4NZ1A

Structure of vibrio cholerae chitin de-n-acetylase in complex with di(n-acetyl-d-glucosamine) (cbs) in p 21
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 142
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz1A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz1A01
2W3ZA 4NYYA 1W1B1 2E67A 2NLYA 1XW8A 3CL8A 4NZ1A 4NZ5A 2I5IA 3CL7A 3RXZA 1W17A 4V33A 2QV5A 2Y8UA 4HD5A 4OUIA 1W1A1 4WCJA 4M1BA 2C1IA 2C1GA 3WX7A 4NY2A 4LY4A 4U10A 1V6TA 2DFAA 5JMUA 4F9JA 2C71A 2J13A 3VUSA 2IW0A 4NYUA 4NZ4A 2CC0A 3QBUA 3S6OA 4L1GA 2XU2A 5BU6A 2VYOA 3HFTA 1NY1A 4F9DA 4NZ3A 1Z7AA 3CL6A 2C79A
chains in the Genus database with same CATH superfamily
2EKCA 2WVSA 3R4IA 4GRSA 3OQ8A 3CO8A 4V1XA 5I24A 1Q66A 2V5CA 1T5AA 5BROA 4HPGA 1FVPA 3I4EA 4ORMA 3RN6A 3CEPA 3I10A 3WD2A 4JKLA 2NVAA 3B05A 3FFSA 2RGMA 3GXNA 1GHRA 1I2NA 4L6OA 2WMJA 4B5UA 1T8QA 1UD5A 4UTKA 1FCQA 2WZMA 1AH0A 3DGBA 3NO1A 2WBKA 3WJSA 3PUOA 2Y7EA 3PZOA 1ZS2A 3EMQA 3CPRA 2GGEA 2VEMA 2O92A 2QF8A 4LAUA 3MSDA 4JTSA 3D3FA 5U7SA 4Q4PA 5AN7A 3UZZA 2VGBA 2DDXA 5M17A 5AVHA 1IXNA 2ZFAA 4N9DA 3OYXA 3VIFA 1F07A 3BLFA 5LA0A 1VBRA 4DVOA 3SCOA 3FY1A 3H2NA 3EA1A 4D2JA 1J01A 4RUBA 3PNUA 4UR7A 4DUXA 5G1MA 1KFCA 4IBCA 1O95A 2X8RA 3DFYA 2DH2A 4ZMGA 3DC8A 3DFQA 1JYWA 4UQDA 1JGMA 1ZU8A 3IIVA 3QSTA 1CX9A 3TKFA 3QOKA 4S39A 5HBFA 4F2UA 1OFQA 3W00A 1JZ2A 3B8DA 3VDGA 3MP5A 5BPVA 3GTIA 3B4UA 1ZJBA 3RX2A 1WOBA 4GC4A 3N14A 2PE4A 4GZIA 4X0NA 4URIA 4NAFB 3CM4A 3A22A 3SR7A 2O9PA 3FN9A 2J4GA 1BYDA 5I3IA 3G1DA 4AIEA 1XYMA 1LM1A 3APGA 4G1NA 4LH8A 1OWQA 3TLQA 1E9IA 4BF9A 4TX9A 1RPKA 1L6FA 4W7UA 1E9YB 3LRMA 2QW5A 5ECVA 5A3HA 2O4QA 1P0DA 3HF3A 1UROA 3W7QA 4J3TA 2WKJA 4NQ1A 3PPHA 1RXOB 3RYSA 4CLMA 2WMIB 2BASA 5JH1A 4B2DD 2Y2LA 1UC5A 1TVLA 4JTJA 2D0GA 2G97A 1QAPA 1F2JA 1UR4A 1XPGA 5DQPA 5EBUA 3MO4A 2Y62A 1A5UA 4KRTA 3OBAA 4YHGA 2PEVA 1EX5A 3UWQA 4IGNA 4OJ6A 1QW7A 3UJEA 3BAIA 1VF8A 2ZC1A 4IM4A 1QPRA 5AFDA 3UJFA 2WC3A 4J4KA 2IPGA 3S4TA 1HKMA 1VB9A 3EOOA 4LV4A 2ISWA 4Q8OA 1D7KA 3H2CA 3KVMA 3VCCA 3QKEA 5D05A 3ZVHB 5KMYA 5I3DA 1J9YA 4U31A 1TWIA 3CB3A 3KRSA 1OHLA 4P7QA 4P8WA 2DQXA 3WQVA 1VLWA 4FNUA 1TO3A 1DIEA 2OODA 1R0MA 4K6AA 2GUYA 4HNOA 3MMUA 3WDPP 3FSTA 4CVUA 2PWHA 4CD8A 3CIWA 3BCFA 4PUMA 3MHFA 5LA2A 2H6RA 1BD0A 1BRLB 2BXVA 3B8IA 2Y2IA 1AJZA 5I5RA 4QLLA 1WDQA 5JXQA 3M0YA 2IPJA 1AVAA 2QIIA 1H1YA 1JFHA 1PCKA 1TQJA 2Z0IA 4DJEC 4EE9A 4CQBA 3U3HA 2FDSA 2OPJA 4AF0B 4JYFA 3GFYA 3GG8A 1AG1O 3CAKA 1TJ0A 3U2EA 1CPUA 4AEOA 5CJ5A 2ZZ5A 3KOFA 3L66A 3SUSA 2G8ZA 3R2GA 3BJTA 4H00A 3W88A 1ONRA 3UJSA 3SFWA 4AIBA 5AHMA 1BWKA 4WGXA 3M7SA 4TR9A 1LL4A 2Y1HA 3W6YA 3VKDA 1GQNA 3LHUA 4L65A 4O28A 3CC1A 3LUTA 1WKDA 2ZRXA 4Q6XA 4ZCWA 1TWZA 3HZ3A 3SQMA 1IE7C 3BCJA 4QEHA 4M7TA 1TIWA 4XBKA 4GABA 4RV3A 4L1XA 2WCAA 3UNDA 2EG7A 1Q7MA 3G6LA 3SCSA 4AD1A 4JOMA 5JU6A 4K8HA 1NDVA 3VX1A 4C65A 1W1ZA 1OSEA 1SSDA 1TZZA 2FVLA 4M29A 2DSWA 3QFEA 4F2TA 2QULA 1LOQA 1ZP4A 1NY1A 5K3VA 3QW3A 1QPKA 3RCMA 3SCQA 3SIZA 4KETA 2P3ZA 2BHUA 4EVZA 3W26A 2FLIA 4LYKA 3WJWA 1GZJA 2WMGA 4IBIA 1GTEA 1OC6A 1XP3A 1SFJA 4Z0JA 4UTMA 4GI9A 3RR4A 1NWUA 1CDGA 4N6FA 4O8AA 3KCOA 3CHEA 5EMYA 2C79A 3V75A 8TIMA 2J9YA 5I02A 2HROA 1GKQA 3IUDA 2W6RA 3H22A 3AYVA 4TOQA 5DT5A 2OO0A 5D04C 3P61A 1XQKA 3WJYA 1X8CA 2VQTA 4W89A 3P0WA 3GIYA 3G1RA 3QQWA 5LA1A 3ZJ7A 5M5DA 1NQKA 2R8WA 3S9YA 4JFTA 3NYZA 1JDCA 3PULA 3TUUA 2YYUA 5J5DA 2D23A 3W6LA 1DP0A 1W1TA 1I75A 2J7CA 3S1UA 1W1YA 4LYQA 5LGXA 1GYNA 3AXXA 3KRUA 1CI1A 2F2HA 2J27A 4O1EA 3STGA 2EEXA 3NJ3A 5U4NA 2EAWA 3KOXA 3BV4A 2XSBA 1G67A 4WCJA 1B31A 3AMDA 1K77A 1IZKA 4AZ5A 3DC0A 1IXQA 1JG9A 3WJXA 4ERAA 1HKJA 4LVAA 3VE9A 4DNMA 1IEVA 1NOWA 3TFXA 4JD4A 4Y90A 1NTHA 1AODA 3CUHA 3UG4A 2NW0A 1XH1A 1JQXA 3D47A 2ATSA 3O6DA 2RDXA 4H83A 4PMUA 4YTTA 3H2EA 4LCQA 2PBGA 4DO4A 4B92A 5CG0A 5HQMA 4FNSA 3TROA 2QYGA 3VZYA 1I1WA 4AISA 2WZEA 4NJJA 2PGEA 2GQ3A 4LX4A 2PTWA 3VOCA 1TRDA 2R1MA 1PTDA 3VM7A 4NYYA 5CZTA 4EPKA 1YUEA 1ZAHA 1B3YA 4NZCA 1QK0A 3U8GA 1AQ0A 4DPQA 2FMNA 3UERA 4NILA 5K2ZA 2Q71A 1YTDA 3CNYA 3UFYA 1FDJA 4IJRA 4O12A 2NLYA 4TXEA 3SRHA 1F3TA 1ELSA 3RM9A 3N11A 4IZGA 2DUZA 1GYMA 1TA3A 5K9XA 1WDPA 3WQGA 4MZ1A 3IIOA 2BHYA 3GVVA 4PCNA 3EWDA 3HFTA 1UJQA 1TV8A 5MHBA 4DLFA 4JNYA 4DLMA 1F8MA 3EGJA 1FCBA 1V0KA 3H7RA 1SFLA 1GJPA 3T42A 4BI5A 4DRSA 1XISA 1HF6A 2Z24A 4HHMA 2OZTA 1OFPA 4F66A 5T91A 4C6NA 2FTYA 5FJTA 2D2JA 4Z2GA 4GIAA 2WJFA 4WHBA 2VC9A 2B7PA 1HFBA 4MIMA 3RXZA 4F0RA 4DPPA 5C2GA 2I57A 1TB3A 2NT1A 1GVOA 1M01A 2A79A 2EGZA 3FA4A 2FHBA 1Y8BA 1GOWA 3SEPA 1UP0A 4EKJA 3FYYA 3ZJ6A 5IM51 2FMOA 1HN1A 2F6UA 4PRRA 1ME7A 1ZBWA 3WMSA 1Q6FA 4DF2A 4PBGA 5LIUX 4Y9OA 4CUCA 5G4WA 3W7RA 3NQMA 1JJKA 1ZJIA 4LTSA 3GZ3A 3NTYA 3F2DA 2XFWA 4GNJA 3MBDA 1NFPA 3L29A 1TCDA 5CSYA 4IIDA 2NVDA 1AFSA 4IBKA 3WLKX 4I5XA 1TZ9A 1XIBA 4MKSA 4W88A 3OGVA 1J2WA 1A53A 1YPIA 5EMLA 2P8BA 4IHCA 4N42A 4FX8A 4DX3A 4DXKA 3RK8A 3UPMA 3KS8A 2PWFA 3FYPA 3K8KA 3UNTA 2ONEA 4E38A 4MUZA 1OG0A 3G1HA 3CZLA 3S1WA 4WOZA 1M7JA 4R33A 3K2GA 1HQTA 1UD8A 2V5LA 2V68A 3U4FA 3PB0A 2DEPA 3UWEA 3NQ6A 1KBBA 3H55A 4HYVA 4US5D 