4NZ1A

Structure of vibrio cholerae chitin de-n-acetylase in complex with di(n-acetyl-d-glucosamine) (cbs) in p 21
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
403
Chain Sequence
b'PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 142
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz1A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz1A01
2E67A 2DFAA 4NZ1A 2VYOA 1XW8A 4LY4A 2Y8UA 4WCJA 4OUIA 2C1IA 2C71A 3S6OA 3VUSA 4NZ5A 4L1GA 4F9JA 1Z7AA 3CL7A 2W3ZA 1W1A1 4M1BA 2NLYA 3CL6A 5JMUA 1NY1A 2XU2A 2QV5A 3CL8A 4NYYA 1W1B1 4NZ4A 1W17A 4NY2A 2C1GA 3QBUA 4V33A 4NYUA 2CC0A 4U10A 5BU6A 2C79A 2I5IA 3WX7A 3HFTA 4HD5A 4F9DA 2IW0A 3RXZA 4NZ3A 2J13A 1V6TA
chains in the Genus database with same CATH superfamily
1KW1A 1KFJA 2GVJA 2BHYA 2OKTA 1Q4WA 1RK6A 1RVKA 4YTTA 3GZAA 4DWSD 5DFAA 3Q45A 3AXHA 4I90A 5C9WA 1BGAA 4Z2GA 4QISA 2FZDA 4FNPA 1FQ0A 4ATLA 2HISA 3OPSA 2YCEA 4QIUA 3D46A 4IUOA 1QI0A 5EL1A 1JCJA 3PULA 5HWMA 4UTUA 1EP1A 1SZRA 1A5LC 1TYGA 3TFCA 1UD8A 4PUWA 2NW0A 2BS9A 1TWIA 1TJRA 4Q8WA 3RLHA 3WFLA 1F73A 3VDCA 2W6RA 4G7EA 2Y6ZA 3KAOA 1CENA 3BCJA 4QR6A 1XLLA 1SU5A 4EWND 4OUIA 4ZQCA 5DN1A 5F4XA 4TXEA 3LPFA 3JR2A 1O68A 1XKYA 1XIGA 4UTTA 3C8NA 1JRBA 3OEXA 4EPEC 3UW6A 1KBIA 2PDYA 2VWTA 4TV6A 3QKZA 6ENLA 4MB3A 2J79A 4NX0A 3KDOA 4GJJA 1WXYA 4LVGA 2WB5A 4MSSA 1XLGA 1YU3A 3KCJA 3MUCA 4HK6A 3BV4A 3ZIZA 3BLFA 4NAFA 5AVHA 2XHYA 2ZC8A 3NQEA 1GZJA 1UZHA 1E1CA 3FNDA 3U4AA 4EWJA 2YCLA 3GYEA 1GOOA 4A3QA 3ARQA 3FJ6A 1EDQA 3GDBA 4W8AA 1UOKA 4Y8FA 1XSIA 1EF3A 2V82A 1JPIA 4FALA 1ZY9A 1TQXA 5C9RA 2NSOA 2CPUA 1EDTA 1W9BM 3F5LA 4IBBA 2IOUA 4WQ6A 3SN0A 4AZ5A 4NL1A 4I7UA 4HZ7A 2ZRYA 4FLRA 3E0VA 4FNQA 9CGTA 3T4WA 1YE4A 2QDDA 2TPSA 1HVXA 5AYXA 3H6OA 3LG3A 4WUIA 1YQ2A 4IFOA 3QM3A 1C29A 1IYXA 3BGAA 3F4WA 4OV4A 4BA0A 3W7CA 3FGCB 2E1DA 4CEXC 1BXNA 2DPEA 3M47A 1KBBA 3LMZA 5I24A 1X6UA 4HNTA 2PDCA 4CD8A 5HINA 3QTPA 4MJ4A 4K37A 3EX2A 1R30A 4S3KA 3M0JA 3LERA 1B0IA 2VWSA 3W1QA 3U2ZA 3WD1A 3EOLA 4WR3A 3C0SA 4AC1X 1YU0A 4C60A 3GHRA 2F2HA 2FQIA 1XINA 4CCEA 3GFYA 5HXMA 4B9YA 1PIGA 4NUWA 1PE1A 1A3HA 4WOZA 1TV5A 4Q22A 5CZKA 1EP2A 4HTYA 3L4ZA 3MDUA 4AIBA 3K1DA 4P7OA 1MUMA 1MEIA 2G8ZA 2R9RA 1Q3NA 1S39A 3CK5A 2FB3A 3GW3A 1EBGA 4GZIA 4DELA 2QDEA 3TU9A 1JJKA 2PDXA 2DJXA 2CWXA 1KM3A 2X0SA 4L4MA 5AKQA 3NQBA 2CWNA 1G5AA 4B3ZA 2NQZA 4AD1A 4ZVJA 1ZJIA 3AS2A 2J7GA 3RHGA 1AH4A 2J24A 3MSDA 1CGXA 3H26A 3WDPP 4FA3A 1A47A 5BRBA 4B90A 2ZDRA 1GTEA 4KT2A 4OJPA 3G3MA 1YRRA 1EIBA 4JYFA 1CLVA 1OC6A 2D73A 1OINA 2GGGA 4RR4A 2V0TA 1W6TA 4Y9OA 1YLVA 1SJBA 4IBJA 4IP4A 4O50A 5E09A 4GFSA 3BL3A 4CNNA 2V5BA 3QC0A 3FX4A 1LL4A 5DO8A 1K4HA 1NY1A 3AYRA 3EMQA 4GMEA 1N8WA 3AROA 2R91A 4R34A 1ECEA 5BPVA 4W5ZA 2ABBA 3TN3A 1VCFA 1DJZA 2J77A 1E6RA 3VIOA 5CAKA 2R1MA 4FF7A 1R38A 1PAMA 4QAWA 1H7RA 2QV4A 3WF0A 3BJTA 2ALDA 3VFLA 2QIWA 2FFCA 3VMOA 1UYQA 3LNPA 4NG3A 3H2NA 2YBUA 1VBHA 3B8TA 1RY0A 1RJRA 2ZWYA 3C4UA 1HKKA 1ZALA 3EMZA 2VX7A 4PRTA 4LV9A 1JF5A 1QDSA 3QHMA 3HF3A 4HNNA 3GR4A 3K2GA 2CBIA 3MPGA 3S1VA 3TCEA 4ERIA 4GZJA 3HG3A 3UWQA 2CLOA 2HE5A 3NYZA 3M0ZA 3U5UA 3VNMA 5FF0A 1A80A 4U3CA 4JQ1A 1XH2A 4M29A 4HU8A 1IXQA 2QPUA 5HMDA 1KFBA 1OF8A 4N0RA 2F84A 5CGMA 2AL1A 1GYLA 3APGA 5G5IA 2VRQA 1V3JA 5D2WA 1G69A 2FZNA 3ITYA 4HJWA 2IQDA 3KCLA 1WE5A 4C1LA 2D3LA 4EAYA 4Q8QA 3BSMA 3NSXA 4MF4A 4ASTA 5G2HA 2WM0A 3UY8A 2J7HA 1PKMA 2R94A 1US2A 3S6DA 2WJZA 1Q6QA 3KRSA 4IJCA 1MUWA 1EOKA 5KETA 5M03A 3PPCA 5DF0A 4DM2A 5FIPA 2H6RA 1VP5A 2G37A 3ATYA 3KL3A 5EBAA 1R0MA 3R94A 3KDNA 4LVFA 4MPKA 3VO0A 1Z41A 4GYFA 2DW6A 4RXGA 1N55A 4LCSA 4IJFA 3ABZA 4FO4A 1A5UA 4XZWA 3QEZA 1LOQA 1XM3A 3CNYA 1W5PA 2R8WA 4WXYA 4FIRA 4JEQA 1LT8A 1OVDA 2GSHA 2A7PA 4ZOEA 1XQKA 1UB3A 3PG9A 4S3EA 1EOMA 1AL7A 1R6WA 2PF8A 3W6MA 1ICSA 3PHAA 1PWLA 1X38A 5I78A 2NUYA 1LQAA 3PZ9A 3BSGA 4IBIA 3STFA 2YGYA 3NURA 5LNRA 4N6FA 2VYOA 1DIEA 1YADA 1U2YA 4C6OA 4TX9A 3BXWA 3EBVA 1QNOA 2ZA1A 5DCEA 2FHFA 4C1NB 4JNMA 2XH0A 4UTWA 2QUTA 2DZAA 3PB0A 4HCHA 2J7DA 4CNSA 4IIBA 2VEIA 1VQTA 2VENA 2YDRA 1KTBA 3FLUA 4ZO8A 2JKPA 3S5NA 5LNSA 3B8DA 3A9IA 1QNVA 2BY1A 2ZQ0A 3L0GA 1IXOA 2NV9A 1CIUA 3CWNA 2VL4A 5HA7A 1CGUA 3TOPA 1QT1A 3ERPA 3Q58A 4ICCX 1G9HA 2P53A 1IQ8A 2WWCA 1V7YA 4J40A 3FJ4A 1PCWA 3CUIA 3FGCA 3W7PA 1KFCA 1ZBVA 3LCWA 1DJXA 4C1KA 4GUJA 4DEFA 3U2OA 3VC5A 3O0FA 1KLZA 4BFAA 3K13A 2ZKMX 4JIHA 3W25A 2PEVA 5HATA 2I57A 3HPZA 4CKQA 3L7RA 1OB0A 2ISFA 1NM9A 4JHOA 3VNIA 4H00A 1PCKA 3KS4A 1YYAA 3W74A 1Z7AA 2EAWA 3F7JA 3L0NA 3KS8A 4LNYA 2FJKA 4LVAA 1NTHA 1VEMA 4IH3A 1QXLA 1TV3A 5BOEA 4DXKA 2QCGA 3IJQA 2ZX9A 2V38A 3V0UA 1X98A 1ISZA 3GTIA 1W9UA 1WZKA 1POKA 1XSKA 2VZVA 4US6A 4RJEA 4R7WA 1NOFA 1W1TA 2C14A 3WG6A 1E9YB 3DI0A 3ITGA 3SCTA 2IQ0A 2FDSA 3L12A 5LSMA 1REQB 4RE4A 3VGHA 5TBOA 3WSUA 1RCXB 1SJAA 3SRKA 3MP3A 5GJPA 1WXJA 1NF7A 5KMYA 3MV11 4B4FA 2Z26A 4DJFD 3P0WA 4FX7A 4B16A 3E6EA 4PC8A 1X1NA 4UQBA 3ARRA 3M16A 2Y2IA 3BQ6A 4IQLA 3WEMA 4NU7A 1JAKA 2PGFA 4ZENA 2W92A 4QTGA 2YA1A 3MP5A 3SUVA 2X09A 2ZFAA 1ZCCA 3LHVA 4MJZA 3OLEA 5FF3A 2ABAA 1MQQA 3T05A 5CG7A 3KRBA 3WD0A 4GQQA 3ARPA 1SO5A 3N13A 