4NZ1A

Structure of vibrio cholerae chitin de-n-acetylase in complex with di(n-acetyl-d-glucosamine) (cbs) in p 21
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Deacetylase DA1
total genus 142
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz1A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz1A01
2IW0A 4M1BA 4NYYA 2C1IA 2J13A 2XU2A 3CL6A 4NY2A 4NZ4A 4U10A 3CL8A 4NZ3A 3VUSA 4F9DA 4HD5A 4V33A 1Z7AA 1W17A 2I5IA 3S6OA 4NYUA 4NZ5A 1XW8A 2C79A 1W1A1 2E67A 2VYOA 3CL7A 1NY1A 3WX7A 1V6TA 4L1GA 1W1B1 2C71A 3RXZA 3QBUA 4NZ1A 5BU6A 2Y8UA 2CC0A 2QV5A 5JMUA 4OUIA 2W3ZA 2NLYA 2DFAA 4LY4A 4WCJA 3HFTA 4F9JA 2C1GA
chains in the Genus database with same CATH superfamily
4ORIA 1Q63A 1XC6A 2J13A 2FHFA 4JN8A 3M16A 4PTWA 3A9IA 3CAKA 2NX9A 3FK4A 4QQ3A 4LS0A 4NL1A 4BI6A 4IBEA 2H8XA 1CZ1A 3W7GA 3W1PA 2GGJA 3WZ0E 3A6OA 4JTEA 3THDA 4RE2A 2IKHA 1HNYA 4DJDD 1BSIA 1F07A 4W87A 2HBVA 4JPGA 4M6VA 3D47A 4C6FA 2VC7A 3XINA 2QCMA 5LNSA 3S9YA 4RK8A 3PHAA 3W2MA 4RNIA 5GJPA 3SCRA 4ERIA 2J75A 2ADAA 1DJWA 2BDQA 2CCRA 2Z2UA 4LWWA 1XC4A 4LUJA 3LPOA 1W9PA 4FSAA 3L2MA 4GVHA 1H61A 2ASHA 4GHLA 1PKLA 3W01A 3CWHA 2OSXA 2Q3OA 5CJ5A 2NX3A 1C8VA 2KX9A 4YVPA 4S3BA 2B0MA 3L25A 4MB4A 4UZSA 3NDOA 3USZA 1FFRA 1EGVA 1XJBA 3FN9A 3VDBA 4O8RA 1WBHA 3UXKA 2D1ZA 1EX5A 4Q4KA 1TVNA 3IJ9A 3L4YA 3O06A 1MUWA 3V18A 1E73M 4KIRA 3AMCA 3ARZA 4W88A 1MEHA 3EYPA 2WVSA 1BKSA 2PC8A 4A22A 5LIYX 3S3GA 3GNNA 3IAPA 1QASA 3ZXWA 1THFD 5LIWX 2VOMA 3TVAA 3U57A 1R3RA 4FS9A 3LCHA 1RJQA 3W74A 2FDSA 4X60A 2XYLA 2E0PA 4C6MA 4DWSD 2PBGA 2G0WA 3VKJA 4BR1A 1XINA 1XLGA 3VGBA 4BI5A 2VFGA 1XSJA 4NZCA 2D22A 2QQ6A 4GIAA 4AY8A 1HO1A 2G97A 5GQBA 3UZXA 1XPYA 1BPLB 1LL7A 3BLLA 2VZVA 2QPSA 3QGAC 1R46A 4JIRA 3BQ6A 2YGYA 2QLYA 4WXYA 4HZ7A 1UJQA 4PTVA 4M24A 3P62A 4RW5A 4IBGA 1GYLA 3T4WA 3CB3A 4LUIA 3W82A 4JZ5A 1W1TA 3GDBA 4NILA 3OJGA 3SB0A 1TCMA 1AK5A 3ABOA 2NSOA 2PF8A 3GIQA 1BSLA 3S6TA 1OFPA 4YLWA 4REQA 2VFIA 2E4TA 4JD4A 1LM1A 2PE4A 4IGMA 3MV01 3T07A 1R87A 4IPNB 5C5YA 1A5MC 1E1FA 4EWJA 1W2VA 2Z27A 2B81A 4NI8A 1F76A 1KQYA 3GH5A 2PODA 4M1BA 4A3UA 2QEZA 5EMKA 3DOPA 1UZ4A 2W63A 3W70A 3RCMA 1ZRQA 3UZ5A 1XLFA 1UWQA 3FJ6A 1DE5A 1MQQA 4FNSA 3AISA 4W7WA 1U30A 2VVNA 5HXMA 1XYFA 5DMNA 2DZVA 3PPCA 3U2CA 3Q37A 2OO0A 4WK9A 3HQPA 4GX9A 2CBJA 5FKYA 1VFFA 2OXNA 2CBIA 1CLKA 1JRBA 4UTHA 4LT9A 2I17A 2DZSA 3GTIA 4HN4A 2I16A 2A3HA 3D3AA 4TXEA 4IP5A 1KXVA 1EZWA 5K3VA 1S38A 3JW7A 3URQA 1VIZA 2WJZA 4ZQNA 3WLHA 1K7EA 4NAFB 5CZTA 3Q58A 3L2IA 3WH8A 1TMLA 5E70A 4FALA 1N2VA 4XAZA 1EA0A 4PUWA 4S3FA 1UMLA 4XBSA 1HJUA 3K4WA 1TPDA 3UR7A 3OVQA 1X6LA 1FVPA 4CNTA 4XAYA 2EJAA 1BKHA 1HN1A 3OLIA 3S47A 4KQNA 2V67A 3QEZA 2VGFA 1UWTA 1LRNA 4LANA 3EOOA 1JNDA 1ML1A 1PS9A 3NSXA 2RDXA 1MUMA 3WCZA 5CPMA 3TTEA 1NH6A 3CQHA 3OA5A 4H83A 4H8NA 4O1AA 2FB2A 2CU0A 3V75A 1VBHA 1IEXA 4WQ6A 1UC5A 3WD4A 6CGTA 4F0HA 3MBFA 3DERA 4J3TA 3BH4A 3WQGA 3LV5A 1K77A 3IVSA 1A5AA 1ZBKA 3DKLA 1WXJA 1BVWA 1TPEA 1WOAA 4A8RA 1UZ1A 2ZQ0A 3ITGA 1JGMA 1MW1A 4A2SA 1UYQA 4CD7A 4DLFA 3SO7A 2BGSA 3DEQA 4YPJA 2OFJA 4MB3A 2CC0A 2BOGX 4R5EA 2HDJA 2V5BA 1FXPA 1TV4A 1EXPA 3QMTA 1YDVA 4MYAA 3MI6A 2WMIA 4QBXA 5I77A 4WVXA 2IS7A 3TCSA 3OHMB 1OX5A 1W3NA 1F6KA 1RXOB 4YVXA 4FOKA 3A47A 4F9JA 2I1OA 2YBVA 1A5KC 1F8MA 3A3WA 3MQLA 1EQCA 1H4PA 3LU2A 2HK0A 3KVKA 2E3ZA 2A7NA 3PBYA 4NAEA 4QRNA 1YU4A 2OZTA 2ODOA 2XVLA 5HJYA 4H9MA 5IXEA 1ZS2A 4U5IA 5FSEC 2RJHA 1XYLA 1MMFA 5I3DA 4AZBA 3UPWA 5LHFA 3PBWA 2CYGA 3VYLA 1U1JA 3W7IA 3PZVA 1B5TA 4CNUA 3GYEA 1SO4A 5I23A 5K9CA 1B54A 4MNMA 3ALGA 1S5WA 2GDUA 3GNXA 3KUMA 1YMYA 4Q4SA 3GH4A 1ME8A 1F9CA 3ABSA 1XGEA 2I7GA 4AVOA 3QMRA 2ACRA 3TTYA 4GQQA 3HGSA 1KTBA 3P2VA 1H7NA 1F4AA 1E8BA 3UWVA 1LUCA 5C9UA 4KF1A 1V3LA 1J0KA 2Z1KA 5JIPA 1JXKA 1TPC1 2V3GA 3G3DA 3WQ4A 1G5AA 3MWCA 4RE0A 2AL1A 1JPIA 1S46A 3A12A 1E6ZA 4JL1A 4B3ZA 4DJFD 4D6EA 5ABEA 4B92A 1DBTA 3C0SA 1XIGA 2WC3A 3DG7A 3GIYA 1HXJA 1OYBA 1FHVA 4IPIA 4GE8A 1POJA 2ZRUA 2C71A 3GAYA 5HWNA 4PRRA 5BROA 4C6NA 1AL7A 3MUAA 5B80A 4KCTA 3PPHA 2HE8A 4WJXA 2D0GA 2GPTA 3PVFA 1PKMA 2ZZ5A 4G56A 4HU8A 2PTWA 4JIEA 3I3BA 2FYMA 3DDMA 2P3ZA 2VFEA 4DXVA 3KHJA 1L9WA 1AW2A 3FGCB 3PF3A 4Y96A 2VQTA 1QXLA 4FEZA 4FMVA 2GGIA 6ALDA 3TYAA 4WLCA 4C6LA 1V6VA 3WLJA 5JBEA 3QH2A 3VNDA 2H8ZA 3SZ8A 2YKKA 2ACQA 2VCAA 3WJSA 2W6RA 1KFEA 3GXDA 4UTTC 1H11A 3MANA 2OSWA 5D09A 1OIFA 4O1EA 1VHCA 3BOLA 3VTRA 3HQ1A 3HQOA 5A8GA 3QV7A 2JKAA 1SR0A 4ZOCA 3W71A 1DJGA 1VH7A 1FWIC 1F4HA 3NQFA 3F2BA 1P4CA 2XN0A 1S2TA 5C0QA 1OB0A 3L4WA 3MTWA 3AO0A 1V08A 2E9MA 3BO9A 3DKJA 1V6UA 1W9XA 2OSYA 3EB4A 1C9WA 2GVEA 3MMDA 3HTWA 3FLUA 4R3UA 1RR2A 3T42A 3UD6A 1SR9A 2IPGA 4RPQA 1NOUA 3LNPA 4L6OA 1WKEA 1RALA 1WNOA 3KBVA 5RUBA 3P74A 3OHIA 1TTPA 2GJPA 1F2JA 3PZGA 4QP0A 4R27A 3R10A 1J0JA 1E0UA 4YN5A 2BY3A 4WJ8A 4IXXA 3E1F1 2GVJA 4S1FA 3VD9A 3CAQA 3OBEA 2EPLX 1ZBVA 4XB3A 4UCGA 1HL8A 1CXHA 3EOEA 5AOUA 3AYVA 2PTXA 1K02A 2A4AA 3T05A 2VC6A 4JQ4A 1H0GA 3VOGA 5EA9A 1LLZA 2X30A 2AAAA 3SADA 2X1RA 1XFCA 3CZ8A 2ZUTA 1G4EA 3Q2DA 2PRMA 1NM9A 1NWRA 2J27A 4XIMA 5CC7A 4TQTA 1YU1A 4CD8A 1CXWA 5AC5A 2CZVA 