2PDPA 1SZEA 1PUDA 3DFNA 4NXKA 2YZ5A 1FXPA 1TJPA 1FHDA 4FOJA 2C19A 4I5UA 3GXFA 3A3WA 7XIMA 2GPTA 2POTA 4HK5A 4XAPA 1D7FA 1G4SA 4UWMA 3PZ9A 1DJNA 4ZO8A 4ZSUA 3VM5A 1XGDA 2HTMA 4PBFA 3Q65A 1A5SA 2A6LA 1NOFA 3R13A 4ADSA 2A7PA 4GUJA 2QT3A 3UXAA 2J7HA 2Y2MA 2NWSA 1GZ1A 2A6NA 3A3XA 4LEQA 2WSKA 5DXXA 5LNWA 3W28A 1XBVA 1J96A 4ICNA 2H8XA 1KGXA 4UTUA 3E9AA 2VUYA 4R7JA 3GHUA 3SW6A 5B7YA 2OWCA 3L26A 1S5VA 3NQ8A 5KZEA 1Q6OA 3LNMA 4H2CA 1XDLA 1XSKA 3W02A 1AQFA 1UOKA 2V82A 1TJRA 3LPPA 2Y8KA 2ODOA 4LUSB 4O54A 3UPWA 1W8GA 1E6XM 3T07A 1B4KA 4S3GA 5HDRA 3GR4A 3GDTA 3EDDA 2KX9A 2VX6A 2CLEA 1IGSA 4C6MA 4XAGA 2H3BA 3UWYA 4G9PA 2ZUNA 1GPWA 1HIZA 2ZE3A 3GNRA 3GC4A 1VFHA 4W8BA 3JRKA 4DJDC 1S3HA 3BAKA 1GWJA 4C1NA 3PBVA 1J12A 1J93A 2QS8A 3LGGA 3W84A 4WKFA 3M0MA 4A8RA 1EGZA 1DPMA 4I7UA 1ONEA 1HKKA 3WNPA 3ARQA 3PUEA 1AD4A 3FHQA 5K7JA 2ZUUA 1ZQ5A 3QV8A 3MVTA 3QV6A 4Q4RA 2IXUA 3FXGA 4JYDA 4XBJA 4JHMA 1YHTA 5DBTA 1V6YA 2NX3A 3AIRA 5KETA 1OD0A 4IIEA 4MKVA 1FQ0A 3QY7A 4LS1A 3VMNA 2YCIX 3AYTA 3L5LA 3M44A 3DAQA 2YOCA 1TMHA 1WUFA 5C5YA 1E6NA 3AC0A 5F2LA 2EQDA 1QVBA 4K68A 3RMJA 5HWJA 4KCVA 1YBQB 1VFLA 4GQGA 3WEOA 3W1XA 5CZ0A 1X6UA 4H6EA 4B9ZA 4QAWA 2Q3RA 1BYCA 2RHGA 3IUHA 3E49A 4O10A 3QPZA 3WQFA 1LDCA 1FTXA 1SW7A 1UUQA 4IP4A 3ARZA 3L5AA 4B5NA 3W75A 1BHGA 4HIBA 3N25A 2A5HA 2WCGA 3EX3A 4LF1A 3TC6A 1VBHA 1Q45A 5DCEA 4BF7A 3W81A 3AOFA 4XIMA 3USBA 2JQXA 4D71A 5E0CA 1ECQA 1JZ5A 5LZLA 3HIJA 4GQRA 2OZ8A 3MW7A 1M7OA 3NGJA 5CBIA 1XBZA 2OKOA 3FAWA 4HT3A 3TFCA 2QJMA 3BVJA 2ZZ3A 4IGHA 2OSXA 3VE7A 3B40A 4RZBA 3ZIZA 5FCZA 4CNNA 3UWVA 3CU2A 1EQCA 2HQAA 2I1OA 2YZRA 5E09A 3W1TA 1VEPA 1BGGA 3WEZA 3IIXA 4LC6A 3RHGA 3ANVA 4Z1CA 3I68A 3D6NA 1QI2A 1DTUA 3KL3A 1B5TA 3PY2A 1TTQA 4F9JA 2XIIA 5D8WA 2IQTA 4KCTA 1EHNA 1CB7B 4ILSA 4ECLA 2BY0A 1EZWA 4QSFA 1OQFA 2UBPC 3VDHA 5E9XA 1WOAA 4XKYA 4Q4KA 4L9ZA 1W37A 3W1RA 2V67A 3IJDA 4JCMA 4QJ5B 3CHCA 1GVYA 4X3ZA 1ITCA 4M80A 5A8GA 1KXTA 3VZXA 4LB3A 1E43A 4P8VA 3FX4A 3CWNA 1BVNP 3TN5A 1PKYA 2VR4A 4O1BA 2QCLA 4IWWA 3CYVA 1L0PA 5FF7A 5C7HA 3QHNA 3OG3A 1H11A 2OG9A 1VFFA 3QHOA 5AC6A 1QT1A 1SUXA 1BPLB 1YX1A 4O0QA 3Q58A 3WMBA 3I3DA 4YPJA 4J9JA 2JGYA 2QJJA 2EPKX 2ZBTA 2JGQA 4XKMA 1EC8A 4AZCA 1TPFA 4HTBA 3CTLA 1S2WA 4D8AA 3G3MA 5GPRA 3A23A 1MNZA 1CIUA 4JX4A 1FH7A 3MT1A 2DW6A 1Z3NA 1O4UA 3O9NA 3URAA 4GISA 3M9YA 3WG6A 3WLMA 4L6HA 3GYEA 3NZQA 4OBSA 1FWTA 3SCPA 3WSUA 4DXVA 4PUJA 3W1AA 4UTHA 1P5BA 1OC7A 2WSQA 2XVKA 5C9UA 1HJSA 3N17A 1E9ZB 3P5ZA 4U28A 1KCZA 4G2DA 4HNTA 2E9MA 2XG9A 4REQA 1GOXA 5HR7A 3N9KA 4GK8A 1ME9A 4CNPA 4J2PA 3H2FA 3CAVA 2RDWA 2AGKA 4IFKA 1IR1A 2FGBA 5HNTA 3C8NA 3DEQA 2PDFA 3EWWA 3EKLA 1TMQA 2WLZA 4BKNA 1JZ6A 1VHNA 1KFEA 4WJEA 4H1ZA 1V6VA 2JIEA 1FHLA 3T2PA 3W2KA 1H41A 4GA8A 3R8RA 2CZVA 1EIXA 1M5WA 1VYPX 3T4CA 4M24A 1DYSA 3FLUA 4WSKA 3TV8A 4A8LA 4NYUA 2YBTA 2OMAA 5C7VA 3SRFA 1JPMA 1XYBA 1RK6A 1ODUA 3PZQA 3N6HA 1REQB 4FB7A 3EWBX 4C5ZA 2VC5A 4XZIA 4LFYA 1HVQA 5A69A 1GK8A 5GNYA 5GJPA 1R86A 5JMUA 1E70M 4K1WA 3T05A 3QN3A 5LNVA 4D6EA 3W85A 3S1VA 1BWLA 4GFIA 4HYWA 2A1YA 3DHFA 4WF7A 2YDQA 3LGEA 2HPIA 1ZY9A 5LNUA 4F48A 4GI6A 1EBGA 1W2VA 8XIMA 4I9AA 2ZOXA 3EDKA 3M5YA 3QGAC 2O0TA 1PX4A 1R9XA 4IG2A 2QCDB 2Y2HA 3LHYA 6REQA 3MCNA 4FOKA 2ZX9A 3WF4A 4NASA 1J5SA 5LIXX 5CZSA 1NJJA 1LQ0A 2BGQA 2XGZA 5FJJA 4QGCA 1WKEA 1MEIA 3NO5A 4IXHA 1TE1A 2QIWA 3UEQA 2X30A 2UWXA 5I09A 3HPFA 3WUFA 3MMWA 3IAQA 1X97A 1CGYA 3HO8A 3ZLGA 4FI4A 4WSJA 5ABFB 2IPWA 3O0FA 5HQLA 2VQUA 1EFZA 1LBMA 1VIZA 4H9VA 4HZ7A 1EYEA 4O4WA 4JKMA 4ATDA 2V3FA 3PBMA 1YTKA 1UMYA 1DWHM 2VZTA 2ZKMX 3M0JA 1UZDA 1B9BA 3ZS4A 4DJFD 2QCEA 3EKZA 1F4HA 4H8VA 4DN1A 3WUEA 2GQAA 5XINA 2C14A 2DT1A 3TH6A 3PM6A 4WY0B 3LTYA 3L23A 4E8CA 5AHEA 3GXIA 2E0PA 2PRHA 3HU7A 3LRLA 3SAZA 3WH7A 4O0ZA 1YU4A 2Y0FA 3TMLA 3N4AA 4FNPA 3AXKA 5G2HA 2BVYA 2EHHA 3GDKA 4KGJA 1W56A 4YCOA 4XIAA 3GKAA 4OWGA 2X05A 1E4IA 4H3DA 3ZOAA 2FTWA 1VGAA 1WDSA 4NNBA 1BWVA 1JI2A 3STEA 4GVIA 5AHLA 1LBFA 1UWQA 3HURA 2X0SA 1KNWA 3E38A 4RZ5A 2Y8UA 3KBWA 4Y7EA 2BVWA 1N82A 5JVLA 1NQ6A 4IH3A 3ARRA 2OR2A 2Q02A 3AU6A 1B30A 1RK5A 3U2ZA 3VIKA 5I2UA 3PZUA 3R5EA 1SGJA 4MMWA 3VUSA 2OOFA 3VZZA 3TCSA 3V0TA 3NL3A 3OIXA 3EZ4A 3LHVA 4MGGA 1E5JA 2VEFA 3INPA 3CUJA 4UTWA 4D6GA 5C0QA 1FWBC 3UT0A 2XDFA 3KEHA 3STPA 1BTMA 4KBXA 1V0MA 3DYMA 3T08A 7REQA 2G4FA 2Y2PA 2WJEA 2VFFA 1B3VA 3B3DA 3SQLA 2HNEA 3WNKA 1N8FA 4IPLA 4O11A 1XIHA 4I9TA 4GBUA 3APYA 4X63A 3GG1A 3W71A 3CGTA 4Z17A 4GX9A 2WVVB 3TW6A 3WENA 3QGKC 2E67A 4H04A 4G7EB 1TPEA 2PP1A 3FEQA 3UYIA 3KOYA 2BS9A 2ZVRA 4S3EA 1D3GA 4N4PA 2QUMA 3GXMA 4A4AA 4UFJA 4L1GA 1VJIA 3UJRA 5C6MA 5DLCA 2R1KA 3REQB 2P8CA 4IJEA 2GLKA 1PJ9A 3EMCA 5D9PA 5G4HC 1POKA 3FKEA 4AZ6A 4AW7A 3PAOA 4GNKB 3E5BA 3AHYA 4Z08A 1UC4A 5D4YA 3IPWA 1NDWA 4FXJA 2EKGA 3M46A 1KM5A 4FLRA 1WBHA 3BO9A 3GWQA 4CD4A 2WNQA 1RUSA 3NNTA 4GZ7A 2F9RA 4UOZA 5IBXA 1W1IE 1PZ3A 1UH3A 1G1YA 4EPDC 2DZUA 2ZUMA 3PBYA 5EMMA 1JYNA 1IGWA 3NQ2A 3STFA 4JAWA 2XFFA 3LTPA 4I7WA 1E1FA 3PF3A 2IQDA 3PB2A 3TX9A 1J18A 4JS3A 3KS4A 2VC7A 1LF1A 1WBJA 1C7TA 4ALDA 5MKGB 4JY8A 4N9CA 4AX6A 4ATWA 1VZWA 