4NZ3A

Structure of vibrio cholerae chitin de-n-acetylase in complex with di(n-acetyl-d-glucosamine) (cbs) in p 21 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 145
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz3A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz3A01
3S6OA 2W3ZA 3CL8A 4M1BA 2VYOA 4HD5A 4NZ4A 2IW0A 2QV5A 3HFTA 4OUIA 4NYYA 2NLYA 4NY2A 2C1IA 4NYUA 4NZ5A 1W17A 2CC0A 3RXZA 2DFAA 4F9JA 1V6TA 3WX7A 4U10A 1W1A1 1W1B1 1NY1A 3CL7A 2Y8UA 2C79A 4L1GA 4WCJA 1XW8A 4LY4A 5BU6A 2E67A 3CL6A 4V33A 1Z7AA 2I5IA 4F9DA 3VUSA 2C71A 2C1GA 3QBUA 2XU2A 5JMUA 2J13A 4NZ3A 4NZ1A
chains in the Genus database with same CATH superfamily
5BRQA 2QCGA 4C6OA 2QV5A 4QDMA 3DEQA 1M53A 1FWBC 3K46A 3QY7A 3WLJA 1RH9A 3ATYA 1WUFA 3NL2A 1V4YA 4UTIA 2WC4A 3CPRA 3KZSA 1RA0A 4WY0F 4Z0SA 4FI4A 4IIBA 3F4VA 1VIZA 3BLDA 3KDOA 2INFA 1KW1A 3LLFA 3S42A 3KBVA 2JBMA 4DXVA 3PZUA 4GFIA 4Y9OA 1PKNA 4B9ZA 5XIMA 3ANYA 2ZA1A 4TR9A 3S6OA 1VPQA 2YB4A 4HQVA 2YCLB 1VLWA 3W7CA 3B9AA 3WMCA 4ZB0A 3BICA 1MQRA 4JFSA 1KGUA 3B9EA 5CGTA 1JI1A 2PURA 1KRBC 3OLEA 4DQWA 2FTWA 3SR7A 3S9IA 3FKKA 1VQTA 2V5DA 4IWWA 1PCKA 4YWIA 1TTJA 1GJUA 4DYJA 3QGKC 3MO4A 3GDBA 3KOYA 2FH6A 3SFKA 1YE6A 4LY8A 5A95A 1QJWA 2B7QA 2J7FA 5A94A 4XB3A 5G5IA 1Y5VA 2ZUTA 4DBSA 1BVWA 1D8CA 3TYCA 1H51A 3EOEA 1P1XA 1HZYA 2BXZA 1OC7A 1EJUC 3B97A 1K7FA 3REQA 3IS4A 4BY3A 4EWND 2ZRXA 4O4VA 1E6XM 2WMIB 2QULA 3OODA 3CZJA 3MMUA 2E4TA 1TV5A 1VFFA 2POZA 3U6WA 3QW4B 3KAOA 3S1XA 1RQEA 4DJDD 4JTLA 1S5MA 1XG3A 4OVXA 2QNEA 1Q4WA 4JTSA 3A64A 1ZP3A 1OT2A 2WBKA 4JFTA 5LNUA 4O18A 1FBAA 3S1WA 3P81A 1VFMA 4D6EA 1F8MA 2JGQA 4WSKA 1M7PA 2WCAA 1LCOA 3FGCA 1XISA 3SCUA 4F4RA 3B03A 3TR2A 4JPGA 1GNXA 1UG6A 4XIMA 5FEWA 1HKIA 2GGHA 1FWDC 3VC6A 2YA2A 4R88A 3OVPA 3BLLA 4ERAA 2Z1SA 1ITQA 1MEHA 3WD0A 4HMCA 2O9PA 2QCMA 5B7ZA 1GQNA 4H9XA 2Y85A 2YYTA 2HPMA 3EWBX 1CGWA 4YMZA 1MW3A 4W86A 1E73M 4HZ6A 1QNRA 2VFIA 3GXTA 3EX4A 4UNIA 1UWTA 3KS8A 3W1TA 4MNLA 3GY1A 2OG9A 1JZ2A 1H50A 3KBSA 2V2CA 3GTIA 4CNPA 1KCXA 2I56A 1IQ8A 3FYYA 2QGHA 3U0HA 4HMNA 1D3CA 2XG9A 1N8WA 4G2DA 4XZIA 1W9DM 4XAYA 3VNLA 4QS5A 4FNSA 3WNLA 5CLWA 4JTDA 3BVJA 3PUOA 4IL2A 3LCIA 3N15A 5FAGA 4IMCA 1DOSA 5F7UA 5BU6A 4D1IA 3GVQA 2QMKA 4RX0A 2FMNA 1Z44A 3ZSSA 4XSMA 1PX3A 5K4XA 2UBPC 5HQLA 4KFOA 3GWQA 4Q4MA 2Y5JA 3LBOA 3H2EA 3EXSA 4NAEA 1FXQA 2W63A 1L2UA 3B9OA 3Q45A 1CYGA 4XBKA 3CWNA 2NSOA 4M8UA 1ZCOA 1XBZA 5CZ0A 3P84A 1T40A 2F6KA 4K6AA 2VR2A 4QDWA 4WQ6A 3MBFA 4PMVA 3LRKA 2NLIA 4WY0A 3SB0A 3ZQ9A 1QRQA 1J12A 1OEPA 4CN6A 3VOIA 1EX1A 3QQ1A 3GIQA 5T9BG 4DO5A 1LDCA 5FA5A 3WENA 4F3HA 2QJMA 1JZ8A 2XSAA 3Q65A 2FKPA 1UKSA 2OMAA 3PVFA 2X30A 4DZHA 4XAGA 4NILA 4HCHA 9XIAA 1SO6A 1BWLA 2VZOA 4I9MA 2PP3A 2FFCA 2F8QA 3NZQA 3PBVA 4UCFA 1TX0A 2PDIA 2QVNA 4AYSA 2BP1A 3QOKA 3GH7A 3VZXA 2VCCA 4LAMA 7ENLA 1PXGA 3H26A 1GKRA 4KIRA 1YADA 1UZHA 1ZRQA 1K8CA 2WQPA 2VNCA 2OWCA 1NY1A 4KCUA 3CYVA 1GG0A 3GXPA 3RR1A 5MKGA 1XQKA 3VGHA 3LTPA 3WJWA 4ORIA 5AZ0A 1VPXA 1P7TB 1O95A 1XP3A 4OJ5A 2IW0A 1VHCA 2ZVRA 3LSBA 3A5FA 2Y24A 1GG1A 1OC5A 4DYEA 5D2WA 4EF9A 4H9YA 4PE8A 1QBBA 4E6MA 1M01A 3DN5A 1C91A 3SCNA 3WDRA 3MP5A 2VP8A 1H49A 1GYNA 1S2VA 3OTRA 1XLEA 3LTYA 5FACA 1UYQA 4H9MA 3CLWA 3GYCA 4POCA 4HJFA 4IOTA 4WKAA 2DZBA 5KETA 1QTWA 3ENLA 3DXIA 4UTUA 4PRTA 1TPDA 2DSZA 4PUUA 4IJRA 3QQWA 4K38A 4D8LA 4X2PA 5LA0A 4JTFA 4J2MA 1J0JA 5K9CA 4AIBA 1KCKA 3ARTA 4Q8WA 2VDHA 1O4UA 2E67A 1A50A 2VEKA 4DI9A 1FWRA 4ZE5A 5LHEA 1N8FA 3SCPA 3CQKA 3T42A 4DJFD 3NGFA 3LS9A 3FV9A 4GQBA 4LAKA 1UIPA 4V1XA 3W84A 2Z0IA 3TWAA 2CZVA 3A3XA 2H3DA 3EWZA 2FHCA 4L80A 4I7UA 3GZ3A 4HVXA 3GNNA 3ZVHB 5CCZA 4UFHA 2G8ZA 2V82A 3TE9A 4LNYA 3TYAA 2PTDA 3PZGA 3U4FA 5K7JA 4NX0A 5JBFA 1EYWA 1ISXA 3A3HA 1MW1A 2WWCA 2J27A 4C7GA 1N8IA 1B9ZA 1W5OA 2AMGA 1P5BA 4INFA 1BGGA 1OFBA 4CCZA 3EB3A 4LEQA 3TW7A 3T09A 4RR4A 4UCGA 5D30A 3WMBA 3VTRA 4G56A 1GGOA 3BPWA 3GNRA 4LQ1A 4PB4A 3LG3A 3U9IA 3A5VA 2WMKA 4K8HA 3W2KA 1AQ0A 3T7VA 3C5QA 2J74A 1GKPA 3TXVA 1HO4A 1FXPA 4W93A 2R1NA 3NM1A 4AISA 1ELSA 1NQKA 4YVXA 1PZ1A 1AJ2A 1ODUA 3KP0A 3KX6A 4W7WA 4CD7A 4PUMA 3TJLA 1HKWA 4HA0A 3TNBA 4P8XA 1KCZA 5I5RA 2YL6A 3HZ3A 1FX6A 1UWUA 4GH3A 4O4WA 2C6QA 5GJNA 3BZGA 4EPDC 1MEWA 3GU9A 4BF9A 3WDQA 3URBA 4U3CA 4GUHA 1YTKA 1IV8A 4QTGA 1U22A 3DDMA 3TJIA 5I23A 3E2QA 3IRSA 1FY6A 4NJKA 5A8QA 2WSKA 3ARWA 1NDZA 1RV8A 2FZDA 1HF6A 4JHOA 4N7QA 1RQBA 3OLDA 4LNCA 3LPFA 3V75A 3WH8A 3FK4A 5D2TA 4CCCA 2FB3A 3ABZA 4L65A 4IBEA 3N19B 1GEHA 3L0NA 3GXNA 3M4HA 2VGGA 3PAJA 1KXHA 3UBPC 1M1BA 3TC6A 4TX6A 1R3TA 2A3CA 5I06A 2YCKX 1HX0A 4UTFA 4Q22A 3VGFA 5I3FA 4O15A 2JKAA 2XGBA 5M5DA 2BY0A 1TO3A 1M7XA 3RCMA 3REQB 1KB3A 5M1TA 2H9AB 2NV9A 3RU8X 4MKVA 1NF0A 2YDAA 4MY9A 1K70A 4HHHA 4JTHA 3WBAA 1W1TA 5I09A 1V3JA 3R2GA 1BQGA 2YZ5A 1JCXA 3GSMA 1KXTA 2XIQA 2VUNA 1EUNA 4Q4QA 4WX2A 2QPUA 3KBWA 1FDJA 1Q4NX 2JK2A 1SFJA 3M6YA 4ZOAA 4A8IA 3PNZA 1RCXB 3R0DA 4L9YA 3GC5A 4RK8A 3M0XA 4OBSA 3ERPA 5EY5A 3BTNA 3TQ0A 4JYDA 2XH0A 2OT0A 4U28A 3IIVA 1F3EA 4QEHA 2IQ0A 2J7CA 2QS8A 2VVSA 2EAWA 4LYRA 3VU2A 2X1UA 1FRBA 1XWYA 1W6TA 3QMTA 1V0KA 