3PWIA 1IT8A 1X98A 2ZXDA 1DE6A 1TTJA 1EJTC 3SRKA 4D71A 3ZVIA 2PDBA 1W2PA 1X96A 1KXHA 1UKQA 5C8BB 4IJBA 1ZCCA 1RPKA 2QKFA 1JEZA 4F2BA 3OGRA 4GBUA 3KOZA 3CAVA 1EPVA 3EOUA 2I5IA 4IIFA 3CJPA 5EBUA 4GUHA 1L8NA 1EYEA 4W89A 2Z0IA 3W1RA 2V5CA 1ME9A 5EKYA 1BTCA 1OQFA 5AHMA 5TF0A 3INPA 3NSMA 2WBKA 3LMYA 4AEEA 4MUPA 4AD1A 1S1PA 2G37A 1X1ZA 1NQKA 4IM4A 5K4XA 3VNJA 3EDEA 3GC4A 4JIQA 3VIMA 1FWAC 1CX9A 3EWDA 2LLEA 2DUAA 3TMLA 1YTDA 1PSCA 4KWVA 2DVTA 2VGBA 3T55A 3OZYA 1MXSA 2R82A 1KFKA 4PB5A 2REQB 4H8UA 1KM4A 1UUMA 1DJHA 1XM3A 3GR4A 4M8UA 8XIMA 3DFTA 5A3HA 3GTFA 3FAXA 2FN2A 1WKYA 3N4EA 3WG6A 3NXLA 2WV8A 2YIHA 4IISA 2PRHA 1F8IA 3L4XA 2GJXB 1JCLA 1P0BA 3KCOA 4OJLA 3U3HA 3PUOA 4LB3A 4C1NB 4RZ5A 2Y5JA 4S3AA 2BY1A 5D8ZA 4AISA 5I07A 4W8BA 4NX0A 2ZZ1A 4IPPA 3CHEA 3T0CA 3AMGA 1YLVA 4KW2A 4KEVA 4JCLA 2QGYA 4S3KA 3ZT6A 1FCVA 1QWGA 2WB5A 1E56A 2XSAA 3S9IA 2VJXA 3TNBA 5ABGA 3LM3A 3NQMA 5A95A 4TOQA 4H7VA 4GO8A 2DIJA 3BDKA 4CQBA 1RBAA 4HPGA 4AHPA 3LGGA 4O4WA 4NASA 3LHTA 3AXKA 3W7RA 2F2KA 3LBCA 3WDRA 4GRSA 1DV7A 3NQ6A 4ICMA 4PMVA 4DBWA 4PCTA 3ARTA 4E2DA 4H9YA 4LEQA 3K2GA 3HPZA 2Y6ZA 4HTBA 4W9TA 3B04A 2W4XA 4BEQA 4GGBA 3UGVA 4E5TA 2ABAA 2GUUA 1XBYA 4YHGA 1ZTVA 2OODA 3TTQA 1SW7A 5KZMA 4LF2A 3VKKA 2AGKA 1E9IA 1SYTA 1QHPA 4ERAA 2J25A 1G6CA 3M5ZA 4QDWA 4Q4MA 4DBDA 2YCLB 3BLFA 2JEQA 3QZEA 3AHYA 1I2OA 4F79A 4CLMA 4IXHA 5CJNA 2OVLA 3S2NA 1E9YB 2JE8A 3OGVA 3O63A 4J5NA 4IICA 1ZJAA 1TX0A 1UCWA 2CZFA 4GWEA 4E2VA 4IG2A 1UB3A 1N8FA 3VO0A 1OY0A 1S5MA 1B3OA 4X9SA 1OCNA 2DJXA 4AC1X 2XIQA 1PXGA 1W9UA 1OG6A 2WWCA 3NQ2A 1FTXA 1PDZA 2E5DA 4QISA 4QJ1A 4AIOA 3WD0A 3FDKA 3DFHA 3Q4DA 3MJMA 3UXLA 2IKJA 1SSGA 1KO0A 1I6NA 3BAKA 3IGSA 1PHQA 4REQB 4HZ6A 4L4PA 2E09A 4HPHA 2QPUA 1BXCA 1LP6A 1QOXA 4BY3A 2Y2KA 1YKWA 1LQAA 1UD8A 3UA3A 1KM1A 3E0VA 3WK2A 1UA7A 1O60A 3CV2A 3S8HA 1Z7AA 3HPXA 4PCFA 1XRFA 1W3KA 1J96A 3LLXA 5BRBA 1RD6A 1JL8A 2OQLA 2H90A 4YYFA 3AIVA 2ZUWA 3W2LA 2EPMX 1E0TA 5H6HA 3IJDA 4QDMA 3IAQA 5LGZA 3KVLA 4ZZ9A 4WEVX 3GHTA 1W1PA 4O19A 4LVAA 3IUHA 4G1KA 3LRMA 2XVNA 4S38A 3M7PA 2QCHA 3QKEA 3W27A 2ISVA 2VR4A 3KCJA 4PN2A 3PANA 3MW7A 4IUOA 1BYDA 2ZRZA 4W86A 1AD1A 1MW3A 3VIHA 4D8LA 3KOYA 3W7CA 1PX3A 3EX3A 3B4UA 2BXVA 4IFKB 3GC2A 4MF4A 4FLQA 1ZFJA 4N9EA 4UNLA 3QHOA 5BWFA 1VF8A 1LOSA 4GK8A 3NOYA 2FGLA 4XAPA 3BPWA 3OTRA 3U5YA 3UU0A 1Y8BA 1ISXA 3QLDA 5AC4A 1MFVA 2HVNA 3NQGA 2VDIA 3K46A 5HA7A 2PLKA 5D2TA 3IJLA 1VGAA 4KGJA 3H4WA 3ENLA 1IV8A 3GVGA 5G5IA 5DFAA 2FB3A 3DFQA 4XZHA 1MW2A 4QM1A 4RCXA 4Q7NA 3GIPA 5J04A 3CYJA 1SJAA 1XLKA 3GXPA 3WLKX 2Y5EA 4G2DA 4M0XA 3S5SA 3KTXA 3WLQA 3ZLGA 5CEWA 1AH4A 4C6KA 3K4DA 4OVXA 4Q8NA 3VILA 4H9TA 2VRKA 3R8GA 3PWAA 2G4FA 2VYOA 5I7GA 4MUZA 3B0YA 4U5KA 3S9ZA 1Q8JA 1QDSA 1O4UA 2F2HA 2VKZG 2XGZA 4YTSA 1H7RA 4DUWA 3VAVA 5BNKA 3KZSA 2J4GA 2OO6A 1DHKA 4X0NA 3BJFA 4Q8QA 1XLIA 4I5XA 3L23A 4HJFA 1J0ZA 5E93A 1XX1A 3W85A 4X9YA 4PYSA 1UBPC 1SMAA 1ZPTA 3UPMA 1HJWA 1IEIA 1C3FA 4LNCA 5AECA 1TWIA 2D69A 1EJRC 5A8MA 3GFXA 2J8TA 1E1EA 4XK2A 3SGZA 2JGYA 1PUDA 4U2ZA 1M65A 2BHUA 4XZBA 5AYBA 2RHGA 4QCFA 2WMIB 1J6OA 4ATLA 3KTSA 3H6OA 4NXSA 4IGHA 4MKVA 3KOFA 3TTSA 1Z44A 4D72A 3MCOA 1EJWC 4WDUA 1KW1A 2PB1A 1Y0EA 2Y89A 5F2GA 1B3WA 5REQA 1LRTA 4LAMA 4IIBA 4X3ZA 3LD5A 3VZYA 2CKSA 4B5TA 4QITA 2QR6A 3UA4A 1CIUA 3UR8A 4QEHA 3UNTA 2A7PA 4Y9NA 4V2XA 3UGRA 4B90A 1V93A 1B9ZA 3P8IA 3SURA 1CGXA 3C8NA 3ABQA 5XIMA 1R9XA 4PMUA 4PEKA 2QXWA 1DJIA 3ITVA 4AW7A 4A2RA 1JCYA 3W1UA 4YS1A 1MDRA 1JG9A 4NX5A 3VMPA 1OYAA 1EJUC 2QCNA 2V3FA 2WPGA 3HV9A 2Y8KA 2CZDA 5BXPA 3GUWA 3F4CA 2FZDA 4L4MA 1ZNNA 3EKLA 4GY7A 2I56A 3UJFA 2I14A 1T8QA 3B9NA 5FEWA 5CZJA 4FLRA 3U7BA 3H12A 1YXDA 1VQTA 1VB9A 4OBTA 4AX6A 4FIQA 1W5NA 1FWEC 2QS8A 3QXBA 3W9ZA 1YXYA 4IX2A 3VIJA 3QV6A 4W84A 7REQA 4FP1A 2WM1A 3FEQA 1U5JA 4L9ZA 5AC8A 4MFDA 2WM0A 4AD3A 5I3GA 3P82A 3NTYA 3KL0A 1JDCA 4IQLA 3T7VA 1SMDA 3H21A 2C13A 3W7KA 3EEZA 4K36A 1T40A 3F1QA 1OFBA 2YBTA 3QMSA 3ARSA 4J2PA 2GQ9A 3NYZA 4UTKA 2ZZ4A 3HV8A 2HQAA 2XD1A 2XIMA 1ZJBA 3ARPA 3ZMRA 3B8IA 3ITYA 2P5NA 4C65A 4J3UA 4XX6A 4E4FA 1UH3A 3DG3A 1R0MA 4XZWA 3WBAA 4M6PA 3T44A 3CTTA 4I5RA 1NFBA 2ACUA 3I4EA 4DELA 3EZ4A 1GHSA 5T9CE 1XLMA 1V3KA 2J7EA 1HUVA 3TSBA 1GZJA 3UCQA 1M7PA 3HOJA 1CLXA 4RL3A 1YU2A 3LPPA 4FOUA 1QTWA 2DORA 4LVDA 1EBHA 1N82A 2ZXAA 2WC7A 5CPQA 1R5YA 3EWCA 1TYGA 1V02A 1KXQA 1CB7B 3EA1A 4HA4A 4LJ3A 4U31A 2IQTA 3PAJA 4Z1CA 4JX5A 4UTFA 1S5VA 1P43A 3W24A 2YZRA 1WOBA 2GLKA 1C8YA 2X1IA 4OJPA 3WLNA 1CXIA 3RYSA 1GVEA 4LOCA 1F7BA 2AQOA 1WYIA 3BGJA 4A8NA 1JDEA 4QE1A 1DVJA 5HBFA 1R3SA 4ZENA 2IUZA 4AEFA 3NO1A 2WW5A 3H24A 1KA9F 1I2QA 3TYCA 1OGSA 3QSTA 3B0UX 3E5PA 3LM7A 3QYSA 3P8JA 1KFJA 1TPH1 4I6KA 2NWRA 2Y8VA 4KFOA 1BWVA 3LPGA 4E2OA 3N2XA 4WDWA 1EEPA 2CXEA 4RUBA 4AYSA 1J0IA 2QCDB 4KRUA 2PFHA 4AB4A 3WLOA 1W5OA 4GVGA 3RO6A 3AICA 1KWKA 1TPVA 3HFTA 1TCDA 3T0TA 1DOSA 1TWDA 1GOKA 4UTWC 2AKZA 4A8IA 3RG6A 4JNYA 1H1NA 5EU9A 1KBLA 3WH5A 1SO5A 1XCXA 3WJZA 1S2WA 1EWEA 4PFHA 5E0FA 1IEQA 3H8AA 4QJ5B 1XDMA 3CXOA 1U83A 1ZHAA 3I4KA 3GQYA 4MNKA 1GWJA 1KKOA 1GOOA 1WDDA 3VD3A 5A2BA 2ZA3A 4NJGA 3UG5A 1JYNA 