3IV3A 2W61A 4AD4A 4RE3A 4DYKA 2EJAA 1V51A 3WNLA 4FS9A 3CZJA 4YTUA 3AWNA 2ZXBA 1KM2A 3A21A 4GG9A 4YTSA 1UCWA 1XDMA 4ILSA 1EUAA 1D8WA 1FH7A 1FWIC 3N11A 3E02A 1E5NA 3VI2A 3GIYA 3VOHA 1S2WA 2DDXA 3TP4A 1J0HA 2DSWA 1AUSL 2DORA 1OGSA 2XIIA 1Q13A 3HPXA 1M3UA 4LAUA 1MUCA 4OOUA 1F6PA 5HNNA 1Y0EA 3DN5A 5JBEA 5HUPA 3LTYA 5CPSA 5LHFA 3MTWA 1KWGA 1Q6FA 3R0KA 1XI3A 3ZMRA 3UJRA 2WJDA 3GIPA 3VX0A 2BVYA 2WCGA 1A3WA 3ZR4A 3WL0A 2NVAA 2CZDA 3UNDA 4L1GA 4YMZA 5BW6A 2OELA 2YLAA 3VGDA 4AWUA 3CL6A 4H1ZA 4JX5A 5A8OA 1W1VA 2ZZ5A 4NJHA 5F2MA 3IJ9A 2E9LA 1M6JA 5I0DA 3DG3A 4DY1A 4W5UA 3TKFA 1XJBA 4LAZA 4LOCA 5CJNA 1LLZA 1F3EA 4QDPA 4MJ2A 2DU2A 2MNRA 1OSEA 2Y88A 4HA0A 1XBYA 2ACRA 2JGYA 2JK2A 2QVHA 1NOWA 4X2RA 4F79A 1UWTA 3PBGA 4KFNA 1UD3A 4JTTA 3MWCA 3H4WA 4Q4SA 1UP3A 1B3OA 2AGKA 2VURA 3ZS4A 1VIWA 4LCQA 3CMFA 3THAA 3U5YA 3MUZ1 3N1AA 3DHDA 3IEBA 2YW4A 7ENLA 2QUUA 1YU1A 3WLKX 1CZ1A 3LNMA 3NQ7A 4J3VA 4UFIA 1XV8A 1CGWA 2BGNE 1GZ1A 2HROA 4JIIX 1QHPA 4QDMA 2V81A 3LM3A 2PWFA 3Q67A 3WK2A 4I5UA 1QK2A 2J13A 4AFYA 3CQJA 4TR9A 1YXYA 2DIKA 2WBKA 4O52A 5CH9A 3SI9A 4B5XA 4HK5A 3MKKA 2AQVA 4C1NA 1WAUA 3KBWA 4Q8TA 3N04A 5FF2A 1M01A 4GUGA 1VENA 1XIHA 2Z2UA 2CLFA 5BRQA 4PRWA 4P61A 1H51A 4HU3A 2GOKA 3V18A 3PTKA 5CZ0A 3RCNA 4RE2A 3CPUA 2WLZA 4E8DA 3L2MA 1UD5A 4S2BA 3M7PA 1AW2A 3KBJA 3W07A 3UWEA 2XD5A 1XRSA 3ZO9A 3M44A 4URIA 3STCA 3ZFHA 3TMLA 2VELA 3G24A 3QSRA 3URQA 2W3ZA 3OOQA 3R7MA 3QKEA 4RKAA 3MCOA 2HNEA 3GS6A 3CIWA 1MXGA 4TUFA 3GTXA 3NPXA 2YOCA 4ZOAA 1DJNA 4W87A 3ZVIA 2RDXA 3GXNA 2VC7A 4N9CA 1R3YA 3WJYA 4NNAA 3NO5A 1EZ2A 5DT7A 4E2OA 1E0UA 1IR1A 1IXNA 4GYPC 4BI7A 1E6XM 4J4KA 1I2QA 3DFQA 1H5VA 5HMFA 3M6DA 1XDLA 2VUYA 2XJ7A 2WBGA 4MWAB 1EXBA 3S9ZA 1H4PA 4PUJA 2QIIA 3TSBA 1PDCA 3SEPA 1VB9A 4C6NA 4JTGA 4RLIA 2FTYA 1K9FA 3PF3A 1PTDA 1JYVA 3WQWA 4D6DA 2QCLA 4O19A 2R6OA 5FESA 2Y62A 1DXFA 4AHPA 1RZMA 1PVNA 1T5AA 2PTDA 3OQEA 4WRHA 2ZA3A 3V0TA 4GYJA 2UWXA 3GG8A 3LOTA 3FJLA 1H7PA 3BLKA 2NT0A 3GC2A 1V6YA 3B8SA 2RHGA 2Y7DA 2Y7EA 4XD4A 5DBUA 1REQA 1XLAA 4R9XA 3WLMA 4BQ2A 1TELA 2ZXQA 4ADSA 2AL2B 3B0YA 4DUWA 1AJ2A 4XKYB 1QOPA 1GYNA 1KKOA 2DFAA 1SGJA 3TW9A 2PC8A 1G4TA 3QOKA 3L5LA 3E0WA 1AMKA 2FMOA 3EZ4A 1E4IA 4CD5A 5JIWA 4S3FA 1A0EA 5E70A 2A3EA 2ZX6A 3IANA 3ABOA 2J9ZA 4S3BA 2OTDA 1O94A 2UV8G 1TUXA 4UFJA 5DT5A 4IM4A 4NRRA 3RM4A 1F8MA 1UW9A 4GI6A 1R3RA 2PFHA 1L9WA 2VZOA 3C2VA 1NFBA 3SJ3A 3P7YA 5KITA 5G1TA 2GDVA 4E3TA 2I56A 4GXMA 3O8AA 3KUMA 5CZSA 4GGHA 5D09A 2OZ8A 1YTDA 5K9XA 3WL1A 3MO4A 1D7KA 3AU6A 4P8UA 3GDTA 2WW5A 1VFUA 1OYAA 4L65A 2XVGA 3LEPA 2Y2KA 1V3HA 5TQLA 4V15A 3ORWA 1E72M 3FXGA 4Q8MA 4C6DA 2CLPA 1PL9A 1EJ7L 2E67A 4GH3A 1SZNA 1B57A 1QNSA 1EH9A 1V08A 3AALA 3CB3A 5LIUX 4GUHA 4XD5A 1EFZA 4X63A 4I7WA 3FSTA 2ACSA 1OZMA 3S1GA 1GQJA 3J7HA 1QHOA 3WBYA 5IHRA 4K1GA 4X9YA 3AI0A 2Q8ZA 3GHUA 2W62A 2G50A 4PCSA 1R3QA 2ICSA 4CQAA 1Y5WA 3M5ZA 5E0CA 3TYUA 5A6KA 3UZWA 2GJXB 1BYAA 4E38A 2DY3A 2WJEA 4H6KA 4RV3A 1K7XA 2OMAA 3MZ2A 4N9DA 4DLMA 1U33A 4HMDA 5HNUA 3BV7A 1YDYA 5KZ6A 1TJ2A 4RZBA 1FCVA 4HD5A 4BI6A 4IPJA 3W1XA 1K9TA 3GAKA 1T8QA 4P5UA 3W3OA 5KZEA 1GORA 1UR2A 5EY5A 4C91A 3V35A 1NH6A 4ZO7A 1BG4A 2FZ9A 3MI2A 2W63A 1DV7A 5C55A 4NVTA 5LHEA 4BY3A 3PZGA 4JS3A 1S5TA 4K6AA 3IPWA 2ZX5A 4CN4A 1PTAA 2PE4A 4LS0A 1J0IA 1UC5A 3LX9A 7A3HA 2QCHA 3V1PA 2XFFA 3KW3A 4WOQA 3BJSA 2HQAA 2ZTKA 4PMXA 4AZCB 4HN4A 5D05A 2PCEA 1SW7A 3IWPA 3MHUA 2CHNA 3QRHA 2XYLA 2E40A 1EJRC 2BGQA 1OQFA 1FXQA 1YTKA 4LU0A 3FKKA 4I3GA 3S6TA 2VD8A 3K4DA 1JI1A 2FFFB 3MV01 1ISXA 2W0UA 3GBEA 2CXGA 1H41A 2WKGA 2VDHA 3VZXA 3HQ1A 4GI8A 3DKJA 3R8GA 5M5DA 1PKLA 2EHHA 2A79A 3VNKA 1KR1A 1E0XA 2EO7A 2WMGA 3WDQA 3ZLFA 2V3DA 3D3AA 3H2OA 4XAFA 2VEMA 2Q02A 3UVAA 5BZAA 3UR5A 1FP8A 1A5MC 1DIOA 3FCPA 5I7GA 1YXDA 3F4VA 4DAIA 3P74A 5LIYX 3MZNA 4N9BA 4AHQA 5K9CA 4NZ1A 1WOAA 1MW2A 2GUUA 3TNOA 4IP5A 3FXYA 2PRMA 4H2HA 1CXEA 1TCMA 5XIMA 5CBJA 1TMQA 2XM1A 1W3HA 2Y2QA 3PTDA 4Z1DA 4AWSA 4U4MA 3C3UA 1WQ5A 3MT1A 4PRRA 3H53A 2WSQA 1ZCOA 4IF2A 1YEYA 4JY9A 1L6FA 4JN6A 3CLWA 3QV7A 4GINA 4I9JA 1TPVA 3QR3A 2YIHA 4M51A 4MWAA 3FAWA 4O17A 3PAOA 2PDMA 4E2VA 3TMQA 1WKDA 1R87A 4JTQA 3KS6A 5D9NA 1G4PA 1H61A 1R8LA 1V5XA 1SSGA 1DWIM 3DFNA 2EF9A 5BU6A 1UOZA 1CBGA 2YZRA 2I5IA 4C6QA 4GO8A 1TE1A 5BXTA 3QY7A 3TZNA 4L5ZA 3ZM8A 2Q3RA 4GVHA 4LYKA 1XISA 4D1JA 3SM0A 3H2MA 1LF1A 1WZLA 4HMCA 3KRZA 4IBEA 2J8TA 5AFDA 2RDTA 3WLPA 1GWJA 3NL3A 4BI5A 8CGTA 3P60A 1S1RA 3NXFA 1EJWC 1VFFA 2VM8A 7ODCA 4TMBA 1EA0A 2OZ3A 2XTKA 1EWEA 7REQB 4XKYA 2E5BA 3SUUA 1KA9F 3WNPA 5HNRA 1HQTA 3E38A 3GXMA 1LP6A 4XB3A 4HA1A 5D2XA 2NLYA 1N2VA 3EWYA 1RK5A 5EMKA 4ADTA 4JIPA 3BLLA 2CKSA 1HKVA 2G3MA 3THUA 1E51A 3KTSA 4Q4PA 2OOGA 3M7WA 3IACA 2HWGA 3OGSA 1A3XA 3DZ1A 3K46A 4G6CA 4Q4QA 1LBLA 3T9PA 2REQB 4MTVA 2PRLA 1ML1A 2FGLA 1Q6GA 4ZA0A 4MJMA 3NXLA 1O5KA 3W9ZA 1WBHA 1F61A 1TV2A 3T2PA 4DJEC 1ED7A 1HFBA 1EEPA 3ZT7A 1JNDA 1PDZA 3M7SA 4NAEA 4X61A 4EF8A 3PNUA 2QCDA 3VIFA 3VIMA 1W3NA 4NZ5A 5MKGB 2Q3OA 3HG5A 4N2YA 1CXHA 2WMIB 4HPGA 1EB3A 3SCOA 3OYXA 4KIEA 3L9CA 1I2NA 1R3TA 2DZSA 1IGWA 2WVSA 1AJ0A 2ZIDA 4KQNA 2EPMX 3DEQA 1UJPA 