4NZ3A

Structure of vibrio cholerae chitin de-n-acetylase in complex with di(n-acetyl-d-glucosamine) (cbs) in p 21 21 21
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
403
structure length
403
Chain Sequence
PKGTIYLTFSDGPVNASVEVIKVLNQGGVKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVEEFGPTSGADCNATGNHQIHSYQDPVRDAASFEQNLITLEKYLPTIRSYPNYKGYELARLPYTNGWRVTKHFQADGLCATSDNLKPWEPGYVCDPANPSNSVKASIQVQNILANQGYQTHGWDVDWAPENWGIPMPANSLTEAVPFLAYVDKALNSCSPTTIEPINSKTQEFPCGTPLHADKVIVLTHDFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPRWSVGKTYQAGEYVLYQGVVYKAVISHTAQQDWAPSSTSSLWTNADPATNWTLNVSYEQGDIVNYKGKRYLVSVPHVSQQDWTPDTQNTLFTALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deacetylase DA1
publication title Structural basis of chitin oligosaccharide deacetylation.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 145
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2013-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.90 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4nz3A02
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4nz3A01
5BU6A 2C71A 1Z7AA 2C79A 1V6TA 4V33A 1NY1A 3WX7A 4U10A 2IW0A 4F9JA 3CL8A 4NYUA 2XU2A 1XW8A 4NZ4A 2NLYA 3RXZA 2J13A 2QV5A 4NY2A 3CL7A 5JMUA 2DFAA 3VUSA 4F9DA 2CC0A 3HFTA 3QBUA 2E67A 3S6OA 4OUIA 4HD5A 4M1BA 4NYYA 2VYOA 4LY4A 3CL6A 4L1GA 4NZ1A 4NZ3A 2I5IA 4NZ5A 1W1B1 2C1IA 2C1GA 4WCJA 2Y8UA 1W1A1 2W3ZA 1W17A
chains in the Genus database with same CATH superfamily
1K3UA 3U2CA 2XM1A 1X98A 5HULA 1XFCA 5G1TA 4HMEA 5HNUA 1CGXA 2YDQA 3E2RA 5G1MA 4NNBA 2GGGA 2YYUA 5D02A 3H22A 3K2GA 4PCNA 5JVLA 3PZUA 1GXDA 1HP5A 3KS8A 5DRCA 3N2MA 1TPB1 4J3XA 4H04A 3NQ8A 4IPLA 3C61A 1Q5MA 1GZGA 1KGWA 5T9BG 5I02A 1FDYA 4IMFA 3SGZA 4ICCX 1J2WA 3U2ZA 2ABAA 2ZUSA 1O68A 3L4ZA 1Q66A 1AL7A 1ELSA 3GVGA 4EX4A 2TYSA 2Y88A 4GUFA 4O12A 3L12A 1GOOA 6ENLA 2C79A 2X0YA 4UNLA 3QV7A 4UR9A 1ISVA 1S38A 1UWQA 1LUCB 2WB5A 4IMAA 4F2TA 2BGQA 2A85A 1ISWA 3FLUA 3I65A 3KBSA 1KM2A 1L9WA 3P8JA 2VEIA 4YWIA 1ONEA 2X09A 3NQCA 2QJGA 5EY5A 5EGRA 1PVNA 2PF8A 1E9YB 1VBHA 5CPOA 3VFLA 4AHQA 1G94A 1JGIA 4D1IA 5I3KA 1PDYA 3M16A 1QTWA 2IKHA 2TPSA 2Y2PA 3MKCA 4HHLA 2WMFA 1EDQA 2VEPA 3LBOA 8TIMA 1XLKA 4LUTA 2JBMA 1K02A 3WDIA 1ISYA 4GD0A 2JKPA 3VOJA 1ITCA 1JI2A 1IEVA 3CPUA 3NO3A 4RW3A 4ADUA 4R5EA 4KW2A 2Q8ZA 2WNZA 4PUKA 2OZ8A 3M0KA 4HN4A 4I5UA 1QI2A 4MWAA 4OV9A 3URQA 2Z4GA 1OYAA 4DZ5A 1BKHA 1KA9F 4DUVA 4C5ZA 4NAEA 4GY0A 3K4WA 4AHOA 2YCJA 4CNPA 3RU8X 4NX5A 3LK6A 1A47A 3OYXA 1P7TA 4P7LA 