2Z1WA 3W7QA 1XBVA 2HCVA 2Y2LA 4DF0A 1QATA 4L6DA 3LHYA 3KOZA 4H9UA 1LLOA 2CXGA 5D03A 5E0CA 1ITXA 4QEEA 2G5WA 1AQHA 3AS2A 3QYQA 3CL6A 1T5AA 2QDHA 2GQAA 1ZBCA 2MUCA 1W1VA 3N3TA 3NEVA 1RBLA 4GZJA 1B4KA 4XD6A 2LLEA 3DGBA 3KLLA 4XV0A 3PG9A 1A4MA 3H2MA 5EL1A 5E6YA 1IZKA 3AFBA 3NVTA 3C2FA 2WM1A 1F4AA 3T05A 3AIRA 2OPJA 4DWSA 5CPLA 5TNVA 1W1ZA 1JJKA 1XG4A 2OOFA 1BRLA 4Q6XA 1AQMA 3N29A 1UCWA 5ABTA 1ZY9A 3TTOA 1H7RA 1VS1A 1PYFA 4YS1A 4A21A 2IPJA 3UXAA 4PMNA 4YXGA 4HU8A 4FX7A 3KWSA 2QJNA 1DWGM 3THCA 1Q8AA 4JTEA 3W73A 2AAMA 5HULA 1Q65A 3R94A 3O06A 4F79A 4ICCX 3HG3A 3C2RA 1EEXA 1XRSA 1XDMA 4WY0B 3H21A 2A3BA 2DUZA 3JRKA 3UEQA 3TNOA 1F61A 2QT3A 3R1ZA 4ZBCA 2DZPA 3JVAA 2PDYA 1IIHA 3PANA 4FXFA 2QKFA 1SQ7A 1FDZA 1TWSA 2VWTA 2WVTA 4A3YA 1KKOA 1AG1O 3KLKA 1FVPA 4MGGA 5F2GA 4I5XA 4MZ1A 1E4MM 1YLVA 3RAOA 2A7PA 1JCNA 1FHDA 3AWOA 3CUHA 3VNZA 2ZX6A 4RCXA 1R38A 4DZIA 4L6HA 1QI2A 4DBWA 5AECA 4OJPA 3U48A 2DQWA 1LL7A 2WLYA 1SSGA 3UG8A 5JU6A 1W9BM 3HSHA 4NHVA 5CBJA 5DRCA 1OFDA 4I9AA 2BHUA 3PF3A 2VYOA 5MKGB 2VD9A 3NJ3A 1X1NA 4NYUA 4KRUA 4O50A 4Q4KA 1E71M 5KMYA 4IHCA 2V68A 3WLLA 2ZUMA 6ALDA 3RN6A 3OHIA 3IJ6A 1DIDA 2AAAA 1XKJA 3N2CA 1WBHA 1CDGA 1K77A 1UKPA 3AU6A 1FUYA 3DKJA 4KETA 1YBQA 3UPMA 3RU6A 1Y7VA 4P7RA 3IUIA 2GJPA 3VOGA 4L4MA 1VBGA 1KNWA 1TIMA 3CHCA 1UR0A 1DJXA 4E8GA 1MSSA 4GQQA 2QXWA 3WH5A 2OZTA 1JZ3A 4IQEA 1EDGA 4FK9A 4CU8A 4NRRA 3VKAA 4GQRA 3B9DA 2J88A 3R11A 3MCNA 3BW2A 1NSJA 1RCOB 1N2VA 1GZJA 5FKYA 4AWTA 5I07A 1XLGA 2CYGA 3UZJA 2DUAA 1HJUA 2Q8XA 4I3GA 2PDWA 1JPKA 1PBGA 1K3UA 2BMBA 4HCLA 5FJIA 3OW1A 2E09A 1PB0A 5E70A 2GWNA 2BY1A 2DSWA 1IR2A 1H0GA 3MU7A 5D38A 1F73A 3BLOA 5FJOA 1WP6A 2IOUA 2V5KA 3MV01 4YTTA 1J2BA 1S39A 4M81A 1PYMA 5IRPA 1PJ9A 2WPGA 2RGMA 1OX4A 1SJBA 1F6KA 4JICA 1SFLA 1UPPA 1LYXA 4PCSA 3H12A 5DEZA 2QPSA 1V79A 2NQLA 4J1OA 1JDAA 1NIUA 1W3IA 1BG4A 1ZFJA 2I57A 1U30A 1QNOA 1A80A 3EX3A 3A23A 2JIWA 3GZAA 3MMWA 4ZO9A 1KV5A 3OHMB 2D3LA 4V27A 4OUIA 4B3LA 3CC1A 4XBJA 1JCJA 1D7FA 4GQ0A 1GYMA 1CLKA 1LBLA 1EB3A 5BWAA 5C6MA 2W66A 2Y6ZA 1TRIA 3VDGA 3QOMA 4S3AA 3D0CA 3BAJA 1NDWA 4PBEA 3VZYA 5CZJA 3GD6A 3O05A 4QNLA 3RPDA 5H2ZA 3N4FA 1OG0A 3EYPA 3CQJA 2QEZA 5HMEA 5U4NA 3LXAA 5AVNA 3EXTA 1KFCA 1JF5A 4G1NA 1ZJIA 1BLIA 3TWBA 3N13A 4OHQA 3A6OA 2E6AA 2VEIA 3QKZA 2VGFA 4Q8PA 2BLEA 3LPOA 4FO4A 3DI0A 3EWCA 3SCTA 1SPQA 4IPNB 1HP4A 3LYEA 4IMAA 2OKTA 1XPYA 2H8ZA 4JX6A 4N6FA 5IXEA 1W9XA 4MZYA 4ZSTA 2V2HA 5H1WA 3QC3A 3S1UA 4J4KA 3NQ7A 2YLAA 2QCFA 4L61A 3VFLA 3RR4A 2WKLA 1CK7A 4QHRA 3BLKA 3DGRA 4MWAC 4JNMA 1EA0A 3EXRA 1G4EA 5C9XA 3L4YA 1KCLA 3G2GA 2TODA 3QFEA 3IV8A 2DJLA 3C6CA 1EDQA 2ZTKA 5CPQA 1A3HA 2CWNA 3VNIA 4TVDA 1V77A 1J6OA 2Y2MA 1H61A 3MCOA 2OFJA 3D3FA 3KOXA 1K03A 3LEPA 2IXUA 2DP3A 2JE5A 3GU2A 3RM8A 1Y5WA 2QVHA 3DFYA 3WBEA 1OADA 4MHBA 4TMCA 3QF0A 3QR3A 4IP4A 1KFLA 1PIGA 1NH6A 3VIPA 3GVVA 5JBEA 3A4XA 2R91A 1J93A 3ARUA 1KFEA 4GXPA 3NQMA 3DFTA 1S2CA 2BSLA 2DZVA 4IUOA 4JFUA 1GUVA 3GDRA 1FWFC 1RVGA 4MDPA 1AK5A 1E6SM 2ABAA 2A7NA 2GGGA 4HOXA 5T8GA 1BEUA 2C1HA 1UMYA 5C5YA 4PMQA 3R12A 4Q3MA 2NLYA 5GJMA 5BXPA 1ISZA 2V3FA 1V02A 1E4LA 3S2NA 4DBDA 2ACUA 4HN4A 1VFLA 1E6NA 1GJWA 2OVLA 4D72A 4LS2A 2VEGA 3BG9A 2R82A 4EXBA 2WANA 4OOUA 3WH7A 3S2MA 4MPQA 2D23A 3VABA 4GVHA 4H7VA 3ZJ8A 4EPEC 1TPWA 1M04A 1X6LA 1SZFA 2V63A 1C90A 1XIIA 3ITYA 1S5WA 5LIYX 3LGEA 4ZFMA 3HQ1A 1I9CB 1LLWA 1AMYA 5FCZA 4CEXC 3MUY1 4ZR8A 3N9SA 2XWDA 1FH8A 2FVKA 4ZQNA 3P2VA 3UG4A 3L5AA 3FEMA 5JBDA 1OCQA 2CFFA 3GTXA 3RF9A 1P0KA 3UR2A 3E02A 2C16A 2R24A 4EE9A 1UC5A 1XX1A 3W7HA 1KFWA 1SZRA 2G4JA 1LG1A 1FCQA 1XGZA 2ZXQA 5C8BB 3MUCA 4GACA 4DWSB 3TUUA 1MUMA 1IZJA 1CX9A 1H5VA 1F2JA 3EMCA 3MSGA 3DG3A 1PKLA 4GCXA 3B04A 4M6PA 1BRLB 3CUZA 4NI8A 4I90A 1UASA 1UC4A 2XVNA 2WZTA 4HTBA 3Q58A 1POKA 3PG8A 1TV3A 2XVKA 3NVDA 5BOFA 3M5YA 2VX7A 4S3FA 5AYYA 1GVOA 3AIVA 4KEUA 3TK7A 2WZHA 3VDBA 3PBMA 4AW7A 3AXXA 1RALA 1XR2A 1AW1A 3L4ZA 2J79A 4JFVA 2YBVA 4S2BA 3CT2A 4JTJA 4TTUA 1OCJA 4PB5A 3O15A 2Y7EA 3ALFA 1OG6A 4IFKA 3CQIA 1PIIA 1CXIA 1ICQA 1DVJA 1MFUA 4N4PA 4CGTA 4LVBA 3K30A 3W6MA 4YPJA 3H6OA 4L1GA 3O63A 5MF5A 1PTDA 4DO6A 1I0BA 1LBMA 3NR0A 1M3UA 3RM4A 3V5FA 3NWRA 3HA1A 1B1YA 3MYPA 3B8VA 3MDWA 3P80A 1GZGA 2ZUSA 3N4EA 3GDLA 3BJFA 5CC5A 2NV2A 3CUIA 1GQIA 1Q2SA 1AD4A 4PUEA 3U2EA 1PDZA 4X0NA 1TRDA 4HKPA 4QLJA 2DT3A 2XGIA 1X1ZA 3O6CA 1J0IA 2E9LA 2J9XA 4YJ5A 4K1GA 2F7FA 2WB5A 5AOUA 1J0HA 2VWSA 1YBQB 3TSBA 3BOFA 4O1DA 3FHAA 1EH9A 3HV9A 2GVLA 4R9XA 4BS0A 3STCA 2WCSA 4KEZA 1Z69A 3LX9A 3NOEA 2D2OA 4NI3A 1R3YA 4GI4A 3L67A 3KCLA 4RV3A 4UTTC 4A29A 1UUOA 3DU0A 3SO7A 1EA9C 3WQPA 4JOMA 3W1NA 1DPMA 6XIMA 3WN6A 4NX5A 1DBTA 1JAEA 3VIKA 2ACRA 4Z2HA 5FF0A 7ODCA 1IWPA 1EAKA 2ZZ7A 5DFAA 3W83A 3TU9A 3T0TA 4B5WA 4QLLA 4QJ4B 1TWWA 3U5UA 2F9RA 1CCWB 2PP0A 2PRLA 1US0A 2ZRWA 4C5YA 4EACA 3LV5A 3GHRA 2EKGA 2A1YA 1JRBA 1WOAA 3FAXA 2J7BA 3CMFA 3R25A 1JIBA 5GQBA 3ZT6A 3CZGA 4MNMA 3SW6A 4CQAA 1KS0A 3B8UA 1R47A 2A6LA 2Y61A 1PHQA 2OB3A 4HTYA 2CU0A 2I1OA 1XD0A 5DRIA 2WO5A 7REQA 3P0XA 3QHNA 3GO2A 3H22A 3K4AA 4HA4A 3MVIA 4PSRA 1OX4B 3WMLA 2WCGA 3NQCA 3NG3A 