4S23A 4TIMA 3SECA 1UR1A 1TO3A 3Q4DA 3WQ4A 1XBVA 2EEXA 3MKVA 5HMSA 3M64A 2D0FA 2ZZ1A 1A5SA 1UD4A 3UF9A 4A3YA 3WLTA 2BY2A 3VCCA 5FF4A 3T55A 1VYPX 4CD6A 2JE8A 2XN2A 1BYDA 3HQNA 3A4WA 2V5CA 4JKMA 3UZXA 1K02A 3BURA 4GYPA 3CUZA 4OBTA 2QZRA 2G5WA 4CNUA 3GTHA 1EWDA 3DFYA 1XPGA 3PK7A 3WK0A 1AD4A 3OQ8A 1MEWA 2VFHA 3LCXA 2CC0A 3JVAA 3NZQA 1PIFA 4H9UA 2JKEA 1C91A 3CYVA 1UG6A 4OOZA 1W1B1 3PG8A 4HU4A 4IWWA 4NX5A 1BKSA 1VZWA 2ZUVA 1ADOA 4J1OA 5A6MA 5FEWA 3LK6A 1IWBA 3ISIX 2POZA 1Q2SA 1E9ZB 4PGLA 1DWGM 4D9PA 2QAPA 1VPQA 3SBFA 1ZAHA 1XXXA 3LBCA 2BLEA 5FEXA 1VRDA 2W67A 2RTSA 1ODZA 4K8EA 1BWLA 3A5VA 3S5ZA 1TZ7A 4G5DA 3B0UX 4D1IA 1OIMA 2CLLA 3U57A 3PP7A 3W2JA 1E1EA 2JIWA 4LWWA 3AXKA 2OB3A 5AB3A 1EKOA 4NYYA 4LQ1A 2GK1B 3VNJA 4IFRA 3KOXA 3WDIA 3O15A 4KESA 1KGUA 1WDPA 4FX6M 4GKTA 4H8HA 4MLRA 4KWOA 1W3LA 2XIBA 2V5LA 4I8DA 4OBSA 3E1F1 2PDIA 4NJGA 3B40A 1RBLA 4Z1AA 5DBTA 4Q33A 5IFPA 1CXKA 4IG2A 3W83A 2PWVA 2F6UA 3NNTA 5FI8A 3W24A 3A4JA 1PZ2A 3FJNA 2QGYA 1JDAA 3V5CA 1VRXA 3QLLA 3HJEA 4Q8VA 5EGRA 3BANA 4A3RA 1J4EA 4WJXA 3TE9A 4LW7A 3ME3A 1ESWA 4FIQA 3MQTA 3W2MA 2WPBA 3EWWA 4QGCA 4UTMA 3FW6A 1O7AA 4JEJA 3WNNA 5HAOA 1W8GA 2QT3A 3OO2A 1U22A 2I1OA 4GNKB 4MWAD 4IGSA 1XGZA 1NQ6A 2EKGA 3PTQA 1P4CA 2GVLA 3IUHA 4HP5A 3F4CA 7PTDA 5JBDA 3RX4A 4GIYA 4KGJA 2JALA 1IV8A 3MUY1 2IW0A 5GNZA 3S1XA 2W9MA 3AZSA 3P80A 5AHNA 1P0KA 1OD8A 4LT9A 4MKSA 4NT0A 1L6GA 4K8GA 4O57A 2XU2A 3DIPA 1V6XA 2X30A 4C6EA 3P93A 2YJQA 3S9IA 2ZC1A 1D7FA 1XWYA 3KFTA 1V0KA 3MANA 3SRHA 1Q6DA 4IIDA 1UROA 2DQXA 3W23A 3TTEA 1OZQA 4B5WA 1ALDA 4Z2LA 1GJWA 4OU1A 5D04C 3QV6A 4XQ6A 1JNEA 2W5FA 5D37A 4LX4A 4QE4A 1OK6A 4DBDA 5CC3A 2G97A 1E55A 4LBUA 1CXFA 4OTKA 3TH6A 2WANA 1UJQA 4Y7EA 1DEDA 3R58A 4POCA 4GH9A 1J7MA 2YR1A 3V5OA 3ZOAA 5EMLA 2VOMA 1RY8A 4A22A 2REQA 4Y9AA 4Y90A 4PR4A 1S3HA 4GPNA 1ADSA 1P0BA 4FNRA 4MKNA 1N7KA 2PB1A 1FWEC 4K38A 4E2BA 1YDOA 1U1UA 2OLHA 3H12A 2D1ZA 2IPFA 3WNKA 3DDMA 4WSKA 3LB0A 1TPH1 1XGEA 4W8LA 5ABHA 1M41A 2NWRA 1DIDA 5A5WA 3FY1A 3OIXA 3VTRA 5AECA 3S5OA 1GPWA 5MKGA 1FP9A 1WDQA 3MY9A 1YE6A 3H2AA 1JDCA 2HVNA 2YSWA 4ACZB 1B9ZA 3PANA 3MVIA 4J2PA 4U10A 2ASHA 3FVMA 4JQ3A 5D9OA 2WMIA 2NZLA 4LFYA 5C7VA 4FAMA 3WH6A 1A50A 1KFKA 4BF7A 2ZRXA 2VXNA 5J04A 4AVFA 3WQDA 3AHTA 3JZEA 4FEZA 2VI0A 4QJ1A 2XSAA 2INZA 1ZZMA 3EDJA 3IUDA 1J0JA 1OX4B 3AMDA 5IDIA 1JCXA 4AZ6A 2D0GA 2E3ZA 2DVTA 4WSJA 3OIHA 1XQLA 3AYVA 2E0PA 3LCFA 3NTYA 2WK2A 3I7SA 3IS4A 2F61A 2O0TA 4HPJA 5JXQA 3W70A 3MC5A 1Q8JA 1B54A 1HL9A 1FCBA 3L4YA 4L9XA 1YKWA 1FWBC 2OGYA 3CAQA 2PDKA 1RQEA 2BXVA 4QG6A 5I6SA 1PKNA 3BAIA 3NR0A 1UQZA 1VCGA 2GDQA 1TPFA 4FP1A 4GBDA 4OHQA 2FZ8A 1WYIA 2O55A 4WY0F 1QPOA 1V6TA 1W2PA 3DHUA 3QW3A 5B80A 1RA5A 1ISWA 3K4WA 2OQLA 1E71M 4WKAA 3QPZA 3NOEA 2QJJA 4LTSA 4JX4A 1ZP4A 3RFAA 1QNQA 5DELA 3T1GA 1ELSA 4K1WA 1S38A 1UZ1A 4UTFA 1GVEA 1Q5MA 4UMCA 2KAUC 2WVUA 3WJWA 1N82A 2TYSA 4AZBA 2Z7KA 2EPOA 3W73A 4D2JA 1UKTA 4KCUA 4C6MA 4GBUA 2BVWA 1V3MA 3B4YA 1YIXA 2G3IA 4CCDA 3ALGA 2Q6ZA 1W1YA 4GNVA 1BWVA 2QCFA 3GB6A 1TB3A 4FXFA 4FNTA 3EXRA 3OB8A 5BXPA 1MQPA 4TVDA 4EIVA 3B9EA 2NVDA 3MVTA 3SO7A 2RKXA 2R1NA 2G96A 3BAXA 1VFLA 3QFWA 4FXRA 1BF6A 2F2KA 5A8QA 3AZTA 1K9EA 4TX8A 3WZ0E 4YPJA 3LHYA 4DNHA 6TAAA 1PEZA 3M43A 2PCQA 3C56A 4I6KA 1UH3A 1WX0A 2VT0A 3WLOA 4UUIA 1QOXA 1DWHM 3GAYA 1U1JA 1NSJA 4REQB 2DUZA 3LMYA 4PE8A 3W1PA 3I6TA 3TTQA 2WJFA 4HCDA 4JXCA 5LZLA 4CVUA 1FXPA 5HNTA 5H1WA 3NQ6A 3W76A 3G1XA 4RW5A 2QV5A 3N4EA 4PBGA 5D8ZA 1GVQA 1LBMA 3W1RA 2PRHA 5C6MA 2BY3A 4PBEA 2ZICA 4FLQA 3IUIA 5FSEC 3AXXA 4KBXA 4B92A 4F2BA 5IFTA 2CLEA 3T0BA 1OFBA 4LCRA 4C7FA 1E15A 1DVJA 2RJHA 3BG5A 2J7FA 4DPPA 1XDJA 2CEQA 1JGMA 3W84A 1BG9A 4Q8NA 3VIKA 3DC8A 1UUQA 5BMWA 2VGGA 4QE5A 1BLIA 1H62A 1YBQB 3R8HA 4GX8A 4R3UA 1Q85A 4OE7A 2WC4A 3TN6A 2Y8KA 4UMAA 4MYXA 4MNKA 3VVGA 1DXEA 3L29A 4KRTA 3C2RA 3GQYA 2B7NA 4M6VA 3UXDA 3GHSA 1W17A 3HFYA 3GWQA 1DKWA 2CETA 3NL2A 4U2YA 4EX4A 1YMYA 4AXKA 4MUZA 4OIFA 2HCVA 1VLIA 4HA3A 4UWMA 4DBEA 3M46A 1PIIA 4PBFA 2J75A 4B4HA 4DYEA 3AC0A 3OZPA 1Y5VA 3TV8A 3HQOA 4FMVA 1MEHA 3M41A 2Z1VA 3WQ6A 4FK9A 5E93A 4BCEA 1I60A 4ML9A 2BDQA 4GH1A 3QLDA 5CPNA 3ELFA 4KRZA 3UETA 4AYSA 5CZJA 4PMNA 3VOFA 4M5PA 5CPTA 4BQ5A 1ZBCA 4PUDA 1S1PA 1TREA 1XIIA 4ACZA 1HL8A 3ABRA 1ZFJA 1D3GA 3N18A 3VXGA 1XGDA 3PSWA 4FSAA 4LB4A 4MNMA 2PGRA 3SY8A 4C6IA 4RPPA 2ONEA 1VBRA 4AEOA 2Y24A 4JAWA 3RJXA 3RO8A 4YVVA 3ZSTA 1RLCL 2OU4A 5D2VA 2XFRA 4JDBA 2PA6A 2Z00A 1P6BA 1MMFA 1E4LA 2L5HA 1OX4A 4MZ1A 1TA3B 1Q7QA 2CKRA 3WEOA 1KRAC 2NX3A 3FSUA 1NFGA 4XZMX 4MAZA 3NG3A 3WQFA 2INEA 4RZ6A 4K39A 2QCEA 2UY4A 4M7SA 2QCNA 1K8ZA 5FD0A 2YX0A 1KO0A 2DT1A 3UVIA 1E4MM 2X0HA 2WCSA 1WV2A 3R89A 3QY8A 4ZSUA 1R5YA 4JFVA 3I3BA 1EQCA 1XLCA 4QHRA 4C6KA 2VR5A 2O9OA 4KS0A 1S2TA 1LLWA 4UXDA 4IQEA 4JBRA 1CX9A 3A47A 4ECLA 1HIZA 4MMWA 1F76A 3QH2A 1E70M 2YPIA 3M1ZA 5CSYA 3AOFA 1NWSA 4NF7A 5AYBA 2O4QA 1TTIA 3GG1A 3L0KA 2EJ1A 1A5NC 1FH8A 2CNCA 1A5BA 1FCUA 3QR0A 1XKJA 1XLJA 4E4PA 4PTNA 1B4EA 3GU9A 1H0GA 2J74A 2OODA 4QBXA 4BK9A 3NQAA 1QO2A 3KBMA 1LBFA 4PCPA 5A8PA 4JIEA 3IVUA 3H7VA 3RM8A 3UXLA 1ZB5A 4UIOA 2C16A 