4FNQA 2RDWA 2BOEX 3G1HA 1JF6A 2A7PA 4PEKA 3SW6A 1YYAA 2XHYA 2A79A 2INEA 6TIMA 1S2TA 1JNDA 3EA1A 1I1WA 1K9FA 1TWSA 3C8FA 1PYFA 3JU2A 1H11A 2DFAA 3TCEA 1US3A 3A9BA 3TYAA 5M2FX 3GRIA 5GNZA 2ZBTA 4QLKA 3NYZA 3LHZA 3M41A 1KWKA 1O1ZA 1M41A 1W5NA 1SZGA 4AXKA 3M7PA 5G2IA 2CKSA 1KFBA 2DT0A 3PPGA 2QULA 4F9DA 2QF8A 2IQDA 3GUGA 1T8XA 4XZWA 2QV5A 1DWIM 3P8IA 1UD4A 3QGKC 1K8XA 1IE7C 2BY2A 3VD9A 1O95A 5HNUA 4ZTYA 2ZC1A 2ZUWA 1JAEA 5EU9A 2YOCA 4GOAA 2NWSA 2VEIA 1F6PA 3EEGA 5XIMA 3KXQA 3W1MA 2Z28A 3S2LA 3FLUA 1UKOA 3PSVA 4IMGA 3TQPA 3FAXA 3WMBA 4IPLA 4HNUA 2WHLA 1XLFA 6XIAA 4R53A 1NOFA 1IXQA 5C8BB 4CU7A 1TPEA 4GZ7A 5G1TA 1FP9A 4H8UA 4UOJA 1XBVA 2HVOA 3AQUA 3WJSA 1PIGA 3WH6A 1L6YA 5CAHA 1YNPA 2YB4A 3F4CA 3N2XA 1UOZA 3FAWA 2E3ZA 4HSOA 2GSHA 1AH3A 4D8AA 2YXOA 2PCQA 3UQNA 1OQFA 4UTHA 3R43A 3K46A 5D02A 3MYOA 2CLOA 2PTDA 3E6EA 3M0JA 1GCYA 2O56A 1DIOA 4K1WA 3WJWA 1YU0A 3ZVIA 3L2MA 1V3KA 2CEQA 3NWRA 4HP5A 4YCOA 3NZPA 3RM8A 3TQKA 4W7WA 4CEUC 1ZL1A 4Z17A 3KOXA 4HZ8A 3RAOA 3BO9A 3SUTA 3EDFA 1DWJM 1TJPA 2WO5A 3DHDA 1UWUA 3GC5A 4CNUA 4NZ5A 5IM51 3RU8X 3P67A 3DN5A 4GI4A 2ABAA 2FKPA 1FHUA 3N15A 6REQA 1I75A 4S23A 1GVQA 1FKXA 3W27A 2VTFA 5E09A 1E43A 2F7FA 1E9ZB 4S3BA 3KRBA 1LF1A 3HFYA 4REQB 3GIPA 2QIIA 5CLTA 1B30A 3RX4A 3LPFA 3SB0A 1KFLA 2OPJA 4AW7A 1VFHA 1PHQA 5E9XA 1VP5A 1JCMP 5AC6A 1QWGA 5E9AA 2WLYA 2G4FA 3DHPA 1EF3A 1A3XA 4CQ8A 2DIEA 1XLJA 2D73A 1VRDA 1KQYA 4I90A 5G4HC 2FPTA 3VKBA 1X96A 1P0NA 3T55A 2BODX 3APYA 3DC0A 2QUTA 4TIMA 2REQA 1OFDA 4MFEA 4OJPA 4IP4A 3O6AA 3LNPA 3WFLA 1CGWA 3CHDA 3H4WA 2OVLA 3TQ0A 1PDCA 2G4JA 3PZTA 3WF3A 4C65A 1P0DA 2CLEA 1M01A 4WDWA 4MY8A 2F6KA 2YBUA 3FA5A 4HA1A 3AHZA 4GJ1A 3BLPX 1TQJA 2EJ1A 4TX8A 3AIEA 1LUCA 2Y61A 4YHGA 3N4EA 1PB0A 3BV7A 2J7EA 1J10A 3QLLA 4AIBA 3GG7A 3CZ8A 1Y7VA 1L8NA 5HPOA 4O8RA 4LY8A 2A3CA 4L61A 4DO4A 1H41A 1I0BA 1MZHA 2XZ9A 2ZWYA 3P3BA 2JEQA 3MUY1 3OLGA 3T4CA 1DVJA 1A4LA 3UZ5A 3VC6A 4C91A 4I3GA 1B4EA 3MDUA 3DFYA 3TN4A 2FTWA 3MW7A 3RO8A 5LIWX 3WQFA 4H4IA 5H8PA 1CI1A 2NUWA 