2MANA 5CGQA 2NXHA 2HNEA 4J7RA 1WAWA 2CPUA 4HHPA 1NOUA 1GGOA 1S5VA 1IT0A 5BXRA 5J5RA 4IBBA 1ZL1A 3K5XA 3W02A 4A21A 1NOWA 4GZEA 4GHLA 4JS3A 4ZE4A 3VI2A 3PZ9A 2P88A 4UTFA 3C52A 5AVHA 1ZAHA 4Q8VA 4XBJA 3TTQA 4BF5A 8RUCA 2JKEA 2WC4A 3ARVA 3LCHA 3WQFA 2NXIA 3L9CA 5DFAA 4MKNA 3WG6A 2FTWA 3UZWA 4GIYA 1NM9A 5LIUX 2V5CA 3LU2A 2VUYA 3MT1A 1XLEA 1ESWA 1DQWA 3CGTA 4MB5A 1GPFA 4XAPA 1ZBKA 3IARA 5CKSA 1K6AA 1FWCC 3HQOA 1DE6A 5D2WA 1I6NA 3TJIA 1L0PA 4AG0A 1LM1A 2ZXAA 3DHPA 4NX0A 2DSWA 4U3AA 4HPHA 4N7QA 1XRTA 3AYRA 2IS7A 2CBVA 4O1CA 2NUWA 3CQHA 3FA3A 3PBGA 2J9XA 1J0ZA 3L5LA 1AQFA 3MMUA 2GWNA 5FJPA 1UKSA 5DX7A 3R0UA 1ZFJA 4S3AA 4HNTA 3EWWA 3ABRA 3PNZA 1LORA 2ZICA 2FVLA 3GBDA 3DN5A 2J6XA 4LCRA 2RH9A 4HA1A 3U48A 4V33A 4QNEA 4A3QA 1XJBA 1I45A 2PDXA 2G3JA 1DJYA 3ELFA 1PV8A 2CLOA 4REQB 5EBUA 2VFDA 1JCJA 1E9LA 3PJXA 4AISA 2O0TA 3EXTA 3EWBX 1V6WA 2V6AA 3CPRA 4F9JA 4EP8C 3GVVA 4OHQA 4H9ZA 3N18A 3BAWA 1TRDA 3FHQA 3U5YA 4AZ6A 3W38A 1V4YA 2EPKX 1H63A 4RNIA 4B3LA 3NEHA 3VKCA 2J7HA 2ZA2A 3L66A 3UQNA 3UVAA 1S5NA 2VEKA 4G2DA 2PDLA 1KBLA 3O1NA 3AS3A 3MHUA 1GYMA 1KCLA 4JTAA 2VFHA 3P67A 4R7WA 2YDSA 1WXZA 1GOIA 2FDSA 4AZCA 3PZNA 3LXAA 4FNPA 3W2KA 4GXPA 1JIBA 1LQAA 1J5TA 4AW7A 4C65A 1XBZA 5IFPA 4LPCA 1S2VA 3R12A 3CZKA 3DYMA 3UFYA 2WMGA 1GW9A 2AQOA 2D0GA 4WEVX 2BY1A 5LXXA 4B5VA 2PLKA 3VGFA 4OZOA 4LBUA 1P0EA 3ARWA 4S38A 1R9XA 3BLLA 4DY1A 3EB3A 3T42A 1FWNA 4I9AA 2Z2AA 1JD9A 3L29A 3T8LA 3PK7A 3T0AA 2O55A 4O53A 2PC8A 4PCTA 2ZXQA 3S83A 3WLIA 2HVOA 2O56A 2PU0A 4E2DA 3B8SA 1GQIA 5D05A 3W1NA 2BG5A 4WIWA 3AU6A 4A22A 4Z2KA 4HD5A 1FKWA 1ZPTA 3DHDA 4GYPA 4PMRA 4L6OA 2C6QA 3KS5A 4NP7A 3RU6A 1RCQA 2BG1A 5CLWA 2EPHA 3THQA 5T9CE 1E1CA 2VX6A 4W88A 3VOFA 3H4WA 1QW9A 1QWKA 2WZHA 1KLYA 4DJDA 3KWXA 4H9XA 4BR1A 1B4EA 4XZWA 5D9OA 3GHRA 3EBVA 1TTPA 4QG6A 2X2GA 2E68A 3LHVA 1GCYA 3GXDA 1QUMA 3GUWA 3MHGA 2V3FA 3S2CA 3AS1A 5FA5A 3ARUA 2P50A 2OJPA 3NL3A 3NDZA 1UWAA 4QLJA 4E2OA 1L8PA 3IAPA 1TWIA 3RILA 3M0HA 3TFCA 3W7GA 3WDJA 1EZWA 4M6UA 4EWJA 2YCEA 4ADTA 3KP1A 4J3TA 3GDMA 4LRTA 4RDZA 5HWJA 2V68A 4Q7NA 1FQ0A 1VB9A 4DJFA 3EWDA 1XIJA 2EPNA 4WR3A 4QJ4B 3USZA 2REQA 4EKJA 2C18A 2Y70A 4GNVA 4IGNA 1F4HA 2GVJA 2ZADA 1CXLA 3E74A 5E70A 3AUOA 1C93A 3LSCA 2EQDA 4RDVA 3OVGA 5D8ZA 1HKJA 3H21A 3STGA 1I0DA 1GOQA 5C2CA 5DF0A 2HISA 4Z2GA 1XCXA 1VPQA 4J3ZA 1PDZA 5T91A 3SIZA 1XLLA 1W1A1 2FTYA 1US2A 4MFEA 3SRDA 4ZOAA 4ZGYA 1LBFA 4MG4A 3VOCA 4GYJA 5BNKA 4FHAA 1GKRA 1GWJA 4BWLA 2ZFAA 3VA8A 1KBJA 1KWGA 4WY0A 2YYTA 5GQBA 1W9BM 2VKZG 4G7FA 2OXNA 3RCMA 1BSLA 1XD1A 