1RVKA 4YYCA 3TVAA 4M1BA 1UR0A 3LXAA 4XBSA 2FYMA 4IBFA 3ARSA 4QM1A 1ZHAA 5MF5A 1TPH1 1XSIA 4JTAA 4XSLA 3F1QA 4JTEA 4MVAA 5REQA 1G7UA 2OO6A 4WDWA 4JFSA 1MXDA 4O16A 1YPXA 5J04A 1S1PA 1RP8A 2V9DA 3LPFA 4U33A 1ZP3A 4HMCA 4NVTA 3TONA 4IIHA 5FF2A 4QNWA 4U4MA 3KVLA 1NEYA 3TJLA 2EG8A 3IARA 3G1SA 3SCVA 1KO0A 4TUFA 4BEQA 3C0QA 4WDUA 4QG6A 1W32A 3FOKA 3EOLA 3KHJA 5FJPA 1V02A 2QNEA 4FOUA 1SR9A 3ICJA 3BOFA 2C3ZA 3FVMA 4UTFA 3ATYA 2DSZA 1XD1A 3M16A 4PRWA 3IAPA 1PDYA 3WFZA 1XPYA 3LBMA 1N2VA 2E4TA 2VENA 3OO2A 1YNQA 3HG4A 3GH4A 1RCOB 4L4PA 3TTEA 3E2VA 2YFOA 4P8UA 2D73A 5IRPA 5C9XA 1ISZA 2W79A 4FLOA 2WNZA 1KR1A 3IVTA 4O13A 1XYAA 5D2WA 1LOLA 2WCSA 4PCPA 3NQGA 1EL3A 3GHRA 2EPOA 1V3JA 4DM2A 1HVXA 2GDQA 1K9DA 2R14A 2OWWA 4JQ4A 4P7LA 2ZTKA 4CQ8A 4HNVA 4IJFA 2X1UA 5H8PA 4HA0A 1GGOA 3QY6A 5FJRA 1G6CA 1JD9A 3NDZA 4BFAA 2VOMA 2PWUA 4DI8A 5FEZA 3V16A 2JBMA 3N1AA 3QM3A 4MWAB 1VCVA 5EPDA 2XZ7A 3CUZA 3TYAA 3KS6A 1LT7A 1UKTA 4AMAA 1DE6A 3OYZA 1VRDA 5D2YA 4WOQA 3UA3A 2E6YA 3CZGA 2A3LA 4LJ3A 1DWFM 3N34A 4JIEA 3ZT5A 3SGZA 1AW2A 1P6WA 2GJPA 2CITA 3MHGA 1Z48A 1WAUA 1PIGA 1UWTA 2VEPA 2OKTA 1XLIA 4J5NA 3BOXA 5CPSA 4M3PA 1XW8A 2FZDA 2V69A 4CEXC 4HMDA 4LW7A 4EPBC 2E6FA 1OF8A 2ZXBA 3CZ8A 4YCPA 3LM3A 2VXNA 1KQYA 1QI5A 1ZBCA 1O5XA 1Y65A 1OB0A 2PU1A 1OC5A 3PWGA 4W8LA 2ZDRA 1UPMB 3SCRA 1F3EA 1J10A 3P84A 2VGFA 4XZBA 2DUXA 4U2ZA 3CV7A 4PEEA 5AC8A 4CCCA 1VENA 1BKHA 4UTTC 4OOZA 1I2PA 1CXFA 4CN1A 1OZQA 1PWMA 3WQOA 1V8EA 2CLOA 3WN6A 1YNPA 2NXGA 2I5IA 3UVIA 1V6XA 3MU7A 2J62A 1OIFA 3NPUA 4HPHA 4MWAE 3RILA 4D72A 3CWHA 1OD8A 1ISWA 2WHKA 4N4QA 3WNLA 2OQYA 1ITUA 2O56A 4NZFA 2QAPA 4Q7BA 1WDRA 2W9MA 1F6KA 4O1CA 3L4YA 3ZWSA 1KBJA 4Q8PA 4RXFA 5DEZA 1K7FA 2G50A 4IICA 1R9YA 4F79A 3NXLA 3GC2A 4JTUA 4ZE4A 2ZE0A 2QUTA 2ZRUA 5DMYA 4EANA 1MUMA 4W7WA 5HJYA 2PS2A 3VNDA 1KGWA 4S2BA 1QDSA 1E1CA 3GNOA 4NSBA 3CB8A 2CKSA 3I7RA 4F0MA 1X98A 4FMVA 2INFA 1FWFC 3MJMA 3SBFA 1KKOA 3CAQA 4YVXA 3GY1A 2CHOA 1R5YA 3VD9A 1QW9A 2CLLA 2X41A 1UHVA 4EXQA 2TAAA 2WO5A 3BGAA 1EGMA 5D9MA 4PTDA 2DZTA 1DJGA 3R10A 1EQPA 2VI0A 3KLKA 2C7FA 1V0NA 1VFSA 2JF6A 1XH0A 1G0CA 4DWSD 4AEEA 2PGFA 3WYZA 4OE7A 4HCDA 2X1TA 3GO2A 3KBJA 4FS9A 1OX6A 1CBGA 2PF8A 2W61A 1TTIA 1PO9A 5BU9A 4BWLC 4DY1A 1QNVA 3S5ZA 5CC7A 4LBUA 4NZ1A 1RCXB 5DF0A 3NUKA 1THFD 4WDTA 1PVNA 1NELA 1E6SM 1L6SA 4EF9A 2XINA 2QMKA 5A2AA 1WE5A 3VABA 2D49A 3VU2A 4AY7A 1GQLA 3AUOA 1WPCA 4TMCA 1M65A 3FSUA 3NZPA 4YIWA 3FGCA 2G5WA 3C3NA 1B2YA 3HMJG 1ZB5A 1E0VA 4LYPA 2DU2A 2FPTA 4PSPA 2Q8LA 4IFOA 3S8HA 4QR6A 1LUCB 2ZADA 3ONCA 3H4WA 4S3KA 3S6OA 1A0DA 5FJUA 1KGUA 2VZSA 3ANYA 2O7QA 3LCGA 4H9UA 2J7GA 5D2VA 2WQDA 4ATLA 4GVGA 3ZZ1A 3GX9A 5I23A 2HV5A 3QYQA 4GY0A 3H6OA 3UG8A 1I6NA 4CNOA 2G4JA 2ZA2A 4J27A 1QNPA 3IRDA 3W1PA 4R9XA 3A4AA 3BLPX 3VC6A 3SADA 1M41A 4UNLA 1UD4A 4CQCA 4AWTA 3CQKA 1HXJA 2XSXA 5C55A 5I3JA 3E0LA 2XSAA 3S5OA 2GK1B 4LWWA 2VGGA 4YVPA 3AWOA 2V3EA 4MF4A 4HN8A 4R85A 4Z0SA 4XSMA 2VFIA 1U5JA 1TWDA 1VJSA 1J6PA 1XI3A 2J78A 3IANA 1RY0A 1VP5A 1WQ5A 1GVIA 1R38A 4O14A 3N2CA 6PTDA 1QHPA 2F6KA 3LXCA 2BG5A 3WD1A 4R3UA 4Q8MA 3WMLA 4Z1DA 3WQ5A 3AO0A 3H2MA 4FALA 4CD6A 4GC3A 5LHFA 3QOMA 3EWXA 3ABZA 2PA6A 1U2YA 3WL1A 3D0CA 4C6BA 1EO7A 1R3SA 4R7WA 2XTKA 2A4AA 4C7DA 4RNFA 5AHFA 2R94A 4LUTB 3M47A 1UA3A 4RZ6A 2GJLA 2I17A 5IXEA 1WXYA 3RRAA 4MNLA 1DJHA 2WKLA 3AMLA 5FD0A 3O3RA 2GL5A 3ZR4A 4QROA 1VFMA 1CXIA 4LU0A 3OZOA 3WLSA 2ZX8A 3FJ6A 5IFPA 2MUCA 3N6JA 4DBSA 3O15A 1WZAA 3DKLA 4BA0A 2WKGA 2RDTA 3UJ2A 2GQ9A 3TWBA 4D6IA 4ZFCA 1TZ7A 4QAIA 4WD0A 2PB1A 1QO5A 3V5OA 3QC0A 5A6MA 2ZX6A 5C8BB 1YTEA 2QCFA 3E5PA 4AF0A 3AHTA 4JNZA 4JHZA 5E6YA 1UQZA 3MPGA 1WZKA 4LB4A 3HM7A 4XD3A 1AUSL 4AVOA 1AW5A 3GUWA 1SR0A 3KW3A 5KZMA 1UKQA 1GT8A 4I8DA 4B2DA 3OVPA 4NRSA 4LRTA 4B3KA 1XRVA 3MC5A 5D30A 3DFOA 2OTDA 2R1LA 3L2AA 2PSNA 1TKKA 5D33A 6TIMA 2GUUA 4UTTA 3LPGA 5A8MA 3BG3A 1FWEC 4PTVA 2NUXA 3W82A 3WF1A 2CESA 4XTDA 2ZX5A 1CCWB 1EUAA 1B54A 2VGIA 2R9RA 2EPLX 4E4FA 1YIXA 1Z8AA 1K8YA 4HZMA 4MB3A 1J6OA 1XCFA 3VCNA 2GSEA 2FPYA 3PZMA 3BE7A 2V3DA 2KZHA 4HA4A 4PTWA 1FY6A 1HJVA 3EAUA 3A12A 3SZ8A 3L65A 4K7VA 4O57A 4IXXA 4LUJA 2BDQA 3AHZA 1DJIA 5TAOA 4CKQA 1MRQA 1DIKA 4UR8A 3CXOA 2ZUTA 1PHWA 4DI9A 3PTQA 1D3CA 3UR2A 2I9EA 3WNNA 3L7RA 3N4FA 3TQVA 1CXWA 4R7OA 9XIMA 4XAZA 4J35A 1EUNA 4MM1A 4YS1A 4ZTXA 1PCWA 1J8VA 2KAUC 3IWPA 4H8NA 2B7OA 5KITA 3QJAA 4O19A 2V5DA 4M6PA 4RE4A 1U1HA 1XG4A 5DRCA 3B0UX 2QJGA 1J0ZA 3W3OA 3FVDA 1E15A 3QV7A 1E6QM 3LSCA 3DYOA 3QQ1A 2WSYA 5TD4A 1JPHA 2QCHA 4E2BA 3L25A 2TMDA 1JCNA 2CLPA 4GFSA 2P10A 2Y85A 2GJXA 1EIBA 5M03A 1KCLA 3CJPA 4HSOA 1NDZA 4M8UA 3TQPA 5I3GA 3DOPA 1SJBA 1UWSA 2YGYA 3JVAA 3IK2A 4XX6A 1HGYA 3R7MA 3M1ZA 1J2BA 4YJ5A 2QGYA 1XIMA 1AH3A 4HSHA 4R9OA 5A95A 1XXXA 3AMCA 1AZ1A 4HSNA 3CS2A 1DWIM 4CQDA 4BWLA 1R2RA 5LIKX 4F8XA 2D0FA 2YXOA 3GIQA 1W5NA 3TYUA 4M1RA 3RPTA 3U0HA 4MSSA 3UZXA 1LL7A 3LCWA 4NI8A 1VAHA 3R89A 4AHQA 3M7WA 4MUPA 2J24A 3T0AA 4NX0A 4DIAA 2OGJA 5JH2A 2ALDA 1D2KA 4QLJA 2C1GA 4MNKA 4XD5A 1KS0A 3IJQA 1CENA 3PG8A 3AXIA 4KFNA 4UOQA 4DB7A 3MWAA 4C1KA 5T26A 2CU0A 3G0SA 2Y88A 4L80A 