3QVQA 7A3HA 1XXXA 4ZOBA 3WD3A 1UD4A 1ESWA 3PB2A 4IIEA 2PCQA 4ZFCA 1V3IA 3RILA 5LSMA 1J2BA 2O55A 4INFA 3FVMA 1GGOA 3O6AA 3CK5A 4EPEC 3GG1A 4J1OA 3T8QA 2J79A 5CCZA 3VOHA 5JH2A 1CGWA 4WDTA 1ONXA 1AJ0A 1QMLA 1U1UA 3AUJA 4A21A 1LBMA 4XVDA 1VYPX 3ZO9A 5F4XA 3BK0A 2Y0FA 3AJXA 5H8UA 1XIIA 4CQDA 4EXQA 3VMOA 4K7VA 5KTLA 1KR1A 1HW6A 1W31A 1X1NA 3ZIZA 3LY0A 1YTKA 3B4YA 3Q94A 3C0QA 4P7OA 4KWWA 4MZ1A 2YL8A 1FRBA 2NVDA 4AUBA 3DHUA 4CCEA 3H7RA 3TFXA 1ISZA 3PZUA 3E02A 4HSOA 4RE4A 4EPDC 4ZB5A 2BOEX 3NAVA 3ZJKA 4DNHA 3NFUA 3WMLA 4V1XA 5FEPA 1TRDA 4Z2IA 4EF8A 2WLYA 1OG0A 3T9PA 5AHEA 4H9XA 4U10A 1IWBA 4IBIA 1OSEA 1V0LA 4QQUA 3QQ1A 3Q67A 1PB0A 3OLGA 1XG3A 3WNPA 4GUJA 2D0HA 5I24A 2AQVA 2NXHA 5G1MA 3IWPA 1E0VA 2D23A 3W6LA 1HQTA 3LXCA 3DFNA 2Y2OA 3FHAA 1HX0A 2PP1A 2V5KA 5HWMA 1JDDA 3IGHX 2Z00A 3DENA 2OYLA 1CXEA 5AHLA 2ZDRA 3GVRA 1LF1A 3JS3A 1G7UA 4S3DA 4QLKA 4BF7A 1UZHA 3NO3A 3PULA 3POHA 3KBSA 3O16A 4Q4QA 5JIWA 3EA3A 1E51A 3VPLA 1AW1A 3U6WA 3BCFA 3VNLA 4QXIA 1EDGA 4B5NA 1M7OA 1G4PA 4ROQA 3KBWA 3QPZA 5H1WA 3ZSSA 3L0KA 4R85A 3FFSA 5CLWA 2YA1A 3L0GA 1KCXA 5HUOA 1CGVA 3ARUA 1HGYA 1LOQA 3ELFA 5DBUA 4D6HA 1CXLA 1ITXA 4MB5A 3EXRA 3BV4A 4B5VA 2WMFA 2ZC8A 1VS1A 3VGFA 2ZBTA 2FHBA 2W0UA 5BOEA 1ECEA 1KFWA 4QDPA 4ZSTA 3LB0A 4Z42C 3S2CA 4WY0B 3DESA 3HN3A 2WZTA 1FH7A 5D32A 3TYZA 2DSUA 3LPFA 5KEZA 3G1XA 4DUXA 1QO5A 2V9DA 4QLJA 3TH6A 1B3XA 3NGJA 3WLPA 3DC8A 3UZJA 1V0NA 1DQUA 2TMDA 3E0FA 1HG3A 2DSWA 3TSDA 4B15A 3CO4A 4ORMA 2XU2A 3CTLA 2YLLA 2QYGA 1DXIA 3SRDA 1QPOA 1UOKA 3R8HA 4N42A 2YPIA 2QUVA 1M41A 1WXYA 4IBJA 1FWCC 3CC1A 2PS2A 3RAOA 2X09A 6TAAA 1ITQA 5E0KA 2Y2HA 4JQ3A 4MNJA 5G4HC 3VNKA 5LIUX 1RCOB 4DF0A 3U2OA 3WEOA 3QGKC 3GM8A 2X1TA 4WZHA 4Y7EA 3W1QA 4JTUA 4B5WA 4H1ZA 3SQSA 5DMYA 4E4UA 4LC6A 4P5UA 3O2LA 2DIKA 4PUEA 1NOWA 2PMQA 2CIPA 3W7QA 4LRSA 4EWND 2E9LA 1G67A 1D7KA 3GDLA 2PGFA 5M2FX 4JFUA 4N02A 1XW8A 3S2JA 4TR9A 1HKIA 3MUXA 4Z0JA 4MYXA 1Z41A 2A3LA 3OVGA 1R3YA 4M6UA 2PP0A 1S5NA 1A47A 2HJPA 3HGOA 1Q6QA 1U2YA 2R1NA 1W32A 3W84A 4HNTA 1ZAHA 4MIMA 1E4NA 3L4ZA 4R7OA 5CH9A 1JQXA 4IFKA 2F6KA 3ARWA 1UW9A 3CMJA 3I6TA 1RAKA 2Q8LA 3TLQA 5U4NA 2GJLA 4RZ6A 1TZ7A 1HKJA 2O56A 2XIOA 4L65A 3DBPA 3IGXA 2CZ5A 2F38A 2JE5A 2FPTA 1EYWA 3R58A 5BXSA 2ZZ7A 3BICA 3W2UA 1UKSA 4DZIA 3LERA 3VNZA 1JZ6A 1JR1A 2BG5A 4UMCA 5DEZA 1OT2A 2J8GA 2V63A 2FZNA 5CQ1A 3PZOA 5LNVA 4PMZA 1E72M 5FEXA 4BA0A 1OFOA 1QNSA 2A7RA 2DDXA 1JYWA 1RBLA 3NJ3A 2NQJA 4C91A 4IMEA 4XO7A 3SY1A 4EPKA 1SO6A 2Q3RA 5DCEA 5M1TA 1E43A 4Q8TA 1Q4NX 6REQB 2PDHA 4IP7A 3VIKA 1P1MA 3EDFA 4JFTA 4HU3A 4DYKA 1BAGA 3PFRA 1VJZA 4IOTA 3M6DA 4O12A 4ZE4A 2VEPA 4S3EA 3PFMA 3BMXA 2Y7FA 1HT6A 4HB7A 3CQ0A 4PMQA 4JYFA 3G1RA 3CMFA 2X1SA 1JZ2A 5DXYA 4TIMA 3WJWA 4PUKA 1NOFA 2VP8A 3WMCA 4GQRA 5E09A 3WYZA 3ABXA 1LG1A 2XIJA 4GC3A 5XIAA 1T41A 1UQZA 1W1IE 2R6OA 3Q45A 2J9ZA 4GY0A 3KDOA 9XIAA 1VJSA 1REQA 4WHBA 1S3TC 2E77A 3P60A 4QFUA 4XIAA 5HQLA 2P3EA 1OK6A 4S23A 1EXBA 4GHAA 3WDIA 4MLRA 1J01A 3VOJA 1V3JA 2WCAA 3VD7A 4JDYA 3WQ6A 1JYVA 2CLHA 1PYMA 4LUTB 5F1VA 4BFAA 3GDRA 1XIEA 5CKSA 3M44A 4GYPA 4J2MA 3UW6A 4TX6A 2FFCA 3FDGA 1TR1A 3TWBA 1J2WA 3BAWA 1NIUA 4R88A 1BLIA 2IMRA 3SFKA 4Q7BA 4W5ZA 5CBIA 5A2AA 4E8CA 3LI1A 5EGRA 1UASA 3AALA 3QR3A 3D5HA 1A0CA 8XIAA 2YBUA 4GYJA 1QUMA 3MKVA 1U33A 2CLPA 1EJVC 3HIJA 4MY8A 5JQ9A 3IIOA 4ZSUA 1DWJM 2FFFB 2SFPA 3MKCA 1EP1A 1D7FA 2J88A 2XWDA 1XLEA 2HBXA 2PDLA 2UZ9A 3V1PA 5MF5A 1W9DM 1DEDA 4DAFA 2V2HA 3TMQA 1M01A 1L0PA 2VO5A 1YHTA 1E6XM 2E6YA 4H9ZA 4IJEA 3P0WA 3GD6A 3L66A 1EPXA 1VR6A 4CN4A 1SGJA 2C0AA 3KCLA 1XYAA 2YXGA 1AVAA 4GI4A 5DXXA 3O0FA 3V36A 4HU0A 4XD6A 3N18A 1OVDA 3M47A 3MI2A 5D2VA 1NFGA 4QS5A 1OF6A 3M4HA 3UYCA 1KM2A 5U7SA 3CZEA 4N2YA 5K4ZA 4ZQRA 4V27A 2RJGA 3HGJA 1DQXA 1ODUA 3DUGA 4B91A 5HOSA 2PU0A 1KM6A 4UFHA 1LYXA 2BODX 2Y88A 3WK1A 3LCXA 2Y1HA 3P3BA 1GONA 3GSMA 1C7TA 4WY0F 4ZTXA 1V03A 5HUPA 3TQKA 1UBSA 3ITXA 3FYPA 4LTSA 4NRRA 4QX4A 4Y2WA 3BQ5A 3RF9A 3U5UA 2WJDA 3N12A 1E5NA 1H5VA 1HKWA 3N2BA 2DVXA 2PURA 1F3WA 1ZCOA 3MP5A 4YWSA 2CLIA 4NJKA 1MXDA 2NUYA 4UMAA 3OZOA 4NP7A 5I5RA 6ENLA 1VRDA 4AZCA 3M5XA 1HKMA 3OBKA 1UWAA 3PNUA 4XKYA 5CC3A 1N8WA 4DWDA 4YCOA 1Z69A 5FF0A 1FWFC 4M7SA 4MMWA 1H49A 3DFOA 3UWZA 1C93A 1XCWA 3M1ZA 3BCDA 1I0DA 4IHCA 4HCHA 4GCAA 2BY0A 5HR6A 4PBFA 2J7CA 3GE7A 3HA1A 3N6QA 1O7AA 1KRBC 3EXTA 4EF9A 2JCHA 5D02A 4WDXA 4E2BA 1G9HA 3WBXA 3QN3A 1OFQA 1ZGDA 4LUSB 3HPAA 1PCKA 3M43A 2D0FA 3ORWA 3UCDA 4F0RA 3L12A 3SW6A 1Y7VA 3I7RA 5EY5A 1GZ1A 1FH8A 1R86A 1YPFA 1FWRA 4PMYA 2A0NA 4L7ZA 2Z24A 3VDHA 3GXIA 1VFMA 4OU1A 5AYYA 4ATWA 4PC8A 3ARQA 2QCCA 1NWUA 4UNIA 4YU1A 3RMEA 3C61A 4I8DA 4EK7A 1TZZA 6XIAA 9RUBA 1P0EA 2JIEA 3D3FA 1WZLA 1R6WA 1OFRA 3AAMA 4AF0A 1TR9A 1M53A 4BZYA 2KZHA 3G5EA 3DCPA 4GVFA 2CLFA 1HGWA 3TW7A 4IBCA 4C7FA 4LBRA 2JKPA 1SU5A 3N4FA 1S1RA 2XN2A 3AZSA 1PZ1A 4JN6A 4LB4A 3MS8A 3KTCA 1WAWA 4QG9A 3ICJA 4Q8VA 2OYMA 3ZSTA 4WR3A 4UOQA 3BW4A 2RH9A 3GH7A 5PTDA 4QE5A 1E3XA 2QDHA 2D49A 3GTXA 3VM5A 4GJIA 5CBBA 3RRXA 1DPMA 1W9BM 3H53A 4JEJA 4HBKA 2I5QA 4LUSA 3OVPA 4GY1A 5EBAA 1NP0A 4S3CA 4CU6A 2PF0A 4KETA 