2XIQA 3W1LA 3VZYA 1J0ZA 4U2ZA 1AMYA 1E0TA 3R0UA 3QGVA 1HJSA 1CXIA 3SCRA 1JZ5A 3VNLA 3MI3A 3GRIA 1ZQ5A 1G6CA 2HK0A 2OZ0A 2PSNA 4ZO6A 4AG0A 3LPPA 3GDRA 3C2EA 5M1TA 2Z1WA 5I23A 3WQEA 3DHPA 5HBFA 1DJWA 5K3VA 2YDAA 3OBAA 1EGZA 4OV9A 1R7AA 1ITXA 1KV8A 4RK8A 5DY3A 1P7TB 3KL0A 1OFRA 4L64A 5IOBA 4NZ3A 4GZ7A 3AWOA 1UKPA 4BWLC 3ITOA 4H8UA 4QM1A 3K5XA 4N6EA 1U5VA 2OWCA 3C2FA 1C93A 2IXUA 2V67A 4PTDA 3S9YA 4MYAA 4AAJA 2C0HA 4REQA 2PURA 1VR6A 3CUJA 4NKCA 4LALA 1FHLA 3LSCA 3BQ5A 3CT7A 1ZJBA 2OJPA 4GUFA 3N2BA 2W79A 3WQCA 1X7FA 3VGEA 3WUFA 2ZADA 4D6CA 3CV7A 3OLGA 4XO6A 5LXXA 1FHDA 1AQMA 1IEIA 4DI8A 3SCVA 5I09A 3FYOA 1KCZA 3THCA 1VH7A 2P76A 3W7LA 3GXTA 4W7UA 1FHUA 2Z7GA 4B2DD 4X60A 1GVSA 1J6OA 1HX0A 2QJHA 3NYDA 3I10A 2J7EA 2PWEA 3W37A 2DUAA 4FNUA 4EP8C 3H21A 5ECUA 3F5KA 1GW9A 3RCYA 3I3EA 4D6EA 5IDZA 3BZGA 4HHLA 4ACYA 2BP1A 4S3DA 2NSXA 3N2TA 3PM6A 3QV8A 1CLXA 4LYRA 1E40A 2ZBTA 4NJKA 2GJPA 4BQ3A 3KE0A 5EU9A 2HS6A 4ADUA 2C13A 3H2EA 4OT7A 4UCGA 5A6LA 1OX5A 1SFTA 3C0LA 1S2UA 1SYTA 4A8NA 3QGKC 2AKZA 4KMQA 1B3ZA 3BMXA 4UTIA 1SQ7A 4YU1A 2A21A 3PWGA 3MYPA 5CXPA 3UJ2A 4DBWA 3DU0A 3LGDA 3HZ3A 3BK0A 4XISA 4JNZA 3NPWA 4KEZA 4PTVA 2QF7A 2C79A 2P88A 1X8CA 4PSRA 5I79A 2D2JA 1UBPC 1IZJA 3G0UA 1QCWA 5FJTA 4DI9A 2GSJA 2V68A 3FYYA 3NWRA 2UWFA 3UWWA 3OGVA 5EPDA 2QXWA 3BG3A 4ZXOA 5DRCA 4JTIA 2JF6A 1LJYA 5CJMA 5ABEA 1BRLA 2WLYA 1W1PA 4JTEA 2HSAA 2Y5SA 5D38A 3LBMA 4HPNA 3WQ8A 1HJQA 3WH8A 5CLTA 2C15A 1NQKA 3VDAA 3SCPA 2EG7A 2PPGA 3U6WA 1RA0A 3HIJA 4O16A 1GVIA 3HG4A 1WKFA 3T0TA 3CYJA 1TA3A 2Y2PA 4BZYA 5DY2A 3OA5A 2ON3A 4O53A 1DIKA 3H2CA 1XL9A 3G5EA 1VFTA 1D2KA 4HHHA 4NIRA 1C8YA 1RP8A 3OVQA 4GUIA 1XRFA 4WK9A 3AHZA 1EZWA 4IP7A 5AOUA 3COTA 4TU1A 1FX6A 3PZIA 3IJ7A 4G1KA 1NARA 3W7QA 1LWHA 2J9YA 1TQJA 3S8HA 3EPOA 2G3NA 3RLVA 6XIAA 2BNJA 5U7SA 3GZ3A 2OSXA 2NXIA 3P84A 3CEPA 4YTQA 1KXHA 4H2CA 3UGVA 2PZ0A 3MO7A 3SFWA 4LEQA 4MZ8A 1MYRA 4EPBC 2D3NA 3AMKA 3BWWA 4PMZA 4A6GA 3AIEA 4BJHA 3CV2A 1M1BA 3CASA 4HYRA 4MPQA 4QDWA 4JYEA 1UKOA 4PUKA 1SSDA 2XG9A 2HXTA 1OG6A 4UTHA 3RK8A 4ZMGA 6ALDA 2EXOA 4DJFC 3JUGA 4M24A 2VC5A 3CWOX 5LA0A 3L28A 4O8AA 3VE9A 2QVNA 2Z2AA 1GQKA 1E3ZA 5HUOA 4AZ7A 3L26A 1US0A 3O05A 2FTPA 3AS0A 2C91A 1Q8AA 1ZL1A 1ZU8A 2A6NA 2C7FA 2V30A 6CGTA 2J25A 3NL6A 4Q3MA 4MHBA 2JCHA 1FDYA 2Y2NA 2INFA 1UKSA 1PV8A 4KF1A 1UP2A 1ME7A 1MNZA 1UWQA 3FOKA 4A8IA 1SM9A 4K68A 1K6WA 1RJQA 3FDGA 3DFTA 1V6WA 4JHMA 3II1A 3PZQA 1MDLA 4W8BA 3R25A 4IJEA 4UNKA 4FOKA 2CU0A 4AY1A 1UPPA 3MHGA 1K03A 3BLDA 1GONA 5AYYA 3K4AA 2OEJA 3K8LA 1P7TA 3UXAA 2PODA 4WJEA 2X1SA 4X22A 4XK2A 5GQBA 2OCZA 4CQCA 4L1WA 3W6LA 2JE5A 2RUSA 1TSIA 1XS2A 3OVGA 3D47A 1OEPA 1GCYA 3H70A 4LVBA 1GYMA 4BQ4A 3L4VA 1DHKA 3T2OA 3HPAA 1JEZA 4PMRA 1POJA 3RXZA 3CM4A 1KGWA 5FJPA 3BAYA 3WBXA 5B7ZA 4UTKA 3GVGA 3SCWA 1EO7A 3LXAA 3VX1A 3CV1A 1H7XA 3BICA 3V75A 1P6CA 3PZUA 4O1AA 1X39A 1DJHA 3P3BA 2XUCA 4Q8OA 3MMDA 1XG4A 4Z0SA 3NQGA 5JQ9A 1L8NA 2Y70A 2E7FA 3ZT5A 4C6LA 3WQOA 1UR8A 4UNLA 3P2VA 1AW1A 4ALDA 2JFEX 1NF0A 3CTTA 4H9TA 4ERAA 2E9BA 2VKZG 4XSMA 1DE5A 4XTIA 3VOCA 3CJPA 4LNCA 3EA2A 4AH7A 3NM1A 4E6MA 1BF2A 4D8LA 3NZGA 5HQMA 4M8UA 1ZS2A 1ZHAA 1PX4A 1GXDA 3PZVA 4CVWA 1EX1A 2V5KA 4JZ5A 4GHAA 1ZAJA 2WNNA 1F2JA 1XIEA 4W85A 4XZNX 1JPKA 2Y7GA 3GDMA 5U4NA 5AC8A 2QEZA 5EMUA 2HBVA 3V5FA 3UFYA 3QMSA 4M6UA 1ZAIA 1FFRA 1NDZA 4L4LA 1H49A 1FKWA 1FWSA 2F7FA 1P43A 2OX4A 4QX4A 5C5YA 1VJSA 1SMAA 4UOZA 5CSRA 4IGNA 4L80A 3LSBA 2QKFA 1M03A 1A5AA 3LU2A 3ZYZA 2ATMA 2ZXAA 4PFHA 1W5NA 3C5QA 5REQB 3PJXA 1E0VA 4XTDA 1TWSA 5JMUA 4IOTA 2OT1A 5G2WA 3LHUA 2ZZ3A 3B8IA 4UTWC 2E6DA 1OFOA 1K70A 4A21A 1UIOA 3WDRA 1FHVA 3E5BA 1ONRA 4B9ZA 2DH3A 4DNMA 1TTJA 3YPIA 2OEKA 2UBPC 4HIBA 4RZ4A 2HK1A 2GGEA 5HDRA 3T4CA 1HGWA 5C54A 3VABA 1E5JA 1OT1A 1VAHA 4JTUA 5CKSA 4EK7A 1TX2A 3G1DA 5AYIA 9XIMA 1XLFA 3ES7A 3WF1A 2FVMA 1GOWA 4GHRA 3EKGA 3TTOA 3KOZA 4DF2A 3GNNA 4HPHA 3BAWA 3WELA 2ODOA 5LIXX 1ADDA 3OTRA 3W7NA 3HSHA 3KZPA 1DORA 3BOLA 1XCFA 2OQYA 2PTWA 4OQVA 1HJXA 4QXIA 1TWWA 3B0PA 1RUSA 4HK7A 1LZOA 1A4LA 3A24A 1PTGA 2P0IA 4MADA 5K4ZA 3POHA 3VNDA 2HV5A 3KBSA 3UG8A 2BMBA 3B05A 3P14A 5BXSA 1RPXA 1B90A 3DYOA 3HO8A 3RM9A 4AIOA 2C19A 5I02A 1FWCC 3NQMA 1EYWA 4LH8A 3Q2DA 5EMMA 5I3FA 5E0KA 5A1AA 2ZVRA 3W85A 3LHTA 3N3MA 3TA6A 3O63A 4YHGA 2RH9A 3EPNA 3LZ3A 3W7KA 4Q4MA 3RPTA 3ANYA 1IEVA 3E49A 2OLSA 1BFNA 2QCCA 2QPSA 1QW8A 3DECA 3W7RA 4FOUA 3RMEA 1WAWA 4WEVX 1SPQA 4B5SA 3NSMA 4XV0A 1OCNA 2P5NA 2WYSA 3L4XA 1BYCA 3UXIA 1BPLB 1PZ0A 1AA1B 4GYKA 4O1DA 1R3VA 2FGBA 5BCAA 4KEMA 4PZVA 3H24A 4HSNA 2QUMA 3KWSA 1XPYA 2RGLA 1XRTA 3PZNA 1O12A 4MVAA 4EF9A 3GXIA 3DESA 4OKDA 4BS0A 2ISSA 1FWNA 3WNOA 3L5AA 3W7IA 1Q65A 3AXMA 4HGXA 3NFUA 3U8GA 1O1ZA 2A3CA 1PXGA 4EAMA 3O7UA 4LUSA 3CT2A 4PEEA 1V93A 3I7RA 1LOSA 3H7RA 2Y63A 1TTQA 4HHPA 2WOQA 4O1BA 4IIEA 4RNFA 1L2QA 4UQ9A 3O06A 3VUSA 2FJUB 1J2WA 4UR8A 3NM3A 3W27A 5LXEA 3NQ8A 5J5RA 4O4WA 2P8BA 5E5CA 1LQ0A 1UUMA 2B0MA 1CGVA 1Z44A 5FAJA 6A3HA 3L65A 2Z25A 1T99A 4HYWA 3KBNA 3CV6A 1QO6A 5B7YA 2WVTA 4Z2IA 3V7PA 1W37A 1C90A 1W3JA 4JFUA 3B9AA 5D02A 3ABXA 3I6EA 1HZYA 2VZTA 4IMGA 1JCNA 