4BFAA 1DXEA 3CL7A 2RJGA 1XBYA 1HNYA 4LS2A 4LY4A 1TX0A 1XRSA 4I7WA 3LY0A 2BVYA 4XZMX 1SFJA 1SZNA 3QLDA 4O17A 3MCMA 4BZYA 1R46A 3L65A 4UFLA 3LHWA 2C14A 4QBXA 1LQ0A 3BJFA 5LXEA 3M44A 3BWWA 2AOSA 4X60A 4GNKB 2D0FA 3HBLA 2Z1VA 1H7OA 3WKZA 2DIJA 3LXBA 4KCUA 4MYAA 4IJBA 4ZA0A 3WMSA 1WX0A 1FRBA 1BVNP 3RHGA 3QMTA 1L6FA 3LV6A 1AH4A 4NAFA 2GQ3A 4G8TA 3G1SA 2RAGA 5I0DA 3SCUA 2V5OA 3R4IA 3IJQA 3EPOA 4X3ZA 1US3A 2YW4A 1E0UA 5BRPA 1WDPA 3WNPA 3AHXA 3W3OA 4DXVA 3N6HA 5CC3A 1YBQB 2GK1A 4RW5A 1X1NA 3HGRA 3UU0A 4GKLA 1AJ2A 4PH6A 4N42A 3KTSA 1D8CA 2DZXA 3E0WA 1XXXA 1KS0A 3WX7A 2CU0A 3B40A 4LTSA 3S2MA 1PO9A 3WK3A 5KZ6A 3E0IA 1EA0A 1JDEA 1FHDA 3QR0A 1CW2A 5A6BA 2V5LA 2XYLA 1RCXB 5E0KA 1Q7MA 3CUIA 5CCZA 3QH2A 3A13A 4Q8WA 5H1WA 2MUCA 3AQUA 1F6KA 4Y9NA 3RAOA 3ZR5A 2J66A 1NP2A 4O13A 1G4EA 2ADAA 3R94A 3IEBA 3QJAA 3G24A 5F2LA 4LCSA 2VUNA 4QROA 1QI3A 5ABTA 1M65A 3W7MA 3K46A 1FWGC 2PWEA 2QCDB 1UJPA 4XSMA 1W5OA 1OINA 3AIEA 3QC3A 2NX1A 3LGGA 4HCHA 3E9AA 1RA5A 4ORIA 4ZODA 4DF1A 2QCMA 4EOUA 5DCDA 3M9YA 1LWIA 3KHJA 3GDTA 2C71A 1K9DA 2ZKMX 4D6HA 1AODA 1GOMA 1LRQA 1ZB5A 1HL8A 3MKKA 4IBIA 4W7VA 3BARA 4HA4A 4NJGA 3WLLA 1BSIA 5A6MA 3EMZA 4LC8A 3O15A 1PTDA 3NXLA 3ARQA 7ENLA 3PPHA 1XSKA 3GFXA 3ABZA 3GIYA 4JKKA 2V5DA 5I5RA 5CPSA 2Y62A 1UROA 3NQVA 1J96A 2TMDA 4R7JA 1TWDA 3DGBA 3L2MA 1YXDA 4P8VA 3WH6A 1W17A 2CYGA 4XKYB 1HIZA 2NV9A 3M43A 2D2HA 2RHGA 1RALA 3WMLA 1SGJA 1XSJA 2XSAA 4PMJA 1N8FA 5JBFA 1MFVA 1XP3A 4GQGA 3LHYA 2DZWA 3EA2A 3HIJA 4K8HA 1ZGDA 4Q22A 4L6HA 3WH7A 3E96A 1L8NA 4OE7A 2WLYA 3LENA 3VDAA 4PN2A 5FJOA 3AMKA 1DEDA 3AIWA 1OG6A 3ABXA 3P0WA 1VP5A 2HS6A 4IQEA 4NI3A 2Z29A 1M7JA 1QT1A 3HG5A 3THCA 1AQ0A 2VQTA 4PRTA 3E49A 2BHZA 1PZ2A 2DQWA 1JFHA 2OELA 1LWHA 3RLVA 1BLIA 3EOUA 2Y1HA 3PC0A 3SCRA 4E4UA 5BOOA 4HZ6A 1EGMA 3WNMA 1TVLA 4GC4A 5H6HA 2G5WA 4GXWA 4IH3A 4URIA 4RX0A 1M7PA 2XH0A 4TVDA 1Q7QA 2X0SA 3S4TA 1NDYA 2PGRA 3T2QA 3TYBA 2Y2MA 4HHHA 5D38A 3W2NA 4RR4A 3QRHA 1M7XA 3WF4A 1A53A 2WVTA 4OWGA 2ZA1A 4NL1A 2YBVA 4D9PA 4JHOA 4LYKA 4D6EA 3CAVA 3DENA 1I0BA 1PKLA 3C2FA 4D8LA 3EOOA 4OBSA 2Z2BA 7TAAA 2WSPA 4E8CA 1CXFA 3FGCB 3LRLA 1IGSA 2WZTA 4I6KA 3W84A 1REQA 1W2VA 3V4BA 1AQHA 1BXCA 4D8ZA 2X40A 1GG0A 4RPPA 3M0YA 3KW3A 4PA8A 3WK2A 4ZQMA 5EPDA 3TR2A 5C70A 5C9UA 5C7HA 3WLMA 1C7TA 2XIQA 4WSHA 3BJSA 3IK2A 2CLKA 1LDCA 3SRKA 5CBBA 3SJ3A 3C8NA 5A6LA 5E0FA 4I9TA 1Q13A 4JHZA 5IDZA 1J6OA 2XN0A 4YHEA 4JAWA 4KEZA 3GXFA 3HGSA 3TXZA 5C7VA 1XRVA 2IUZA 1UKPA 2EKGA 4KWSA 1UD6A 3QZEA 3UESA 1QW7A 3OLEA 3T78A 4H9YA 5C71A 5D03A 3QMRA 2GSEA 