1RSCA 2WQDA 4MY1A 3W76A 4AYSA 3D47A 1E4NA 3K1DA 3C2RA 2WPBA 5AZ1A 3VIPA 1Q8JA 1TCMA 1DBTA 2ZUUA 5JIPA 2F8QA 5EMJA 4IMAA 1TV3A 1AFSA 4GUFA 4S1FA 3SSZA 4JS3A 3WQ4A 1H5YA 4RDWA 2Z7KA 2DZVA 5AHEA 3QN3A 2E6YA 4NAEB 2PB1A 2ADAA 4O16A 4KERA 4H8HA 4N42A 1OABA 1AW1A 1OCNA 2VYOA 1F4AA 5D09A 4Z1CA 3VK5A 2ASHA 1JYXA 1XIIA 4ZFMA 1E5NA 3VM5A 4PBFA 3WX7A 5AKQA 3IIVA 2WMFA 3S5ZA 3TFXA 1E73M 4WY0F 4ZB5A 3CLMA 1RBOB 3OJGA 1KFEA 2QXWA 2O4QA 5I3HA 3SQLA 1DORA 2C19A 5DN1A 1B90A 2V5CA 4PUUA 1ODUA 3Q67A 1ICSA 2CWNA 4AWTA 3W2KA 4DF2A 1FY6A 3ABZA 1HP5A 4HPGA 4ADUA 1LBLA 1YQ2A 3VE7A 4YS1A 1TVNA 4WDXA 2DQWA 2VZUA 1ZAIA 1M03A 4HSHA 1ZJIA 4ZZ9A 2IKHA 4FOJA 4KGJA 2OMAA 2YL5A 2J9YA 3R8RA 5CZKA 2J77A 4FO4A 4D6GA 2DUXA 1VF8A 4WK9A 2XN2A 3LGEA 3CIVA 1WNOA 3WNOA 1QOPA 2BMBA 1UWRA 4JN7A 4I7WA 4MYAA 4B5SA 1RXOB 2YJQA 1KV5A 2RHGA 4LAUA 1V08A 1GK8A 1OG6A 2YR1A 5EMUA 3ZXWA 2YGYA 3BW2A 1RZMA 2OOGA 4IXHA 1A5BA 3AU6A 2ZXAA 3OB8A 3RPDA 3W0KA 3TEVA 4ZE5A 3CUXA 4WCJA 1K02A 1OC6A 4GKTA 1GOMA 1E51A 3C2OA 1C90A 1PWMA 4JTSA 5A8OA 3VNKA 4US5D 3FSTA 5C2GA 5F7UA 4IFOA 5F4WA 2A4AA 2E9MA 1P0EA 2PDXA 3SZ8A 4DXKA 1W31A 3AROA 2FB3A 3A64A 1GGOA 2PS2A 1IIGA 4J3ZA 1EO5A 4OJYA 4Q8VA 3EEZA 1G7VA 5EY5A 1BGAA 4C6NA 1FDYA 3DBPA 5U4NA 1HF6A 1M9HA 4GCAA 5A2BA 3VOGA 5E6ZA 5LA1A 1A4MA 3HSHA 3FJLA 4LC6A 1C29A 4G8TA 1K8CA 1UBSA 1YRRA 1A5CA 3EOLA 3TUUA 5C2CA 3URBA 1I2OA 3BG3A 4YU1A 1JVNA 2C1GA 4GCXA 3L28A 3A5FA 2QYGA 4TVDA 2O55A 3UXDA 3O0FA 4NRSA 5B7YA 5D9OA 2QUVA 2WQPA 2PODA 1ZSXA 1XISA 3A4AA 1KB3A 1BYAA 3WKZA 1CTNA 3DG6A 4XAPA 1WO2A 4AUBA 3QC3A 4DJEC 5I0DA 2DU2A 2GQ8A 4LJ3A 3RN6A 3SIZA 3IPWA 3BCFA 3R10A 3VINA 3R0DA 3SRDA 1H4PA 2F38A 2V67A 1IGWA 5MKGB 3IV8A 2HVMA 4V1XA 1F4HA 2UWFA 3BLKA 1OBAA 3UWZA 1IWPA 4UMBA 2FN2A 2OZ0A 3MZ2A 4OHQA 1IWBA 2Z00A 4WJXA 1XUZA 3AHTA 3N34A 2W9MA 4E5TA 3AXXA 3NDYA 4Z1AA 4F0MA 3PZVA 3AS1A 4ILSA 1UWTA 1US0A 4JICA 4PE8A 1JF5A 3KL5A 1E3XA 4X3ZA 3SCWA 1MXGA 1RK5A 4PUEA 1NWSA 4J9JA 3UA4A 2VEMA 4JN8A 1AL8A 2W79A 1HKJA 5T91A 1KM3A 4GC4A