4IMFA 2OYMA 2QW5A 1DXIA 1MDRA 2VDGA 1HTIA 3CQ0A 2QULA 4U3AA 1QHZA 5FOOA 3CH9A 1GEHA 1GKRA 3GUGA 3EMCA 1X6LA 2YCKX 4P7QA 3LHZA 3SN1A 4S39A 1PS9A 5GPRA 4A8LA 3SSZA 4GQGA 4HMEA 3A64A 4EVZA 4IPLA 5FACA 1G94A 3TYCA 3NDOA 3VMPA 2VX6A 3JW7A 3TEVA 4OECA 3TWBA 2PDNA 4RW3A 4JOMA 1OM0A 4IFKB 3TW7A 3ZT6A 1GVFA 3M0HA 1IIGA 3UESA 3IIXA 3AMLA 3BJFA 1O6IA 1SUXA 3AS1A 1XSJA 3NZPA 3VDGA 2X40A 2Q09A 3CHFA 1CECA 2GSEA 1JVNA 1YNQA 5C9UA 4Y96A 4HVXA 1WA3A 3ITXA 3EXTA 5REQA 3U0HA 5JVLA 1GK8A 4IJBA 2B4GA 1EJXC 3UBPC 1AH3A 5A8GA 4DJFA 4BF9A 1P0EA 3TC3A 3GXFA 4H9XA 4U33A 4MB4A 4X0VA 2O4MA 1FDZA 2WSYA 2XM2A 2DIEA 3A5FA 3THQA 4XX6A 1EYEA 1WDSA 2ZRZA 1Q6RA 2PWHA 3W0KA 3UZYA 2PDFA 3TR2A 5LYRA 1HJVA 3AIQA 3GY1A 3E2RA 4ZZ9A 1E6NA 4W93A 1JD9A 2AMXA 3AYSA 1XIJA 3S2CA 4CNOA 7XIMA 4LANA 3URBA 2WMJA 4AEEA 3LRMA 3SCUA 4ORMA 3GKFA 3ZLHA 3TSMA 4FHAA 1ONEA 5K4XA 5MHBA 1W9VA 4RX0A 4KETA 4J3TA 2QUVA 4DXXA 2BX7A 4HQVA 4U31A 2A3LA 3KP1A 3CWHA 2DZXA 4UR7A 3BO9A 4M19A 4O28A 2EKCA 5A3HA 3UQNA 2TAAA 3VGGA 2YL8A 2J78A 4IBGA 1FWFC 1VJZA 4O0QA 2PP1A 1GKPA 3WLHA 2ZA2A 4R85A 4C5ZA 4UMBA 1B3YA 4ZQRA 3SADA 2TRSA 5HPCA 2GFTA 2YYTA 4QS6A 4BHYA 4JKKA 1FBAA 3S46A 4A2RA 3EDEA 3JZUA 4G2DA 1E6QM 4O18A 1NDVA 3SGUA 3WBWA 2XH2A 3N3FA 4AD0A 3EOOA 1ZRQA 1BSLA 5M17A 2WHKA 1EUNA 1Q6CA 2WVVB 4AXNA 4LUIA 3SFKA 2VOTA 4GO9A 4IX2A 3LZ5A 1KM0A 5CPQA 2PU0A 2C1GA 2CHRA 1XCWA 1WCGA 4JTJA 3N17A 4J27A 1XH0A 4ZE5A 3EEGA 4CLMA 1RPKA 2TSYA 4UFHA 2OWWA 3W1MA 2CCRA 1P5BA 2EG6A 2NVCA 4DVOA 1CNVA 4JIQA 3GXDA 4AW7A 3LXCA 5IBXC 2PLMA 4IISA 2GUYA 1LDCA 1QFEA 1JQXA 4DO6A 1VLWA 4AVOA 3WJZA 4R9OA 1H7WA 1NJJA 4CUCA 5JH2A 3BMVA 4WDWA 3SY1A 3RGTA 3TONA 3GR8A 4J3XA 4JTFA 4E4UA 1KD0A 2X05A 4DO4A 2I9EA 2PS2A 4MB1A 1JYXA 5C0QA 1QBAA 3ECQA 1ONXA 2ACQA 2Q8LA 3KVMA 5C2CA 1UASA 1VCVA 1E3XA 4M82A 4MLJA 2BASA 3DFHA 3P82A 1V8EA 3K1GA 1K4GA 3VKCA 2WMKA 3N14A 4QITA 3VKJA 4AHOA 4X2PA 2NV1A 3PBYA 1ITCA 2P0OA 3DFOA 1UHVA 5F2GA 1HF6A 8TIMA 2PGWA 4L61A 1OK4A 4FX8A 1J0KA 3E2QA 1FWDC 2VVNA 1P6WA 1J9YA 2OSYA 1U30A 2R14A 5FSDC 1WUEA 4UBPC 2AKMA 4BF5A 4J2MA 3PZTA 1PHWA 2PGEA 4ICMA 5G1YA 2J62A 1EDGA 3PNZA 2VVSA 3LGEA 1R46A 8XIAA 4B91A 3M5XA 1SFLA 2OT0A 2GOUA 5GVJA 4J9JA 2O7SA 4WX2A 1X96A 4ZQOA 2A5HA 3WD3A 1QI5A 3RNDA 1U5HA 1W5QA 3B0XA 3CUHA 4XIAA 3CS2A 3N25A 2X2GA 3WLIA 4K2SA 4PODA 3PBWA 4ZQNA 4ICNA 3P81A 3WK3A 1ENUA 1KQYA 4PCTA 3W7MA 4YNGA 3HOJA 3POCA 3CQIA 4F0HA 1OIFA 3VA8A 3WD2A 5HPOA 5H8PA 1KXVA 2CW6A 2WWDA 4IFKA 3OVRA 4OVXA 3F5JA 4WJ8A 2BOFX 2H9AB 1K8CA 3BGGA 3L4UA 1HO4A 1VEOA 4JX6A 4J3WA 1M65A 3AO0A 1GEQA 3U7VA 3G1AA 4D6JA 2Y2MA 2VJXA 1JQVA 2A6LA 4H9YA 2G3FA 3WMBA 3P61A 2NXGA 1OADA 2IQTA 3USBA 1XYBA 4KWWA 1OJXA 1BGGA 5HJXA 3S42A 2XFYA 3DFPA 4AY7A 3DYMA 4GD0A 3CO4A 2OKOA 3UZJA 1V6UA 3R4IA 4ZB5A 3XISA 4IQDA 2A3HA 4DZHA 4GVIA 4F66A 1XYCA 3MJMA 2C3ZA 1OFEA 1VHNA 3ATZA 3M0KA 3QXBA 1HT6A 1QI3A 4A05A 1H50A 3BTNA 4M80A 1H63A 5CEWA 3UGRA 1GQIA 3IK4A 4ZFCA 1OCJA 1EXPA 1TVPA 1DL3A 4A3HA 1TZ9A 4GC3A 1DPMA 3IRSA 3NVDA 1YDVA 1MFVA 3BLPX 4WSHA 3WNMA 1TJ0A 3RF9A 1HKIA 1CB2A 3UG5A 5I77A 1TCDA 5GNXA 3QHOA 4QG8A 1JYWA 5EKYA 3VMNA 3O6DA 1H60A 1HUVA 1LRQA 3CL7A 5EA9A 5CBBA 1IE7C 4O15A 2KZHA 2QPXA 4NJIA 4N42A 4WIWA 1H8PA 1X8FA 1R47A 3DHFA 1TV4A 5AVNA 3GHTA 4MWAC 3VIJA 3GNOA 3BDKA 3S5SA 3T44A 2DZWA 1GVYA 1R7OA 1H5YA 3TYAA 3D5HA 2NUWA 3NGJA 1RHCA 1QNPA 4C6BA 4QNWA 3PZMA 2DT0A 2IPGA 2O92A 2QF8A 3QMRA 4XAGA 1J0YA 4PYSA 3W82A 3EOSA 2ZZ2A 3NZ1A 3MA8A 4CQ8A 1YU2A 4PL1A 4Y6GA 1V4YA 3GDLA 5A95A 4MWAE 2GZXA 1CB7B 5HWJA 1WDRA 3UG3A 2J66A 1SO3A 8A3HA 4XWUA 2BHZA 2V9DA 4LEFA 2YBVA 3BLOA 1KBKA 1TPUA 2B81A 4PMQA 1S3TC 3MS8A 3S5YA 1C9DA 4GOAA 2J27A 1X1OA 1QVBA 4B3KA 4MDOA 3HPSA 3MW7A 2UY3A 3N4FA 5BNKA 3ZR6A 3GK0A 3ARWA 1KCLA 3APYA 4E0CA 1WZAA 4FLOA 1Q63A 4LAOA 3TC6A 5HJYA 3REQB 4DO5A 2ZX7A 3IJIA 2OX1A 5AZ1A 4IIFA 5DMNA 2V2CA 4EACA 4IMAA 4K7YA 3WDJA 4JGDA 5T91A 1OF6A 3CZKA 1Z89A 1UA7A 3T2QA 3BH4A 3VD7A 1F7BA 4M81A 2V8ZA 5IXEA 5CQ1A 1I1XA 1WUFA 3LM7A 1BVZA 2E28A 4F0RA 4LS1A 1IWPA 4JTHA 4TOQA 3DFSA 3I68A 3GX9A 4F2TA 3IGSA 2NQLA 1PX8A 4IPPA 3WQ5A 2D69A 3CO8A 4MY9A 1G7VA 3XIMA 1CXLA 5E6YA 1Y7VA 4BR1A 1S2VA 1RVGA 1VGAA 3R11A 3QY6A 4H3DA 4DBUA 2LLEA 5BOOA 1S5WA 4YJ5A 1D3CA 1ZPTA 4B3LA 3NEHA 4WZHA 3W1UA 3L2LA 3E9AA 1MO0A 3CIXA 2WSRA 3EDFA 2Y7FA 1Y8BA 5HR7A 3QTGA 5H8UA 3V1HA 2FIQA 1QO5A 3ZJKA 1XCXA 4C5YA 5I3HA 4LGXA 4NAFB 4DF0A 1I75A 2DUXA 2VC9A 4IXXA 4LB3A 1E1CB 3WQGA 4E3VA 3W7EA 1BXBA 3HPFA 1HXJA 4F48A 1XYMA 4ZB2A 1FRBA 3UA3A 1NU5A 1L6WA 1EPXA 3BOXA 3ARUA 4C6JA 3H2FA 3B8WA 5LKYA 4DBSA 1W91A 1WPCA 4V27A 1TWZA 1Q4NX 4B5TA 2BY0A 2YXXA 2GPTA 5HMEA 3UJSA 3B8VA 3ARZA 2RDWA 3DYPA 2CZFA 2H9AA 2QJGA 5GJMA 2VZSA 1NP2A 1NWRA 2TODA 2J9XA 4ATWA 3GFZA 1YUEA 1KC7A 1TPWA 1XFBA 2WCAA 3W2LA 2ZOXA 4G9PA 2PDJA 4NNCA 1C3FA 3T6CA 1WXZA 2PDWA 1F3XA 3GLCA 1UR4A 4KEVA 2PC4A 4P8VA 2DVUA 4B5UA 5A94A 3A12A 3R0DA 4BEUA 1I0BA 4KRUA 3LHWA 3OA3A 1TJ1A 1B1YA 4M6QA 3MQLA 1XHGA 3A9BA 5DEZA 3LQGA 2E6FA 2OXNA 1L6JA 1M9HA 1IIHA 1KS0A 1UD6A 1NVMA 2PDPA 1GHRA 4AF0B 1TKKA 4FF5A 3HGOA 4XKMA 3TJ4A 3PWAA 2X7WA 3LRKA 