4FXFA 1SSDA 3GU9A 5AYXA 3TFCA 5E5CA 4N4PA 3NL2A 4ZEPA 1Q7MA 4G9PA 4L9XA 2GOUA 4HNLA 5FAJA 2PWGA 3UZYA 3M5YA 3WK0A 3V5OA 4GYFA 1I9CB 5DO8A 1E6PA 4RDWA 4ASTA 3EPNA 3QPYA 4U3AA 3IUDA 8TIMA 5JUVA 2F61A 1VHNA 4AF0B 1XUZA 3AIUA 1Q6EA 1LBFA 5AC7A 5AHFA 4I5UA 4UQCA 2GSHA 1EQPA 4MPKA 1MDLA 1C91A 1RA0A 3FW6A 2E8ZA 3PG8A 3AU2A 3QR0A 2YCLA 2XH4A 4ZQCA 1C9DA 5LKYA 2OT1A 3LK6A 4IMFA 4RV8A 4UCFA 1US2A 1XRSA 4NRSA 5A2CA 3C2VA 2IPWA 1P6BA 2YCKX 2Y2IA 4AZ5A 3ANYA 1SFLA 4CCDA 5C7HA 2FTWA 4NJHA 3QHNA 3WEMA 3U4AA 3I68A 1CEOA 3ONCA 2EPHA 3PNZA 3OYZA 4AFYA 2FKPA 4RXGA 1EJXC 3LA4A 3E74A 2VEFA 3VIFA 4AWTA 4LVBA 3REQA 1H51A 1ITCA 1FWGC 2J7BA 4F48A 4GLEA 3RNDA 2Y4SA 1TTQA 5FCZA 1PTDA 4G7EB 1DTNA 3I10A 3HGRA 4GQ0A 2OQHA 2Y2WA 1M03A 1FQ0A 4GBDA 1MO0A 3S42A 2WVVB 3CM4A 3MZ2A 1RBOB 3S6OA 5F2IA 4RDZA 4XZNX 1IWPA 2NZLA 1W91A 3KHDA 4J3ZA 4AU0A 3LCIA 5CGMA 3XISA 3WNLA 1EIXA 4TU1A 7TIMA 2PA6A 2FZ8A 4PCSA 4FX8A 1HFBA 4TMBA 5GPRA 4FXJA 2PWVA 3GZ3A 4ZQPA 1F3XA 3PBMA 1K03A 1FCUA 1Q6GA 5EYWA 4DRSA 1TO3A 4D6GA 3B8SA 3LHWA 2XG9A 2VFDA 4RDVA 3AIEA 5KITA 3W22A 1GXDA 2PCEA 1KWGA 1XQLA 2VCBA 4JTFA 4AXKA 5DQPA 1IXQA 5FJTA 5G4WA 5HK4A 1BWKA 3DHFA 3NVDA 4G1NA 1O1HA 4KS0A 4PA8A 3AXMA 4O0QA 3PBGA 3OLDA 4DJFA 5FOOA 1KM3A 4ONVA 3W1NA 7TAAA 4UTJA 1YNYA 3SCTA 2V30A 1W3HA 2BMBA 5I3KA 1NQ6A 3WNKA 1QO2A 5CPTA 1C8QA 3SN0A 3NZPA 1NSJA 3V5FA 2WZHA 3W73A 3KFTA 1L6FA 5C2XA 4NVTA 2WKGA 2PDKA 4WD0A 4GCXA 2O4QA 5HDRA 1A5UA 5L6UA 5EMUA 1EZ2A 2GWGA 4LEFA 3BVJA 5DF0A 1UPPA 1TKKA 4RNHA 3BAJA 1E3ZA 2DT2A 2QCGA 2ISFA 3W37A 1LDCA 4LV9A 3EDDA 1EJSC 1O6IA 2E5CA 2NQLA 2WQPA 3UWUA 5DBTA 2ZUSA 4X2PA 5D9MA 2Y85A 3U2EA 1RK5A 2HPMA 3VZXA 2AKMA 3GTHA 1PE1A 3B8UA 2UY3A 3OP2A 1TA3B 2Y2QA 2XGIA 3FKEA 3EX6A 2QJJA 4JIIX 4GHRA 4WSJA 1AL8A 3WLLA 1LZOA 1NU5A 2Z1WA 2OG9A 1GQJA 1KFBA 1KLYA 5C9WA 2PDPA 3F2DA 3EPOA 3VK5A 3RPTA 4LV4A 4DJED 1XL9A 1Z9AA 3AWNA 3TZNA 2DUXA 1FHUA 2OZ3A 2ACSA 3GVVA 3STPA 5LNRA 1QNQA 5BXTA 1VD6A 4MDOA 1GOIA 3AHXA 3AYRA 3NYDA 1GVYA 3FJ4A 3BXWA 4AHQA 4QJ4B 3QY8A 2JALA 4MZ8A 2PGWA 1UQYA 1WPCA 1YE4A 2ISSA 2PDNA 1JZ8A 2QJGA 3OIHA 3NO5A 4DBUA 3HURA 3W6MA 4M5PA 3BG3A 1FWBC 2PWFA 3UWWA 1KD0A 3ZJ7A 3CWOX 4GIEA 1PAMA 2XM1A 3TWAA 3HMJG 3FAWA 1WUEA 3UY8A 2GGHA 1R9YA 5I0DA 2VEKA 4L1GA 1JZ4A 1JI1A 3R43A 4BWLA 1TJ1A 5C70A 1IT7A 3EMCA 1ZJHA 3CQJA 3R8RA 6PTDA 3R5EA 4KFNA 1UJPA 3KVMA 4JTTA 4MHBA 3EKZA 2PTYA 2PDWA 4NSBA 2VZSA 3DYPA 3QR1A 5CPOA 2Z25A 2QAFA 4P8UA 1NWSA 4FX6M 4IZGA 2B7OA 2FH8A 2ZOXA 4ZOEA 1GVIA 3MSRA 4AMAA 3C86A 1WKDA 1ZUAX 1T0OA 2NXIA 1PHWA 4IIGA 2ZRWA 1PX4A 3BOFA 2QDDA 2PD5A 3BAXA 3UYIA 1AMKA 4ENLA 1V79A 4GPNA 1YDOA 4ZCWA 2WSPA 2XINA 5EL1A 3DI1A 2G5WA 3WUEA 3AMDA 3KWXA 4EP8C 2BNJA 1E4MM 1D3GA 3WL1A 1TVLA 1EOMA 1DP0A 2GGEA 2IPFA 1GVQA 1TZ9A 2DSZA 1EH9A 3UG8A 1CPUA 1UR9A 5IBXA 5C55A 3W1LA 1A49A 2HS6A 2WSQA 4FNPA 5T91A 3S4TA 3M7WA 4EANA 4YMZA 3B06A 2JF7A 4AZ6A 4IJFA 1RP9A 4NJJA 4NQ1A 3HF3A 1UKPA 3T08A 1P0KA 4PTDA 1TG7A 4L9YA 3T8LA 3R2GA 1RQBA 2ZTJA 2B7NA 1D8WA 1GG0A 3WIJA 4BQ4A 4E8GA 4WX2A 3QQWA 2RKXA 4BKNA 2V3DA 1OHLA 3STGA 4NZ3A 1XRVA 4QIUA 5EB8A 4PMXA 1JF6A 2ALRA 3QW4B 4FXSA 1Z89A 5D05A 4O57A 1SFJA 2OPJA 3ATZA 4AD4A 3GY1A 4UQEA 3LLFA 2C91A 2CFFA 3ISIX 1F3TA 1RJRA 4CQCA 2AMXA 2EG8A 2ZADA 4RXFA 3SRHA 3U0HA 2BXZA 4WOQA 1ITUA 2C0HA 4JHMA 5A6MA 1R2SA 3N14A 2EO7A 5G4EA 3E2SA 1L2QA 3WELA 3PG9A 2A6NA 4UMBA 2XWEA 1J0YA 1E5JA 4GKLA 4POCA 4OTKA 3E2RA 4F40A 3SBFA 3C6CA 3L0NA 1GQNA 1X7FA 3VKDA 4HA3A 3AHTA 4NF7A 1IIGA 3LN3A 5HMEA 3BZJA 3GW3A 2WLZA 2X8RA 1CTNA 4L56A 1Y5WA 4KEZA 1XWYA 2YJQA 2XD5A 1BXBA 2ANUA 2O7SA 2PAJA 3OOQA 3TK7A 1B3YA 1BYAA 4HT3A 4PE8A 2UWFA 5DN1A 3NXFA 1XLBA 3FY1A 1WZMA 2W3ZA 2VX5A 1MYRA 3TU9A 4LW7A 1E88A 3GG7A 1F6YA 1S2CA 1BGGA 3N6HA 1VYSX 5JBFA 2AQWA 2VENA 3BV7A 3M64A 4HMEA 4LF1A 4C6CA 2NQZA 4HU4A 4A05A 4E4PA 4HA0A 1V5XA 3TJXA 3CIVA 4GINA 1GOWA 2C16A 4N6FA 4W8LA 1LL6A 5FI8A 1W5PA 3SR7A 4ACZA 4K1WA 2CW6A 3QFWA 1OZQA 3P5YA 1GKPA 1KBIA 1EA9C 3T6CA 3B03A 3TSMA 4UTLA 4DJFC 3MB9A 2F6UA 1VENA 4F2UA 5AKQA 1XRTA 3PUGA 3ZVHA 4URIA 3BLKA 4BI7A 3UFYA 3SUWA 4U2YA 2ZX9A 2VZOA 3HSHA 1BF2A 3T2PA 2CLOA 4ADSA 3OZPA 4HPJA 4C1LA 2XFFA 4ZFMA 4IBFA 5EPDA 3V1HA 1OFDA 3TAKA 2H9AB 1XBZA 1H41A 5ECVA 2INFA 4MADA 1R3VA 1UOZA 1J5TA 1PKNA 3XIMA 1P5BA 4PUDA 8CGTA 3BSHA 3E6EA 1B3ZA 2VXNA 4GGHA 5L9FA 1TJ0A 3THQA 1RHCA 2WVVA 4A29A 3KRSA 5I09A 3WENA 3K8LA 3P80A 1WKFA 4O0KA 1P0DA 3CUIA 2D3LA 1W6TA 2E9BA 2HV5A 1E1CB 2OT0A 2DZUA 1JFXA 4UTMA 1Q2SA 1FH9A 4WKHA 2GVLA 3OODA 2HISA 1CGYA 2DGAA 3DIPA 1S2AA 2PZNA 4US6A 4XTIA 1JULA 1DWHM 4JHOA 1A3HA 4ZE5A 3VIOA 1RQHA 3W1MA 1RCXB 1M9HA 4YL2A 4WIWA 5ABFB 1IXOA 1DWGM 1BYBA 2E25A 3CUJA 1K9FA 1FUYA 3DN5A 3PTDA 3R1ZA 2Y62A 3DHPA 3GKAA 4QEEA 1MWOA 1B31A 3ZVHB 4PZVA 2POZA 4DHGA 2TRSA 3PY2A 1XISA 1FWNA 1SZFA 3T81A 5ABTA 4I9JA 5CC5A 4OUEA 5AHIA 1TTIA 2HVOA 1W5MA 3QZ6A 1IIHA 6REQA 3BE7A 5E9XA 2VQUA 4J3SA 2QAPA 2Q6ZA 3BOXA 2YCEA 2V8ZA 2OJPA 3FYOA 4YWIA 1RP8A 3UETA 5C9RA 1H7XA 4GG9A 4Q4PA 2YZ5A 4UFJA 1MI3A 4H9UA 3RCNA 1NAL1 1KV8A 2FTYA 5F7UA 2PUZA 4EVZA 3UR2A 4MY1A 2F7FA 1IWAA 3IPWA 