4CNTA 1FWWA 3ZMRA 3W7NA 4HP5A 2PRLA 4ZB2A 4MAVA 5A6JA 2P1FA 2W66A 3VNZA 5CG7A 4IX0A 4FIQA 5F2GA 1IQ8A 4QFUA 3I6TA 1XRFA 2CXEA 5FIPA 1LORA 4OIFA 1FUYA 2D3LA 5E6ZA 1K6AA 3CZEA 3CQHA 2WWCA 2PDQA 4Z2LA 3VD3A 2UY3A 3QYSA 1VBGA 1SYTA 3EOSA 3KM8A 3AXHA 4HA3A 4QDMA 2P50A 5BWAA 3PUGA 1CLXA 3W1MA 4TIMA 5DMMA 3KDNA 1JYVA 2VTFA 4PN2A 3UWUA 1A0CA 2DQWA 1FCVA 2ACUA 4L4OA 4C6JA 3W7EA 3IUIA 1JUEA 4LNYA 1F6PA 4GHAA 2X2YA 1E1EA 2WHMA 4P2VA 5A5WA 2WLYA 4JQ3A 4QIUA 4Q4SA 3BLIA 1S38A 1XYFA 3ARXA 3UWWA 2BX7A 1T7LA 3AICA 3VDCA 3M0LA 4NJGA 2ON3A 4WZHA 3ZLHA 3OTRA 2Y2OA 2ZDSA 3BJFA 2Z6JA 4U10A 2UWFA 3KXQA 1VBUA 1GQIA 2YCKX 2Q09A 3W1QA 4GQ0A 2DVXA 1HL2A 1US3A 5LNSA 2FZ8A 3KTCA 3B8SA 1B3ZA 1OFRA 2VT0A 5ABEA 3ONBA 3P6LA 3RMEA 4A3QA 1OX5A 4PULA 2V63A 4TV5A 3WLTA 3VC5A 1UR3M 4XZNX 3COTA 3WLPA 4QDWA 4QJ3B 2BG1A 3FXYA 3W7DA 5BYWA 4JX5A 1GW9A 3DFSA 1A47A 3UD6A 1L6GA 2HCVA 1MFVA 4WXZA 2FVKA 1OFDA 1WZLA 4C6OA 1VH7A 4XD6A 1E55A 1VR6A 4MOZA 1WXJA 1BG9A 2DUAA 1QO6A 4XZHA 4ASTA 2YFNA 3HA1A 2ZZ2A 3PZVA 4GJ1A 4BCEA 3J7HA 4W8AA 3VGGA 1CXLA 5CPLA 3TWAA 3V3WA 1IV8A 2YL6A 1BQGA 3C2VA 2VYOA 3IK4A 4F4RA 1H4PA 4AQLA 1TPC1 5HULA 5F2MA 3BCDA 2E28A 3F2BA 5DY3A 3I6EA 3DI1A 4B5TA 1D8CA 3G8EA 1UD3A 2Z1SA 1XR2A 3I6RA 4U3CA 1YDYA 5BRBA 3KRZA 1AZ2A 1C8XA 5BMXA 3UW6A 3MDWA 3WF0A 3H2OA 4IFRA 4M56A 4AWUA 2HSAA 3NPXA 1SQ7A 4L5ZA 3MANA 1Z42A 4RE2A 4TMBA 3BANA 4W87A 1EJXC 3P60A 3W24A 4GKLA 2G3FA 2Y2QA 2MANA 2PLJA 3W7CA 1NIUA 4RE0A 3TYBA 1XV8A 1KD0A 2DZWA 4GYFA 4B4FA 1G69A 1SW0A 1NARA 1S5TA 3PJXA 1H7NA 2XH7A 2JALA 3URBA 2E3ZA 3THUA 1ICQA 3EWUA 4FO4A 5JBDA 2WVUA 2YA0A 7CGTA 3QC3A 4CU8A 3S47A 2R1PA 4W85A 4BF5A 2QCMA 4FEZA 2E6AA 1GONA 3IJIA 4YYFA 1UW9A 4HB7A 3KTXA 3WFLA 2X16A 3E0FA 1TPDA 3LBCA 2PZNA 2PDXA 4BJHA 5C9ZA 3IJ9A 3ELFA 6XIAA 4B5WA 4ROPA 4LG2A 4PTNA 3RU8X 5A6AA 3O06A 3I4KA 1O5RA 3K1DA 4BK9A 2ACQA 1O6IA 2J7BA 1CGWA 2JKAA 1MXGA 1JUBA 4WK9A 3NURA 1FWAC 5A8QA 5F2IA 2A2IA 4C7GA 3SN1A 2W27A 3LCIA 3TTOA 3N9SA 2QV4A 4XZLX 4E3TA 1E73M 3EKGA 1HX0A 2A3CA 1AD1A 3U6WA 5HJXA 1GUVA 4C6LA 2ZCGA 3K4WA 4RV8A 3GU2A 3LX9A 4US5A 3C61A 1EC9A 3QR0A 3THAA 3L2LA 3WBEA 3OOQA 3KX6A 3UCCA 3N4EA 5DX7A 2E09A 7ENLA 2ZZ6A 2E8YA 2DH3A 2ACSA 1M7PA 5BXRA 3V5FA 3SUTA 1U5VA 4HU3A 4ZEPA 4DWDA 4ZQPA 1YADA 5DELA 1MW3A 1QI3A 1UR8A 2X09A 4OJPA 4YL2A 3L4VA 5AYBA 3EX6A 1V6TA 5FF4A 1TYGA 1KTBA 4JYEA 4NZJA 4QG8A 2PUZA 3CL6A 4HKPA 1VCFA 4LF2A 3TP4A 1RBLA 3ITVA 1KM4A 1OK4A 4HNNA 1CK7A 1VIWA 4X2RA 1SO5A 3CMGA 1N8IA 4AC1X 5JIWA 4OHQA 3O6AA 3W73A 2DT2A 5DT7A 2IOUA 3PJTA 4GYPC 3QPEA 2DIKA 1X7IA 2XN0A 3DI0A 3FKRA 3C6CA 3LBOA 4C6IA 1UR2A 4AZIA 8RUCA 5AZ1A 1S5NA 2C71A 4J3ZA 1QNOA 3E2SA 2GDVA 4KCWA 4MNJA 2PCQA 2FDMA 2PWDA 4J2MA 3POCA 1UH2A 4JQAA 3ALGA 4ZQOA 1JDAA 3G3DA 4DHGA 3NSMA 3ES7A 4P8XA 4FP1A 2J9XA 3HBLA 2Z4GA 1HL9A 3C86A 1F6YA 2P3EA 4EXAA 3LOTA 1MW2A 1UD6A 2PF0A 4Z1AA 5D37A 3GBDA 2G95A 1RV8A 3CQ0A 2OEJA 2Y2GA 1DHPA 3DG6A 4NZ5A 1XDMA 1P6BA 3WIJA 3G24A 1IF2A 3FS2A 3QPYA 1TELA 1FWNA 4XAYA 1JCXA 2VD8A 1VFTA 4UIOA 4HHHA 1SO4A 1EJRC 1R46A 4UZUA 1RBAA 1W9XA 4RL3A 4KERA 3QKZA 2QJIA 2DZVA 2EPMX 3RCNA 1O68A 4US6A 1M6JA 4PCFA 3L0GA 3VNKA 1E0XA 2VC6A 2J8GA 1MQPA 3W7MA 1W8SA 3B9NA 3DECA 3UR7A 3W72A 3HOJA 1Q13A 1LYXA 1A50A 1EA0A 3EEGA 3LS9A 5FI8A 1F74A 2CFFA 3PTMA 1UR1A 3EA2A 5EYWA 3WLRA 3APTA 4IJCA 1Q6LA 1TJ1A 4GGHA 3TTSA 2WC4A 2PBOA 3DDMA 2BVTA 1HT6A 1QOPA 4GXWA 4KWUA 4R34A 3T0TA 2RGLA 2PMQA 3T0BA 3IGXA 1ADOA 3O6YX 3NQDA 4H6QA 1XCWA 3WDHA 5D03A 3K30A 1ADDA 4DJED 1CXEA 1LRTA 4GUFA 2EJAA 4TU1A 2GGHA 1QPNA 1UBSA 2WWDA 5AHIA 5DANA 3VK5A 1SO3A 3PC0A 4Y8FA 5IDIA 3S2MA 1UPPA 1ZPTA 1TFVA 3C3UA 4EACA 2W0UA 4LUYA 4UB9A 5FF3A 3WUBA 1VEOA 1EDQA 4GYJA 3N73A 1LLOA 2WMFA 5CCZA 3NQEA 2OJPA 1O12A 2X42A 2YB1A 4OBTA 2XIOA 4M81A 3DFPA 2O7SA 1A5AA 4I9MA 4KIRA 5L9FA 2JF7A 3W4RA 1XIEA 2Z7GA 3ES8A 3TXZA 3GC5A 2YLAA 3BZJA 5IDZA 4PMRA 1UG6A 4AAJA 3CASA 3ZM8A 3UCQA 2OELA 4DBEA 4LVDA 3BMVA 1ITXA 1V3MA 4PFHA 3EOUA 3VD4A 2GSJA 1LT8A 4QBXA 2BY1A 3FV9A 1MQRA 3S9IA 1SJDA 1EA9C 2PGWA 3CH0A 4IMCA 3PZTA 3GLCA 2JEQA 1MZRA 4A3HA 1MSSA 3RM8A 2FZ9A 1DVJA 3D5HA 1ZGDA 3WLHA 1JCTA 4E8DA 4ZB5A 1QNSA 1XCXA 3E2QA 3QHMA 4UFHA 3LB0A 2ZXQA 4QDPA 1RA0A 1CGVA 2OCZA 3MYOA 1ODZA 3T2QA 2AKZA 5A8PA 1BG4A 5FKYA 1S39A 1E9LA 2CW6A 2Y7GA 3QF0A 2VFDA 2E6DA 3GKFA 1KFJA 1TWWA 4ZVJA 3ALFA 3E6EA 4DXXA 3TJIA 5DY2A 2EPHA 4K3ZA 5BNKA 2I9UA 2Y2WA 4J40A 4R5EA 3WF2A 5H2ZA 4RPQA 4CQ9A 1US2A 1M04A 3DIPA 2CWNA 4AHPA 3UETA 2QPXA 3A4JA 3VCRA 4M82A 2WBGA 1OADA 3MO7A 3WBXA 3HG5A 3JW7A 3KZPA 2CKRA 3BQ5A 3S2JA 5CSUA 1H7RA 3WDJA 3L5MA 1QPQA 3H7UA 3DH7A 1O94A 4UNKA 4AHOA 3KS5A 4PB4A 4PRTA 1RQBA 4FXRA 3F4CA 2XVNA 3NZGA 4QNEA 2BZNA 3R1ZA 5CGTA 4GUGA 4WXYA 2WNNA 2NQ5A 2Z25A 1H63A 1XX1A 2WHJA 3NEVA 3EX4A 1D8WA 4NP7A 4X61A 4OBRA 2PDYA 2Y5EA 1LROA 3AYSA 2NQZA 5F4SA 1OBAA 1QI0A 2QDEA 1O66A 4M6QA 4C1NB 1ZALA 3OLEA 4GJJA 1RLCL 1Q8JA 2OXNA 4MFEA 2C1IA 3C0SA 2Z2UA 1DIOA 1T96A 4JTLA 4A05A 1H60A 1WKFA 1JPDX 3WBAA 5CBJA 5F4WA 3N12A 4D6CA 2QUVA 4L1WA 1JFXA 1P0BA 4B4HA 4M6UA 3U4AA 3P3BA 3BICA 4DAFA 1PDZA 3K5XA 2NV9A 