3EWXA 4C7GA 1QPRA 2WHJA 5IBXA 1U83A 3B8UA 3UYCA 4TX6A 4HNOA 5FAGA 3RAOA 1JF6A 3GM8A 5DMMA 2WNZA 5RUBA 4IIGA 3ABSA 1EJVC 3AIBA 3PY2A 4R53A 4IMDA 3MBFA 5HR6A 1HL2A 2QHAA 3VDHA 3CLMA 3CZGA 4XVEA 3SDOA 4H19A 4TO8A 2WC7A 2V5DA 1IEQA 2IMRA 4H9MA 2UY5A 3W29A 1WDDA 3VFCA 4Z17A 1F3TA 2PU1A 1PX3A 1RQBA 1W3IA 1TIMA 2XGBA 1F74A 4RDWA 1O1HA 1OC5A 4UZUA 1A0CA 4L4PA 1PZ3A 4J28A 1LORA 3TYBA 1V79A 1AQFA 1UH2A 1TRIA 1LL6A 2X16A 3GTNA 2WHMA 2AAAA 3CXOA 3HGJA 4Q6JA 3W26A 3BCFA 3FHAA 4PSPA 3DBNA 3UP8A 3NJ3A 3WH9A 4JTSA 3VKKA 2YB1A 4PUUA 5IHSA 3DC0A 5T9BG 2VO5A 1G01A 4KPLA 2F38A 1UR9A 1RLDA 4LBSA 2PMQA 2SFPA 4B5VA 3D3FA 4UR9A 1KRBC 4OJYA 1T8XA 2PLKA 3KBVA 8RUCA 4MAVA 1VBGA 4HSHA 1MXSA 4JDYA 1XYFA 4LSBA 3H4XA 2QDGA 3SCNA 3CMJA 5A2AA 2ZE3A 4MFDA 3BZJA 2QJMA 4OJLA 4ZE4A 5D03A 3O6AA 1NDWA 4HTBA 2VEGA 3AS3A 4JTRA 2X1RA 2GJRA 2W27A 3CUXA 2Z1XA 3ONCA 1VIZA 5HQLA 3GH7A 3URNA 4AEFA 5C9XA 2Y1HA 1YPXA 2DV0A 1M04A 4TQTA 1OYBA 3REQA 4P8WA 3LV6A 4DPQA 4JL1A 1A49A 5AHIA 3PZOA 3IJ8A 3W4RA 5F4WA 3QVQA 4IZGA 1TE6A 2AAMA 1OFPA 2J4GA 2P50A 2GQAA 3A3WA 3FAXA 4GLEA 4AZHA 1SO4A 3RR4A 1WB0A 1FTXA 2BGSA 5I07A 1FWRA 1QPQA 3HJZA 5FEZA 1LG1A 2Z27A 1K6AA 3UZ5A 4ERGA 2CIPA 3GSMA 3W1NA 5A2BA 2ATSA 4NNBA 2C6QA 3SIMA 2Q71A 3W02A 1JCTA 1RCOB 3VOJA 4PB4A 1I6NA 1GPFA 1UZDA 4JICA 4YTRA 2Y2LA 3U2CA 1PJ9A 3N4AA 5KINA 1TV8A 3RG6A 2XWEA 3NQCA 4RPQA 2ZCGA 5CSUA 5BU9A 3UPMA 4X3ZA 1C92A 1JZ4A 3WDHA 4HA4A 3NCOA 4H8VA 1I45A 4XVDA 1YPIA 4I8YA 1ZNNA 3P62A 1XFCA 5I03A 1GT8A 3G1HA 4JY8A 1CEOA 3WF2A 1DQWA 1PUDA 3KM8A 3ARSA 4NZ4A 4PEKA 1XIMA 3L4WA 4E5TA 3V3WA 4F0KA 3G8EA 3G18A 2YA0A 1I0DA 2NX9A 2VX5A 2YCIX 1J2BA 3HV8A 3W38A 4JTLA 4F4RA 1ME8A 3SCQA 3TVAA 5LNWA 2ISWA 3PS7A 5EFFA 3UXKA 3MCMA 3FDKA 2X1UA 2VX4A 3UR8A 4ONVA 1ODUA 1RAKA 4RZ5A 1Y5XA 3EWBX 4IUGA 3T8QA 3C0JA 2GGIA 4UFMA 3PBVA 1EGVA 4DO7A 4H04A 3W2UA 1QWGA 4Q7NA 4CNTA 4QS5A 3NQDA 2EQDA 4IBKA 3FEQA 1VPYA 3R12A 5G1MA 1TUFA 1HKMA 4XBJA 1M53A 2V5JA 1OFQA 3IIVA 4F0LA 4Y2WA 3QZEA 3CQKA 5FEPA 3B06A 1XH1A 1FWTA 1QU4A 1IEXA 5PTDA 4Q4RA 2Z1SA 4L9ZA 5FJIA 2A4AA 3SN4A 9XIAA 5ABFB 2Z1KA 1AODA 3AZRA 3SCSA 4CU8A 2AL2A 4KW2A 3TOYA 2A85A 1A5OC 3G2GA 2VHLA 2Y2GA 2YB4A 3GG0A 2ZZ6A 5LNUA 4MDPA 2HE8A 3G1YA 2XZ9A 4HNVA 4AF0A 2RFGA 3PPHA 3MSRA 4I5XA 3TQ0A 6TIMA 2QAFA 4JN7A 2CITA 4M1RA 4O13A 2GVGA 2NQHA 4PH6A 1QPNA 3MSGA 4OJ6A 2HVMA 5SWUA 4ZODA 1S2CA 1ISVA 2W91A 1LG2A 4HNLA 2WHLA 1UZ4A 1IGSA 2V63A 4LYQA 1JUEA 5DANA 2G3JA 1EL3A 4IL2A 3QOMA 4J5NA 1GVOA 3VILA 1QTWA 1F8IA 4IL0A 1MW3A 3CIVA 3W72A 3H23A 4H9VA 3U2EA 3GDKA 1YNPA 2POTA 4NI3A 2DT2A 2WAGA 1XLBA 1EIXA 3A4AA 2ISVA 3T40A 1NELA 2G0WA 2CBUA 2JKAA 2WZEA 3DUGA 4PCNA 1RR2A 4R88A 3SB0A 1KBJA 3UCDA 3DH7A 1W3KA 4PCFA 2X7VA 1NDYA 3S1WA 4YYCA 2JEQA 3N2XA 4ZR8A 2XIMA 3UWZA 1DJGA 2OPJA 4WXZA 3L4TA 3MJYA 4IBDA 1L8PA 1TG7A 2QNEA 4AMCA 9RUBA 3EX6A 4NRSA 2DSUA 3EWZA 4HPXA 1GUVA 2V3FA 2Y89A 2GJXA 2Z6JA 4IIHA 1E4NA 1QBBA 3A23A 1N8FA 3G6LA 3QGAC 3GU2A 1C8VA 4PN2A 1M7PA 2I7GA 3KLLA 2BBFA 2QJIA 4Q7IA 1UA3A 1XUZA 2ADAA 5FJRA 3G1RA 1XLHA 1J11A 3KVLA 4AD2A 3GH5A 4LAKA 4LY4A 2QYGA 4GC4A 2ZTJA 2O9RA 2XIJA 1BHGA 3L67A 2E8ZA 3A13A 1OCQA 1EC8A 1T96A 1D3HA 3MU7A 5ABGA 3B9NA 1C7TA 5KTLA 3U3HA 3AIRA 3W2KA 3VM7A 1A5KC 1DP0A 3PJWA 5L6UA 1ZJAA 1GTHA 3WH7A 4N4PA 1FUYA 3UJEA 4NP7A 3VNZA 1IZCA 3CZ8A 2P3EA 2F9RA 1CI1A 2UZ9A 2PWUA 1J12A 1IXPA 4V1YA 1EC7A 2JEPA 3TWAA 5LA2A 4AZCA 2ZVIA 3WO8A 4MB5A 5G4EA 1VFOA 3NGFA 1UWIA 1RQHA 3TX9A 2CZVA 4ZB0A 5FKYA 4W84A 1IT8A 4V2XA 3R13A 3OYZA 2BG1A 1PDYA 4W9TA 4WLCA 2Y2WA 3B3DA 2XN1A 4MFEA 5AC6A 1PO9A 1SR0A 4KEUA 4F9DA 2HVOA 1EJSC 3LUTA 1G67A 3P5YA 4O10A 2V2HA 4Z2KA 1B3WA 1JFXA 3FA5A 4QNLA 1XD0A 4DUOA 2D0HA 1V3KA 3MDWA 1K8XA 4EPDC 2I17A 5CC7A 5T9CE 2A0NA 1PBGA 3THDA 3ARTA 3GD6A 3PSVA 3KP0A 4UB9A 2JQXA 5C9ZA 3WY1A 3TXZA 4J7RA 3FVDA 2WMFA 2EGZA 1AQ0A 5H8MA 3BC9A 1KFLA 1IWAA 2XGZA 2ZYFA 4JD4A 4EOUA 5FJJA 5A8NA 3G6MA 4WHBA 4E4FA 1CTNA 4JQAA 4AU0A 2NLIA 2FHCA 4HKPA 3VDBA 1VS1A 1KB3A 3BGJA 4GWEA 2FB2A 5M3WA 2VEPA 2DSKA 3CEUA 4GISA 1ZUAX 4KCWA 1BWKA 3DAQA 4HB7A 5C2GA 1NEYA 1XIBA 4HOXA 4WCJA 4QQ3A 2E68A 1RP9A 3T8LA 3UG4A 1YNYA 3L5MA 3IIPA 3OZYA 5EMJA 5CZTA 3NAVA 3VD4A 5FA5A 1VJIA 1WDWA 3M0VA 3PUDA 1JPMA 3K8KA 4PMOA 1JUBA 4O0KA 4F40A 1Q6EA 4H41A 3W81A 3UU0A 4M7TA 4PMYA 5DXXA 1BKHA 1PB0A 4AUBA 3RX2A 3IAQA 3H4GA 5ABFA 2RDUA 4O0ZA 1CLKA 5LA1A 3GO2A 1CGTA 2WSKA 7REQA 4JNYA 2CZEA 1ZBKA 2OLAA 3FEMA 1U1HA 1XBZA 2QMKA 3P0XA 5I3DA 1KCKA 3O0KA 2YLLA 2E1WA 3CPGA 5A6AA 4P7LA 4I5RA 1DOSA 3WMCA 3M4HA 5C71A 4AIUA 1KM4A 4ATDA 3A4XA 1F4AA 3TJXA 4D6FA 4QROA 2FMNA 3RMJA 1TMLA 2ZUMA 1W5MA 4DAFA 1K3UA 4EKJA 1I2RA 4NZCA 3ANUA 1M7JA 2XSBA 1J93A 2BXZA 1UWUA 3VIHA 3ENLA 3TW6A 2VDIA 5G2IA 3AIVA 2XISA 5AHEA 2OYLA 4P7NA 3V4BA 3W28A 1GOQA 3PWIA 3EOEA 1E6ZA 3ZJ8A 1BD0A 1MW1A 3FA3A 1CDGA 5IRPA 3KOFA 3ZR5A 3UNTA 3MMUA 2A3BA 4I9MA 2D2OA 2A7NA 3WD4A 2CHOA 1WBJA 3PUOA 5C8BB 3MB9A 4E2DA 3OLIA 5E0FA 3TLLA 2CLIA 1VYSX 1ZLPA 2PLCA 1EGMA 2DSZA 4DJDC 4Q8UA 5DMYA 4MUPA 4ML4A 3MUAA 4DHGA 2R1LA 4JQ2A 5A6BA 4JYDA 1H0IA 1S5MA 1C7SA 4GK8A 1X7IA 3RDKA 1OFAA 