2BHZA 3HM7A 3QKZA 3BJSA 1K8YA 5CPLA 3SSJA 1EO5A 3DC0A 2ZX8A 3LSBA 3MBDA 3MMTA 2YDAA 1OYCA 3LHVA 2OWXA 4U28A 3TA6A 3FXYA 3ITCA 4GYKA 2OGJA 2QGHA 1P7TA 4O28A 3IRDA 3MMUA 3P0XA 5EMJA 1MVYA 4NHVA 4H6RA 1WQ5A 5D2YA 4HK7A 1ZENA 2W5FA 1UP3A 5HQEA 5HNRA 1J8VA 3C2OA 4AWUA 3MUZ1 2R94A 4NKCA 3B3DA 3LG3A 1VZWA 2C15A 1FWDC 4DYEA 4XAGA 3VOIA 4BS0A 3MWAA 3DHDA 2X1UA 3HQNA 2IW0A 3CV1A 1H50A 2QVHA 2QDEA 3TZFA 4BQ5A 3GU1A 3FS2A 2YA2A 2F6XA 2NT0A 1SJBA 4Y6GA 2PDXA 4K2SA 3MT1A 4N0RA 5T26A 1BTMA 3E38A 4IX0A 1CW2A 5AHNA 4HNUA 3E0IA 4I7WA 4M51A 3CZGA 4UR9A 3SEPA 4OFCA 4PFMA 1PDYA 2YL9A 2O9PA 3KRZA 5DMLA 2YYTA 1S39A 2EXOA 3KS8A 3GDKA 2QIIA 2XUCA 1B4EA 1Z48A 3RR1A 3P6LA 2YX0A 4ZMGA 1UD2A 1DWAM 3L5LA 2XFYA 1TX2A 3KOXA 1BWLA 1M04A 3GBDA 4S3JA 2B7QA 4HOXA 1LG2A 4XWUA 1VLWA 2ZRVA 3VD4A 1RD5A 2NV1A 8RUCA 5F1UA 1GQLA 1OM0A 5IHRA 3NQ8A 2VDHA 3KRUA 1PIFA 1TIWA 1ZP3A 5BW6A 4PODA 3E0WA 1R9ZA 5HNTA 3GNDA 4KPLA 1EJ7L 2OR2A 1O5RA 4F2TA 4JTIA 4ZO6A 2Z6IA 2O9TA 3TYEA 2WMGA 5D04C 4US5A 2XIBA 2ONEA 2ZX6A 3FA4A 3B9AA 3WD1A 3S1VA 2Z7GA 3STCA 3JR2A 3WEZA 3WF3A 3MDWA 5FJRA 4ZQOA 3ZFHA 4PMJA 3RO8A 5DRIA 2F9RA 2J47A 3CEPA 4J40A 1ZP4A 1YDYA 1AQHA 4B4HA 5I3IA 4HHPA 2FTPA 3W02A 4WRHA 1A5LC 3EGJA 1W1B1 1UWIA 2P1FA 3MU7A 2NQ9A 5LXEA 3QC0A 4LH8A 3VCRA 3WNNA 3WFAA 4GZIA 1KB3A 3I3EA 5TAOA 4PSRA 1TWSA 2R9RA 3EWZA 2QCEA 2PWEA 3C5QA 4D8ZA 2VELA 3LOTA 4TVDA 3TA9A 1Q7ZA 4ZQMA 3N73A 2DSKA 4MWAD 1PWLA 2QJIA 2JK2A 1AJZA 4RE3A 1W0MA 2OZ0A 2F8QA 2E1WA 1L2UA 2AL2A 2AGTA 1OF8A 1S5TA 4O52A 4NZ5A 2DQXA 4JTDA 3WQPA 4TVCA 4QLLA 4ZA0A 4GA8A 4DPQA 1DWIM 1FHDA 1VP5A 3A21A 4GUFA 3GTNA 3NDYA 4LVFA 2ZCGA 1SUXA 3M7SA 4H19A 4L4LA 3UQNA 3NZGA 5AFDA 3PWGA 4KKXA 3TKFA 3TN4A 3ALFA 3FJNA 3B0VC 1FKWA 1EFZA 1XYCA 3DGBA 4LQ1A 3GUGA 2ISWA 3OBAA 1VPYA 2EPOA 4NXKA 2Z29A 2OCZA 4DPPA 3I6EA 2ZWYA 4KWUA 4JQ2A 3L5MA 3SCOA 3MZNA 3W2KA 2WZIA 5A5WA 1SW3A 3T40A 4Y90A 5CPNA 3RITA 3IJIA 3LHYA 4DO7A 4ZB0A 4U4MA 4GXPA 3WDQA 5AVHA 2D2HA 5D9PA 2WJFA 4IT1A 1XIFA 3URNA 3P93A 2XH0A 2YA0A 2CETA 1FKXA 3UJSA 2Z28A 3VNMA 4QGCA 1RSCA 2OWCA 3DX5A 3PS7A 1EBGA 2PLCA 2IPJA 5AZ1A 2OGYA 3NURA 1UWRA 1JZ5A 1VEOA 1U5VA 2R8WA 4HKPA 2MANA 4PTMA 2VX4A 3RDKA 2FJUB 3NSNA 3VC5A 5G1YA 1NEYA 1OCBA 3QTPA 7PTDA 7CGTA 1G4TA 1XDLA 2CEQA 1HVXA 3E9AA 4PUJA 4RR4A 4DXKA 1UZDA 1ICSA 5AYZA 2PD9A 3SQLA 4L4OA 4WXZA 3VX1A 3V0SA 1PVNA 3BW3A 3EDJA 3GHRA 3PB0A 4C7GA 3IRSA 4NAFA 4TV6A 3L67A 3VDAA 3VC6A 1YNPA 2TPSA 5F2LA 2D2JA 1WZAA 3TQ0A 5CPSA 7XIMA 4HZ8A 2BX7A 3G1YA 4NNBA 3DAQA 4GFSA 5IFTA 2Y2LA 2VGIA 3DGRA 2O9RA 2BVTA 2J7HA 4BF5A 3VE7A 3W6YA 4JFSA 1H1YA 4CVWA 1XIBA 4K38A 1RY8A 2BSLA 4LYPA 4YVVA 4DM2A 5D9OA 1XKYA 3TOYA 4EE9A 4OECA 3G1HA 4MJMA 1GCYA 4A6GA 1LRQA 3GFZA 3T4CA 3CH9A 4HK5A 4E38A 2VFHA 2UY2A 2VTFA 3HPSA 3IJ8A 3R6IA 1GUVA 2D3NA 4ML9A 3TC7A 5A6JA 1JPDX 1KR0A 4FLOA 5EFDA 2GVGA 3B8VA 1SO3A 5I00A 3R79A 1BF6A 2ZUUA 4CN6A 1GVOA 4H8VA 2HE5A 1DKWA 1PJ9A 1V6WA 1LORA 1VFTA 3WLTA 3V5CA 5BYWA 2H3BA 3NOEA 5GVJA 1M1BA 1VLIA 4JKKA 5C2CA 1UIOA 3AS0A 3MQTA 2ZA2A 1SFSA 3H7UA 1X6UA 3GDTA 1GPFA 1M7JA 5FAGA 3N6JA 2QUTA 4DZHA 1Q85A 2GSJA 4O15A 2JIWA 1OC6A 2HRWA 3RU6A 3S5NA 3LEPA 5TQLA 4CD4A 1VBGA 2RGMA 3G3MA 1NP2A 4GI9A 1CBGA 1F74A 1DJZA 1T8XA 1ZU8A 3TV8A 3HG5A 4A8LA 4AEOA 3UP8A 1E4LA 2WOQA 3RPDA 2J6VA 3GDMA 2V5JA 3W7EA 4D9PA 4WKFA 4U33A 4ZO9A 2PDQA 1Q6LA 4YTRA 4QNLA 3EPMA 2DQWA 1E9LA 5CAKA 4OJYA 1P1XA 4I9MA 4MAVA 3SGGA 1TV8A 2PWHA 3HFYA 2A2IA 1O12A 2FH6A 3C0LA 1RA5A 3BANA 4LNYA 3A3XA 4AY1A 3I65A 3RLGA 4UTTA 3OIXA 3WQCA 2E67A 3M6YA 4BEUA 1G69A 5EMLA 1R8LA 2REQA 1GOXA 1H8PA 5TNVA 1QNRA 1Q5MA 1GEQA 3KP1A 2CPUA 1YPXA 2DZBA 3MMWA 3F4DA 1Q6FA 2OELA 4IGNA 2Y2JA 2ZICA 1XGDA 2J7FA 1YX1A 2GQAA 3LRLA 2Z1VA 1MQPA 4RJEA 5HJXA 5TIMA 1UROA 3O3RA 4F3HA 3BLOA 2ABBA 2VUNA 1OK4A 4UTUA 2V5LA 4JKMA 4WUIA 3G6LA 3W0KA 1J4EA 1NELA 2YL5A 1DORA 4CKQA 2QULA 2E28A 3CS2A 3P67A 3EX4A 3IANA 2NQHA 2VC5A 5C7VA 1REQB 3BC9A 4JQ1A 1NDWA 2YW4A 4FR1A 4QTGA 3EB3A 2QV4A 4IL2A 1PTAA 4N9DA 1EC7A 3NQAA 3A3HA 1AZ1A 2QNEA 4B3KA 1CCWB 1PIIA 3O07A 2QJMA 3S2MA 3RXZA 3WX7A 3UZWA 1HL9A 2WSRA 2XFRA 3TJLA 4KT2A 3H54A 1AUSL 2J7DA 4GABA 8A3HA 1W8SA 4J27A 3C2FA 5GNYA 1Z8AA 4IIDA 1J6PA 1HVQA 1RH9A 2VNCA 4JGDA 4YTUA 1AQ0A 1JI2A 1TPWA 4O1FA 1W5QA 4DI9A 4HGXA 2GOKA 2PPGA 5CGTA 2OMAA 4JTQA 3BTNA 3GC5A 5T8GA 5M5DA 4AMCA 3NPUA 4DM1A 2BV9A 3E0LA 4DEFA 1V77A 3GWQA 2ZRXA 3WH9A 1FBAA 1LOLA 2DJLA 3DFSA 1QFEA 1WDQA 3BURA 5BPVA 1V6XA 1V4YA 3IK4A 2G3NA 5FF4A 3W1AA 1QW8A 3MHUA 1K4GA 3S5YA 4XZMX 3CT7A 3FGCA 1A3WA 4I8YA 1XLJA 3A13A 1CYGA 2GJNA 2G95A 5LZLA 1L6WA 1R30A 4E3VA 1Q13A 2H3DA 4ZTYA 3QFEA 3RPMA 5KZEA 2XPKA 1IQ8A 2W79A 2PDYA 2WHMA 2A3CA 2PDUA 2X7VA 3WO8A 3UJ2A 4AZHA 3UZZA 3OVRA 2OLAA 4LALA 3GNOA 4Z2KA 4LAZA 1QI2A 3N2MA 4OQVA 2O9OA 4XSLA 1O95A 1UD5A 1LLOA 4H8HA 2C19A 1KRAC 1DTUA 1OCQA 1DJNA 4H01A 1EP3A 4HP5A 4W8AA 4UFKA 1KBKA 5FEZA 3WSUA 5A6AA 1I1WA 5AVNA 3OQ8A 2A1YA 5BXRA 4IGSA 4P8WA 4Y9OA 3NQEA 3C3NA 1MNZA 4FK9A 4DB7A 1XG4A 3KS5A 1ODZA 4IL0A 4TV5A 2CZEA 4AZCB 4PMDA 3M0ZA 2XGBA 3U7VA 3PPFA 3ZT7A 4GC4A 4GQGA 3TROA 1LROA 1CGTA 3AS2A 