2UY4A 1HJWA 1U5VA 4XD3A 3XINA 3HGOA 3W87A 1BXCA 2WNWA 2PZNA 1H7WA 1KM6A 3ZLGA 5E0FA 3CHDA 1YX1A 3ECQA 1BXBA 4MY1A 4Y90A 4O28A 1Q6QA 2ALRA 3QM3A 3FSUA 3ZJ7A 1A5AA 4GJ1A 3PTMA 2GOKA 3UA3A 1E88A 4WK9A 3VIGA 3E2VA 1ADDA 5AVHA 4O1AA 1S2AA 3T4WA 5G1MA 1XC4A 3D5HA 4E4PA 4HPNA 3TSMA 5CSYA 4W7VA 1V6XA 2C15A 1EIXA 2ZUWA 3E6EA 4GA8A 2PD9A 4ZENA 4DJEC 3R0UA 2B0MA 4HSHA 5G4HC 5HAOA 3LN3A 3H2AA 4GUJA 3WUFA 5EMYA 1U5JA 2PDLA 1FWIC 4KWWA 5DX7A 1FWSA 2P3EA 2YA1A 3VKCA 3OQ8A 4U5IA 3B3DA 4QE5A 3N11A 3P8IA 4S3GA 5RUBA 4GJJA 1HVQA 4XG1A 1F6YA 4JAWA 3ZYZA 4MWAA 4ATDA 3W7IA 4AX7A 3AUJA 3LHTA 1FP8A 1A3XA 4NZ5A 4IPLA 3SDOA 2OSYA 2P53A 4QSHA 1EUAA 3RHGA 3EDKA 4G7EB 3FEQA 1FFQA 1F9CA 4Z2JA 4BEQA 3UJFA 3AYSA 4JKKA 4FALA 4DM1A 3VNYA 3UJSA 1TJ2A 3L5LA 1H2JA 4ICMA 4RXFA 4ZXLA 3PAOA 4BA0A 1EJWC 1KO0A 4KRTA 2IKGA 4LUSA 3CIVA 4TQTA 5FL1A 1XSIA 2OLSA 1XLLA 1TR1A 2I9EA 2BASA 1SO4A 3MHGA 2QCEA 3L0GA 1JL8A 4D6IA 1JUKA 3V18A 1XRTA 2VX5A 2Y2GA 3KHDA 4LCRA 2D22A 3T0AA 3TONA 4F2BA 1ONRA 3F03K 3N73A 3K4WA 5HNRA 4LV4A 1H3GA 5HNNA 5G1TA 3SCWA 3W2JA 1GPWA 2EG7A 1SSDA 4HYRA 2VEMA 3RJYA 1EP1A 4AZIA 4PSPA 3QLDA 3MT1A 1W3NA 1VC4A 1M5WA 2GVJA 1KBLA 4GI6A 4DM2A 3DYMA 2PDGA 2C13A 3VKKA 2G3NA 3TTSA 4R34A 5EFDA 2NVDA 4H8UA 3TXZA 2REQA 3LHVA 2YXGA 3NTYA 5KITA 1OGSA 2BHZA 3WUBA 4LH8A 1HT6A 1LP6A 3FCPA 5F2MA 3E5PA 1K4HA 2WHLA 1OFEA 4NJIA 1J0YA 5EB8A 3N6JA 1W1IE 2IKJA 4H6EA 3TJXA 1B3VA 4KQNA 3ARQA 4DF1A 1NELA 3UR8A 1LF1A 3B4YA 1PVNA 4EKJA 1UBSA 2BVDA 3N3MA 5FJUA 4DO4A 4IP5A 5D2YA 4C6MA 4NNCA 1HG3A 2X0HA 3OLIA 1TCMA 1XJBA 4KCWA 1J8VA 4K7VA 1OD0A 3CTTA 4F48A 3PBUA 1FOBA 1KBBA 2VCBA 1EPXA 1WO2A 4BQ2A 3LPGA 4TTGA 3SCOA 4A4AA 3TC7A 2DZAA 1GOQA 3CAWA 2HQAA 3T8LA 1VRDA 3BC9A 3LM3A 3SUTA 1GHRA 1W54A 4YTSA 4EF8A 1EQCA 1XRFA 2CESA 2QJHA 3C56A 2WNQA 5D9MA 3AIEA 1K7EA 1RJRA 5JIWA 2WM0A 1YRRA 3E74A 4ECLA 4GVFA 4P7OA 3OIHA 4JN6A 3UY7A 4ZGYA 3TVAA 3OG2A 3KFTA 5E1QA 3AAMA 4RW5A 3FJLA 1TWIA 5HWNA 1CBGA 1E0XA 3QV8A 5A6TC 4MYAA 4NVTA 3PNUA 4LVGA 3GTNA 3QEZA 4H6KA 1G6CA 5LHFA 3KEHA 5LZLA 1HL9A 3A13A 5HA7A 2IMRA 4UQ9A 3TQKA 4AQLA 4FLOA 3WNMA 1QK0A 2OYMA 4DXKA 3CUXA 4BR1A 2PD5A 4GIRA 1EDTA 2GVGA 5C9UA 1AODA 4QBXA 5SWUA 3MZ2A 2NQJA 7TAAA 4PODA 4DZAA 4HK7A 1SW0A 1W8SA 3WEMA 3LBMA 3ZM8A 1JI2A 4MKNA 3HTWA 1DJNA 5LIWX 3C2OA 3U2OA 2PC8A 2W67A 3DHDA 3LM7A 5BOOA 2W92A 1WDQA 4V28A 2P10A 4M24A 1ZJAA 4HHMA 4CU7A 1EJXC 3MTWA 4IFKB 1MFVA 2OU4A 2V3GA 2CLMA 3QZAA 1SZGA 2VZVA 1AJZA 3HBLA 3XIMA 4S1FA 3T0DA 3ES8A 4BQ3A 5A2AA 1OVDA 3BGGA 5KZ6A 1L9WA 1NARA 1R2SA 1CT5A 1I60A 4WJ8A 3IJDA 5IOBA 2OJPA 1ZQ5A 1ZB5A 4CCDA 1D8WA 3A4JA 1XLAA 3UGRA 1YU2A 4IPJA 3QTPA 1GOKA 3FSTA 2G3IA 2OGYA 4FA3A 5CC7A 4QDPA 3UCQA 3PPFA 4IXXA 1V3KA 2QYGA 2W91A 3NPVA 2CLKA 5A8PA 1OHLA 1W56A 5LIKX 4P8VA 2Y2PA 4GKLA 3APYA 1WYIA 1TJ0A 1IHIA 3IGHX 2ON3A 4GUGA 3WLIA 1TZZA 1F07A 3UR7A 4FSAA 2CZFA 4MOZA 1DIEA 3M0ZA 5J5RA 4PCPA 3VMNA 4N9CA 4C6EA 3ARSA 5CGQA 4IG2A 3N14A 2GQ3A 4FIQA 3VVGA 1FCVA 5CSUA 3S9ZA 4WKHA 5DBUA 1YIXA 1V93A 1JD9A 1O68A 2NVAA 5HATA 4E0CA 3EDFA 1XLCA 1JUBA 2GJXA 3LV6A 4S38A 4UNLA 1FTXA 1B31A 3O7UA 6TAAA 4HMDA 1YYAA 3O1NA 3W7GA 5CPNA 1K6WA 5H91A 1QBAA 3SGZA 2WJFA 3DYPA 3ARRA 1DE6A 1WXZA 5AZ1A 2R9RA 5FF3A 2ODOA 3TYUA 4ENLA 4EXQA 4RLIA 7REQB 3UA4A 2HVNA 5HXMA 5HJYA 4UQCA 4FR6A 4ZFCA 2FZ8A 2E77A 3GAYA 3NQVA 3DFOA 3SI9A 3NYZA 4KRZA 1UWIA 4ALDA 1JDDA 3G0SA 4HNNA 3WLKX 4BJHA 1FWHC 3KL3A 4S2CA 2HS8A 2BXYA 1R86A 4PFHA 4HGXA 2CLHA 5HNTA 1PZ2A 4MPKA 2VZTA 3LHUA 3AMLA 3C4UA 3KXQA 1H7OA 5LXXA 1XIDA 4DJEA 2DZSA 3O07A 1XYLA 4ZVJA 4FOUA 2DQXA 3POHA 5I77A 1NWTA 3LQLA 3C2YA 5E9AA 2CPUA 1CXEA 4MDOA 4NZ3A 1TPFA 2DDXA 3HFYA 5LNRA 4AZ5A 5IBXA 5I0DA 3QYSA 4F9JA 4NU7A 4K68A 4U33A 3TYEA 1ZAJA 2IPGA 4J3XA 2FTYA 3P5ZA 4GISA 4IBIA 4GYPA 3W3OA 2B31A 4HBKA 2Q02A 1W5NA 4G5DA 1LL6A 4WKFA 5KSWA 4MWAB 1HGYA 3RRAA 3SADA 3W1RA 4OWGA 3FY1A 2V9DA 3UETA 3ABSA 1WB0A 4ZOEA 1WCGA 5I03A 1O94A 4AZCA 3W72A 3HPSA 1FWGC 1RJPA 3WK2A 3EPNA 4JKMA 3K1DA 4OJOA 5GPRA 4Z42C 4DZ5A 4FB7A 1FH9A 1A5BA 4C91A 1A5OC 2QDEA 4AIEA 3KOFA 3WLSA 4LUSB 2PSNA 3MI2A 4M6UA 3PTKA 5CPSA 2NQHA 3N9KA 3GR4A 4ERGA 1MWOA 2ASHA 3GW3A 1EL3A 3M47A 3RLGA 4GZ7A 4TIMA 4XVDA 4KF1A 4RDVA 4REQA 5CGMA 1Z41A 3FKEA 2XN2A 4LFYA 3V16A 2FZMA 4M29A 4MJ2A 4IQJA 2CXEA 2FLIA 1EJ7L 3CASA 3BURA 2REQB 2E6YA 3M7WA 1SFTA 4EPKA 3F4DA 5A8NA 2OYLA 3W70A 5F2IA 2PE4A 1R9ZA 4ZOCA 5E9XA 3MI6A 5C2CA 3Q4DA 1CEOA 3TTEA 5BCAA 5EU9A 5AHIA 1KM3A 4CN1A 3PP7A 4PC8A 4JTUA 4O1EA 1QASA 2NX3A 3MW7A 5A8GA 2WKJA 4G7FA 4WCJA 1UR3M 3WLHA 4Q32A 2WC7A 5JH1A 3VUSA 2YB1A 4LCQA 2J77A 3LGDA 4FNTA 3V36A 4Y9AA 1JEZA 1IYXA 3BCJA 1T8XA 1O1HA 1DQUA 1TMHA 4X9YA 4MNKA 1U1JA 5KZMA 3MQTA 3UWEA 3T9PA 4DI8A 2Q71A 4OU1A 3MANA 2E8YA 2HVOA 1EJTC 2Q6ZA 2WSYA 4PUJA 3AMCA 2PF0A 2NVCA 1HXJA 1TPB1 3KS5A 3LCXA 5F4WA 2PWVA 4AZ7A 3MKCA 3CV7A 3UT0A 1UJPA 2ZE0A 2NWRA 2XIJA 1KV8A 4UQAA 1PWMA 2ZWYA 1XS2A 4EAMA 4I8YA 5I78A 1E9ZB 1ZNNA 2XINA 4Y8FA 1TPVA 3TW6A 2OO6A 1JZ6A 1IZCA 4D8ZA 2F38A 2PDMA 2PEVA 1BTCA 4GXWA 3DECA 3GNDA 4PTWA 1HQTA 3FW6A 3EDJA 2XVLA 1E72M 4GFSA 2BWGA 3VD7A 