3AMCA 1DJIA 4OWGA 1KTCA 1R3WA 1TX0A 4AY8A 4M6PA 1UBSA 1BEUA 1TJPA 4GXPA 3LCIA 3VINA 2O9TA 3VD9A 2WQPA 1R2SA 4DN1A 5GJNA 3A3XA 4QSHA 3HN3A 3WYZA 4GHLA 3ZVHB 4M56A 3L23A 4V33A 4YYFA 4L9YA 4OFCA 5TD4A 3C86A 4RNIA 4Y9MA 1H7NA 4RNJA 3N2CA 2BODX 4C6FA 1B5TA 4EXQA 5AC5A 1GG1A 4YCOA 3O3RA 2IKIA 2F8QA 1X1ZA 4CCCA 4IPNB 3DGBA 1QK0A 1L6YA 4C90A 5LNVA 2V3GA 2VQTA 1KFWA 4L7ZA 3MKCA 2XPKA 1HG3A 5D9PA 2D22A 4WKFA 1AIWA 3M0YA 3N73A 4KKXA 4FR6A 4FB7A 1EHAA 5HULA 1US3A 5C70A 3UPBA 2BXYA 4S38A 4FOJA 2YBTA 4YWIA 4GCAA 4AC7C 3TR9A 2CYGA 2XVLA 3U4FA 3WN6A 3MI6A 1HKWA 3TDFA 3I7QA 3H7UA 3SRFA 1FKXA 1KKRA 1ZP3A 4QLLA 2ESCA 2GYIA 4ROQA 3M9YA 2P8CA 2GK1A 2FDMA 1H09A 3KCOA 3H22A 2QDHA 2PTYA 1I9CB 4GE8A 2PWDA 5J5DA 4JTAA 3OJGA 1K7EA 3ES8A 2D2GA 2Z0IA 3SZ8A 3W7DA 4ZEPA 3ZJ6A 1L0PA 2WKLA 3ICJA 3WF3A 1SFJA 3L66A 3CUGA 5BOFA 1RCQA 2FH8A 3LLDA 1DWAM 1YDNA 3IIZA 3GC5A 1SVDA 4WGHA 3MYOA 4AQLA 4GCXA 2AGTA 4GI9A 3KWXA 3SUSA 4DRSA 4CD7A 1BTMA 1W54A 1TPDA 5LGZA 4NXSA 2B31A 3B9OA 1J01A 3M0XA 1BXCA 3T07A 5A8MA 3E0IA 2CBJA 1CCWB 1AZ2A 3OG2A 4R5EA 3AFBA 4CN1A 1AL8A 3GE7A 4B2DA 1XC4A 3HG2A 1HJUA 4LJ3A 2VR2A 4AX7A 3W88A 1VC4A 3T0DA 2PWGA 3HURA 4IBFA 1THFD 4GJIA 3O6CA 2TMDA 1J18A 3AQUA 1EPVA 5LGXA 2X0YA 3S3GA 1MZHA 2HPIA 3V16A 4CQDA 3OHMB 1IHIA 3GKAA 2HZGA 4TVCA 2WZIA 3O6YX 4N7QA 3ZXWA 2DW7A 1G4EA 4GRSA 3WUGA 3IVSA 2PAJA 3AU2A 4D8ZA 3CQHA 1XW8A 3FA4A 2E4TA 3W87A 2W66A 2I16A 4DZ5A 4YXGA 1TVLA 3KHDA 4M1BA 1S46A 2W4XA 4TVUA 1QPKA 5HQEA 1W32A 2P10A 5E9XA 1JZ8A 2EPKX 3CC1A 4CU7A 3WJXA 3NQFA 3GUWA 2R24A 1LQ2A 4FI4A 5ECVA 4D8AA 4D6IA 1AZ1A 2NQJA 1LTDA 2C8NA 3EB2A 3ZZ1A 3AXIA 2X42A 2NXHA 3AUOA 2OR2A 1QW9A 2AQOA 1E43A 3MHFA 1SFSA 7TAAA 5XIAA 1EHNA 3PC0A 4XAPA 2C1IA 2FLIA 3E12A 3CUFA 3SUWA 4QJ5B 3CHEA 1GOIA 2PD9A 2VFDA 3AJXA 2B7OA 3TC7A 4HNCA 4IXHA 3I6RA 1XC6A 3DENA 2GGHA 1W9DM 1UC4A 3ANVA 3H8AA 4NASA 2H8ZA 5C7HA 1BQGA 1BTCA 2WZMA 2PDHA 5DCDA 3QF0A 5EB8A 5AHFA 2CLMA 1JXKA 4ZTXA 1GJUA 3WQVA 1HNYA 1FOBA 1XICA 4PTWA 3MP4A 2YZ5A 2NX1A 4JFSA 2EBNA 3ABQA 1V0NA 3UWUA 4GVGA 5F1UA 1YU4A 5A6BD 3UJFA 1KGXA 3T0AA 1GOKA 3VOIA 3AJ7A 1VFHA 2WV8A 1C8XA 1SR9A 3GTFA 2ZE0A 1BSIA 1GHSA 2QCMA 4JR5A 3KEHA 3RO6A 3NZRA 2WXDM 4NAEB 3SY5A 5JBFA 4LC8A 3W86A 2QCDB 8XIMA 3ZLGA 4O11A 2GWNA 4S1FA 3WLJA 3ZVHA 2ZXDA 4ZO9A 3C2OA 3QBUA 2X41A 1I8JA 2VD9A 2O56A 3CHVA 5A6TC 4AWEA 2E6YA 2YW3A 3ARVA 3LY0A 2PP3A 3BUVA 4GY0A 1WZMA 3N3TA 1UIPA 2X8RA 4LXFA 3TUUA 3VD5A 4JCMA 3OZOA 3HMCA 1H7OA 4WDUA 2VC6A 4GABA 4C6CA 3M0LA 1NAL1 1XX1A 1CPUA 1PZ1A 3FKEA 4QEEA 3VK5A 3EKLA 4GKLA 4WY0B 3KZSA 2EPLX 3PBMA 4E8CA 3CU2A 1AQHA 1KRMA 3VIGA 3GBDA 4KFPA 3TQVA 4AVNA 3QC3A 4WDTA 4A35A 3URAA 2X1IA 4PTMA 3MUXA 3Q37A 3M0IA 3LLFA 1EP3A 3VGBA 5D2TA 3OLDA 3P67A 1P48A 2CBVA 5AZ0A 5F4SA 2YXGA 3JS3A 3USZA 1R3SA 4KIRA 1P0DA 4ZCWA 4B5NA 3QSTA 3PB2A 3BAKA 4L1XA 3DX5A 1UR3M 3N19B 5HWNA 5CPLA 3LTPA 1K77A 1VKFA 2HDJA 2VEKA 3ZWTA 3I4KA 5D9MA 4AISA 1H1YA 1CK7A 2FPVA 5AC7A 4Z1BA 3IVTA 4V28A 4IGHA 1XR2A 4LPCA 3EX1A 3TIMA 1TRDA 1DJQA 3ITTA 3EWUA 1LL7A 1AH0A 2O7QA 3LENA 3HB9A 3E96A 3U7BA 3EDDA 3IAPA 2NQ9A 3EA1A 3UT0A 4W7WA 3QQ0A 1V0MA 1HW6A 1O5RA 4R33A 3C8FA 5I00A 1E9IA 4ENLA 2J7BA 1T7LA 3BCDA 2G95A 5FL0A 2Q8XA 3HMJG 3GU1A 2NUXA 1TPEA 1ZENA 2JIEA 4P8XA 4Y8EA 5F1VA 3CGTA 4N4QA 3S1UA 4DJDA 4DB7A 4EANA 3W22A 4E8GA 2I5GA 3IARA 5J8LA 3HU7A 2XSXA 1OBAA 2MANA 4Z0JA 1LOLA 4HOZA 1OWQA 4ZBCA 2OGJA 4PL2A 4JIRA 1G7UA 3OU8A 1D8CA 2DQWA 2PBOA 3EGJA 3HTWA 1CT5A 4HZMA 4MGGA 3G1VA 3CHDA 3VOGA 3OZMA 1VHCA 1R2RA 3G1SA 3SQMA 2IKHA 4MIMA 2YL6A 2HJPA 1YBQA 4IG2B 3JRKA 1VYRA 4ZL1A 3C61A 4EE9A 1JDEA 3NUKA 5AN7A 1O5QA 3GFXA 5TIMA 1VFMA 3KVJA 2VNCA 2DEPA 2WZTA 5I5RA 2V5OA 1QRQA 2FYMA 3NVTA 1C8QA 3UPWA 2OYKA 2VQUA 2XDFA 4YL2A 1JZ2A 4RNHA 3WX7A 4YIWA 3OVPA 3ZWSA 5D2YA 1KRCC 3NDZA 1F5ZA 5FF7A 1SW0A 3RJYA 4AX6A 5D30A 1UP0A 5CC5A 1LRTA 3NDYA 4O8RA 4O14A 2V6AA 3R5EA 5BMXA 3P8JA 3V36A 3WBEA 4GJ1A 1QJWA 4I9TA 1QNRA 1LT7A 4A4AA 4WKHA 1E6SM 3I3DA 3W6YA 2G41A 1PKYA 4GACA 5EMYA 4XZBA 1BVWA 1KBLA 5KZDA 1J5TA 2NT1A 1NIUA 3APTA 4UCFA 4OGZA 4O12A 4XBSA 3VU2A 1SZGA 1TFVA 2YCJA 4QP0A 4IICA 1O5XA 4W86A 3L27A 4ORIA 2GJNA 2VCAA 2VR4A 3PBUA 3UY7A 1SMDA 4PA8A 2ZZ4A 3PAJA 4L6HA 1JZ3A 4YHEA 1OGBA 4HZ6A 3HFTA 1CXWA 3PPGA 2VFEA 5DX7A 4HMNA 4UTJA 2IKJA 2VFIA 1FFQA 4GA8A 1RALA 3CB8A 3ZQ9A 5H6HA 1H1ZA 2DZBA 1GQLA 1BQCA 4S3AA 2V69A 5HANA 1M68A 2R82A 4DLFA 1MRQA 1RD6A 4AZGA 4S3CA 3UD6A 3TCSA 1EC9A 1EO5A 1RD5A 1DTNA 2XFWA 4IMEA 1FWHC 4XZIA 2DZVA 1C9WA 2MUCA 3LGGA 3IJ6A 2J88A 2FN2A 1IZKA 2B7QA 1W31A 2GUBA 5F2IA 3E74A 3SGZA 3WMLA 1LRNA 3LBOA 5CSSA 1Q2RA 1LLOA 1ITQA 1XIFA 1QMLA 1JPDX 2RGMA 3N12A 2H3BA 3HGSA 4N9EA 3NOYA 2ZZ7A 2CZ5A 4D71A 4LUTB 1M7XA 2J7CA 1W56A 4LV4A 5DLCA 1CW2A 5I06A 2FGZA 3GC4A 5DCBA 1TR9A 2Y8UA 1JD7A 4WY0A 3BPWA 1GGOA 1R9XA 4LUJA 4G8TA 3GH4A 4M3PA 2ZDSA 4DXVA 4QJ3B 2H90A 2VZUA 4RDYA 4PMDA 4PTXA 5L9FA 1PYMA 4ZXLA 3B4UA 3ONBA 1E56A 1KXTA 2F6XA 4G7FA 2J47A 4CGTA 1KNWA 2C18A 4QG9A 3LCGA 2BTMA 3Q94A 4OZOA 1XP3A 1KCXA 3UERA 1F07A 1LUCB 2ZUTA 4Y9PA 5LIKX 2R1KA 1E6PA 4XZLX 2Z28A 3M0MA 1Z69A 1Y65A 3KL5A 