3G6MA 3AXHA 4HA1A 1FDYA 2BS9A 2GL5A 2A3AA 4R34A 3UWQA 4MFEA 4Q8UA 2WVTA 2RGLA 2ON3A 4C6JA 1WUFA 1KGUA 2VX6A 3NR0A 2YLAA 4XBKA 2ZDSA 4MPQA 2BG1A 1KFCA 1OC5A 3AZRA 4NT0A 4MJ4A 1Q7QA 2BHYA 2QV5A 5D8WA 2QIWA 4WCJA 3OZMA 3KBNA 4XQ6A 5HWJA 3E12A 4GNKB 2HVMA 4O54A 3THAA 1UP2A 1T96A 4H6KA 3J7HA 1XPGA 4HTYA 3PZ9A 2NVCA 3EWWA 2HK1A 2UY5A 1U5HA 5ENLA 2C8NA 3H2FA 1GVFA 1QI5A 4ACYA 2AAMA 1KV5A 1RPXA 1UR4A 1QNPA 4ZGYA 1YADA 4TTGA 4PTNA 1XD0A 1P0NA 3AROA 3L27A 4IMDA 4AD5A 4B2DD 4A35A 3URBA 1Q45A 5C6MA 3THUA 5EFFA 3OA3A 1UR8A 2OQYA 2NUWA 2ISDA 1PV8A 2RTSA 2KAUC 3GNRA 4GMEA 3LMZA 2Q02A 3TEVA 2BP1A 3CO8A 4PRTA 5E1QA 3W7MA 3AQUA 4AH7A 5M03A 3CL8A 3WQDA 2CERA 4UOJA 2RFGA 4QS6A 4AIUA 3POCA 4UB9A 4O17A 2IQ0A 3TR9A 4M81A 4OBRA 4P8XA 1EKOA 1TWZA 1AODA 4JR5A 3BLIA 4XZIA 1I8JA 3B9EA 1UD3A 2A6LA 5I02A 4AD2A 3NQBA 2UY4A 4MLJA 4HOWA 1E9ZB 3SUTA 3OQEA 3B9OA 5BRQA 3UXDA 1R7AA 3EX1A 5A6TC 3IVUA 4MDPA 2DFAA 2CESA 2E1DA 4GIRA 3RR4A 2BVYA 2PWUA 3EAUA 2ZIDA 5CJMA 1FCQA 3RLHA 4E6MA 2QJNA 4R33A 1CT5A 2XDFA 4IH3A 1H62A 4RDYA 4Q22A 4JNZA 4L6HA 3FIGA 1KNWA 4PMOA 1B2YA 3A23A 2D2OA 2Y5SA 3ID7A 4Z1BA 2GDVA 4MWAE 4H6EA 1EHAA 1FX6A 1EWDA 4PGLA 4Q6XA 3N9KA 3E3HA 3GHUA 1DJYA 4QNEA 2C14A 5ABFA 3O8AA 5CLTA 3TTOA 3W7JA 2V3EA 3WFLA 3OGSA 1V02E 3ZJ8A 1A53A 5LA1A 4PMNA 4WOZA 2OX4A 1Y5XA 5EMYA 4RNFA 3HG2A 3WUFA 2WCGA 1I4NA 2WO5A 1XQKA 3VI2A 4FF5A 3GG8A 4JIHA 3RX3A 4HYWA 4GZJA 5A6SA 2CHNA 4WF7A 1NJJA 2RDTA 2WSYA 4AC7C 3ONBA 4E0CA 3WDPP 3S5ZA 1ELSA 2R1LA 5D37A 4C5YA 1LT8A 4F8XA 2NV9A 2QDGA 3PSVA 5DT5A 2ZUMA 1A5NC 3BG5A 1QRQA 1EHNA 3TYUA 4JXCA 2AL2B 3RLUA 2XFWA 4M3PA 1QHZA 3W76A 4N7QA 3ARVA 4HJWA 1QW7A 3B05A 2PLJA 4Y9MA 3W72A 4IBDA 3MSYA 1BHGA 2XH2A 3ANVA 3W07A 1UWSA 1J93A 4ES4A 4KBXA 2ZUVA 3NG3A 4W7VA 3SY5A 3AUOA 4P7RA 2NQ5A 4HVXA 1HP5A 6TIMA 2X41A 2Q71A 4OJOA 1VFOA 4O11A 1UR3M 3NDZA 1E6NA 1H0IA 1M5WA 2QCFA 2J8FA 2E6DA 4JBRA 3WF2A 3REQB 1PEZA 3R4IA 4LAUA 3QZAA 4O1BA 1W54A 2ICSA 2P0OA 4UWMA 3O6YX 4AWEA 1U22A 4KESA 4Q32A 1CK7A 3SY8A 1FFQA 2QCLA 1GT8A 1J7MA 3IJ6A 4DWSC 3QGVA 3O15A 3EWBX 4HN8A 4AZIA 3EMQA 1BG9A 1PZ0A 2R1MA 1CNVA 1PKYA 4S2BA 2BZNA 2DP3A 2WANA 4JTKA 3UF9A 3AIBA 4B3LA 3ZT5A 1K8ZA 1PX8A 4MG4A 1LBLA 1KS0A 1YRRA 3H2NA 3EWUA 4CGTA 3KBMA 2O7QA 4UOZA 5E9AA 1T5AA 2HROA 3TQVA 4DWSA 2G50A 4DJEA 3KOWA 1JZ3A 4GNJA 1WCGA 3NWRA 1GW9A 4KFPA 1BG4A 2WK2A 4MJZA 3SI9A 4OJ5A 1JZ7A 1E15A 2WXDM 3R25A 3W29A 2VGGA 4CNSA 2CHRA 4PUMA 1TE1A 1XD1A 4IQJA 2Y24A 4X22A 1EIBA 1IT0A 1QR7A 4U3CA 1TRIA 1QPQA 5FA5A 1JCNA 1XICA 4JX6A 4JFWA 3S46A 4DAIA 2A3BA 1B0IA 4KIEA 4PTXA 2QZRA 3ES7A 1EEXA 4GNVA 2CWXA 2IKIA 3FHQA 1K70A 1TFVA 3PSWA 1PPIA 1X8FA 1PBGA 4CCZA 2W91A 1OX6A 2NUXA 2Z7KA 2P8CA 4C6DA 5D03A 4M1RA 1XUUA 3K1GA 5KINA 3KW3A 3BL3A 3ME3A 1XIHA 3A5FA 1XLDA 2WJEA 3CU2A 3LQLA 5FJUA 3VINA 4UQAA 3BAYA 1G0CA 1GEHA 3CGTA 2YW3A 3IIPA 4DVOA 1DIEA 2IXUA 1JCTA 1KCZA 2OKOA 4DWSB 4LAOA 4AD0A 4ATDA 1FDJA 5CZSA 3SCNA 4FX7A 3H26A 3N29A 4S3GA 4K8GA 3ZR5A 4NZFA 3WN6A 1EX1A 1H2JA 4GQBA 1YDNA 1VAHA 3ZWSA 3TC3A 3SCPA 3NQCA 5LGXA 4TTUA 1QI4A 2Y2MA 1CXKA 1SFTA 4IJRA 1VRXA 5SWUA 4O50A 2XIIA 3BAIA 3AHZA 1JDAA 1SPQA 5HPCA 4XO6A 1WDWA 3TW6A 2G3FA 4JCMA 2A85A 3RLVA 3WQ5A 4MAZA 3H2AA 3RJXA 2VX7A 1GNXA 1VFUA 1DXEA 2R14A 2G4JA 4HPXA 4HK6A 3UG4A 1WDSA 4ZL1A 1GOMA 3LI0A 3PTQA 2FGBA 2BB0A 1XLHA 3S6DA 5D30A 3U2ZA 1H7OA 3L4VA 3LZ3A 4Q8OA 1RK6A 1CWYA 2O4MA 2WMHA 1IEWA 4QG6A 3P81A 1W56A 2X0YA 4GX8A 4HSNA 4V28A 2PGEA 2PGRA 4J35A 1AQMA 2VMFA 4IF2A 1CLVA 3WNMA 3VABA 5LA2A 1HP4A 1UIPA 1IHIA 1E0XA 4XZ9A 1GTEA 3F4VA 5AC6A 3GU2A 1X6NA 4C1KA 4I9AA 3M0HA 3TCEA 3UVIA 5I06A 5BMXA 4XSMA 1O68A 3TC6A 3RCYA 4GOAA 2NWSA 1FCBA 2FFIA 2PLMA 3ARXA 3II1A 3RIKA 1EAKA 3NL3A 2YSWA 1J12A 1AQFA 5CSRA 5DT7A 1UG6A 1K9EA 1VBRA 1XP3A 3YPIA 1J0HA 3K1DA 3G2GA 2G96A 5AB3A 3E49A 2XVKA 2EPKX 2OYKA 3VIPA 4JN7A 4B4FA 1FWTA 4ERGA 4WSHA 1D2KA 1VPQA 2DZPA 2QUNA 2PEVA 2GGGA 1GJPA 2J78A 3MP3A 1YPIA 2P10A 2XTKA 3KVJA 4JY9A 5G2WA 3SAZA 4KERA 3STFA 4EXBA 1LQ0A 1ISVA 7ODCA 2YOCA 4FA3A 2WKLA 4AAJA 3IEBA 3VIIA 2VD8A 3H2EA 3F2CA 2WNQA 1V0KA 2YYUA 2ZXQA 5I3HA 5HPOA 4EAYA 1YBQA 5HJLA 1R3WA 1A0DA 2IKGA 3K30A 3UERA 1G7VA 5LXXA 1AH0A 3UWEA 2JEPA 4CD6A 2XSXA 4D6DA 4WSKA 1GOQA 1JPHA 3FVDA 1XIJA 4FXRA 4JS3A 3VZZA 2GVYA 2X0SA 3BMWA 2J77A 5FF2A 2MUCA 4ZR8A 5C9ZA 1VPXA 3KEHA 1GORA 3USBA 1E4IA 3MCMA 1YIXA 2Y7EA 5F2MA 1FWHC 3A4WA 3RHGA 3KBJA 1TUXA 4IBBA 1X7IA 3O1NA 3EOLA 2BVDA 5C54A 1JXJA 4QSHA 1A4LA 3UWYA 2FVKA 1B30A 1OINA 2GK1B 3RX2A 3W7OA 1VFHA 4AHOA 3A4JA 3IGUA 1EOKA 5CSSA 3SIMA 3M0KA 1KTCA 3FCPA 4FNQA 3IV8A 4Q4RA 1E6SM 1RCQA 1I60A 3CNYA 4F0LA 1EB3A 1YNQA 3DFPA 1C7SA 3MSGA 1HKVA 4UFMA 1OD8A 5FIPA 2X42A 5HMFA 3ARRA 4L6DA 4YTQA 3F4WA 3GG0A 2CBUA 2ZYFA 3LXAA 4CQ8A 4Z1AA 4RZBA 2QHAA 5D38A 2W61A 2Y63A 4J3WA 3TYBA 3NQVA 3GX9A 4NI3A 4KMQA 1W9VA 1E0WA 1EC8A 3QM3A 3G8RA 1U1HA 3A4AA 2VWSA 1US3A 5D2XA 1QJWA 1G1YA 4F0KA 2QJHA 3TE9A 1GPWA 1HL2A 1QO6A 2FVLA 2VZUA 1OIMA 2OLHA 2V69A 2GYIA 3LYEA 2VR5A 4IG2B 1YW1A 3IIVA 3KS4A 4S39A 3T78A 1R2RA 4YNGA 2C6QA 4MJ2A 4DO6A 3S1WA 4ZXLA 3VVGA 4LC8A 1XI3A 