4BEQA 2BVTA 8CGTA 3WBYA 4GQRA 3BDKA 1S3HA 3KVJA 2NZLA 2Z1WA 1U30A 5H8PA 3IRSA 3OTRA 3CWOX 4EIVA 1FH9A 1WKEA 4CU6A 3DI0A 3WFAA 4NNAA 3NM3A 1TV4A 5D4YA 2QIWA 2W3ZA 1H62A 4BJHA 4FLQA 5DN1A 1WDSA 3MMDA 1JCNA 4XD6A 2GQ8A 1JZ2A 1POKA 1E6SM 3VX0A 1ONWA 3P8IA 3LM7A 4Q8OA 2QPXA 5AZ1A 5CAHA 1R8LA 3KBJA 2CZEA 3NCOA 4OOZA 4MSSA 5BWAA 4K8GA 1A0CA 3WF2A 1UA3A 4HKPA 3FAWA 3CPGA 1FDJA 3F03K 1NELA 2CERA 5F4WA 3KZPA 4O4VA 2A21A 3VYLA 5E93A 3SUTA 3MW7A 3QTPA 4ASTA 2ZYFA 4LY8A 4GACA 1G1YA 3NYDA 1DHKA 3KCJA 4ES4A 5CGTA 4UMAA 1W6TA 4IX2A 3RPDA 3N3FA 4RL3A 3UETA 3PG8A 1NWUA 3ONCA 3VE9A 1V79A 2DZVA 3CTTA 1T0OA 2A5HA 4C6DA 3O6YX 3R2GA 3V0UA 3WD1A 4CCEA 4PMQA 4KFNA 1HT6A 3E12A 4AZBA 2GVYA 1JPKA 4I7VA 5M2FX 1HL2A 1HKKA 4NU7A 1R9ZA 1WP6A 2JF7A 3OVQA 4C6LA 3VMPA 3M0IA 1Q4WA 4M24A 2XHYA 1GG1A 2PP1A 5HQEA 3P2VA 3AU2A 1B90A 5LHFA 4NJHA 2WXDM 5G5IA 3MUAA 2ZBTA 1K8YA 3HJZA 2E5DA 2VRJA 4EVZA 3UXKA 5C2GA 3PAOA 3RCNA 5HNNA 4PMXA 1ECEA 2OGJA 2OU4A 3GW3A 3XISA 4E8GA 2D23A 3UWEA 3A9IA 3RG6A 3CK5A 1TVNA 1V3KA 1KBKA 2ZUNA 1Q6RA 1HX0A 2E8YA 2INFA 2F61A 4LH8A 3SUSA 3GKAA 4UTMA 1B2YA 3NURA 1NARA 3SECA 3ITTA 3LNMA 4XAYA 4LV9A 3N2OA 2WVVB 1AH0A 1R2SA 1BHGA 2PEVA 3ARXA 1AZ2A 2B7QA 2I56A 1B0IA 2DZBA 3QM3A 4DHGA 1HN1A 3E0VA 3HG4A 1FFQA 2NXGA 5D2YA 3HGJA 3PY2A 1Z7AA 3W72A 2ZE0A 5AZ0A 3S0CA 1UHVA 1BKSA 1OHLA 4LV4A 3ITVA 3MKVA 2R1PA 4JFVA 3RRAA 3NOEA 1XINA 3DESA 1W5PA 3E6EA 6A3HA 3ZOAA 4W89A 2FB2A 3N73A 3DERA 1XUZA 3G6MA 2ASHA 2ZC1A 5I78A 3B8VA 4JIPA 4IBEA 4V2XA 4KKXA 4GK8A 4B4FA 2Y2GA 1FCUA 4K2SA 3PPCA 3ENLA 3EPNA 1DTUA 2CLHA 3L68A 1SW7A 1VR6A 3AICA 2VOTA 4N6EA 4DYKA 3OVPA 3VVGA 5I2UA 1UOKA 3QQ1A 1A0DA 3TH6A 1AW2A 3ZYZA 4HN8A 2Z2UA 3W01A 3QV9A 3SQMA 1S5WA 2WZMA 1NIUA 1TWWA 3R8HA 3PPGA 4Y90A 1R2RA 3UXAA 2WMIA 3Q4DA 3UWUA 4OU1A 1ICQA 4FF7A 4AXNA 1WQ5A 1RHCA 3C0SA 4JQ4A 3ZLHA 4E38A 4OOUA 4KWOA 3U0HA 3CZLA 3LCLA 2IOUA 3G1HA 4AZCB 3BANA 3GIPA 2WBKA 3SCOA 1NDZA 2IXUA 4QJ3B 4KRZA 1FWIC 2YW3A 3PULA 2DH3A 3P6LA 1D7KA 2D69A 3WQCA 2RJHA 1H7PA 1QOXA 4IP5A 4CD8A 3LGEA 1OGSA 3AJXA 3TYCA 3PUEA 1FXQA 1UR4A 5I3GA 3A5FA 4H9MA 1S46A 3RITA 3CO8A 1G4PA 1P5BA 3IVSA 3LG3A 1QPRA 3CEUA 2VT0A 2GZXA 3NVTA 2EXOA 3AROA 2CKRA 4BA0A 5F4XA 4GWEA 3WD3A 5DANA 4ZQNA 1XBVA 4LWWA 1VENA 5HJYA 1GK8A 1J0IA 4JIRA 2E8ZA 2W4XA 3EZ4A 3PJUA 4ZQPA 2DVTA 2EF9A 1E51A 1XQKA 1Y65A 1RUSA 3TYAA 1EWDA 3QW3A 2VGBA 1GONA 1XM3A 2YOCA 1O1HA 5EB8A 1JAKA 1YNPA 1K4HA 2AQWA 2YCLA 3ALFA 1SJAA 4GLEA 4LQ1A 3W27A 1ZALA 5EKYA 1GVRA 5I79A 4FIQA 3BLDA 1THFD 1KO0A 1CECA 1Z89A 1W2PA 