1AMKA 4GYPA 4IOTA 4OGZA 4IT1A 2GVGA 4RPPA 3VNMA 1EDTA 1P4CA 3E0VA 1XF0A 4TVDA 4E2OA 4Z2IA 4YHEA 1LJYA 4ADTA 2NXHA 3IIZA 3EPOA 1QMLA 5HPOA 4X0VA 1CTNA 3LV6A 1EKOA 3C2FA 2H9AA 4HOWA 2BY2A 5A2CA 5AC4A 4Q8VA 3ME3A 2V5KA 3PWIA 4AD0A 4A6GA 1ZTVA 1WB0A 4C6EA 1W5QA 2J75A 3G8RA 3BMXA 4MAZA 5HR6A 5F1VA 4H9MA 4Q22A 4UFLA 4X2PA 7ODCA 3M0ZA 1YU0A 3RU6A 3O2LA 4L61A 1CT5A 4MZYA 3T40A 4R53A 2BY3A 1F8IA 3VXGA 2VFEA 2QDDA 4DJFA 1FCUA 5AYYA 1OIMA 3L4UA 2AL2A 3XINA 1SVDA 2W67A 2XVPA 1AA1B 4A29A 1LRQA 3SM0A 4L9XA 1VPYA 1ZLPA 2OFJA 3UESA 4FNTA 1EXBA 2WHLA 4HOZA 2BODX 2R1NA 2FPVA 4H7VA 5C71A 3FDKA 2P0IA 2BXYA 1XKJA 3LMYA 2ZQ0A 3THDA 5CEWA 4UUIA 3GS6A 1DXFA 4LT9A 2BHZA 2A7NA 3TR9A 4LOCA 1U5HA 4YXGA 3NG3A 4PZVA 4IPIA 1B90A 2PURA 2XGBA 3QZ6A 2CCRA 3SY8A 3SY1A 3LHZA 2IMRA 3NXFA 1QHOA 2J6VA 2VFHA 3E2RA 4PMVA 4BQ2A 2Z29A 3ARVA 4XKYB 2GJRA 2NX1A 3HJEA 2ZICA 2IKHA 4UMCA 2HK1A 1UKOA 1R7OA 3L4ZA 1U1JA 5HAOA 2ATMA 2PDIA 2VZUA 3PNZA 4ZBCA 4FXFA 2AQVA 4IISA 3VMOA 5C9WA 1Q7QA 3MI6A 2YXXA 4JGDA 5KINA 5HINA 3QRHA 4UCFA 3S2NA 5AB3A 8CGTA 3BG9A 4XG1A 1JDEA 4RR4A 3WD0A 2PD9A 4DZIA 1I60A 5LSMA 3WKZA 1QWKA 6A3HA 3TNOA 4AZCB 3DZ1A 4Q4QA 4H9ZA 3UZ5A 2H3DA 2X7WA 2XWDA 3FYOA 2I16A 3NM3A 2G3MA 3NQCA 3SECA 1Q65A 3R12A 4P7NA 3VIMA 3DFTA 3GD6A 4ZFMA 4POCA 3LPOA 3A47A 4ERIA 1VEMA 5TIMA 1FRBA 1Q6DA 4DWSC 3E12A 3T9PA 4ADUA 5AY7A 1F9CA 5CPMA 3MKVA 3CMJA 4PMZA 4PYSA 2XIBA 1M53A 4BY3A 2FIQA 4RZ4A 4NUWA 5KZDA 2VKZG 1EJ7L 3ATZA 4HPXA 4KIEA 5AC5A 5A6BD 3MP4A 1DWJM 4REQB 3GHTA 4KGLA 1BSIA 3T09A 2YCLA 5A6KA 1EJUC 3OEXA 3WUGA 3N2TA 5FAJA 3WDIA 1GOKA 1WXZA 2RDUA 3BGJA 1HL8A 3W25A 3JS3A 3CUGA 3VA8A 3VD5A 1JZ3A 3AHVA 5E1QA 4IMAA 3WBYA 3HSHA 4X60A 4JHOA 1KM6A 3GVGA 1V3IA 2PWGA 4NJHA 4E4UA 4DUOA 3FNDA 2FGZA 5CLTA 2AQOA 5EMJA 4CCZA 2JFEX 4LV9A 4FR6A 3CYJA 1P43A 4QEEA 1OF6A 3L21A 2A3EA 4G5DA 6CGTA 3O1NA 2GGJA 2OZ0A 3A21A 2F84A 5TQLA 3R43A 4P7OA 4MYAA 1P1XA 1W9DM 4AD2A 2QMJA 1R2TA 3F4NA 1RZMA 3THQA 3C8FA 3ABQA 4HNCA 5C70A 3R0UA 4CN4A 3IIPA 3RLVA 3BSGA 2FZMA 1H5YA 4ICCX 2P76A 3TZNA 1OT2A 3U2OA 3S5SA 3H70A 1RHCA 1KFWA 4Y9AA 1W1VA 4D8LA 3GK0A 1BYAA 4QLKA 3FIGA 2XD5A 1KFKA 2Y8VA 1JZ4A 3NFUA 4L9YA 2J74A 2Y5JA 4IG2B 6REQB 4MY8A 4ZA0A 2YPIA 3VNLA 2G37A 2HNHA 4L56A 3VVGA 4OU1A 3EEZA 4MZ8A 3SY5A 1RR2A 5JUVA 2DSUA 3TN4A 4CCEA 4WKAA 1KM1A 3DG3A 2QDHA 4UR9A 5CSRA 3PSVA 1ME8A 1MZHA 4ZR8A 4M19A 1OCNA 3AIVA 2OX4A 1TX0A 5FOOA 1DE5A 1EJVC 3NOEA 4RDZA 3PJWA 4R88A 4G1KA 4H7ZA 5BXPA 4GIRA 3MB9A 4IL2A 3ZJKA 4S1FA 3W0KA 1JZ7A 1E6ZA 1XDJA 4IMEA 3O07A 1Z32X 4GI8A 4RCXA 3W27A 2E68A 1H50A 4LAMA 3UZJA 3UY8A 2OQHA 2RJGA 4AXKA 3V0UA 1GVQA 2VRKA 1W5OA 1RVGA 4GOAA 3OODA 1EJTC 3LNPA 3HV8A 3MUXA 3II1A 4O8RA 4DQWA 3L2IA 4O53A 1FDZA 4Z2JA 2XIMA 2RJHA 1K9FA 4DZAA 1A3HA 2RTSA 3S5YA 2CHNA 5FJOA 2LLEA 3BGGA 1QFEA 4I6VA 1MO0A 4DBUA 5HWMA 4GZEA 2REQA 3H2AA 1XIDA 3WH6A 3HONA 2VR2A 2WSPA 3VFCA 3MY9A 2Y63A 3T8LA 3FHAA 1H7XA 4QNLA 2PDMA 3R8HA 4QCFA 4XV0A 5CGMA 2OYMA 5BRPA 4IUGA 3IV3A 4UTIA 4Y2WA 1CZ1A 1UMLA 1FKXA 2PTDA 4IBGA 1W3LA 3WQPA 2P5NA 3E96A 3UGVA 1O7AA 1UCWA 1W31A 3MSRA 3UR5A 3L27A 3AIEA 1UIPA 3P82A 4MLJA 3UBPC 2XVGA 1HJWA 5B80A 3LHWA 3UXIA 2QAFA 1VFUA 4LRSA 3LLFA 7REQB 4ZTYA 9RUBA 2OWXA 3VKBA 3CHDA 3N2BA 1ZRQA 4JIIX 1XG3A 3EXTA 3HG2A 3UY7A 1A4MA 3WH5A 3MI2A 1DJQA 1E88A 2YA1A 4XZ9A 4IGSA 1WNOA 3MSGA 3N04A 1CGUA 2GGIA 1K8ZA 3B8VA 3E74A 3GXPA 3QTPA 4UFKA 2R24A 3MCOA 4G6CA 3A5VA 4JDYA 2X0YA 4GY1A 4NJIA 1S2VA 3S5NA 4AG0A 2E40A 3RFAA 3UF9A 3UPBA 1VC4A 3T55A 4OV9A 5LIYX 3POHA 3WZ0E 1VRXA 1DHKA 2TSYA 3DUGA 4C91A 1EAKA 2PDKA 2YL9A 5FEXA 3CPUA 3VNJA 3P2VA 3BLDA 3B9EA 1C3FA 2CWXA 2PCEA 2PP0A 4Q32A 1UZHA 4KT2A 1VQTA 3PR2A 3UGRA 2WQPA 3OLDA 3BDKA 1EF3A 3UWZA 2BXZA 3TOPA 3THCA 3LYEA 1W5MA 3QZEA 3G6MA 3S1GA 3EMZA 1R8LA 3NQ7A 4BQ4A 3CAWA 1UWRA 4CD5A 3JZUA 1H1NA 5CZKA 3QFWA 4UQ9A 4AZGA 1W2PA 1UUOA 3LXBA 3MMDA 4JTDA 3EXRA 4LPCA 2B0MA 2Y7DA 3MQLA 3XISA 3ZWTA 2WK2A 4C1LA 2DZAA 2CIPA 1TPVA 1K7EA 5DCDA 3WH9A 1JVNA 3U5UA 4DWSA 1IZJA 4IPPA 3EWCA 1JNDA 1LQAA 2FTPA 2XH2A 1ADSA 5REQB 1L9WA 5CAKA 3WD4A 4JDBA 5HOSA 3VGFA 3B0YA 3PK7A 4MB4A 4AC7C 2OLHA 5HA7A 1LP6A 1UYQA 4PUUA 1VLIA 5A8OA 2GFTA 3GNPA 1NOUA 3TTYA 3OZPA 3KLLA 3QY8A 3ZFHA 3TK7A 5PTDA 1R85A 1PDCA 2F8QA 4W7VA 2XUCA 4D6FA 1FX6A 1W9PA 3GDMA 2QJHA 4NXSA 2E5BA 4PE8A 1LTDA 4O52A 1QJWA 2V5OA 1E71M 3SFKA 2CNCA 2CBJA 1EDGA 1J79A 2J47A 3W22A 4IIBA 4O18A 2OEKA 4GPNA 5GNZA 2D1ZA 4LC8A 3VOIA 4QS6A 1EF2A 3CV1A 3ENLA 1JGIA 1KR0A 3GW0A 3TOYA 2OU4A 4UTWC 2TPSA 3S83A 3AS3A 1EP2A 4Y9NA 2WB5A 1XYZA 3OHIA 1Q2SA 1EBHA 3RO8A 2Z00A 4LBRA 1W9VA 2J6XA 5B7ZA 5J5RA 1EJWC 3L2MA 1JRCA 3KE0A 1UD2A 4ZE5A 3ORWA 2IPFA 3ZT6A 1CNVA 3BC9A 2A3HA 2X2GA 3ITGA 1ML1A 1H5VA 3WELA 4I90A 1TVNA 4F9DA 1DQXA 3TSDA 1OJXA 1ISXA 1PV8A 1TR1A 4H2HA 2RAGA 3ITOA 1K4HA 3CIVA 3MQTA 3CIXA 1YU1A 4EIVA 2QGHA 2PDLA 3BAYA 1NP2A 4LXFA 2GVJA 3FW6A 2V5JA 1CB2A 3GXTA 2QDGA 3DERA 4AD5A 2EXOA 2CZFA 1KQZA 3P80A 4UQCA 4H9XA 2VCCA 1RY8A 3DKJA 4W5UA 4MNMA 2RKXA 3R0DA 1J0JA 1MRAA 4QTGA 4ZB0A 1EP3A 2F6XA 1JD7A 2HE5A 1OK6A 1OZMA 1K4GA 3BLOA 2EF9A 4UFIA 