4ROPA 1JFHA 5H8PA 3VFLA 4Z2JA 2J9XA 1FHLA 3N3FA 4V33A 3WBWA 1JNEA 2RDUA 3MC5A 2I57A 3TUUA 2VHLA 1T99A 3UEQA 1R7OA 3H22A 1V51A 4H2HA 3HG4A 4B2DA 3P14A 2DW6A 4XUYA 3D0CA 1BFNA 3LENA 3QQ0A 2DT3A 1WBJA 4A4AA 3LGEA 4W85A 4GISA 5LNUA 3W7HA 3M0VA 5A6BD 4D6FA 1XR2A 1WA3A 2ZC1A 2XZ7A 4OKDA 2NLYA 1JVNA 3V35A 2C1GA 3WJXA 1JCMP 3H23A 4P2VA 1JCJA 2JGQA 3SRFA 1IF2A 4LS1A 1VJIA 5HANA 3V7PA 1W17A 2V5DA 1RZMA 4R9XA 3SUUA 9XIMA 4CQAA 3APTA 3L2LA 4IMCA 3CHCA 2DZAA 5A94A 3NM3A 3U48A 1FDZA 3G18A 2OEMA 4FZIA 3U8GA 5A6LA 2AOSA 4HNCA 1TSIA 3VIGA 5FJJA 3EKGA 4HMDA 4C7DA 5A69A 4IPJA 1GZGA 1SZNA 4UNKA 5HR7A 3L5AA 2G3JA 1QATA 2FZMA 5B7YA 3NQDA 4H4IA 4XVEA 1V6YA 1VKFA 3PJUA 1LT7A 4LY8A 4O1DA 4AWSA 1F5ZA 3TIMA 2DPEA 1HO4A 2HS8A 4JYDA 3LTSA 1ZSXA 2W27A 1A80A 5C9XA 1DWFM 1DL3A 2YFOA 4FIRA 3V16A 3VM7A 1VIWA 2PP3A 5HNUA 2PSNA 5C71A 1H5YA 2W67A 5DY2A 4PL2A 1TREA 1W3TA 3LGDA 1IZJA 4LFYA 1XF0A 4ADUA 1K6AA 2F84A 1LLWA 3LDVA 1H7WA 3W00A 1K8XA 3AS3A 4Y9AA 1T6MA 3TR2A 3CQIA 3GXNA 4DZAA 1JD9A 2V82A 1EUNA 1US0A 4W4QA 3SN4A 2V38A 1V3HA 4GACA 3ZM8A 1BVZA 1TV5A 2FMNA 2E40A 1W1A1 4FB7A 2WPBA 2ZTKA 2WWDA 2XISA 4IUGA 4DNMA 4YXGA 4YIWA 5EMMA 3A5VA 1LTDA 1XBVA 2J6XA 3FJLA 4MWAB 5LA0A 3C2RA 5BRPA 4ILSA 1ZQ5A 3HJZA 4WY0A 1GKQA 4BQ2A 4X2RA 3DFYA 4PBGA 3SN1A 1V3MA 3KS6A 5G2HA 5TBOA 4Z2HA 1OWQA 3ZWTA 1TB3A 2V0TA 1C8XA 3W7DA 4LYKA 4S2CA 2R1KA 5JXQA 1ONEA 2DVUA 2XVGA 3E2VA 4XISA 2YL6A 1JF5A 3MO7A 4W93A 2HWGA 4CEUC 1ISWA 5M3WA 4B5SA 2EF9A 3F5KA 3NL5A 3WLIA 5JVLA 4CNNA 5A6BA 3QJAA 1K3UA 3MV11 2NVAA 4OGZA 3BWWA 4HOZA 4YTTA 3JUGA 4O8AA 2GSEA 3EOSA 3UNDA 2A5HA 2ESCA 1KGWA 3TDFA 3ZOAA 1OZMA 2Z4GA 3W28A 1TV7A 1ZY9A 3N9RA 2Y2GA 1O5XA 2GZXA 5ABHA 1TELA 4UTIA 1ISYA 4GJ1A 3G1DA 3LBOA 4C60A 3VMNA 4MWAA 1EDQA 2A3EA 5LIXX 3KL3A 5IDZA 3FEMA 3V0UA 1XH2A 1PCWA 1UR0A 3F7JA 3N04A 4A3RA 3NIYA 3S83A 4DF1A 2PDGA 3N17A 3F5JA 3L9CA 2INEA 4O0ZA 2CKRA 4R9OA 4J9JA 5D2WA 4AYGA 4FR6A 3FA3A 1VCVA 3ANUA 4M6QA 2WMKA 3OEXA 4C6PA 4R7JA 1PZ2A 3T2OA 4PL1A 1Q6RA 1X97A 4OJ6A 5XINA 3WNOA 1TMQA 4US5D 3PZIA 2CLLA 3SCSA 3MHGA 1TMHA 3WLMA 3RN6A 4B16A 4HMNA 1I0BA 3ZLFA 4EOUA 5T9BG 1EF3A 2H6RA 4GUIA 3R0DA 3PJWA 2WNZA 3E2QA 4LVGA 1KLZA 1E6QM 3EMZA 3M07A 3O05A 3PTMA 1OX4B 4EX4A 3HONA 5HINA 3W2NA 4LUTA 1K8CA 6XIMA 4MWAC 3L4TA 3NPWA 2HXUA 1M6JA 2Z6JA 5M17A 5HNNA 4XAFA 1ZAIA 5K9DA 3C2EA 3W2JA 5LIKX 5MHBA 1HKKA 1K9TA 5J5RA 3W38A 3NPXA 4K37A 2WHLA 1ZB5A 4WGXA 3D6NA 4PBEA 5DCDA 2R91A 4HIBA 4Z08A 5D4YA 4GD0A 4Z2GA 1XLCA 1MNSA 2FPVA 4JEQA 1KTNA 1WZKA 3QOKA 5I3FA 3MVIA 4N9BA 1UPMB 4X0VA 1PYFA 3RMJA 1ENUA 1D3CA 4C6OA 3GW0A 1A50A 1GYMA 4L80A 3SCWA 1FWJC 2XHYA 4MKNA 3T2QA 2ALDA 3LV6A 3WBYA 4PCNA 3D46A 5AYIA 3H4XA 4H2CA 2OEJA 4D6JA 1PL9A 5FESA 3GYCA 1CGUA 3CLWA 3RU8X 3B9DA 1NY1A 3KWSA 4C1NA 3WH6A 1UUQA 4MNLA 4GYPC 2XZ9A 3SQMA 4KCUA 3OU8A 1NTHA 3CPRA 1FWWA 2EJ1A 1FWSA 2J7GA 1T7LA 3WQVA 1TPFA 3WQOA 5HAOA 1XIMA 1X39A 1OX4A 1WDRA 3H2OA 3T1GA 3B0XA 1VFLA 1R3QA 1P6WA 3JZUA 4BCEA 1IZKA 2BASA 3VGDA 2VVSA 3QSRA 3LCGA 4RX0A 3R12A 3MVTA 3U4FA 4XUGA 1XYZA 1ED7A 2WQDA 4RPPA 5BU9A 2EQDA 3ZYZA 3VE9A 1O94A 3HB9A 2Z2AA 4Q4OA 1UP0A 3UJRA 1J5SA 3MUIA 3LS9A 1OBAA 4RLIA 3UT0A 3VKAA 4P61A 2NW0A 3RJYA 3UVAA 3OO2A 3VCCA 4Q8WA 3M0JA 5FJOA 1JUBA 3GZAA 1LWHA 4P7NA 2GJXA 4PB4A 4DZ5A 4HQVA 3O0KA 2CLKA 3BMVA 2RAGA 2QW5A 3WKZA 2YFNA 3FNDA 2Y2NA 1K4HA 4UXDA 4BK9A 3TONA 4NY2A 4IBKA 3WQEA 1GKRA 2J24A 1SZEA 1YXCA 2WNWA 3IV3A 1E40A 3FKKA 3R11A 3GR7A 4EACA 2BY2A 3KLKA 4HNNA 1B1YA 3W81A 4NU7A 4NZ1A 1OEPA 5K2ZA 3I6RA 1KRCC 3QPEA 4WKAA 2JF6A 2PWDA 4GUGA 2D20A 4J7RA 5CC6A 3CAWA 4D1JA 1KKRA 1DIKA 4L5ZA 3ES8A 4JAWA 5CSUA 1XSIA 1KC7A 3SUVA 4HHMA 4K8EA 3VGHA 4Q33A 4TUFA 3TX9A 4QCEA 4KEMA 2QVNA 3CLMA 2FJKA 4HCDA 5FF3A 1GYNA 1WX0A 2X2YA 2Z26A 1VEMA 2BBFA 1QPKA 2QT3A 4C6BA 4I7VA 3GAKA 2J74A 4GH9A 3AOFA 4ICNA 3GB6A 2PDCA 1K7FA 3TAOA 4GH1A 2NT1A 4DJEC 2YDRA 2JKEA 4HSHA 1TJRA 1Q65A 4PB3A 1VC4A 2BLEA 1W1ZA 4L1XA 3SSZA 1IGSA 2FLIA 3AWOA 5CXPA 1RV8A 3TW9A 3W25A 3R0KA 2DU2A 1E55A 1QW9A 3ZR4A 2ATMA 4XD3A 3JRKA 3MDUA 1GW1A 2CNCA 3W4RA 2C18A 3MHFA 1Q6DA 4IP4A 2E8YA 3I7SA 3UPBA 1LWIA 3OG2A 1B3VA 2BTMA 3CBWA 2CITA 3EXSA 4HZMA 4AIBA 4LU0A 4K1GA 1W3IA 2FHCA 1FY6A 4H9VA 1L8PA 4C5ZA 5GNZA 3G77A 3SGUA 4F9DA 4YHEA 2H9AA 5F4SA 4IPLA 1XYMA 2EKGA 3C8FA 3UXAA 4CUCA 3L26A 3K13A 3EWXA 4UR7A 4R7WA 3UBPC 3R7MA 4JIPA 3GK0A 4M19A 3ITTA 2IOUA 2PRLA 4JTCA 2YR1A 1NVMA 3PPGA 5HULA 2W66A 1JCXA 5AZ0A 4FI4A 1IXPA 4H7CA 3GR8A 2TSYA 4XKMA 1MQRA 2OOGA 4X63A 2QMJA 4C6EA 1S2VA 1TWWA 3DI0A 3MUCA 4M80A 1F73A 2EBNA 3CHDA 3AS1A 3TN3A 2ZUNA 2G3IA 1LJYA 3G8EA 3C56A 3VCNA 4CU8A 5KETA 2HTMA 2DH3A 5BMWA 3A24A 4DBEA 1XHGA 3MPGA 3IUIA 4Z1DA 4QHRA 2WCSA 2V81A 1V7YA 2C1HA 4Z17A 4GZEA 3C52A 1ZAJA 5K9XA 4UTWA 4JFVA 2JFEX 4ZVJA 3VNIA 2CLEA 2EAWA 3QHMA 1L6SA 4N4QA 1DIDA 3WL0A 4RNJA 4G8TA 3M0IA 2QF8A 3A22A 4UUIA 3NZ1A 4AZGA 4ADTA 3CPGA 1ME7A 4JNMA 1A0EA 4NAEB 3AXIA 3QTGA 3LCLA 3QV8A 3LHZA 3EA2A 1IXNA 3MO4A 4NYYA 1NARA 1OGBA 4HPNA 5REQB 1M3UA 3N15A 1K7XA 3L68A 4ECLA 3S1UA 2QUUA 3MSDA 1DJQA 2HPIA 2GUBA 4I7UA 4Q7IA 1G4SA 2OZ8A 4JTGA 