4EE9A 1BVWA 3IIVA 4MPKA 3L27A 3VDBA 3ABQA 1NJJA 2REQB 3C2RA 4X9SA 1FH8A 5A3HA 2HPMA 1XWYA 4H2CA 3B9AA 4IP7A 3KOFA 2OCZA 2OEKA 3IS4A 4FNSA 3CS2A 1J12A 1RBLA 5LGZA 2WVSA 1UPMB 1Z48A 4U4MA 4DWDA 3NQGA 1TTQA 1JYNA 3T2OA 1PBGA 2Z28A 3INPA 2OSWA 1BYCA 2ALDA 3OHIA 3S42A 2XUCA 2F8QA 5HWNA 1WUEA 4JFSA 3QV8A 2FHCA 3VKDA 2P0OA 2X2YA 3CZGA 4UTLA 2OT0A 1UZDA 1TE6A 3GRIA 4HSOA 4S3DA 2PWDA 3HJEA 1IHIA 5J8LA 3NG3A 3SGGA 3M47A 1GJUA 2OOGA 3NYZA 4LUSB 1RQEA 4L4LA 3PTDA 4IJFA 3DGRA 1YIXA 4KRTA 4WQ6A 3D6NA 1MSSA 4GI8A 1SUXA 1WA3A 5C9XA 1JCLA 2PDJA 4J3SA 4C1NA 1WZMA 3VKKA 4M1BA 1W9XA 4OQVA 4PTWA 3GYEA 5FJRA 5F1VA 3TSDA 2VZSA 2VFGA 4DUXA 2NVAA 4TX6A 3L21A 1QHZA 4XD3A 1KM4A 1MYRA 1UZ4A 2CZ5A 2OQYA 3OZMA 5FF0A 3WFLA 4XZ9A 3R1ZA 3JS3A 1JL8A 6REQB 3B8WA 2H8ZA 5I09A 3BAXA 1M41A 1JZ7A 3VNDA 3VIMA 4HMNA 1TJ0A 3MYPA 3GQYA 3HPXA 4IJRA 3BZGA 2GQ9A 3NSXA 3T40A 1QI0A 3MZNA 1MWOA 3CEPA 3H53A 4HK7A 3G77A 3M7PA 2OSXA 1X7IA 4HBKA 3SN4A 4U2YA 2D2OA 4S3GA 1V3IA 1T40A 3LDVA 4B5TA 2HCVA 3ZVHA 1XX1A 5FF3A 2OEJA 3EDEA 3IANA 4G6CA 3OODA 4JBRA 1TZZA 1XYMA 4Y9OA 5CPLA 3GKFA 1IR2A 2Z7KA 3W28A 4MAVA 2UY5A 1HKMA 1VFMA 4JDBA 4ZOCA 1ODZA 1TPC1 3I3EA 3W7PA 2DVXA 1W91A 1S2WA 5C9ZA 3GS6A 3BTNA 3NIYA 4OT7A 3TN5A 2CITA 3VXGA 2XISA 3UR5A 3MWAA 5BMXA 2P1FA 4CEUC 2Y85A 2PDKA 2ZQ0A 3KL3A 3FAXA 3C0QA 3G1RA 1EQCA 1KQZA 2NQJA 3MMTA 1W37A 2QCHA 3LQGA 1CK7A 1S2CA 4I3GA 3TW9A 1R30A 2AMGA 2YB4A 1JULA 5L9FA 5G2HA 1R3QA 4MYXA 1O5RA 1FTXA 2YX0A 9CGTA 1E9ZB 1K70A 4Z1BA 2DIKA 3KOWA 3W74A 1DWFM 3W1PA 1SR0A 3CAQA 1G4SA 3AIBA 4JTJA 3T44A 1XIHA 1XV8A 2ESCA 4J35A 1OT1A 4O1BA 2HJPA 2QDDA 3BLOA 4UTWC 3F1QA 3ARRA 1JRCA 4HCDA 2FPYA 1KC7A 3ZT5A 4P8WA 1QI5A 1ME7A 2C8NA 4PMOA 3VCRA 1V0MA 3W1QA 1EDGA 1BQGA 3VFCA 1J0YA 3S3GA 3E5PA 1CWYA 2O9PA 4JPGA 1W9UA 4W87A 5CPMA 4DF2A 2GL5A 7XIMA 4JTRA 5BMWA 4A8NA 3LTPA 3W6MA 1MI3A 1YXYA 4NQ1A 1OCNA 2E25A 1V0KA 1QW8A 3KBNA 2PDIA 1OWQA 3FSUA 1DPMA 1EGVA 1H5YA 1EQPA 1JNEA 3GAYA 3FEMA 2GVEA 5I3HA 3B9OA 2GUUA 4WVXA 1EBGA 3FOKA 1JPHA 2J75A 4H6RA 2WWDA 1MNSA 4GI9A 1KKOA 1NTHA 4QDPA 3UA4A 4JY9A 1HVQA 1T8QA 4AF0A 1AW5A 1YPXA 1QPKA 1PEZA 1CXKA 2P8BA 2ZZ7A 5BXTA 4IIHA 3GZAA 2PTZA 1L2QA 4D6CA 3OP2A 1HL9A 1EJTC 3ONBA 2GJXA 3WJWA 3WD0A 2I7GA 4WDXA 1MEHA 4ML4A 3VIKA 3WQGA 3AWNA 1Y5WA 1XPGA 1DYSA 1J5SA 5DCEA 1YU0A 4QJ5B 4OIFA 5EMKA 1VEMA 1PYMA 1LRTA 4Y7EA 3NZPA 1YNYA 1GOXA 3R89A 3KTXA 4BEUA 1CGWA 3N04A 3MP3A 1VFHA 2G37A 4NYYA 2OO6A 1G9HA 3N4EA 3IVTA 2F6UA 2NUYA 4JTHA 4S3FA 4NRSA 1FKXA 3FJLA 1JYXA 3CL6A 4HP5A 4Q8TA 3MA8A 3LCWA 3NQFA 