1H2JA 2W92A 1L8PA 3PTKA 3RJYA 1L8NA 1MEWA 3M5XA 5I3FA 2OZ3A 1P7TA 1KFLA 4HJFA 4C6FA 5IBXC 4D6JA 3RLUA 4XD4A 5IFTA 5LNRA 2NQJA 4A2SA 2BP1A 1Q8AA 4XO7A 3EX2A 2OX1A 1K6WA 1BF2A 1IEIA 1R30A 3AIUA 1E4MM 1TPB1 3TJXA 1I0BA 4WGHA 1F05A 3TSMA 1JXKA 4ML9A 3NVDA 4MLRA 3P74A 3B9AA 1FDYA 5K9CA 1KBKA 3GR8A 2SFPA 1P48A 1U30A 3SGGA 9XIAA 1H7PA 3USZA 3PPCA 5CKSA 4V27A 3WFAA 4MY1A 4Z1YA 1IHIA 4UZSA 5E9AA 3N2MA 2CBUA 1A5MC 3M5ZA 3LDVA 4N9EA 3DGRA 4RNIA 4J3SA 4AVFA 1SJAA 2J88A 1KRAC 4ICMA 2RH9A 2QHAA 5I0DA 1U22A 1LG2A 1BF6A 3R8GA 1R47A 1K3UA 3AAMA 3M64A 4H8HA 1EPXA 3CK5A 3TC3A 5ABTA 1RALA 2V0TA 4H41A 1XUUA 1PPIA 1H7OA 3P8IA 1FWHC 1DWGM 2R91A 3TEVA 3W1LA 2PDWA 1GXDA 4OUIA 1XUZA 5EMUA 2EO7A 3LTSA 1E1CB 1JDDA 2DZPA 5DMNA 3MBFA 2OQLA 1J7MA 3ZO9A 3L9CA 1KKRA 2XU2A 4Z2KA 5GQBA 2PWVA 1YE4A 5EKYA 4GIEA 2Z26A 3A9IA 2ZRZA 4KWOA 4CVWA 3G77A 5A94A 1V7YA 4U5KA 1SMDA 2EBNA 1KFBA 1YPFA 3RAOA 5T9CE 4FSAA 3W37A 1QW8A 4HPJA 4H9YA 3CMFA 3G22A 3NGFA 2HVMA 3FAXA 2PLCA 2QUNA 3AROA 4ZOBA 1W54A 4WR3A 3AWNA 1NWRA 4XUYA 3OZMA 2NSXA 1PXGA 1IXPA 1XLCA 5CC3A 1TUFA 2CERA 5JQ9A 4RW3A 1YDVA 2DZXA 2DJLA 4B15A 1VBJA 2DY3A 3OBKA 1Q6RA 4CD7A 5EL1A 3K8LA 4GO9A 1KV8A 3S0CA 4NU7A 4GINA 1IEWA 2OEMA 4B90A 4QG9A 5HQEA 1A5NC 4ROQA 4WX2A 1DXEA 2PU0A 1EOKA 4LY8A 3W7GA 4HNLA 3O8AA 3OVGA 4JX6A 2WVTA 3FGCB 1FHVA 3QMRA 1CECA 4HU0A 1QPOA 1YLVA 3B0XA 3IJLA 1KB3A 1KTCA 4NIRA 1NVMA 3PZNA 1FWSA 2IQ0A 2CLMA 1G5AA 2EPNA 3CQJA 4RX0A 3N3TA 1L6JA 1OGSA 1RH9A 2ZC8A 2XWEA 5AKQA 1K8CA 1Y5VA 2DZBA 4TVUA 3T6CA 2DJXA 1W3NA 2Z27A 5FAGA 3W2LA 3P0XA 3RJXA 2XGIA 3EXSA 4ACZB 3C2EA 4DELA 3YPIA 1E72M 3IJ6A 3ITLA 2ISSA 3CHFA 1O1ZA 5HWNA 1S5WA 1SMAA 1BTCA 2DSVA 1EOMA 3P14A 2CZ5A 3VMPA 2I56A 3BSMA 5D38A 3GAKA 1XINA 1QR7A 2Z2AA 4EX4A 2A21A 2VX7A 5J8LA 3WF3A 1DL3A 2QPUA 5I06A 3VOHA 3W6MA 4LVFA 5CPQA 3VOGA 5H8MA 3QMSA 1KM0A 3M0VA 3WK2A 2RUSA 4AWEA 2DT0A 1P0EA 4MY9A 2XD1A 2XFRA 4JIQA 2Z1KA 1MXSA 4CN6A 3W76A 2WPBA 1JR1A 1V08A 3C56A 4U2YA 3T0DA 1XYCA 3GH7A 3ZQ9A 4PA8A 4HU8A 1XIGA 4CCDA 1ZZMA 4MJZA 1P1MA 1EWEA 4ZOCA 1XHGA 1BSLA 3KHDA 1KA9F 1Q5MA 1X8FA 4ORIA 1R7AA 2GOKA 4EOUA 1AL8A 4QITA 1V3HA 1YYAA 3W7JA 4FA3A 3QQ0A 3VKKA 2BVDA 3U7BA 2ABBA 3LM7A 2AAAA 2ZTJA 4ZQNA 1RJRA 1XJBA 3WNMA 2ISFA 2HBXA 4JTKA 3HQNA 3DN5A 1UUMA 4KWVA 2CZDA 1XLMA 1VS1A 5FACA 4S3FA 4IJBA 3EDFA 4BZYA 4CNSA 2J77A 3GBEA 3C52A 3SGUA 2HXUA 3IJ7A 2P53A 4B5SA 3WH8A 1I9CB 2XN1A 1ALDA 5GJNA 2DVUA 1JZ8A 1G4EA 4ZO6A 5CXPA 3AZRA 1RAKA 3TYCA 2NVCA 1K02A 4PMQA 4KWWA 3TMQA 2ZYFA 1GVFA 4JQ1A 4PMDA 1SM9A 3NYDA 1XBXA 5I79A 1S3TC 2E25A 1F5ZA 3SI9A 1Q6EA 2PDUA 1IWAA 4H6KA 2OGYA 1XLHA 3SSZA 3LD5A 3L28A 1MEHA 5EY5A 4I9JA 1YW1A 1FA2A 1C92A 1Q3NA 4AD3A 1FH9A 2XISA 3K1GA 1QU4A 1H0IA 1EH9A 1OYAA 5LGZA 3VOJA 2E1DA 4PCSA 2WMKA 4B5XA 4GYKA 3PBWA 4RLIA 1VJZA 1PTGA 1VFOA 2Z2BA 3LG3A 1VD6A 4MG4A 1TUXA 1TV2A 4JEQA 4UQEA 1QXLA 4QCEA 2C0AA 1VPXA 3EB3A 1JI1A 2W62A 3W1UA 1CEOA 4HU4A 2YR1A 5G1YA 1SFSA 4MWAD 2ZA1A 4GX8A 4V1YA 3GVRA 3CV6A 1UBPC 5CGQA 4UTJA 3NCOA 1K8XA 2D22A 1TV3A 1I1XA 4IL0A 1GYLA 1A49A 3C2YA 3VGBA 3SRKA 5HMEA 4OQVA 3LK6A 3AIBA 1QBBA 1OX4A 4WDXA 3L67A 4OOUA 1M3UA 3FK4A 3WQ6A 4JPGA 1YQ2A 2D2OA 4NJKA 2D20A 4F0LA 3WD3A 1U83A 2G3JA 1MYRA 2QXWA 2PZ0A 2BOFX 5AZ0A 2E9LA 3GUGA 4GG9A 1UIOA 3PSWA 2ZUSA 3VGEA 3LU2A 3BOLA 1RP9A 1WP6A 3ABRA 1HP4A 4PH6A 1IZCA 4G7FA 2Y5SA 3I3EA 4INFA 3STCA 4S3CA 2XN2A 4GKTA 1T6MA 2E9BA 1F7BA 4IBBA 2GVEA 2VR5A 4XZMX 2ISDA 3ERPA 3W7OA 1PE1A 2PDNA 3LQGA 3M0IA 4I7VA 5DBUA 1V4YA 2FFIA 4WKHA 1XLBA 3M5VA 4JTQA 3WMCA 4HGXA 4EK7A 3SCNA 2GJXB 2ZZ7A 4UOJA 4FZIA 1NF7A 1GOQA 2WZIA 2XYLA 4QJ1A 3HN3A 3BAJA 5A2BA 3TA9A 5JBFA 2QF7A 4NAEA 1PBGA 1SJCA 4IQDA 1GEQA 1Z69A 1I45A 1X1OA 1KCKA 1PTAA 4U3AA 5HUPA 2OB3A 1PZ1A 4O0KA 3W7HA 2VHLA 4E3VA 1C8YA 2WANA 3SSJA 4WY0F 4HNUA 3NSXA 3EPNA 2YL8A 1Q4WA 4XQ6A 4CNUA 4IQJA 3R0KA 1PYMA 1HUVA 3QEZA 3RX3A 2PTZA 1WCGA 6ENLA 4M6VA 3KOZA 1C9DA 1SZNA 2TYSA 4JICA 4HYRA 2WXDM 1BQCA 4DNHA 2I7GA 5SWUA 2VCAA 1TIMA 2OSYA 4PFMA 5BU6A 3GFZA 2CLIA 4YTUA 3ABXA 1JUKA 1YXYA 1A3WA 4W93A 3EX1A 3BURA 3CBWA 5K4ZA 2FKPA 5G2WA 4RW5A 4UQAA 1FWIC 4LCSA 4GUHA 2Y61A 2AKMA 3GZAA 3SRDA 4IP5A 2F61A 3FA3A 1BEUA 3A5FA 3HB9A 1LL6A 3BLLA 2VRJA 4K8GA 3OG2A 3BAXA 9CGTA 3G1XA 3O0KA 1LG1A 3LCXA 5BWFA 4QISA 5HUOA 4EP8C 2ASHA 3LLXA 1XIFA 3PFMA 4IMDA 1W3TA 3VIJA 3UXDA 2NX9A 1EZ2A 3H21A 5HPCA 1JF5A 1SZGA 2FH8A 3GG0A 2Z1XA 1TWSA 5RUBA 2YCJA 3Q45A 3ANUA 4AZHA 3ARPA 3WQCA 4YWIA 1PWLA 2GYIA 4S3DA 4ZO9A 1DQUA 1KBIA 1E4LA 5BMWA 1YU3A 2BGNE 1GQKA 2IKIA 3VKJA 2P0OA 3SURA 4J1OA 3OVRA 1B3OA 3MA8A 1CGTA 3IVSA 3N13A 1HZYA 5AHNA 2HWGA 2W91A 4NNAA 4BQ3A 1Q63A 2DT3A 1KRMA 2V2HA 3CEUA 3OGRA 4O50A 2Y6ZA 1YE6A 3L0KA 4MB1A 4GLEA 1ISYA 2ZX7A 5K4XA 5HJLA 4HHPA 3V35A 5CLWA 5FJIA 2WSRA 1NWSA 3W29A 2D2HA 1S2CA 4DM1A 3PPFA 3HTWA 1EEXA 1TX2A 3EDJA 2I5QA 1PX8A 3LENA 3GU1A 1UA7A 4JQ2A 2GJNA 3B06A 3PBUA 1YXCA 3AU2A 3RCYA 5FL1A 3SUUA 4Q6JA 3VFLA 2V2CA 3PVFA 2E8ZA 2VOTA 5EA9A 3CPGA 3OA5A 3TCEA 1UH4A 2FFFB 5BCAA 4DJEA 1AL7A 3WLQA 3KOWA 3BWWA 4C7FA 3VDBA 4GI4A 3SN4A 3I7QA 3MTWA 2YKKA 2WAGA 3URNA 3NZRA 