1ONWA 2NSXA 5FJIA 2ZFAA 3L65A 1XDJA 4MVAA 4FPSA 1MRQA 3BW2A 3R94A 2I9EA 1P7TB 1WO2A 3MYOA 1XH0A 2WAGA 3BG9A 1I1XA 4JTHA 4NYUA 3L29A 3ZJ6A 3WDHA 1QNVA 1AA1B 2W92A 4AVFA 2WBGA 4ZODA 1K9DA 3RRAA 3N2OA 4NJIA 1HF6A 4LRTA 2PTZA 4ZBCA 3FOKA 4JTJA 4H04A 5JH1A 2E5BA 3BARA 1Y65A 3W23A 1C90A 1UH2A 4CEXC 3BCJA 3IJQA 4O18A 1MXGA 4PUUA 3UG3A 1JJKA 1C29A 5DANA 1ICQA 4JICA 4LX4A 1OGGA 4JOMA 3FSUA 4W7UA 4OWGA 1R3TA 3LRKA 1OD0A 3M0XA 4EIVA 4GKTA 2VT0A 4K39A 1JGIA 1ZL1A 3CUGA 3CUXA 4BWLC 5IOBA 4OHQA 3BSGA 2CLMA 1MEWA 4QAWA 4ZB2A 2P8BA 3PK7A 1F61A 3QYQA 4KEUA 2QMKA 2VFFA 4DI8A 1UUOA 4GXWA 3MI3A 3DECA 1XFBA 2DW7A 1ADSA 3PUEA 1L6GA 1D8CA 1ZZMA 1WP6A 4NZJA 1MRAA 1RY0A 3EWYA 4QROA 1PIGA 2WVUA 2EHHA 3SJNA 2WHJA 3WK3A 4EPBC 3BLPX 2ZX5A 3G24A 4EKJA 1YE6A 4JKLA 4B5UA 3CZLA 5BU6A 1KM5A 1XGZA 5JU6A 1W1YA 1B4KA 2DEPA 1O66A 5FL0A 3LHUA 5A8PA 4HCLA 3RGTA 1L6JA 5H8MA 2R24A 3HPFA 1XLAA 1G01A 3FXGA 5I3JA 1B9BA 3OB8A 4IQDA 1IE7C 3WF4A 1FXQA 1KQZA 4LG2A 4H3DA 4OT7A 1GQIA 4I3GA 3OW1A 3ATYA 3VNYA 1YUEA 1O1ZA 1K6WA 1QK0A 1QT1A 3RFAA 3SDOA 3AYSA 4FNTA 3PTKA 2OTDA 5G1TA 4K7YA 2E7FA 3ABRA 5FF7A 4QNWA 1OABA 1IYXA 4J3VA 3MYPA 3DYOA 5CG0A 1F05A 4P7LA 1VYRA 3KRBA 1UR1A 1JIBA 2OEKA 4LYQA 2Y2PA 3WUGA 1H63A 2ZA1A 1DJXA 1J10A 3PP7A 1P48A 1QNOA 4F0SA 2YXXA 4OV4A 3O6DA 1XS2A 2HXTA 4LGXA 1CB2A 3ZR6A 2ZVRA 4HD5A 4J4KA 3L4UA 2I5GA 2JBMA 4Q3MA 2WSKA 3BZGA 2Y61A 3CV7A 3KZPA 2FZBA 2Z1BA 2C3ZA 4OZOA 1NF7A 1NWTA 2ZE3A 3OYXA 3VGEA 4CQ9A 2FVMA 4BQ3A 1JAKA 2PDJA 1IEVA 3PJTA 3H70A 1SJDA 4F0MA 2EG7A 2VD9A 4Z1YA 2AMGA 3VUPA 5A6KA 3G1AA 3GHSA 4CD5A 1NDYA 4UIOA 5TD4A 4XV0A 2HSAA 4LCSA 1TPB1 4NZ4A 4JX4A 1QOPA 4LBSA 4JL2A 2DIEA 3VKBA 4I9TA 1ADOA 3DU0A 2BXYA 7ENLA 1ALDA 3CQKA 3TYDA 1GQKA 2Q8ZA 1XKJA 2DSVA 4CNOA 2FMOA 4IFOA 1J18A 4UR8A 3STEA 1IR2A 1AFSA 3MCNA 1WAUA 4AX7A 1O5KA 4KRZA 3NZRA 4L61A 2OWWA 3T0BA 1SJCA 3UY7A 1KGXA 1BYCA 3BGGA 1QK2A 1CENA 3FYYA 1V6TA 3L7RA 2C7FA 4L64A 2UBPC 5HMDA 3VOFA 4B9ZA 4O4VA 1P6CA 3TLLA 2J62A 3CV6A 4JTRA 3LLDA 5H2ZA 3N2TA 5IFPA 1EO7A 1V8EA 3KE0A 1JAEA 1MZRA 1UWUA 4GH3A 4DY1A 3ERPA 4HYVA 3SECA 3V3WA 4XZLX 4GFIA 4JTLA 4FLSA 2HMCA 3AU6A 3P84A 3N4AA 1TUFA 3VD5A 2UWXA 3ABZA 4P8VA 3AJ7A 1AH3A 2VURA 4XD4A 3NCOA 4FHAA 5BOOA 2V2DA 3C3UA 5GJNA 5I6SA 2XN1A 1NFPA 1JYXA 3LCWA 4OOUA 4C6IA 4MZYA 4N6EA 4GJJA 1UD6A 1XSKA 4D1IA 3AIQA 3KAOA 3QRHA 1KRMA 3QY6A 1W8GA 1IR1A 3UCCA 2WHKA 2Y7GA 3VUSA 4BJHA 3WMSA 5CZKA 4KH2A 2ZX7A 4LS2A 4IQEA 4N9CA 1JDFA 1TA3A 3W1XA 3W3OA 1M7XA 4AY7A 2FIQA 2V2CA 2PDMA 1QBBA 1Y5VA 3HG3A 1RJPA 1SZGA 5D33A 4DF2A 1AMYA 5K7JA 3N11A 3H7VA 2VDGA 1OCJA 1LQ2A 4M56A 3ARYA 1XIDA 4MKSA 3BLDA 4A3QA 3EBVA 4DLMA 2DV0A 1TV2A 4IMAA 1Z32X 3L21A 3VGGA 5IDIA 4HNVA 1AJ2A 3QF0A 2OB3A 3JZEA 1N7KA 3DH7A 4JQAA 5BOFA 1XLLA 3GVWA 4UQ9A 3W75A 4AQLA 3VFCA 1EDTA 1D3HA 1JD7A 3DG6A 1MEIA 1FP9A 1QOQA 3TJIA 3GLCA 4K8HA 3UR5A 1SVDA 2QPXA 2HNEA 1FOBA 5I2UA 1BRLB 4D6IA 2VUYA 3DZ1A 3CHVA 2TYSA 4DJDA 4ZO7A 3LNMA 1H7PA 1MFUA 3KXQA 3TP4A 3IARA 4AG0A 2J9YA 2XVPA 4RW3A 3EEGA 2WKJA 4FF7A 1HJVA 2CWNA 1W1VA 4TVUA 3B8TA 3CHFA 1E6RA 4TMCA 1QHOA 3B8WA 4IFRA 4RV3A 1QPNA 3WD2A 1WXZA 1YQ2A 2P0IA 3N3MA 3H2MA 1FP8A 2RDWA 2VRJA 1N55A 3B97A 3IVTA 2DUZA 3W88A 1JPMA 4EXAA 3N9SA 5DY3A 3NZQA 1XBXA 3G0XA 4OIFA 1A5OC 3AIWA 3N2CA 5IHSA 1TPUA 4Q6JA 1TQJA 2E6AA 3MJYA 2EPNA 1HJQA 3SM0A 6A3HA 1RVGA 1CECA 3AXXA 1YU3A 4H6QA 3VKCA 2VOTA 1I2NA 3WMBA 5JBDA 4M29A 2E68A 2C1IA 4PMRA 4M82A 2XH7A 4LXFA 3T0AA 3LUTA 4BHYA 4DBSA 4MY9A 1D9EA 3W83A 3K5XA 2NX1A 4FO4A 4R53A 3ZQ9A 3H55A 2WNNA 4QG8A 2W9MA 4UQDA 1R38A 1AIWA 4J28A 3HJEA 3CL6A 3FA5A 2WYSA 3VDCA 3WQFA 5J8LA 2YB4A 1ONRA 2IQDA 3AFBA 5E6ZA 1UKOA 3KL5A 4MB1A 3KDNA 3GS6A 4AXNA 1OC7A 3KM8A 4O10A 1EP2A 4E3TA 2Q09A 3VU2A 1OJXA 5C2GA 2Q8XA 3LXBA 1X1OA 1V0MA 4NIRA 3HMCA 1BD0A 1DQWA 5DCBA 2HZGA 2BFGA 1NDVA 2WMJA 2VR2A 4OBSA 3P7YA 3MUY1 4QJ3B 1W3LA 1JRCA 3AI0A 1YTEA 3GVQA 1XH1A 4EAMA 5IM51 2DZWA 1J11A 4BF9A 3UJEA 2X0HA 4I6VA 1EL3A 2FGZA 3IK2A 5AN7A 1S2UA 1XYBA 3KP0A 3QOMA 3G1VA 3RM9A 4G7FA 4E8DA 4Q8PA 5CSYA 4DYJA 2XSBA 4HHHA 3AIRA 3IIXA 1IGWA 5LNWA 4JYEA 2VRQA 3CUHA 2VEMA 1KCKA 4GVIA 4KRTA 2OU4A 3CL7A 3K4AA 5FSDC 3HO8A 2YCJA 1K1DA 1UR2A 2BVWA 4JY8A 3LTPA 2YDSA 2VCCA 3I7QA 1MZHA 1KXTA 1BQCA 3WF1A 3ZS4A 3F4NA 4CN1A 3C0JA 1HJSA 1RVKA 2OX1A 4XTDA 5F4WA 2Z1SA 5CZ0A 4NNAA 2Y8UA 3SUSA 1OADA 3WUBA 4XG1A 2G8ZA 1ADDA 5BCAA 1QI0A 2VI0A 1F3EA 2QF7A 5I78A 3N1AA 1RUSA 3SCVA 3UXIA 1UH4A 1X8CA 3H2CA 3LCFA 3N19B 3ZZ1A 4MM1A 3A64A 3NEVA 4ALDA 2UV8G 4JHZA 3NEHA 3HBLA 2HEJA 3K8MA 1ZLPA 3MA8A 5KSWA 3G0UA 3HZ3A 2FQIA 3NNTA 3S0CA 3MY9A 3M0YA 2CHOA 3IS4A 5CBJA 4UFLA 3CASA 1RQEA 2CBVA 2GQ8A 4GZ7A 1UMYA 1RLCL 1OFAA 3SCQA 4O1CA 4ZO8A 1PZ3A 2HNHA 3NVTA 4OE7A 1UHVA 1Q66A 4MSSA 3NGFA 3R13A 2WZMA 3GNPA 2X2GA 1GVSA 4NNCA 3WQWA 2TAAA 3KX6A 3DYMA 3N34A 1R2TA 2ZZ3A 3LZ5A 2DT1A 5FACA 2JQXA 1B90A 1OT1A 3O9NA 1KCLA 4LUYA 5H91A 2INZA 2B7PA 2EEXA 4QAIA 4UFIA 1JQVA 4TO8A 2QUMA 5DX7A 4K6AA 2NLIA 1V7AA 5CGQA 5G2IA 1AG1O 3CZKA 3MKKA 2FDMA 3RM4A 1DYSA 1H60A 1QAPA 2PU1A 1Q6OA 4KCWA 5GNXA 4H00A 1GHRA 1R85A 4AZ7A 3QV9A 5A8QA