1VYRA 4QG9A 2V3GA 4L9XA 5K4XA 1FHLA 3UWQA 4O0QA 4IQLA 1Q6OA 2G41A 3P5ZA 5FF2A 3WN6A 2WHLA 1REQB 1VFTA 3W1LA 5I24A 3CBWA 1Q6GA 4WDUA 5DXYA 3WUFA 4ERIA 3QC0A 1YU4A 4B5NA 3W29A 4A29A 4N6FA 1SJCA 3B0YA 3N13A 3T1GA 1XS2A 4LG2A 3OGRA 4ZB2A 1LCOA 1BD0A 4H01A 2V30A 1VLIA 5HWMA 1XKJA 4KF1A 3PZMA 1X97A 1V3HA 4PUWA 1EHAA 1I8JA 4OFCA 2ABBA 1X38A 2BP1A 2BOGX 2V63A 3WQVA 4LUIA 3PSVA 4LUYA 2V81A 3UZZA 3LCFA 2E09A 1H7NA 2GYIA 5REQA 1Q63A 4G5DA 3ZT7A 1M5WA 3MUIA 1ZLPA 1X39A 4JXCA 1XLGA 2XH7A 3PWIA 1UZ1A 4U3CA 4Q7IA 5HXMA 1FWTA 4PUMA 1JUBA 1V77A 4S3CA 5KINA 5LNUA 1UUOA 4KEMA 5C5YA 3G2GA 1C9WA 5EMUA 3P81A 3FX4A 1X8FA 1JUKA 1FWJC 3H2NA 3ZVIA 3LBCA 1WKYA 4DZHA 1NY1A 1IF2A 2X8RA 1JPIA 2EG7A 4WSJA 2TRSA 5CXPA 4XZLX 3TP4A 5I07A 1TUFA 2F2KA 4DWSC 2A3BA 3B0VC 4DPQA 1F3TA 3AMLA 3UWVA 1FVPA 4U31A 4IIDA 2CHRA 3EWXA 1H0GA 2QUNA 1W9VA 1J01A 3EA3A 3W7DA 4LVDA 3SO7A 1QAPA 3LUTA 1PTGA 3JZEA 3O9NA 4P5UA 4CUCA 1QPQA 2Y7FA 4CGTA 5JH1A 5IM51 1E9IA 1FCVA 1UP0A 4FLRA 2YXGA 1PKMA 1YW1A 4C6KA 1KFKA 3DBNA 1UH3A 1IWPA 3B0PA 2J4GA 3T4CA 1WYIA 4Y8EA 3HU7A 4LS1A 4FR6A 4E8DA 4Q6JA 1BTCA 3GXIA 2HE5A 2HK0A 1K7FA 1UMYA 3FSTA 5DRIA 3G18A 2EG8A 3ISIX 3W1AA 3F4VA 2E77A 4YU1A 3THUA 3MV11 1TMHA 1EAKA 2OZTA 1VEPA 3FXYA 3IUHA 3U5UA 2CHOA 5CSRA 5FKYA 3I6RA 3LPGA 1E0VA 3UPBA 2V5KA 3VK5A 3KOXA 3GNRA 2J7GA 1RZMA 3GXNA 3WSUA 1NH6A 2QPSA 2DJXA 1R3SA 2VX5A 1XIGA 5LZLA 1D3CA 1GVSA 2DT1A 4LFYA 3W0KA 5HUPA 4Q4KA 3V3WA 2GGHA 1YQ2A 4IL0A 1DIKA 2HZGA 1S39A 4CN4A 3TTYA 2O7SA 1UA7A 2XU2A 3OGVA 3O6DA 3O63A 2VRQA 5BXPA 2NX3A 4GG9A 3BGAA 3KDNA 2WM0A 1LUCA 4I6VA 3N19B 1XG3A 1E3XA 4DBDA 4J2PA 1CX9A 4ZQOA 3WL1A 3DG6A 4JD4A 2XM2A 4E3TA 5C9WA 4K8EA 5KZEA 3JRKA 1KRMA 2WK2A 4PBEA 3N2TA 1KFEA 4FOJA 1SJDA 3R8RA 2ALRA 3WLRA 1HKIA 2G4JA 3W81A 4GI4A 1ZP4A 1H0IA 2Y5JA 2KZHA 3AMGA 2E1DA 3NO1A 3BCFA 3R13A 4AXKA 3PB0A 4GIRA 4PUDA 2UV8G 4C90A 1ZUAX 4XQ6A 4QJ1A 2PU1A 2E3ZA 2DW7A 3QYSA 4KETA 3LMZA 2GGJA 3L7RA 3G0XA 3KVKA 5ECVA 3GK0A 1P0DA 2H3BA 3BGJA 3EB2A 5M1TA 4ZBCA 1Q2RA 4HU0A 3WNKA 3WDHA 4R9XA 1CLXA 5CZJA 2ZWZA 5KSWA 1H41A 3CZJA 1XQLA 2BTMA 1DP0A 4MNJA 5FD0A 4CU8A 4BI6A 1OFQA 1TYGA 3NFUA 1MRAA 1E8BA 1UBSA 4G56A 3B06A 5M3WA 4W85A 1SFLA 4TU1A 2UBPC 4N0RA 4MVAA 2INZA 4ZB5A 4ZXOA 3OO2A 5CPTA 3T7VA 5D9MA 2Z6JA 3OIXA 2HVNA 2FHBA 1VYSX 3I7SA 3CQJA 2ZUTA 3K30A 2B7NA 1M9HA 1GEQA 3N4FA 2X1TA 3SSJA 1KGXA 4LAMA 1OZQA 1W5NA 5MHBA 2ZIDA 1F5ZA 1V6UA 2W91A 4F3HA 3NPWA 2WJDA 1JQVA 3MWCA 2VVNA 1T99A 1R6WA 3LBMA 1TPEA 4PRRA 2E7FA 3CB3A 4H7CA 2WBGA 3T0BA 4GYKA 4QNWA 4D72A 4KEVA 