1SO6A 2CBIA 1V3LA 4ZL1A 1KWGA 3AMGA 4OJYA 1C29A 4GY7A 4LSBA 1UZ1A 4AIUA 3AXMA 1W0MA 3GG7A 4MDOA 4M7SA 4Q8NA 4N2YA 2CLFA 2E77A 3GB6A 1FWGC 3RNDA 1A5CA 3G2GA 1W1B1 3IRSA 2NSOA 4IP7A 3JU2A 5TBOA 3MUCA 1JCYA 4YN5A 1C7SA 3B9OA 3N19B 4HCHA 3NDYA 2IS7A 3S2LA 4S3AA 1M9HA 3LCLA 2X0HA 1T8XA 5D2TA 3OP2A 3MV11 3G18A 3BXWA 2BMBA 4WUIA 5A6LA 4I3GA 3ARUA 3M0KA 4QJ4B 4B5VA 4Y8EA 5G5IA 4J3XA 3TXVA 3MS8A 3NQAA 4DO6A 4NAFA 3B97A 4EPEC 1DOSA 1PB0A 4MPQA 3W9ZA 3HGJA 4NZ3A 3BG5A 3W01A 2QJNA 4JTTA 5CQ1A 3KBSA 4V15A 3LSBA 4XISA 3S1XA 1ITQA 5CJNA 5F1UA 4JR5A 1FXQA 4A2RA 5T9BG 3NAVA 5M2FX 3NQFA 1UWAA 4I5RA 1F76A 3GFXA 4IF2A 1Q2RA 2POZA 3B9DA 3O16A 1ZL1A 1L6YA 6ALDA 3OLIA 1C93A 5AOUA 1SSGA 2WMIA 4UMAA 4GH9A 1ZJAA 2F38A 1H51A 1ED7A 4F0KA 4GH1A 2HVOA 2VX4A 3MZNA 3OZYA 1IYXA 2C8NA 2YXGA 4QXIA 3B8WA 3I3BA 3G1YA 2DORA 3GTNA 4TV6A 1E3ZA 4F2BA 1QOQA 3CH9A 1YXDA 2WPGA 3P7YA 1J0IA 3K46A 1E51A 3G5EA 2PAJA 3SO7A 2DP3A 2NQLA 1RA5A 3LQLA 1KXQA 1LBLA 3QH2A 1CGXA 2ACRA 3HPSA 1XC4A 3W07A 1X7FA 2ZXAA 4QE1A 4GVHA 3OBEA 2FH6A 3ZVHA 2O55A 1E0TA 2PGRA 3CT7A 1DTNA 1UWIA 1ECEA 2BTMA 5I77A 2GUBA 1GORA 1QASA 3ARTA 3KVKA 3H26A 2IKJA 4LGXA 1C90A 3OJGA 3L68A 1DWAM 4H01A 5XIMA 1HP5A 3R25A 4PR4A 1BRLA 3F2CA 3W53A 5HATA 4I6KA 3DYPA 2PLKA 1C8QA 3ZSTA 5KSWA 4DYJA 1V6WA 3FJLA 1XLKA 3KBNA 2ZUWA 3IGUA 4A22A 3DXIA 4FF5A 1XFBA 4PMNA 2G41A 2D3NA 1R3RA 3DU0A 1MDRA 7PTDA 4U5IA 3S9ZA 1O60A 4Q8TA 1W9BM 3WCZA 2W5FA 3GIPA 1XC6A 2G0WA 3GTFA 4TO8A 4CU7A 4Y6GA 2FVMA 1XD0A 1G9HA 1IWPA 4ZQCA 3TZFA 4ZZ9A 3KCJA 3JR2A 1E5NA 3IVUA 3IV8A 1VPQA 1T0OA 1JDFA 3VTRA 1V79A 2Z6IA 1U33A 2HISA 2JE5A 4L64A 1DIDA 3AUJA 3G0UA 2OT1A 3VIGA 1S1RA 3KL0A 1GCYA 1ZENA 4C6CA 5TF0A 2PWEA 2ALRA 3E02A 1G4TA 3AS0A 5CZJA 5E0FA 4N0RA 4MTVA 2NQ9A 1HJUA 3RF9A 3F4DA 4P61A 1E0UA 2WM1A 4IBJA 1AQHA 4TQTA 3S46A 3WEMA 4IPJA 2Y4SA 3KDOA 4RJEA 1A5BA 1DJYA 3U2CA 3V1HA 3MSYA 1W3HA 3U57A 1JULA 2FB2A 1K03A 3GH5A 4UQBA 7A3HA 3NPWA 3NQBA 1E40A 1DXIA 3H4XA 5JBEA 2XH0A 3GTHA 3EDEA 2YIHA 4HTYA 3H8AA 1TPWA 1JF6A 4LALA 4PMYA 3NDOA 2PDBA 1XWYA 3UCDA 4O1AA 1DBTA 5EFDA 1F3WA 3QLLA 1KLYA 4PGLA 4A21A 3VGDA 2PP3A 3PS7A 3DCPA 3SQSA 4JTGA 4F40A 1M7XA 2CZEA 5A6TC 3NSNA 3NM1A 2BBFA 1WYIA 1W17A 2YL5A 3VUPA 3WLOA 2CLHA 4QQ3A 4O15A 3N6QA 3AFBA 3CZJA 4GUIA 4Z2HA 2DW7A 4IMFA 2GSHA 1H1ZA 2A3AA 1TG7A 4UFMA 3ECQA 2FHCA 4BR1A 4WQ6A 3RDKA 4KEMA 4ZSTA 1JQVA 4C6PA 4AFYA 4KRZA 4FK9A 4QRNA 2AGTA 4AB4A 1B0IA 1K9TA 4QX4A 1AJ0A 3LV5A 7TIMA 5IHSA 4W9TA 3HGSA 2CYGA 2FN2A 2NWRA 3T1GA 1GJUA 1RJQA 3W74A 2PTXA 3AZSA 2ZVIA 1CLVA 4W5ZA 3SN0A 1JRBA 1IXOA 4B91A 3SJ3A 3RR1A 3KUMA 4FR1A 4PMOA 2DZSA 3LZ3A 4MKNA 2A85A 3CLWA 3ZYZA 1CXKA 1POJA 1UKSA 2YDAA 5HMSA 4A3UA 3N15A 1DKWA 4E2DA 5DXYA 4NNCA 3RPDA 2E7FA 3GDBA 3I7SA 4KKXA 1AMYA 1F3XA 3A6OA 4Z1BA 2B4GA 1W6TA 3GNDA 3IGHX 5FEPA 1ZFJA 5EU9A 3HQPA 1B4EA 1TSIA 4GZJA 2XHYA 1M68A 3BW4A 5FA5A 2J25A 5BOOA 1TRIA 1XYLA 3W7LA 2PDCA 2ZXDA 4BEUA 3SDOA 5I3HA 1C91A 3O63A 3NOYA 3O6CA 2Q01A 1S46A 3NO3A 4TVCA 1FWCC 3RM4A 4GACA 2Z1VA 3UP8A 3GXDA 2EG6A 1KBLA 5TNVA 1RSCA 2CLKA 1MVYA 5I3KA 1A80A 1FP9A 1Y5WA 2CHRA 4PL1A 2QEZA 2J7FA 1OT1A 5A6BA 1R3TA 4OFCA 5FL0A 3KAOA 3KZSA 1UASA 1L2UA 2PDGA 1X38A 2CC0A 2GZXA 1KW1A 1P0KA 5AC7A 4DJDA 3CL8A 2X1SA 4N02A 4C6KA 3PZIA 4B9YA 4F0HA 3S6TA 4EWND 4DUVA 3OLGA 1XLAA 1B57A 2WV8A 1RD5A 4D6DA 3QR1A 2DSKA 1FFQA 1J0YA 4AY8A 4PUWA 1QTWA 4HHLA 1V51A 1HO4A 2O9TA 4YVVA 2JCHA 1TQXA 2C6QA 3BJSA 3MZ2A 1RCQA 3O7UA 2XM2A 3WY1A 4A3RA 2IUZA 4DUWA 1V3KA 3PHAA 3LMZA 4B3ZA 4LY4A 4LCRA 3TQ0A 3T81A 2R82A 3T78A 2CEQA 4LYRA 3OU8A 1ZAIA 4E6MA 4DEFA 1HNYA 4XB3A 3ITYA 3P5YA 1IIHA 4TX6A 5AYIA 1QOXA 2J8FA 3H23A 3ZXWA 3EPMA 3BV7A 2FGLA 3B04A 4GHRA 3O05A 1KV5A 4WSHA 5XIAA 4GXMA 4JFUA 1DORA 4H7CA 4KF1A 3TYZA 1MQQA 1PKLA 5CAHA 2PTYA 3WK1A 1R87A 4C60A 5F7UA 3VI2A 3P93A 2NT0A 4K2SA 3TU9A 4FNRA 2NXIA 1JCLA 3W2NA 3KVJA 1EEPA 4AMCA 4JN7A 3R11A 4IUOA 3OGSA 3QXBA 3GQYA 4Q7NA 1MW0A 1YNYA 2JE8A 5T8GA 2AOSA 2NQHA 2VDHA 3OW1A 3F4VA 2J9ZA 4WRHA 3NL2A 2OLAA 1F4AA 2H9AB 3EWYA 1MI3A 3GTXA 4O17A 2QQ6A 3WQ4A 4AX7A 3S42A 2HJPA 4IX2A 4A8NA 4ZENA 3ZT7A 3DENA 2GVLA 2D2GA 4LQ1A 4ONVA 5E5CA 3WQDA 5EBAA 8XIAA 3ZJ8A 3SJNA 2VNCA 1XL9A 3KL5A 4MADA 2HK0A 5FEWA 1ICSA 2QUUA 4HN4A 3TA6A 4P7RA 3F5JA 4MJ2A 3EBVA 3L4XA 4CU6A 3QLDA 2AL2B 3Q2DA 1EHAA 4J7RA 5AECA 1MFUA 1QATA 2YDRA 5KTLA 3PG9A 2OT0A 3W87A 1UJPA 2PRMA 4F0SA 1CXHA 1TJ2A 1OABA 2IW0A 2XH4A 3FKKA 2CBVA 1V6UA 2ESCA 3C2OA 4ZOAA 4Q7IA 2J79A 4ENLA 2NZLA 3P67A 4GIYA 3ZLFA 3W2MA 1V93A 3CQIA 4Q8QA 2QV5A 2VMFA 3CLMA 5E0KA 2A7RA 4AZ7A 4AYGA 4LUSA 2QR6A 5CC6A 4A3YA 1SZRA 4NX5A 6XIMA 3VIIA 3W2JA 5KEZA 4OUEA 4DZ5A 3IACA 5HNNA 3NL6A 3MUIA 3M07A 3A13A 1R3VA 3M0XA 5BOEA 2Q8XA 2RFGA 3EWZA 1J4EA 3SUVA 3HGOA 1ONWA 1C8VA 1BVWA 1MMFA 4YNGA 1XLEA 1FFRA 1VYSX 4HA1A 4LVBA 3RLHA 1X6LA 2GOUA 4AH7A 2WZTA 1PIIA 5M3WA 6TAAA 2Z28A 3S6DA 1XLFA 2PC4A 2QCCA 1GKRA 3AZTA 1IT8A 1A5KC 3LI0A 4YTQA 5HANA 3C0JA 3E0IA 5FESA 1OCBA 1XLLA 4DYEA 3NR0A 2BWGA 3V7PA 1I2OA 3F5KA 3P81A 3F7JA 1I2RA 1EPVA 3HG3A 4RE3A 1HKWA 1YBQA 2BV9A 3NEHA 5FSDC 4FPSA 3V4BA 2L5HA 