4QX4A 3WG6A 2JQXA 3P14A 3W2LA 2J9ZA 2YW3A 2NXGA 2GQ9A 5H8MA 3W29A 5D2XA 3WELA 2FGLA 3G1AA 4P7QA 1DXFA 3IIZA 1TPH1 2PGFA 4EWJA 2ATSA 3CIXA 3W4RA 4BK9A 3IJ9A 2F84A 1G4PA 4LCSA 3CWHA 1UA3A 3PY2A 1MQQA 3BMWA 2Q01A 3MWCA 4DJDA 1DHKA 2POTA 4C6CA 1TJPA 4I9JA 1VZWA 3NZGA 2DZTA 3T8QA 1KM5A 3L66A 3I68A 4WR3A 4DBEA 1Y5XA 3L4TA 4D1JA 4BI7A 4DLFA 4C6KA 1FKWA 4OIFA 4PTNA 3HGRA 4U10A 4WEVX 3OZOA 1KFJA 2GUUA 4W9TA 1XL9A 3RLVA 4QSFA 3RLHA 3ZT5A 3PS7A 2PWDA 2WWDA 2QCDA 4LYKA 2NUYA 2PDXA 3P3BA 4I5RA 2ZIDA 4F2TA 3R10A 3GTFA 3RRXA 1ZZMA 2INEA 1DKWA 4PH6A 4EPBC 2BY2A 4K8EA 1V3HA 1O5KA 4LRTA 1T99A 2X0SA 4MJ4A 1Z42A 3OO2A 4BHYA 3ARPA 1YXCA 4HNTA 4ZO8A 3ZS4A 4OT7A 3CAQA 3L0KA 2VQUA 1W5PA 5I3IA 1C8VA 5CC3A 4J2PA 4HPXA 2OX4A 5BPVA 1L6JA 3M43A 1LJYA 2VC6A 2AL2A 3LXBA 4O11A 1QT1A 2YCJA 5E0KA 4Q7NA 1IEQA 5HQMA 1Z3NA 3UG3A 4MKSA 3SY1A 3EKZA 4LS1A 3P60A 2WBGA 4HPHA 2RFGA 1RJQA 4CNTA 3DC0A 3U4AA 5D02A 5JMUA 4IG2B 1XXXA 3RITA 1K9TA 4M6QA 4O10A 4DAFA 3W6YA 2VGIA 4P7NA 1H8PA 3EEZA 4YVPA 2GJXB 4N4QA 2BHYA 4WDWA 4FNPA 3U8GA 1VH7A 3TCSA 3QQ0A 2X1RA 1EO5A 4ACZA 4YLWA 4HNUA 1ICSA 3AIWA 3M64A 1XPGA 3NDYA 1TE6A 4DPPA 3WDHA 4AF0A 4JD4A 2OX1A 4Z2KA 3IVSA 4UMCA 4JQ2A 2Y2OA 2GDUA 2YSWA 1IXPA 1IXOA 1IT8A 3QFWA 1ITUA 5J04A 1R3RA 2OQYA 1KWGA 3BAWA 2EG6A 4KEMA 1A3WA 1TTQA 4JIPA 2DU2A 3KOWA 4JIQA 3MKKA 3T2QA 5FEZA 3PJWA 3TOYA 4O13A 4DF2A 3CV1A 3GAKA 3VOFA 1Q6GA 4IIFA 3KRSA 1TJ1A 1WKEA 4XKYA 4W8LA 4DNMA 2ZVIA 2D2GA 1YDYA 1B2YA 5CAKA 2ZKMX 2VZUA 3AHZA 1D7KA 4NAFA 3KM8A 2W4XA 4K37A 1SVDA 1A5LC 3DAQA 1NFBA 1IXQA 3EPMA 1LTDA 1IEWA 4CD5A 1FQ0A 2WVVA 1OIFA 4AZ6A 1CXLA 1IF2A 4CCEA 1GOXA 2PWEA 3LHZA 4HJWA 3B8IA 1ML1A 4WSJA 3GQYA 3IRDA 4UQDA 4C6BA 1OFRA 1BKSA 2D24A 1RPKA 1V7YA 2V0TA 5I2UA 3R89A 1R2RA 1ZTVA 3HGSA 1WBJA 2FPVA 4MAZA 1F4HA 3EWYA 3BUVA 3BMXA 4LSBA 4AH7A 4D6CA 2QZRA 4Y2WA 4HT3A 4ZODA 3G18A 4R5EA 4M6VA 5GNXA 4JNZA 3OP2A 3UGVA 2DIEA 3OGRA 2HMCA 2QUVA 4UNKA 1UA7A 2YZRA 1UROA 1ZS2A 3USBA 3QY8A 4TUFA 4OBRA 1W2PA 3NIYA 5CKSA 1ZAIA 3LRLA 1E9IA 3Q37A 1N55A 3E96A 2XHYA 4IL0A 3DI1A 5XINA 2J66A 5A6LA 1GHSA 4MNJA 3D46A 3FKRA 1ENUA 4AZCB 4GZIA 4GE8A 1E5NA 2CHOA 3AS1A 1MZRA 2HXTA 2VENA 4RDYA 4BZYA 1ALDA 3PB0A 2G3FA 3NSXA 2JFEX 3TYZA 3FVMA 1Q7QA 2RDTA 1GOMA 3EX1A 4DJFA 1UUMA 2WJDA 3SUSA 4LVAA 7XIMA 2XDFA 4GX8A 1W1A1 5DT5A 2G3JA 3UZXA 4CVUA 4NRSA 2V5OA 2AGKA 4H41A 2EXOA 3CIWA 1Y65A 4AY1A 3BW3A 3PM6A 4ZO7A 3KTSA 3B8DA 3ZVIA 1RD6A 4REQB 2BBFA 5F4SA 5HJXA 5EPDA 1M41A 4P8WA 1IT0A 4I7VA 1QHZA 3MJYA 4JL1A 1US3A 3UJEA 3L2IA 5ENLA 4RPQA 1YTDA 1GOIA 1HFBA 1GZ1A 3BH4A 1QMLA 1DJYA 2RH9A 3QVQA 4IBJA 4FOJA 1D3GA 3BCFA 5TAOA 1UQYA 3WQ8A 1FCUA 2AGTA 1J5TA 4UB9A 1YUEA 2V81A 4OFCA 4RE4A 2AKMA 3AQUA 3CAVA 4I9TA 5F1VA 5TD4A 2Y63A 2H90A 1W3KA 2Y7DA 3P5YA 3GG8A 4PR4A 4CLMA 2A3AA 3T07A 4J27A 1TE1A 4MJMA 3AS0A 4AIOA 2DSUA 3XISA 1OX5A 1XW8A 4O19A 1UR1A 1RHCA 2XM2A 2PDJA 3SURA 4LX4A 1IWBA 4GWEA 2XPKA 3ZIZA 1F05A 1VLIA 4S3BA 3RILA 2NX9A 4ASTA 1V03A 1U1UA 3ID7A 3BL3A 1R85A 1XYBA 4W5UA 4U2ZA 1R3QA 3K5XA 1B5TA 4O52A 1H4PA 1V6YA 4GJIA 4UOZA 1Z89A 1EJRC 4A05A 2W0UA 4QIUA 3GNPA 4CVWA 1FA2A 2YA0A 4JTQA 4CNSA 2R8WA 5HMFA 5EYWA 3EAUA 3GH4A 2WSQA 3TOPA 1L6FA 4LAUA 2X16A 5G1YA 1J0KA 4MYXA 3S1VA 2EG8A 4ADTA 2E5CA 3NEHA 5BMXA 4IJBA 1UD2A 1J0ZA 1P0EA 1OZQA 3U57A 2IXVA 2QUMA 3N2TA 5AHMA 1ZLPA 4WOZA 3WQWA 4BEUA 3LU2A 2ZZ2A 1VPYA 2OGJA 1ISYA 4H2HA 3N4AA 2OKOA 3S83A 4JCMA 2OXNA 4QJ3B 1V6UA 4WLCA 4KS0A 2QCLA 1UWRA 1M65A 4D6FA 4XAZA 2F2HA 4X9SA 1MRAA 2JE8A 2RKXA 3PHAA 3ARXA 1NEYA 1UR2A 4QP0A 3M0KA 1LT7A 1QHPA 2PWGA 3C2VA 1ZHAA 1Q6FA 3WL1A 2VFFA 5KINA 1SR0A 1IE7C 4JYFA 5AYIA 4ACYA 3LDVA 1CIUA 4MFDA 3ZR6A 4C6DA 4CQCA 1QW7A 2J47A 2XTKA 3TN5A 2GQ8A 2C0AA 4UBPC 5LYRA 5E09A 4RZ6A 2O9TA 5J5DA 3SRDA 1LBFA 2ESCA 2C14A 3NSNA 3W7EA 3W1MA 2QCDB 5LNWA 5I6SA 5CZTA 2BV9A 3E49A 1V7AA 3RGTA 2PTYA 4PMRA 3R8HA 1P1MA 3HO8A 2FDSA 3Q67A 2WYSA 1QPQA 1NAL1 5A69A 4AZGA 4E3VA 3GC4A 1HTIA 5EMKA 1YNQA 4U3AA 4AHOA 1X7IA 1G1YA 1C9WA 4NG3A 5AYBA 5I7GA 5A8OA 3MI3A 3VIMA 1YE4A 7A3HA 2BOGX 4EANA 5FF7A 4D2JA 3DESA 1GCYA 2WPBA 4ZCWA 2W3ZA 4PL1A 5FJPA 3PBYA 1AJ0A 1SM9A 2AL2B 2OEMA 1A0EA 2CKSA 3IGUA 1IT7A 4QE4A 2EJAA 4S23A 2GL5A 4K36A 3AROA 1MXSA 3OGSA 3GUWA 3B9NA 3T78A 3FJ4A 2D49A 3E38A 4MG4A 2UY5A 4Z1YA 3ZSTA 2YFOA 2EBNA 2RTSA 3DFSA 2VFEA 1VHNA 1A5UA 4O8AA 1KTBA 4IGSA 1GQLA 3NM3A 3ISIX 4X60A 3VCNA 4U5KA 5CJ5A 2JKEA 2RJGA 2O4QA 3F2DA 1YU4A 1X8FA 3AMKA 2GGEA 2VI0A 1CGUA 1VBRA 1KM2A 3W85A 1HNYA 3K4DA 4ACZB 3BO9A 1PPIA 2NUWA 2J7EA 4ML4A 3LHWA 3H2OA 2O7QA 3NQBA 2Y7FA 2P76A 5T91A 4AF0B 1DL3A 4BI6A 2ANUA 5D37A 5JH2A 3AXIA 3WNOA 2RAGA 1OFPA 3THQA 3WQCA 1J6PA 5BXSA 1GOOA 3MS8A 2BXVA 1UR8A 3VUPA 4NYYA 3E1F1 5A6JA 3G0UA 4PMYA 3SGUA 1GYLA 4B5VA 1L2QA 3IAQA 1VB9A 2DT2A 5HANA 1QI3A 4H7ZA 3RX2A 4GH1A 3SQSA 4IM4A 1EC8A 2ISDA 4XKYB 4KCVA 3P0WA 1TKKA 3B40A 3MHUA 3VIJA 4CNUA 3O0FA 4NAFB 2DVUA 2F6XA 1JYWA 3L9CA 3WLMA 4P5UA 4Q8QA 2W6RA 4HSOA 3I4KA 3SCRA 2WVVB 3UYCA 3L68A 3R8GA 5AHEA 3IARA 2G37A 2V2DA 1KXVA 1OYBA 3I10A 2DZXA 2FZNA 4GIEA 4C1NA 3CU2A 1KR1A 2VDIA 3RLUA 4KGLA 