3LTYA 1TG7A 2NVDA 1F2JA 4B2DA 4KEUA 4PTNA 3UWZA 3E0FA 3AI0A 1W1B1 1PB0A 3W7IA 4HPNA 3W73A 3WDPP 2XGBA 4GA8A 3UWYA 1P43A 4TTGA 3SFWA 1FP8A 3L0GA 4QTGA 2BWGA 3M0VA 3G0SA 4GX8A 1E71M 1Y7VA 1J10A 4INFA 5I77A 3B05A 3QV6A 3VZXA 2F38A 2QMJA 1S2AA 4LVAA 4DBWA 4GZ7A 5AFDA 1OD0A 1YLVA 1P0NA 3ZFHA 4ZB0A 4JTSA 4X0NA 2FN2A 1F76A 3VILA 3AHZA 2AKMA 3G3DA 1A80A 3A4JA 2HE8A 3L4XA 3N34A 4FS9A 3BAKA 1YX1A 4WK9A 4LCQA 4REQA 2ACRA 3R10A 1SQ7A 4NZFA 1B3YA 1UKOA 2IMRA 1F07A 4UWMA 3URBA 5T8GA 3L0KA 3KAOA 1V51A 3WUEA 2HVMA 3FIGA 4OUEA 5IFTA 5KEZA 3P61A 4O4WA 4F0RA 3OW1A 3B4UA 1J4EA 3DHFA 3AS2A 5KETA 4MY8A 1Q6LA 2PSNA 2PLMA 1ICPA 1X96A 1GYLA 3HO8A 1J8VA 1UWTA 3P7YA 3ANVA 2L5HA 3TOPA 1QK2A 5A6AA 3U57A 2WCAA 3SJNA 1K6WA 3NTYA 4BQ3A 4AIUA 4KWVA 2QPUA 4IPIA 4IBCA 3N1AA 3OOQA 2JE8A 1CTNA 5EYWA 4L4MA 2PDCA 2J6VA 2J8GA 3SY8A 4ZSUA 2DSKA 3W76A 1MW3A 1TPVA 1SSGA 3W07A 1GJPA 3MUY1 1E6XM 1JZ8A 3FN9A 2DUZA 3DCPA 2EO7A 4FEZA 3CZ8A 3UXIA 3TWAA 1H7RA 2YJQA 4V1YA 4BS0A 4AEOA 1EOKA 3RX2A 1H1YA 2H3DA 5G4HC 1JZ5A 4TQTA 1F8IA 3HFYA 4C1NB 4U10A 3OLGA 4JGDA 4AMCA 5C8BB 1YTKA 2Y2HA 3ITCA 4K36A 3E2QA 3DFHA 4LUJA 4L4PA 2ZVRA 2GDQA 2EGZA 3OVRA 3U2EA 3RR4A 3WJYA 4DZAA 4IG2B 4IMCA 5FSEC 2JIWA 4EPKA 2QLYA 4JTCA 4HYVA 1R3RA 3TJ4A 5CJ5A 2DUAA 4GZIA 3W6LA 5EFDA 4KGJA 4FR1A 5BWFA 3BE7A 1G0CA 2EEXA 2HXUA 3LYEA 4CEXC 4B5WA 3G1DA 4C1KA 2OPJA 4XD5A 3T08A 2P0IA 3OG2A 2QR6A 4IQJA 1ITQA 3KEHA 2PBOA 4OECA 3VIFA 1KR1A 1F74A 3MSDA 1MFUA 3H2AA 4UFHA 3MU7A 4FLOA 3GG7A 1XW8A 4FMVA 4CQCA 2WC7A 4BQ5A 4PUNA 3AFBA 1E4LA 2UZ9A 3W70A 4F0SA 1CZ1A 2OX4A 1P0KA 3N17A 1U33A 2ANUA 2ZUVA 5B80A 4XIMA 4LF2A 5FJUA 1ML1A 1TELA 3MYOA 3SUUA 2W0UA 3FKRA 5AY7A 1CDGA 3BMXA 2FJKA 4DI9A 1FX6A 2I14A 1W1VA 5HMSA 3RM8A 3MDWA 3OBEA 1NSJA 1BYBA 1XF0A 4NI8A 4ROQA 3TTSA 3L5AA 4M80A 1L6GA 2B4GA 3SCTA 1FCBA 5K9DA 4J3WA 2ZCGA 2GSHA 5AOUA 3ZWTA 3CXOA 3II1A 1LOQA 4Q4QA 4PBFA 2UY4A 3BAIA 4WXYA 2C0AA 4S3BA 1YDYA 4PEKA 2PB1A 3TA9A 3G0UA 2EPLX 3TJLA 3W75A 5U7SA 3WLTA 2A7PA 4WJ8A 3HPZA 1C9DA 5GPRA 3VOGA 3W7NA 4LEFA 1UR1A 2R1NA 1TRIA 4JYFA 1B3OA 3GXPA 1T6MA 4YCOA 2G96A 2A0NA 2V2DA 3RR1A 5CPQA 2VR4A 2CLLA 3W85A 3ZZ1A 4R33A 1WDWA 4MDOA 2ZUUA 5BPVA 3BLFA 3RM4A 2VZOA 3EWUA 4Z17A 4Z0JA 4YMZA 5A1AA 4PMYA 3LEPA 2F84A 3WBWA 5K7JA 3CWNA 1E55A 2XFRA 3EDJA 3AO0A 3QKEA 2VC5A 2VD8A 1OK4A 1V6YA 2Q01A 4J9JA 4IPPA 3M5YA 4KRUA 2ZWYA 4PFHA 1E72M 2TODA 5F1UA 2J7CA 3NVDA 3SZ8A 1BAGA 4Q33A 5F2MA 1KXVA 2Q02A 3CQ0A 1W32A 1H2JA 1I2QA 4H3DA 3EXRA 3IJLA 2BGNE 3E02A 4E2BA 1VRXA 4TX9A 3KP0A 2F7FA 2QCEA 3TW7A 