1MZRA 4IJRA 3WLSA 3NIYA 1AJZA 2IXVA 3WLQA 2GQ9A 5AHMA 4V1XA 4A8RA 4CQ9A 1UUOA 3INPA 3C3NA 3SRDA 1X6NA 2ALRA 2BOGX 5D33A 2NQ5A 1KM1A 4INFA 3S6OA 1L2UA 2A3AA 4BKNA 4L56A 3AYTA 2E8YA 4AB4A 1XD1A 2FH6A 3PTMA 3GR7A 2YDSA 4RDVA 2XH7A 3OG3A 4GQRA 1VBJA 1V3IA 3W7OA 5KSWA 3O07A 3ITLA 2WMHA 4Q32A 1QW7A 3QW4B 1OYCA 1VBUA 2IUZA 3DI1A 1OX6A 3N6HA 2AOSA 2FPYA 3GVRA 3TJIA 5F7UA 1XLKA 4HJFA 4ZQMA 2ISDA 4DJDD 4ZQPA 3BW3A 4YS1A 3B9DA 1TZZA 3CTLA 1Z48A 3SUTA 2HS8A 3TAKA 3QHNA 3E5PA 4OJOA 4JKLA 2H3DA 3KTXA 1DHPA 3FYPA 2Z1BA 3CAVA 1Z8AA 3NSNA 3W01A 1GW1A 4I6VA 4XD6A 4Z1CA 4H8NA 1EA9C 3TN5A 1OCBA 3QZAA 3ARYA 3R10A 4KWSA 4D6GA 4XUYA 4Q7BA 1RH9A 2HPMA 1DJYA 1WOBA 4I7VA 3CAKA 3G22A 4Z2HA 1I2PA 3G0SA 3TQKA 1B3VA 5FL1A 2E5CA 1R2TA 3LV5A 1JL8A 3G8RA 2DZPA 3E3HA 1DYSA 1UWAA 4UTLA 3GXPA 3SAZA 1FCQA 4LAMA 3KOYA 1AK5A 1W8SA 3BMWA 4GY1A 1W1ZA 1MVYA 3QZ6A 1Z42A 4DQWA 1W9XA 3NPUA 3BE7A 2BFGA 4QJ4B 4F9JA 4XUGA 2Y61A 1LWJA 3T7VA 1LCOA 1UPMB 1TVNA 1RV8A 2RAGA 4OUEA 4UOJA 3OGRA 1QI2A 1AD1A 3M5VA 3LTSA 1I2OA 4AIEA 2PDBA 7CGTA 3F1QA 4DM1A 1DBTA 3BSHA 3S2MA 3M07A 1Q45A 4A3UA 1UMYA 3WLNA 1RBOB 2ZX8A 3N6JA 2YXOA 3XINA 3SJNA 2GQ8A 1Q6OA 4LRTA 4XZHA 1K7FA 5TNVA 2VUNA 3AHYA 1UMLA 4RL3A 3SURA 3A3HA 3N15A 3UYIA 1ITUA 4UFKA 3RN6A 2Z4GA 4ZSTA 4L6OA 4FR1A 2WKJA 4MY8A 2AMGA 1DWJM 3TYDA 4DZAA 4KWVA 3D0CA 1P1MA 1ICPA 3UR2A 5BROA 1DQXA 2YA2A 1H3GA 3LYEA 1FA2A 5I2UA 2VCBA 3LXBA 4IX0A 2PLJA 3PJTA 3VD3A 2WPGA 4RXFA 4F8XA 5GNYA 2E6AA 5H91A 3TYZA 3F4NA 2D23A 3F03K 1VF8A 4LF1A 4TTUA 1KTNA 1R85A 3LS9A 5BXRA 1XLDA 1MNSA 1O4UA 4PB3A 4YWSA 3EKZA 5EBUA 1ECQA 4MZYA 1AVAA 2EG8A 1KWKA 2EPHA 1XBXA 4I9AA 1QI4A 4RDZA 2RJGA 3VAVA 3WF4A 3E0LA 3T42A 3SGGA 4S3JA 2C71A 4JL2A 3G0XA 3TFXA 1SZEA 2YKKA 1KFEA 1V6VA 4MNLA 4XAZA 1IF2A 1JAEA 5CG0A 5DQPA 5E1QA 4KH2A 1V0LA 1O66A 4LUTA 3OP2A 4DZIA 3N34A 2FHBA 4WGXA 5HOSA 4RV8A 2G4FA 4QLKA 3W7HA 1MRAA 3DG7A 4CQBA 3BOFA 4LY8A 4DUXA 2OFJA 3LN3A 1TPB1 2XVNA 4XAYA 3O1NA 5BRPA 1TR1A 2ZUWA 1OC7A 4QLJA 3BG9A 1KLYA 2CXEA 3TN4A 3BW4A 3VC6A 2HMCA 4OBRA 2Y5EA 3RLUA 4GQ0A 3WIJA 2GVEA 3OODA 1SW3A 2DIJA 2BSLA 2OZTA 3N29A 1EJTC 4X0NA 3TTYA 3IV8A 3PVFA 5E9AA 2XINA 3KS5A 3WLRA 4JFWA 1OGGA 3RU8X 3LPGA 2GJLA 1LUCA 2BOEX 4FPSA 3SW6A 3S2LA 1W9PA 1NWUA 3R43A 2XZ7A 2QJNA 1HJWA 2CFFA 5CLWA 4AWTA 1XYAA 1J79A 4JQ4A 3EPMA 3P6LA 3HONA 4RE0A 2V2DA 4KERA 4RCXA 2ACUA 2J6XA 5EYWA 3BARA 4YVXA 1JIBA 4MNJA 1JCLA 3LQLA 1EBHA 2PUZA 2GWGA 3RX3A 4J3UA 4A29A 1W3TA 1I4NA 4ZGYA 1R9YA 2Z24A 4P2VA 3R1ZA 3C52A 4NYUA 2DZUA 3FKRA 3S2NA 1JGIA 2I14A 4J35A 4O54A 2PF0A 3ARXA 3KX6A 2HNHA 3S47A 3S2JA 2Y2OA 4CEUC 2OVLA 1O95A 1LYXA 2DZTA 4YN5A 3W71A 1OG0A 3G77A 3GYCA 1W1IE 4UFLA 2VRJA 2Y2JA 4JPGA 2DGAA 3QMTA 2FZBA 4H6QA 3VCNA 2NWSA 4XG1A 4J3ZA 1V77A 3VKBA 4QSFA 1XLIA 2XIOA 2YFOA 1IEWA 3GNXA 3LLXA 3QQWA 2CERA 1VFSA 1ZJHA 4ZOBA 4GZEA 3L68A 4ROPA 3DG6A 3U9IA 1IT7A 1NOUA 3L25A 2GL5A 3VZZA 4HOWA 1HN1A 4DJEA 4NQ1A 3F4DA 2WQDA 3RUBL 2CLHA 1KM5A 2VFGA 4PMUA 2VEFA 2NV2A 3B0VC 1J10A 4W7VA 1JFHA 3A22A 3EX4A 3C0QA 2O9PA 5LIWX 2WZHA 1EJUC 2Y4SA 1Z3NA 4H9ZA 1J8VA 3WJSA 4DWSC 1XLMA 3AAMA 3HBLA 2E9MA 3EDKA 2Y5JA 3HA1A 1S5NA 1Q7ZA 2C0AA 1H11A 2BG5A 3N9RA 3FHQA 3RPMA 3EB3A 4JN8A 4LF2A 1VPXA 4LBRA 1Z6KA 4EPKA 3CZLA 1A4MA 5D32A 2D20A 3UEQA 1GG0A 3TK7A 2PD5A 3W7JA 4H01A 1UR0A 2QS8A 1KM6A 3KHJA 3RRXA 5TF0A 1AW5A 1W0MA 3W7GA 3RIKA 1ZGDA 3NQ2A 3IRDA 2QUNA 3HQPA 4QEHA 4P7RA 4CCZA 1OFDA 1B2YA 2X1TA 3TZFA 4F0MA 5DRIA 3IGXA 1JRCA 5K9DA 5MF5A 3A6OA 4IHCA 2YFNA 3UR7A 2PTZA 3TXVA 1HP4A 4ES4A 3N6QA 4M0XA 3EA3A 2OQHA 3R8RA 3AISA 1HP5A 4KCTA 4W4QA 4NILA 4JFTA 4QNEA 4U5IA 1TWDA 1B4KA 2J8FA 1KV5A 1ZBWA 4PUEA 3VM5A 4PUNA 3STEA 1BAGA 1MFUA 3BLEA 3D6NA 3ITVA 2HEJA 2R1PA 3WQPA 3LDVA 4GY7A 1DTUA 3G1FA 1UWSA 1UKQA 3DGRA 2ZRUA 1RBAA 2FPTA 1ONWA 3OBEA 4ZOCA 1J6PA 1W2VA 3N9SA 4OJ5A 2XN0A 3E0FA 3W2NA 3U48A 2PDGA 1AFSA 1XIDA 1V7AA 6XIMA 3UCQA 4U5KA 3FV9A 3PJUA 1BRLB 1P0NA 1T40A 2FVKA 3UWVA 2ZRWA 4HN8A 4HT3A 3I4EA 1QUMA 3OW1A 2Z2BA 4FNSA 2B7PA 3VCRA 3FFSA 1IR2A 3TA9A 5I3JA 5IM51 1JUKA 5FJOA 4FZIA 3QN3A 4DYJA 5HJLA 4KGLA 1T0OA 5A6SA 4ZFMA 2YL9A 3DCPA 4H4IA 1QASA 3RCMA 1GOMA 2AQWA 3QYSA 3PN8A 1FY6A 1GQNA 4LVDA 4W89A 1CYGA 3R79A 3GG7A 4S3GA 3W53A 4Y9NA 2E5DA 3R6IA 3L2IA 2PI6A 3NQVA 1L6SA 3IGHX 4C65A 3UCCA 4MY1A 1UWRA 4IPIA 4D6HA 1XYLA 1D9EA 2Y8VA 4IGMA 3HGRA 5DMLA 1PYFA 1DE6A 4S2CA 2I9UA 3WUBA 3IIOA 2WO5A 1F05A 4UQDA 4DWSB 1G1YA 4PUMA 3GNRA 1HO1A 4PFMA 3CH0A 2IPWA 1MQRA 3RILA 3EEZA 2ZRVA 1R9ZA 3NO1A 4DX3A 2VFFA 5M2FX 5JIPA 3WFAA 2E25A 3NPVA 4YLWA 1YXCA 5CGQA 1E9LA 1KQZA 1QAPA 3E2VA 4HU0A 5CPMA 1JDDA 2WSPA 4G1NA 1LWIA 1P1XA 2VMFA 3CMGA 2X2YA 2E09A 4Q6XA 1JDFA 1UQYA 3MMWA 1X97A 2F6KA 2A1YA 5T26A 1U5JA 2OSWA 4O1FA 5CC6A 1G0CA 3AICA 1JZ6A 1FWWA 5AYZA 2VGIA 2XWDA 2OO0A 1MSSA 2D24A 4UNIA 3NEVA 1MWOA 2PDUA 2IPJA 4AD5A 1LM1A 4Q4KA 3M5YA 3MBDA 1DWFM 3TYEA 3AUJA 6REQB 2ANUA 4NZJA 3KXQA 2OEMA 3CL8A 2P3ZA 1RXOB 6PTDA 1KXQA 2JGQA 3OHIA 1I1WA 1JULA 3PFMA 3T08A 3EXSA 1SZFA 2FTWA 1BVNP 3OBKA 3TQPA 4WVXA 4MG4A 1RJPA 4DJED 3R2GA 1RSCA 3DKLA 3RLGA 1JZ7A 2DH2A 1TMHA 4IQJA 1B3XA