4AD4A 3CHFA 1XD1A 2B4GA 3AYVA 1ICPA 1L6SA 3L4UA 3PZTA 1BG9A 4R27A 3VGGA 1DJHA 4CN4A 4QR6A 5HUOA 4BF5A 3UNTA 5A1AA 3WF4A 2WZIA 2Z1XA 4UOQA 4DWSC 3CJPA 2Y8VA 5HINA 4X61A 3WJYA 1EOMA 3S6TA 3MYOA 2WMFA 1W8GA 3DHUA 1AQFA 4GOAA 1XCWA 3OZMA 2HNHA 3WD1A 4P61A 4Q8VA 3PTQA 3LCHA 3F4CA 3EDEA 4QFUA 4H9ZA 4PTMA 2GSEA 3T2PA 4DX3A 3G5EA 2DFAA 3TAOA 3Q2DA 4AVNA 2DSVA 3L2LA 3DERA 2X2YA 1TV2A 2FVMA 2GDVA 3LUTA 5CBIA 4Y6GA 1VFOA 1WDSA 2EPNA 3PSWA 2YKKA 4KEVA 2Z6JA 2Y1HA 4GBUA 1R5YA 3L23A 1MMFA 1K9FA 1ODZA 4IISA 4M19A 2ZDSA 1V0NA 5HQEA 4A3UA 3CT7A 3NGJA 1KM4A 3LBCA 4FLRA 2HK0A 2Q8ZA 2YPIA 3GW0A 4H19A 1EIBA 3JUGA 5BW6A 2NUXA 3OG3A 3TYBA 3H7UA 2VR4A 4LANA 4HIBA 3EX6A 4Y7EA 3CHEA 4GX9A 4WOQA 3JU2A 1E51A 4RE2A 3WD4A 3URAA 3UWQA 1UQZA 4BKNA 2FGBA 3ARZA 3I65A 5G4WA 3WQFA 3OEXA 3G0XA 5DO8A 1SJAA 3UZWA 2CHRA 3OJGA 1Y0EA 3RPMA 2EPHA 3OGVA 4Q4OA 1SR9A 2Z00A 3B0YA 1BWVA 1LRNA 2G41A 5D9OA 2CERA 4M80A 1XINA 4O8RA 4IIHA 2X8RA 1R0MA 4S3EA 3A12A 3CM4A 4J3SA 3EX2A 3LA4A 1K8XA 2O9OA 2QPXA 4AVFA 4AMAA 4NZ4A 1W5QA 3SCVA 1E0VA 3WLQA 2IS7A 5M17A 4A35A 1BHGA 4J3VA 4XUGA 3OYZA 1EC7A 1CGXA 2VX6A 1E4IA 3M07A 3ZMRA 4PUNA 3W7NA 5BXTA 4C6PA 1J18A 1V02E 4DEFA 5CSSA 3SJNA 4TOQA 5JQ9A 4I6VA 1J10A 3FYPA 4L56A 4C90A 2NW0A 3W02A 4CQDA 3LZ3A 3VD5A 5D04C 4ZB2A 4W7UA 3GBDA 3R5EA 3LCWA 2Q8LA 3HG2A 2HWGA 1ONWA 1MXGA 1T0OA 2XVGA 1KQYA 2PLCA 4FNRA 1YPIA 5D2VA 4XX6A 4RNHA 3KBMA 2ZA3A 2P5NA 4M1RA 2BOFX 1C7SA 4IBCA 6REQA 2R1MA 1ZBVA 3TX9A 4OQVA 1RXOB 4N9DA 3KWXA 4BF7A 4BQ5A 2QUTA 2NXHA 3G1HA 1OINA 3W81A 5AN7A 3TROA 2VX4A 4AD1A 5ECUA 1PZ3A 1JDFA 2GJNA 5HPOA 4HU3A 3S2JA 3ZR4A 4QNEA 3BZJA 1RUSA 1QAPA 4ZTXA 4Z2GA 5CBBA 2NT0A 1TMQA 1WZMA 1TCDA 2F6UA 5HMDA 2E3ZA 3WY1A 3OZPA 5HWMA 3SEPA 4NXKA 2V5JA 4XTDA 1FWNA 2CLLA 1HJSA 1Q13A 3AUOA 1K02A 4CNNA 4Z0JA 3WLPA 1L6YA 4MWAD 1QK2A 1SW7A 2TMDA 4JN8A 3R4IA 1UP3A 3C8FA 4Y9MA 1I0DA 4X3ZA 4HCDA 2ZDRA 2D2JA 5LKYA 2FMOA 4TXEA 5HJLA 2KX9A 4GABA 1JUEA 2WHJA 3N9RA 1XGDA 4MZ8A 2B7PA 5ABGA 2XZ9A 2D0GA 1KM1A 1WAUA 2Y8UA 5EMMA 4GKTA 2PC4A 2ZX9A 3HPZA 2TRSA 1F76A 4AD0A 3BOXA 1A53A 4UR7A 1XLHA 1TYGA 2Y88A 2VOTA 2PDCA 1TPC1 5HOSA 5H6HA 1HKKA 2YXXA 5EA9A 2OR2A 2DV0A 4TV5A 1V6TA 3GNXA 3L5MA 3IJQA 2ZADA 2JKPA 4NZJA 5LNSA 1OSEA 1W37A 4JKLA 2W27A 4YL2A 4O1FA 2FJKA 5MHBA 1JFHA 3NURA 3G1XA 1FWJC 4DY1A 2YGYA 3N2OA 1BVNP 1PZ0A 5BWFA 3C61A 4UTJA 3U7VA 1QO6A 4AIUA 3GVRA 3V5OA 4O16A 3GRIA 2BODX 1NFGA 3S5NA 1IXNA 4L4PA 1DXIA 1TZ7A 3RO8A 1P4CA 5EBUA 1RR2A 3NO1A 2WMGA 3HU7A 4L7ZA 4RDZA 3ZWSA 2FZBA 2V3DA 4H8NA 1WDPA 2QIWA 3PPGA 4BWLA 3OVGA 2CITA 2Y2NA 3ZFHA 2BG5A 4FHAA 2Y2JA 2C71A 3GHTA 3VE7A 1B54A 1VFHA 1NFPA 5EMUA 2C19A 3EDDA 5FJJA 1CW2A 1H7PA 1UKQA 2QDGA 3QPEA 2YCIX 1VF8A 4Q33A 3NXFA 3M5ZA 4M5PA 2VFHA 3DYOA 2HE5A 5GVJA 3MY9A 5KZEA 3UY8A 8RUCA 3QGVA 2YCLA 3WNPA 4OTKA 1MXDA 3LLXA 5TIMA 2ZRUA 1U33A 2C8NA 3UVIA 3CMJA 2CW6A 1OWQA 4HZ8A 1A5NC 3UFYA 3FGCB 1C8XA 5L9FA 5DMMA 1DJZA 4U4MA 2YXOA 3UXDA 1PCWA 3T44A 3QBUA 4DUVA 1XHGA 1EHAA 4TX8A 2Y2QA 1YXDA 4IBFA 3W53A 1ONXA 2Z24A 1W9UA 1EO7A 2G3MA 3CL7A 1WXJA 1Y8BA 3M0IA 1REQA 4K2SA 5E5CA 1NDYA 1NQ6A 2ZUVA 2I5IA 3BQ6A 2ZWZA 4PCFA 1W9PA 3AHVA 3SBFA 1ZALA 5I3GA 4Q7BA 1ME8A 1UJQA 3JZEA 3PSVA 4G8TA 2Z25A 3ZJKA 3AMDA 1TELA 1YU1A 1JZ5A 3SCQA 3C8NA 3F5JA 4UTKA 4PGLA 3LERA 3SSZA 3PJXA 2HK1A 3V0UA 4U31A 1W1PA 4B4FA 2L5HA 3CLMA 3H55A 5EFFA 1T7LA 1XUUA 4Z2IA 4YVVA 2IKIA 1JCLA 4US5D 4A6GA 3A47A 5M2FX 2O92A 1FHVA 4HNVA 3WD2A 1Q7MA 3VCCA 4NQ1A 5F1UA 3ALGA 4H83A 1S1PA 1XYCA 2Y62A 2X7WA 4JTCA 3CQ0A 2ZRVA 3CXOA 7CGTA 3WSUA 2DSKA 1C9DA 4JBRA 1EZ2A 3O8AA 1E3XA 3K1GA 2OWXA 4AZBA 3LXCA 4MUZA 5A6BD 3HURA 3VMOA 1X38A 1I2NA 4MY8A 4NAEB 1UWAA 1KFBA 2NQ5A 5AY7A 3ANUA 4F0HA 1DIKA 4YTRA 3EB4A 4ROPA 3USZA 1Q7ZA 2WNNA 4L1XA 1A5MC 1LL4A 2XGZA 1PX8A 2PDUA 4UR9A 5BROA 2QLYA 3ICJA 2EPMX 4AEFA 1XLJA 4ZMGA 4D6GA 3N12A 1W3LA 2CNCA 1EKOA 3IUDA 1VBHA 4NJGA 1PDYA 4KW2A 1THFD 3MBDA 4ICNA 2NXIA 5LNVA 3W2NA 2ACSA 1TVPA 3POCA 3A4AA 1I45A 3N2XA 3W26A 3EWXA 4K7YA 5C7HA 3IJ8A 2C18A 5LIXX 4F8XA 4FOKA 1NDVA 5E93A 1QNVA 4GNVA 2P3ZA 1ESWA 2OZ8A 2AQVA 1R2TA 3GKAA 4XTIA 1FWWA 2Q09A 2ZUUA 4MTVA 2ZXDA 5GJPA 2Z28A 3W1AA 2VEPA 1RPXA 4H9TA 3RUBL 4ZXOA 2EEXA 2ZOXA 1FHUA 1TIWA 1A0DA 4I6KA 3MVTA 1Q63A 5K4ZA 2A79A 3CB8A 3R6IA 2FYMA 3IIOA 3AZSA 1VFSA 3KS4A 4Z2LA 2FDMA 1LQAA 3P8JA 4LXFA 4BCEA 3TW9A 1XH0A 1TR9A 4AVOA 4XAFA 4PULA 1BYCA 5U7SA 3PWGA 1S3HA 3T1GA 2DVXA 4D71A 1XICA 3PZQA 5A8MA 1HO1A 5D09A 4O54A 4PEKA 3M44A 3VM7A 3ABXA 3PTDA 1QI0A 4G9PA 3THAA 3C0LA 1VFUA 1W2VA 2H8XA 1JZ4A 5HR6A 4Y8EA 1GQJA 4GG9A 3I7SA 1GVRA 1ME7A 4YYFA 3BG5A 2VUYA 4KPLA 3K13A 3IJ7A 2C7FA 2W9MA 5C55A 1US2A 5DCDA 3DZ1A 1HW6A 3AOFA 1FWEC 1D2KA 2X09A 4OUEA 3FIGA 1H41A 4R85A 1XYZA 3P93A 3QHMA 1E1CA 1EWDA 4FXSA 1LOQA 1R3SA 1HIZA 1QU4A 4DJED 1AMKA 3IVTA 4K3ZA 5FJRA 3ABOA 5AC6A 3S2LA 1WAWA 2EGZA 6REQB 1KTNA 2GLKA 3SFWA 3TN6A 5A2BA 1W5MA 3BLPX 3PJTA 3VZZA 2NQZA 4AEOA 2GJLA 1A0CA 3UWVA 1TVNA 3L4VA 1JDCA 4GMEA 1P6WA 1WQ5A 4GQGA 1B3ZA 1J01A 3CPUA 4GK8A 3RIKA 1N7KA 4C6JA 1OGGA 3VM5A 3WCZA 2O55A 1EGVA 4Z08A 2PA6A 2J13A 1Q6LA 