2VWSA 2VJXA 4O1DA 4Y96A 1FWDC 4DAIA 5HMDA 5IHRA 1RBOB 3L4WA 4RDWA 2MNRA 1OFAA 4AD4A 2DVTA 3AIQA 5CSSA 1YKWA 1OYBA 4HK6A 1IWBA 4MPKA 4K1GA 3VIHA 1XGZA 3MVIA 2W63A 1WV2A 2YCLB 4IQEA 2ZWYA 2YX0A 2DIEA 4HPNA 4AUBA 3RLGA 2GWNA 4ZXLA 3AMKA 1H0GA 3T0CA 3RRXA 4IBEA 5DRIA 1UP3A 3GHSA 1AH4A 5EFFA 3LCFA 4E5TA 3NWRA 1K70A 3K8MA 3WX7A 4NT0A 4JN6A 4WVXA 3WK0A 5F4XA 3VO0A 2OLSA 3MJYA 3RPMA 1OVDA 1G94A 2OSWA 2CETA 1K9EA 1IEQA 4PCTA 3WO8A 4L7ZA 4GQBA 4LS0A 2WYSA 4PUEA 3F03K 3PANA 3PP7A 4RKAA 4DJFC 1XGEA 2WW5A 3RO6A 1CWYA 3WK3A 1D9EA 3A4WA 4Y9MA 1F73A 5CH9A 3GYCA 3VKCA 4Q8WA 3T8QA 4GNVA 1KRCC 1ZNNA 4LANA 2WJDA 1X1ZA 4JTCA 1FP8A 3HFYA 3DHUA 4W86A 1WDWA 1UP2A 3LRKA 1GG0A 2O9RA 3HV9A 3W1NA 1NFBA 1TTJA 1MUWA 2HBVA 3PBGA 2BNJA 1QUMA 3U5YA 2C91A 3A9BA 2VL4A 3N3FA 4FHAA 1PKNA 3V5CA 2PD5A 4JN8A 4HD5A 4NL1A 3F5LA 4C90A 1DV7A 2OOGA 3BARA 4Q4OA 4NG3A 1W3IA 1TA3B 2FZNA 3CTTA 2FB3A 3OVQA 3TTQA 3WQEA 5DN1A 4J3WA 2H90A 2PDHA 3LY0A 2ZRYA 4H9TA 4HVXA 1KRBC 2XM1A 4UTLA 3EB2A 4ES4A 4S3JA 4ZOEA 1OGBA 4L4LA 3AI0A 5DO8A 5AYZA 1QRQA 3G1VA 3SCTA 1EB3A 3RG6A 2HDJA 4NZ4A 3R6IA 4EF8A 1WUEA 1EWDA 2XVLA 4OT7A 5ABGA 3I65A 1RQEA 1OFBA 2YB4A 2AL1A 2XIJA 1FWJC 4QS5A 3LEPA 4KH2A 2WNWA 1FWRA 4GCAA 4NKCA 2JIWA 1OFOA 4XWUA 3PAJA 4JL1A 4IIGA 4C6QA 3C2RA 1I0DA 3MMTA 3NVTA 3A24A 3IS4A 3HQOA 4K7YA 3NZ1A 1H49A 1TV7A 4JY9A 1OM0A 1NAL1 1XQLA 3BH4A 4JTIA 4X22A 4J28A 3QW4B 2XZ9A 4CEUC 1P0NA 4H4IA 1W5PA 3HGRA 1EYWA 1ZBVA 2REQB 3OPSA 1Z7AA 2HS8A 1LLWA 2PC8A 3MUAA 1PHQA 3DHDA 1KWKA 1BYBA 1YMYA 5HNUA 1TE6A 4PB5A 1TV4A 5AYXA 4Q8UA 3KFTA 2QVNA 3N3MA 3UXKA 4BS0A 4N6EA 1W3JA 1MNSA 1ONXA 2GQ8A 1REQA 3NL5A 2Y2NA 2YLLA 2PODA 2Y2JA 3BQ6A 3MHUA 4EAYA 1GG1A 4NY2A 2PLMA 5D9OA 3LCHA 1G7VA 3TLLA 3PTDA 1OGGA 1FOBA 3BLKA 2Q6ZA 4A35A 7TAAA 1XM3A 3LZ5A 3UR8A 4AIOA 1CYGA 2G3IA 3EA3A 3GDRA 1GKPA 4GH3A 3LLDA 1WO2A 3H7VA 2QCNA 1E8BA 3GAYA 1QNQA 5D9NA 1E6RA 2Q8ZA 4N7QA 1KC7A 2QCDA 2NUWA 4AZBA 3VOFA 3VNYA 3TNBA 1NH6A 4XZWA 4MWAC 3D46A 4IMGA 1E6PA 3VDAA 2ISVA 4Q33A 3FEMA 2ZRWA 3TC7A 4EWJA 4ERGA 4HZ6A 1Z6KA 2QVHA 1WX0A 3EB4A 4O4VA 4H8UA 5D32A 4E8GA 4K8EA 1QCWA 1G01A 1WDDA 4MDPA 1ZCCA 5CPNA 4WEVX 3UZWA 5ABFA 4G8TA 3H12A 2Z7KA 1UWUA 4NRRA 2YSWA 1GOMA 2Y7FA 4ML4A 5LXXA 3HPAA 3BMWA 3QTGA 3N2OA 2VCBA 1XS2A 4GHLA 5G4EA 3TW9A 2G96A 2ADAA 1NWTA 4G56A 3TYDA 4IQLA 4JFVA 1DQWA 1QHZA 3GDLA 4EXBA 1OYCA 2D0HA 2BOGX 2ICSA 2YCEA 1Q7ZA 1H61A 4WY0A 4ACZA 4XAFA 4ZGYA 3M6YA 4MFDA 4PC8A 1TVPA 3CWOX 3GM8A 1XLGA 1Z41A 1MWOA 2Y2KA 3ID7A 2D24A 4WJ8A 2P88A 4GCXA 3MCMA 4MJ4A 2Q3OA 1QO2A 1CW2A 2FFCA 1KCXA 1GZGA 1UOZA 4RNJA 1NM9A 2ZZ4A 3GVWA 4DWSB 2VM8A 1E56A 2VZVA 4JNMA 3VIOA 1QK2A 4LS2A 4YWSA 3VIPA 4GD0A 4C6DA 3AS1A 4KCUA 1GEHA 1T99A 5BXTA 2PDJA 4PMJA 3SIMA 2BSLA 3N2XA 5I00A 3VILA 1LLZA 3HQ1A 4LEFA 3AJ7A 3KWXA 3CO4A 5GVJA 4AU0A 2TODA 2FZBA 3CUIA 1ZSXA 3WQWA 4AYSA 1YDOA 2HE8A 1PEZA 4GVFA 3GU9A 4LBSA 3T7VA 1H3GA 3QV9A 1JCJA 2HZGA 2V30A 1UQYA 3LI1A 2AMXA 4DO5A 3GE7A 3CV2A 2UY4A 1TREA 3VD7A 4KPLA 1OFEA 4KEVA 3FCPA 2VVNA 5DCBA 1A4LA 1JEZA 1VHCA 4IIFA 1TR9A 3NPVA 3OA3A 1XBYA 1HKVA 2WVVA 1PZ2A 5A6SA 1L2QA 4NI3A 3TE9A 1E0WA 4QP0A 4G7EA 1FKWA 3RITA 4W4QA 3VYLA 3QMTA 1UZ4A 3BPWA 2FQIA 3KBVA 2J7EA 2WMHA 2NLIA 4KQNA 3KBMA 5ECUA 3SB0A 1XICA 4N9BA 2PPGA 1DJXA 3REQA 3W7IA 1OCJA 5HNRA 2YW4A 3PZGA 2HRWA 3W70A 4QHRA 4S38A 4HJWA 4Y9PA 3EYPA 1R9ZA 4NHVA 3FDGA 4H6RA 1BKSA 1GQJA 1N55A 2YW3A 3N18A 1G4PA 5FF0A 1S5MA 3DX5A 3QGVA 3TJ4A 4YU1A 1C9WA 4B3LA 4JKKA 2FHFA 2VFGA 1GPFA 1YU2A 2C15A 4UC5A 5GNXA 5DMLA 2BLEA 4MYXA 1ENUA 3MWCA 1B9ZA 3HMCA 3OQEA 5JIPA 3TAKA 3RIKA 3UQNA 1R2SA 5FSEC 4PUNA 4PTMA 3JZEA 4KWSA 5G1TA 2D69A 3AJXA 1IT7A 3B8UA 5MKGA 1V7AA 1YRRA 3KTSA 3JUGA 2JEPA 2PI6A 3BAWA 3AISA 3AQUA 1OEPA 4HCLA 3VAVA 2IXVA 4KW2A 3BZGA 4XVEA 1J5TA 2J8TA 3ABOA 1WAWA 2ZUVA 3TAOA 2I14A 1GHSA 2Y70A 1PSCA 1P7TB 1X1NA 3KRBA 2C13A 1F61A 3BW2A 3VINA 3T44A 4KESA 3TYEA 5HMFA 4JBRA 2V8ZA 3PUDA 3LGDA 4OJLA 2YBVA 5CPOA 4JIPA 1VCGA 2O9OA 3ARYA 1Q4NX 2W4XA 3MP3A 1V5XA 2F2KA 2JK2A 3KP1A 5EGRA 3N29A 1Z9AA 1Z89A 4RNHA 3RX4A 4HBKA 4GBDA 4HOXA 5I03A 1LWJA 2V38A 1I4NA 1FHUA 4PUKA 3Q67A 4PBEA 5G2IA 4YTSA 1NF0A 2E1WA 3B0PA 1TPUA 2QCGA 3PWAA 3D3AA 4PB3A 2B7NA 1KTNA 5BOFA 2VDIA 4QQUA 1KXVA 4RK8A 1LWIA 5CPTA 4P5UA 4HQVA 3WBWA 1BLIA 2B31A 3OB8A 3W23A 3QR3A 4DJDD 2ZRVA 4Q4MA 3M41A 1XSJA 4DO7A 3PJUA 1P6CA 4IFKB 4RDVA 3UYCA 4BI7A 4B16A 3PN8A 4Q3MA 2INZA 3VNIA 4XO6A 4X9YA 3ZVIA 5KZ6A 4L6DA 3IJ8A 1XKYA 4FLSA 2C16A 1TV5A 4KS0A 1B1YA 3BW3A 1MW1A 1BAGA 1W1PA 3E1F1 3UA4A 4A8IA 1E3XA 3CHVA 4OVXA 4ZO7A 1OINA 1K1DA 3K4AA 2G3NA 4YTRA 4MWAA 1EXPA 2OYKA 1PS9A 1E4NA 1CLKA 1N8WA 3HPZA 5D02A 1AJ2A 3GR7A 2DV0A 1OY0A 4HMEA 2XFYA 2C1HA 5LHEA 3W86A 1JAEA 1Q85A 3BL3A 5AVNA 1O5KA 3U9IA 3IGSA 1XH2A 2A3BA 1Y5XA 4R27A 5E70A 4BQ5A 2H8ZA 5M1TA 3W7KA 3W38A 4KFPA 4F3HA 3SCUA 3B8TA 3TN3A 1V77A 1QBAA 3ZR6A 1DJZA 3R58A 5ENLA 3QVQA 4JXCA 2VEKA 4M5PA 5IOBA 3M4HA 4GWEA 4PSRA 4UXDA 1Q6QA 4JEJA 4TX8A 3T2OA 4E4PA 1JL8A 4GXPA 3ITXA 4RDYA 1JYXA 3HJZA 3H4GA 4OV4A 4ZQRA 3NQVA 3K13A 3R79A 4E2VA 3AHXA 1LCOA 3WDRA 2V3GA 4JFWA