2HE8A 4FX6M 4C7DA 2YX0A 2CZEA 4HK6A 3E0LA 1NWSA 4UTWA 1EJVC 3GU1A 2VM8A 3FOKA 3WQOA 3SN1A 3UPBA 1VYRA 4O53A 3MA8A 4QS6A 1Z7AA 1YEYA 2Y5EA 2Z1VA 3M46A 5A6KA 1VGAA 3RCYA 4W89A 1KLZA 1L0PA 3L21A 1OCBA 3FJNA 1BXNA 3RJXA 3ES7A 1R7OA 3VX1A 5DXYA 1W31A 4URIA 2OT1A 1RBAA 1P48A 3W71A 3GIYA 1NOFA 1ZBWA 3W37A 3THUA 1NU5A 3RDKA 4JX4A 1R7AA 1ME9A 2E6DA 2PMQA 1HJQA 3B8SA 1CGTA 5A3HA 4JQ4A 3NXLA 5D32A 3NQAA 2PZ0A 3EGJA 4MM1A 4I7WA 3MWAA 2CZDA 4C6LA 2BS9A 4WF7A 1CXWA 4XQ6A 3E0IA 3B06A 2GYIA 3STFA 5LA2A 3NDZA 3SECA 1EF3A 4BI5A 3MKVA 1HJXA 4J40A 3QR1A 4B5TA 3BJSA 4LALA 4LB4A 1MUWA 1S38A 3S9YA 5D9NA 1G0CA 1J4EA 1JULA 4A8LA 1G67A 4N9BA 4RNJA 4N42A 3BK0A 1BSIA 3BMVA 1CB7B 1TTIA 2A3HA 4RZBA 3A9IA 1X96A 3BLFA 1LZOA 2DT0A 3GBEA 1LQ0A 4X22A 4GC3A 3VI2A 4JXCA 3MSYA 4JIRA 3W7PA 1XV8A 2GPTA 4XD4A 1ADOA 1KD0A 2WHMA 1UD3A 3DIPA 1AL7A 2VVNA 4LUJA 3WK1A 2G4FA 4AMCA 2PGEA 4NZCA 2X1IA 1FWTA 3U3HA 5J8LA 3MZNA 2FZ9A 1MW0A 3QV9A 1QNPA 3M0HA 1GJPA 1MO0A 4JQ3A 2I5QA 3AYRA 4GBDA 2FPTA 3GFZA 3FN9A 3PFMA 3QLLA 1CGYA 3GXIA 1MNZA 1QR7A 4Z1CA 3URNA 3EKGA 3EBVA 1SJCA 1XM3A 1XRVA 3AALA 4XSLA 1FHLA 3AC0A 2CIPA 1O66A 3CH9A 1JCYA 3AZRA 4MB3A 1PKYA 3WK3A 3V3WA 5FD0A 3VDAA 4BFAA 4AFYA 1LLZA 1O6IA 2WKGA 2PFHA 4LY4A 2CEQA 1TB3A 1N82A 1TWZA 3UVAA 1EXBA 5LGXA 1REQB 2DJXA 1TPUA 3B0PA 1CLVA 4UOJA 1UP2A 5AYXA 2XFYA 2HBXA 4LT9A 4TO8A 4C6IA 2R1LA 3N18A 5FI8A 4RW3A 4YWSA 4C6NA 2X1TA 9RUBA 3M41A 3NDOA 1GPFA 3N34A 1XLMA 3MUZ1 2H9AA 5JIPA 4J9JA 3B0UX 1E70M 3QSTA 4PZVA 3HB9A 1VP5A 2QMJA 3P74A 2P0IA 3KCOA 3AHXA 1OFQA 2XYLA 4EOUA 4IICA 4DO7A 3SN0A 2V30A 3KRZA 3QHOA 4IIGA 1DJWA 1QWKA 1X8CA 1TZ9A 4PL2A 4IBDA 1BF2A 3H2NA 3L2MA 4DBUA 5EBAA 4QAIA 2TSYA 4GHLA 4E38A 3W82A 3SRFA 1JR1A 1V0MA 3LSCA 1V08A 3HFTA 3V5CA 2VURA 4ATWA 1M68A 3UJRA 2BGQA 5AC4A 1W3TA 2QCNA 4PMOA 2ICSA 4O0KA 2OEKA 4YN5A 4B91A 3CZ8A 3LRMA 3L4WA 5HPCA 3BLIA 3OU8A 1S3TC 1RBOB 3M7SA 3TEVA 1UR4A 1OC6A 3VO0A 5TBOA 1H1NA 4B2DA 4K1WA 4HPGA 2WSPA 3N2BA 2UY2A 1SYTA 1JPDX 3RX3A 3HQOA 6TIMA 3VILA 4DNHA 4FXJA 4RE3A 3NQ2A 4HK5A 1XF0A 1PWLA 2VDGA 4GNJA 3G1YA 2ZRZA 3EWUA 2Z4GA 5B7YA 4O0QA 3DH7A 3HOJA 3EA1A 1W17A 4Q8MA 2CLIA 4JHMA 3G8RA 1RD5A 2ZFAA 2OEJA 5FIPA 1RZMA 6A3HA 4LC6A 2TYSA 5REQA 3H7VA 1GVIA 2DIJA 3RPTA 2J6XA 4X63A 3E2RA 4NZ1A 1G7UA 1MDRA 4HD5A 4YNGA 2HXUA 4B90A 5JXQA 1IGWA 1SMDA 5CJNA 2X0YA 3NZ1A 4AAJA 2YYUA 4LB3A 4QQ3A 1VJIA 4FNUA 3IIPA 4M7SA 2J75A 3CYJA 1UD4A 1K8ZA 2PWUA 5DMYA 3AU2A 2ADAA 4ORMA 3W1PA 1F7BA 3FFSA 3H54A 5E6ZA 4GYFA 2IKHA 3KRBA 4GO9A 1WPCA 2VEFA 3ARVA 4GPNA 3MUAA 4MMWA 1I2PA 2CZ5A 5JUVA 1K9EA 1JXJA 2PS2A 3EMQA 2VELA 2QJIA 2VHLA 4XWUA 4JQ1A 2YJQA 4YU1A 3QZEA 2ZZ4A 4NY2A 3FA4A 1LWHA 1V3IA 4EVZA 3F5KA 1B30A 2J24A 2G50A 1Z8AA 1TA3A 5BRBA 1V0LA 2VRJA 2PUZA 3O3RA 4IFRA 3ZWTA 3I4EA 2IQDA 1HJVA 2A6NA 3HJZA 1GVSA 3AICA 5A6SA 1MEIA 2ZTJA 1QOQA 2J8TA 4WZHA 4IT1A 2RJHA 2G0WA 2PODA 3DFHA 1P6CA 1UOZA 1DTNA 5DY3A 4LG2A 4QAWA 4LUIA 1XH1A 1UH2A 3WZ0E 1G4TA 2WMHA 4G6CA 2DORA 1GQKA 4GGHA 5I3DA 4GI8A 2GK1A 2Z1KA 2ZQ0A 4FZIA 2D1ZA 3UZ5A 4LAZA 4RPPA 1E1CB 2V8ZA 4PRRA 3SM0A 3PFRA 2Z2UA 3QW3A 2VRKA 4W5ZA 4ERIA 1GK8A 3GE7A 4LAOA 1SMAA 2JEQA 3AMGA 1TV7A 1X1OA 4S3KA 2ZC1A 2BDQA 4XZLX 3VIFA 4RJEA 1UWSA 1TMLA 3PK7A 4R9OA 5AKQA 4LYQA 4RE0A 4QJ1A 3B05A 3UERA 3PUEA 2HISA 4UTMA 3UXLA 5BYWA 1GVEA 4UR8A 3VGEA 2NSXA 4JYEA 5C0QA 3W88A 5CC6A 3KZPA 4IBGA 3F7JA 1TWDA 2QAFA 4A3QA 4QGCA 4OZOA 4R3UA 1Q6CA 1A5KC 2WC3A 1CECA 4H3DA 5FAJA 4KESA 1SGJA 1TSIA 1NWRA 1AZ2A 1ECEA 4V33A 2WMJA 1YPXA 3I3EA 1UOKA 4JTTA 1JG9A 4ZOBA 3P61A 5FF2A 4ZQOA 4B3ZA 1JYNA 1J9YA 2Z2AA 3ZJ6A 3O0KA 1EGMA 4HA3A 4GIYA 4QXIA 2EHHA 4JZ5A 4G1KA 4PUKA 5EMLA 2CWXA 3Q94A 2GVYA 4LF2A 4M3PA 4WJEA 5K9DA 4LRSA 2Q3OA 3VNDA 3ME3A 3IWPA 3TMQA 4DRSA 3H7RA 1EJSC 1ZENA 3BSGA 1G5AA 1UH3A 5IBXC 2CLFA 4E8DA 4YCOA 5CPOA 2V6AA 3AHTA 3SIZA 1TG7A 5K2ZA 4JR5A 1HKMA 3IAPA 3CTLA 5EGRA 4GYPC 1Q6OA 5DN1A 3L65A 3F1QA 1TVLA 5CQ1A 3IK2A 4GC4A 2DUXA 3WMSA 5DBTA 4MIMA 1EX5A 4JTAA 3WF3A 1LRTA 2PBOA 5BRPA 4RKAA 1KKRA 2G96A 3NCOA 4F0LA 2J7DA 2BNJA 5AHFA 3WFLA 3OQEA 2FIQA 2A85A 3AO0A 2Y2HA 1BAGA 4MF4A 2ZCGA 3NO5A 3BWWA 1XLKA 3VD3A 2XSBA 4ZA0A 2INZA 4PB3A 4P8UA 4V15A 3W7RA 1OM0A 3HQPA 1EWEA 3A3WA 3CWOX 3LY0A 1VKFA 2GDQA 4MB4A 1MVYA 4NKCA 1HVXA 2AMXA 3TSDA 2FJUB 1WV2A 4JQAA 3V4BA 2JGYA 3SY8A 1PL9A 3S5YA 1POJA 4P2VA 4UFMA 1XIFA 3BV7A 1I75A 4RZ4A 4W88A 4AYGA 1H7NA 3NPUA 2GOUA 1J79A 3VNJA 2QW5A 3VIHA 4TV6A 2CLEA 4LUTA 3NNTA 4V2XA 3LMYA 1PDCA 4HSNA 1YPFA 2PGWA 3WNNA 1TJRA 1U83A 3T08A 3MUIA 4H8VA 4UUIA 2OSWA 3NAVA 4H1ZA 2HZGA 1PS9A 2YL5A 3DX5A 3H8AA 3DG6A 4PBFA 1SW3A 1BYDA 4O57A 2ZUNA 2UY3A 2J62A 1PEZA 3LNPA 3ZXWA 1ISVA 3A21A 3TH6A 3MJMA 1PAMA 2D3NA 1VD6A 2P50A 4NASA 5C2XA 5BNKA 1MYRA 1UHVA 4FAMA 3NQEA 3NOYA 1VBJA 1FDYA 1L6GA 4Q8TA 1G01A 4CD4A 3DC8A 2XJ7A 3ITOA 3DBNA 4C65A 4ZTYA 2DW7A 3PZIA 2E8ZA 4CU6A 1E1EA 4EK7A 2H3BA 2YR1A 1XIGA 4GXMA 4HU4A 4WD0A 3CHVA 3QMSA 2R94A 4GVGA 2BOEX 4ZB5A 4N2YA 3WLTA 4LPCA 4KMQA 4XUYA 3VYLA 4UTLA 3ZLHA 2FGZA 2ZXAA 4IP7A 1KQZA 2XN1A 1UD8A 4S3DA 6PTDA 5IFTA 4IPPA 1V3LA 2X42A 3VD9A 1EXPA 3ITXA 1JYVA 1F3WA 3CUJA 1XIBA 1QOPA 1NM9A 3NPWA 3S4TA 4ADUA 3GKFA 1JGMA 2CLOA 2FTPA 2Z29A 2E9BA 2PU1A 4N02A 1CB2A 1K9DA 4CQ8A 3TZFA 3NQGA 3APTA 3QV6A 5D05A 3KVMA 3GTHA 3V0SA 1DWFM 2MNRA 2UZ9A 2XIOA 3PZMA 4NNBA 3VOJA 2YL9A 5G2WA 2KZHA 4GO8A 5KTLA 3W7OA 4J3TA 3IVUA 3GLCA 4I5UA 4KBXA 2XSXA 3EEGA 5A6AA 5FEXA 3HN3A 4O0ZA 4I8DA 4H9VA 3M7PA 4DJDC 4KWVA 4TU1A 2XU2A 1H09A 3IV3A 1B3YA 3HJEA 1E55A 1RAKA 3ZT7A 3TDFA 4W8AA 5REQB 4LVFA 1KBKA 1JFXA 1D3HA 1T6MA 5ABFA 4QM1A 2DT1A 4ZQPA 1AL8A 4Z1BA 4FXRA 3WQ5A 4UFIA 3DOPA 1K6AA 2PI6A 2QHAA 1RCQA 4J3ZA 2DZUA 1DE5A 1WOBA 3EA3A 3EA2A 2EPKX 1B0IA 1JQXA 3W76A 3WDIA 4UZUA 2OODA 3A24A 4IXHA 3KRUA 4UFKA 3GIPA 3NQ8A 3WUEA 1G9HA 2DW6A 4UFLA 4AXNA 3RNDA 3F5LA 3W27A 2E9MA 5C70A 1QPKA 2DEPA 1M6JA 4MUPA 3KDNA 4IF2A 3R79A 1QW8A 1QUMA 3GDTA 4HZMA 5AHNA 1B4EA 1J96A 2PCQA 3HPFA 3R43A 1M7OA 5AFDA 1AA1B 3LK6A 3PZOA 4D6HA 1HUVA 4MB1A 4NXSA 3TFXA 1TA3B 1LUCA 3W25A 4X0VA 3VGBA 3NQFA 2PLJA 4WVXA 5DT7A 4C1KA 4RNFA 1IEVA 5DMLA 1XSJA 4H6QA 3UQNA 3LCLA 4AEEA 1DV7A 4LTSA 1QO2A 1VEOA 4HP5A 3VKBA 3N6HA 1ZSXA 4AY7A 1KGXA 2NZLA 4N9EA 3TA9A 3GXDA 4YTQA 1JCMP 1DEDA 4GYJA 1CWYA 4DAIA 3WL0A 3PBWA 1SO5A 3CZKA 2C1IA 3G6LA 9CGTA 4HYVA 3C3UA 2PWFA 2PRMA 4PTVA 5D4YA 3WEOA 3KTCA 2GK1B 3HG4A 1Z48A 1W91A 3G1FA 3QR0A 4H8HA 1S2UA 1X6NA 3I7QA 4QLKA 3VOHA 1HKVA 4JL2A 1G7VA 2XIIA 4UQEA 1VENA 4OOZA 5D8WA 2HS6A 2ZZ3A 2BB0A 2YCEA 3O6YX 3OBKA 2FQIA 3TN3A 1PV8A 4GI9A 1C7TA 4U2YA 1PTGA 3UZYA 4LC8A 2OOGA 2KAUC 3U2ZA 3MP4A 3VDHA 1P6BA 3S5SA 2GFTA 3TC3A 4A8NA 2PDNA 3M1ZA 3L27A 3PULA 4AWSA 3TN4A 2OSXA 3VNMA 4WDUA 4R7JA 1E0UA 5DANA 3C2EA 3WJXA 5F2LA 4WJXA 1PX4A 1BVZA 1W0MA 1EEPA 1R9XA 5CAHA 2XVPA 4IQDA 3PPHA 1J2WA 1QO5A 3CZEA 2V38A 2QAPA 1AD1A 2QJGA 1WX0A 4YCPA 1GKQA 3A22A 4PUWA 2P1FA 4QCEA 3IGXA 3W74A 2E40A 3WX7A 4GD0A 1OYAA 4PUDA 3R0KA 4RXGA 2V5BA 1UIOA 2RDUA 4GY7A 1UR9A 3CO4A 1AW5A 5DELA 3CV2A 4TVCA 9XIMA 3V35A 1NJJA 3H53A 3MCMA 4JDYA 4CUCA 1P0NA 2HSAA 4UMBA 2O4MA 2A21A 4WXZA 2BVTA 2Y8KA 3DFPA 1F74A 3H4WA 1YTEA 3E0FA 1T96A 2RDXA 3M0MA 4Y96A 1HP5A 2HBVA 2BY3A 4F2UA 1EC9A 1GT8A 3G22A 3STPA 4FLQA 4EIVA 2ISSA 3QH2A 2QR6A 3W86A 3S6DA 1UMLA 1J11A 3PWAA 5ECVA 1R3VA 3I6TA 2YDSA 4L5ZA 1U5HA 4JTRA 3GK0A 3WUGA 4CD6A 1I2RA 3AXMA 4GGBA 4ONVA 4B5UA 4LUYA 3LLDA 2DIKA 1ZL1A 4JHZA 2PAJA 4E2BA 4F0KA 2ISWA 3GX9A 3LGGA 3HONA 3PUDA 5F4XA 4EX4A 1CZ1A 1JYXA 3D3AA 4D6JA 3ONCA 3STGA 4GINA 8A3HA 2XH4A 3JW7A 2ZA2A 5FOOA 4PMDA 3GDMA 3L28A 4QITA 2D0HA 2DZWA 2Y2WA 5FL0A 2P88A 1W3HA 2HNEA 1E5JA 4B5NA 3DHPA 3WH9A 2XISA 4AY8A 3D47A 1E6RA 4OECA 3V1HA 1JPHA 2G95A 3WFZA 4O17A 1GONA 2VCAA 1XKYA 4DJFC 5FSDC 1G4SA 1O7AA 4AHPA 3H4GA 4Z1DA 2ACQA 1E4NA 2W5FA 1R46A 2V3EA 3FVDA 2GSHA 1EPVA 2GSJA 3DKLA 2O9RA 1TV4A 3G3MA 4FF5A 3A4WA 4OJLA 5AC7A 1P0DA 3SGGA 1TFVA 2B7NA 4OV4A 6CGTA 3BE7A 2CBUA 3FLUA 1TUFA 4LUTB 3E9AA 3VMPA 2XIMA 4AUBA 3WLRA 3VC5A 1XSKA 2X1SA 4G7EA 2Z7KA 4QG9A 1HN1A 5CXPA 2V5CA 1ECQA 4KIEA 4F0MA 3C0JA 4XO7A 4LYPA 6XIAA 2YDQA 1GOWA 2Y5SA 3KCJA 4PTDA 4CQBA 1E40A 3H24A 1UWQA 2QCCA 4L4LA 2HTMA 5IHRA 3G77A 1WZAA 3OZYA 1DJQA 3TIMA 5A6MA 3QPZA 2PDBA 2UWFA 4M51A 4HNOA 3PN8A 1IEIA 1OK4A 1WKFA 4MB5A 3ZO9A 5FSEC 3RX4A 3NL5A 1R3WA 2PTWA 3LTSA 5CPTA 1NWUA 3EOSA 2Z26A 1E15A 2BGSA 3HQNA 4QG6A 4R7WA 4IMDA 5A2CA 1RLDA 1DYSA 1HL8A 2NQ9A 4RDWA 4A2RA 3JZUA 3L25A 3UYIA 1KRCC 3H2FA 1DQXA 1Q8JA 3GHSA 3UR5A 1CPUA 2Y70A 5G4EA 5I3JA 5XIAA 1DJGA 3T4CA 3NSMA 5LSMA 2DPEA 1KBJA 3OLGA 4EP8C 3HV8A 3PWIA 4PMZA 4F66A 1X6UA 1ZUAX 3WF2A 5FESA 1B90A 2I7GA 1XIJA 1VR6A 3O9NA 1FKXA 1G69A 4XBSA 3R8RA 1GVQA 3VD4A 3TYDA 4GY0A 3C52A 4B4HA 3W2MA 1SZEA 1BD0A 1E0WA 3I3DA 2BG1A 4LWWA 4OBTA 4E3TA 1NOUA 3SUWA 2X41A 2EO7A 2PDQA 4FMVA 4E5TA 1EP2A 1XH2A 3I6RA 2WV8A 3HPAA 3GXFA 4HZ7A 4IBKA 4RNIA 4ZEPA 2RDWA 1UD5A 4IGHA 4WIWA 3MHFA 3PZVA 1UB3A 1SU5A 3K8MA 1XFBA 3VKDA 3V1PA 1XQLA 5CZSA 3WQVA 2W61A 1U1HA 3V0TA 2HVMA 3WD3A 1JDEA 1O60A 3SIMA 5ABFB 1R6WA 3EOUA 4H00A 4IJCA 1YQ2A 3OOQA 4MVAA 1W9VA 5K9XA 1ADSA 3KW3A 4WGHA 2AOSA 2GGIA 3P7YA 4IFOA 3U7BA 4ES4A 3H2CA 3UWYA 4XISA 1J7MA 1WKYA 3GXMA 4NNAA 1BPLB 4WXYA 4A8RA 4FNQA 1I4NA 2YL8A 2XM1A 4H04A 5CZKA 2V67A 3ZOAA 4Q4PA 5FJTA 3RMJA 1XUZA 3A9BA 3L29A 4HHPA 4KT2A 4XK2A 4RL3A 4TX9A 2GWGA 4Q8OA 2FVLA 4UQBA 3ORWA 1VEMA 4ZO6A 3H4XA 3N3FA 8XIMA 1RA5A 1LUCB 4GYKA 1RK5A 1I1WA 3M0VA 1NF7A 2X7VA 3KHJA 1ZJHA 3UPWA 2YBTA 2QF7A 2TAAA 1XDLA 3CH0A 2F61A 2WSRA 2BVYA 1BFNA 3WEZA 3W7DA 4PMJA 4JTGA 1S46A 1OY0A 3N04A 4KERA 2VGBA 1XLBA 2E5BA 3SSJA 1JQVA 4YTUA 5CG7A 3GH5A 2XH2A 4ZZ9A 1K1DA 1I6NA 3V7PA 3W38A 3SUVA 2Z2BA 2PP1A 2OELA 3OVQA 1Q6EA 5CSRA 1JNDA 4HOWA 1MUCA 5BZAA 4F0SA 1VCGA 3FA3A 1GWJA 3W2UA 2R1KA 5PTDA 1SO3A 4XZ9A 1XCXA 1DWIM 1LORA 2ZZ6A 1I1XA 2TPSA 1C92A 3G8EA 1A47A 3W00A 3BCDA 4DWSD 2WW5A 1KRAC 1OYCA 2A2IA 1DWHM 1UKOA 4LF1A 2VXNA 4XZNX 1XBXA 1H1ZA 3AZTA 4N0RA 4NJHA 2ZZ1A 3EKLA 3GR8A 1I2QA 4GZEA 3SN4A 2HROA 5EMJA 4LU0A 5C9WA 5HMSA 5DQPA 3T0CA 2RHGA 3KL5A 3AXHA 3N25A 3CB3A 5DF0A 4YHEA 2A5HA 4V1YA 3OBEA 3BAKA 2Z27A 3MDUA 4JTKA 3TAKA 1PTAA 1GVYA 4Q7IA 4N6EA 3SJ3A 1UH4A 3W1LA 2IPFA 5HDRA 1CI1A 3P62A 3KE0A 1LOLA 4F0RA 4NL1A 3BSHA 1QOXA 1P43A 5HUPA 1E6ZA 2VKZG 1ZAHA 4DVOA 4HB7A 1B3WA 1JZ7A 1Q2RA 4AWUA 3GFYA 3SRKA 4DLMA 1WE5A 5C7VA 4GH9A 4Q8NA 3TA6A 1GTEA 3LI1A 3CO8A 3BAYA 5IDIA 4M56A 3NZPA 3UCDA 1XYAA 1UBPC 3RFAA 5I00A 2VC9A 3H23A 1Q45A 3FX4A 3HIJA 2PCEA 1IEXA 4H6RA 4Q4SA 3ATZA 1TV8A 1FCBA 5LA1A 2QGYA 3SRHA 4AU0A 4KWUA 2A3EA 5M3WA 1C8QA 2WQDA 3T40A 5CG0A 3S1GA 3RXZA 3RYSA 3BW4A 3MP3A 2WZMA 3LENA 3TQPA 3DUGA 4OJYA 2QUNA 3OVRA 3VA8A 1W32A 3CV6A 4K39A 1U2YA 3WQ6A 3KL0A 4RZ5A 1F3XA 2UWXA 5LXEA 1JCTA 3KVLA 1KFKA 4JIEA 3O16A 3WLOA 2OO0A 4XZWA 2NX1A 4PMXA 4C5ZA 2AKZA 1EHNA 3AHYA 3CPGA 4DXXA 3L26A 4JNYA 4ZSUA 2Z1BA 2WJEA 3WDJA 2GGJA 2ALDA 2OQHA 4W4QA 1Z9AA 2O56A 2P8BA 4LBSA 4XZMX 1ZGDA 3W07A 1E6QM 3QZ6A 2NWSA 4A3HA 3AIQA 2D69A 3QKEA 1X39A 1IGSA 1XIMA 1C3FA 1IWAA 4AXKA 3VCRA 5K3VA 2JCHA 3LCGA 3MO7A 3P82A 2BFGA 4UZSA 4C6QA 3QJAA 1XC6A 3TFCA 2CBVA 1ED7A 3VGDA 2GUBA 3SZ8A 2E6FA 3NL3A 4ILSA 3EWDA 4AD5A 3S8HA 2QJJA 4DUWA 3KBJA 5ABEA 4QRNA 1O5QA 4NZFA 1WDRA 3INPA 5GNZA 1OQFA 2PDHA 5HR7A 4IGNA 1S1RA 2FFIA 4XZBA 3EMZA 2PDPA 1OJXA 4LBUA 1PHWA 2EJ1A 2J8FA 2VZSA 2ZX7A 4O14A 4O12A 3WF0A 1Q5MA 1XYFA 1H60A 3WFAA 3VE9A 2ISFA 3UU0A 2Y0FA 5DXXA 3M5XA 4Y9NA 1VBUA 3BAXA 4W87A 1DJIA 1DIOA 3NL6A 3HF3A 3GM8A 1RVKA 3WYZA 4DUOA 2VQTA 2C79A 2I9UA 1EF2A 1R87A 1HL2A 1Q6RA 3ZLFA 4LVDA 2VC5A 3WF1A 2H6RA 1VIWA 3RK8A 3S5OA 1XI3A 1UP0A 2EPLX 4IMFA 4XKMA 4OGZA 3M0LA 4UC5A 3SUUA 4DELA 4GIAA 3WK0A 1FWAC 1ITCA 2E68A 5C9RA 2D20A 2Y7GA 3MSDA 2XIBA 4PN2A 4W8BA 5L6UA 3W24A 1TUXA 4A2SA 4YHGA 3W22A 4HHLA 3II1A 3QC0A 4D9PA 1KM0A 2C1GA 2B7OA 2W62A 2WJZA 3LD5A 3YPIA 4JIIX 4US6A 1TQJA 3TKFA 1NP2A 3UZZA 3WH6A 4YYCA 4E2DA 2D2HA 4IX2A 3BSMA 1L6WA 3AJXA 2V5LA 3QN3A 4WSHA 2I14A 1BQCA 5KEZA 4HMEA 1O12A 4J5NA 4LGXA 1BF6A 3AISA 1QHOA 2HRWA 1KXQA 3GG0A 4PFMA 2WVSA 1A4LA 3WJSA 3B0VC 3BARA 4JEJA 4PRWA 4IMGA 1F5ZA 1FWCC 3KTXA 1M7JA 1B9BA 3I7RA 2RGLA 2ABBA 5I3KA 1UZ4A 2CC0A 1PO9A 3VIOA 3GG7A 2J7HA 5BU9A 4NJJA 3LNMA 1VEPA 3E2SA 8TIMA 2VD8A 2VO5A 2UV8G 3LMZA 2J25A 1HKJA 2XFFA 2QCHA 1J5SA 4S3CA 4B3KA 1UD6A 2VL4A 2X2GA 4O1CA 3F4WA 1OT1A 3CEPA 1O5XA 4GHRA 4B16A 2MANA 3EPOA 3O2LA 3KUMA 5FF4A 1YDVA 1AZ1A 1UZ1A 2QDDA 4GUFA 4IIDA 2QQ6A 4HNCA 2E1WA 5G2HA 1YNPA 4PCTA 4AD3A 2ISVA 3G24A 1KRMA 1CENA 3G6MA 3NUKA 1SUXA 3QY6A 2Y4SA 1VFTA 2GZXA 5AC8A 3UXKA 4FS9A 4H2CA 1JRCA 4M0XA 3QGAC 1KTCA 2ZX5A 3LOTA 2D73A 4C6FA 4AG0A 1F8IA 3F2BA 3UXIA 1KA9F 3ONBA 4L4OA 4DPQA 3WDPP 1NP0A 1JVNA 1H63A 1XYMA 4US5A 3AXKA 2BX7A 3BAIA 5I3HA 2A0NA 4RUBA 1H7XA 3JS3A 4H01A 4MFEA 1A49A 2NV1A 1KGWA 4WUIA 2PDKA 4GVIA 4HYWA 1BWKA 3KBNA 1RK6A 4BWLC 2XD5A 3M5VA 2JALA 3M0JA 1GEQA 2QV4A 3WLNA 4LJ3A 1XCFA 1E43A 2IQTA 1SZNA 4UMAA 3LPPA 5HNUA 5A6BA 2CCRA 1I2OA 4JS3A 2J8GA 3UF9A 1VJZA 5C2GA 2CETA 4H7CA 5BOEA 1AFSA 3P67A 5H8PA 4Q8UA 1NTHA 3KS6A 4M1BA 4DWDA 2I5GA 4JFWA 4L64A 3B4UA 1EYEA 4LBRA 2E28A 3CNYA 1GVFA 2PBGA 5I79A 4QG8A 5I24A 4GCAA 1AIWA 3T2OA 2PB1A 4KFNA 1YXYA 4IGMA 2Y2IA 2C0HA 3SQMA 1QNSA 3NFUA 2ZX8A 3TLLA 1JPIA 7TIMA 4E4UA 3W01A 3G1VA 3WNKA 1E9LA 1MW2A 4UTTA 4PYSA 2F2KA 5DY2A 2OLAA 1ZP4A 4K8GA 4L9XA 3W7JA 1M9HA 3PC0A 1WA3A 1F3TA 2PWHA 3MSRA 1OZMA 4KFPA 3GHUA 3FYOA 5JVLA 3BG3A 3C0SA 3COTA 2XWEA 3E0VA 4B2DD 3E12A 2FN2A 1PUDA 2YW4A 3WQGA 4DYKA 4PEEA 2J9YA 2E5DA 1QXLA 3T0BA 3WO8A 4LEFA 1JPMA 2WHKA 4KWSA 4GLEA 5D9PA 5DCEA 3RCNA 4IH3A 5AC5A 3WBYA 4ZE4A 4FP1A 3TTQA 3EOLA 1EGZA 1I8JA 5AB3A 4IPIA 3UJ2A 2J7GA 8CGTA 3MV11 3KVJA 2HV5A 1EZWA 5D8ZA 4FF7A 3BANA 3APGA 1GORA 1RP9A 1LG2A 3RMEA 2XFWA 4X2RA 3VFCA 4OJ6A 2OTDA 2WLZA 4R7OA 3BV4A 2DY3A 2X05A 4PTXA 4E8CA 1HGWA 3ITTA 5CH9A 3GC2A 4A22A 4JTIA 5ABHA 4TVUA 4QQUA 4FR1A 2JF7A 4ZQMA 3W9ZA 2XN0A 4MLJA 1WNOA 3G1DA 1E9YB 3SY5A 4GY1A 5C9ZA 1GTHA 1Q85A 1JF6A 3TLQA 2YFNA 4D8AA 2HEJA 1Q66A 2W79A 4M82A 3L4XA 3VPLA 2QF8A 1OABA 1D9EA 2PU0A 5T9CE 4YIWA 3IACA 3RM9A 1C29A 3WIJA 3NPXA 3BXWA 3LI0A 4MSSA 3ITVA 1V3MA 4CEUC 1XGEA 2C3ZA 4NP7A 3W1QA 3DCPA 3KVKA 3U2CA 1LWIA 1CLXA 2E0PA 4UIOA 4UWMA 3B8WA 3OA5A 3E0WA 4LW7A 1T8QA 2OZ3A 4BQ4A 1V5XA 1V51A 3LQGA 1VYPX 3LZ5A 3GVWA 2ZYFA 4JIHA 3TJ4A 4ZQCA 4CQ9A 2WAGA 2Y89A 3B8TA 1LRQA 1JAKA 2CBIA 1VCFA 2HPIA 3UG5A 1TTPA 1CXHA 4Q4RA 1RY8A 3IJIA 1OF8A 3ZZ1A 3MMDA 4HN8A 3GR7A 5CJMA 2I16A 4E2OA 1E56A 1BKHA 4W84A 3TCEA 3SQLA 4OV9A 2R14A 5AHLA 1F6PA 1YU0A 1VYSX 3TQVA 2YOCA 3JR2A 1K7XA 4WRHA 3W7LA 1LM1A 2P0OA 3W28A 2FFFB 3K2GA 3O6AA 3U5YA 2DH3A 3G1RA 1KC7A 2X40A 4NSBA 4WDXA 4C1LA 3EB2A 1B3OA 1JXKA 1TX2A 2J4GA 3IGSA 3GDKA 2NT1A 3S0CA 3UNDA 3W0KA 3RO6A 2ZICA 3N6QA 4MLRA 5H8UA 4UTHA 4EAYA 3PJUA 3EZ4A 1ZJBA 4NT0A 3BQ5A 2GJRA 1S2TA 3MMTA 3AIBA 3R58A 1H0IA 1XIHA 4L1WA 3FAWA 1DQWA 3C86A 4R53A 1XLDA 5T26A 1K4GA 4NF7A 3IANA 3BLEA 3N1AA 3ZR5A 2JIEA 2WK2A 3SAZA 2EQDA 2D0FA 1FP9A 1BYAA 3NZRA 3BGJA 2ZZ5A 4JGDA 1S5VA 3CUGA 1AW2A 4FLSA 2GUYA 3ITCA 1G94A 4MAVA 2JEPA 2FB2A 1CXFA 1BSLA 5BMWA 2FHFA 4D6DA 2ZC8A 4IUGA 4PBGA 1PE1A 4GUIA 3AIUA 2PPGA 3MC5A 1W1YA 3R13A 4IX0A 2I17A 3DFNA 3FS2A 4XD5A 4GHAA 1ZPTA 4UTWC 1S5TA 4NIRA 3T6CA 1QCWA 2JF6A 3AI0A 2OCZA 4HPJA 4J28A 1WKDA 4ATLA