2PDMA 3NWRA 4WKHA 2PP0A 5FJJA 4GABA 1UZHA 3SCQA 3QQWA 3FKEA 2EPOA 3SY5A 3TLQA 1B3WA 3TYEA 3B04A 1CXWA 4WRHA 3IJ6A 3ITLA 1YU2A 1LOLA 2GJXB 4P2VA 5F7UA 1KR0A 5I3FA 1CGVA 4IBGA 1YBQA 1WBJA 3M6DA 4KBXA 1I2PA 3VGBA 3ZJ8A 2Q3OA 2J77A 3DHUA 2FKPA 4K38A 4J4KA 1Q6FA 5K3VA 1BEUA 4PMZA 4IJEA 2X0HA 3XIMA 5GNXA 1DV7A 4L1GA 3KL5A 1S1PA 4KWWA 4ZFMA 4RZ6A 3PTKA 4H8VA 4D6DA 1J18A 1NVMA 2VRKA 1HO1A 3NPUA 1EL3A 2Y2NA 2E5CA 5I3JA 4S2BA 4MDPA 3GB6A 4UFMA 3WFZA 2JGQA 5DY3A 3CMJA 3AIVA 3UXLA 4IL2A 2V38A 5T26A 2J7BA 3BW4A 1YPFA 4G1KA 1WOAA 3LI1A 3UA3A 4K1WA 3BUVA 5EU9A 1DWHM 4XO7A 2Z27A 4US6A 2FZBA 4MGGA 3S1UA 2DH2A 3LXCA 2BV9A 3M46A 4F79A 3ITGA 2V8ZA 1G01A 5HMDA 5CJNA 5ABFB 1WV2A 5FEZA 3F2CA 3WCZA 1DJHA 4IISA 4P7QA 4E4PA 2IW0A 4XAGA 3CAKA 3N15A 1XIIA 3HG3A 1J0KA 1ZAIA 1UW9A 4S3EA 3NSNA 1YDNA 1TSIA 2Y7DA 3OQ8A 3QHNA 4XV0A 2DSVA 4JIIX 4LRSA 1XH2A 3GH7A 4GBDA 5A6TC 4CCCA 4IBFA 2B31A 1W9PA 5E09A 4LGXA 4P61A 1R0MA 1ZY9A 4OJOA 3S5NA 3IUDA 2IQ0A 1EJSC 1F6PA 3BH4A 2X16A 1K8ZA 3MC5A 1V3LA 4CNTA 3PVFA 3CMFA 1JDCA 1VKFA 1XPYA 3N25A 4GVHA 2VGFA 1ZENA 5BCAA 4DELA 1W9DM 1OEPA 3C8FA 3TWBA 1V7AA 4XZIA 1AJ0A 4QXIA 4XKYA 2CBJA 1QASA 3WLNA 4ZO8A 4HIBA 1PWMA 3ALGA 2E6FA 3KX6A 1VFFA 4ZXLA 2QXWA 1L6SA 1FWEC 2QUTA 1AA1B 2XFYA 3WJZA 1QNRA 1KXHA 1HTIA 5FACA 4M3PA 2ZTJA 3TSBA 1NF7A 1JF6A 3S2LA 2J62A 2ATSA 4Q3MA 3UZYA 1DKWA 2C1HA 2ZOXA 4JYEA 4GUGA 2VCBA 4GOAA 4TVUA 2AL2A 3OZOA 2J88A 3IGUA 4LBSA 3NQEA 1GORA 3FYYA 3IJDA 2O7QA 1EBHA 2BVWA 3G1XA 2E67A 2XD5A 1I2RA 1VF8A 1E0XA 4K7VA 1BXBA 5SWUA 1SPQA 1OD8A 2Z1KA 4HPJA 2ZRVA 4O15A 5HQMA 3MZ2A 2CC0A 3NZGA 2DT3A 4I7UA 5BROA 1DE5A 3CASA 1IXQA 2P8CA 3APGA 2GUYA 2QZRA 1V8EA 5LA2A 3F4CA 3STFA 4X0VA 2NX9A 1QVBA 4WY0F 1YU3A 1VC4A 1PKNA 3CU2A 3FGCA 1BQCA 4EF8A 2VX4A 2AAAA 4F0LA 3UR8A 2YKKA 3VNIA 1FWWA 2VFEA 4ONVA 2KX9A 2PGWA 4KH2A 3TMLA 4HJFA 4N9DA 1JG9A 1H09A 4QLLA 4MTVA 4UFKA 3V1PA 1YYAA 4BQ2A 1YMYA 3RUBL 4YXGA 2OB3A 3UJFA 4LYQA 3VM5A 2W27A 4IXHA 2XH4A 4UQ9A 3WF3A 3UPMA 4WSKA 2WMJA 4YNGA 2CWNA 3MVTA 2VX7A 3MJMA 1LOSA 1R2TA 1Z44A 1S2UA 2VO5A 4M56A 1TX2A 1ZZMA 1Q85A 2HSAA 3URNA 5LNVA 4GUHA 4X22A 3H26A 4IIBA 1PCKA 1OGBA 4RV8A 4WZHA 4DYJA 1RV8A 5DELA 3AZTA 2Q71A 1ITXA 2ON3A 3GW0A 3K8MA 4NNCA 3JUGA 1Q6QA 3TE9A 1D8WA 4YVVA 2FQIA 3KL0A 1UD4A 4XTDA 3VNYA 5BU9A 4GY7A 2R82A 5HBFA 2ZX5A 3FA5A 4JTDA 4DO6A 3WJSA 2E0PA 4E0CA 1TQXA 1A4LA 3ARPA 2BZNA 3I10A 4AD1A 2VC9A 2Y2OA 4CN1A 1GPWA 1GEHA 4PBGA 2XPKA 4PTMA 4EAMA 2J9ZA 3GE7A 2GQAA 3PZQA 1POJA 3U4AA 4UCFA 2GSJA 5AYYA 4FIRA 2X30A 3T07A 4GX9A 2YA1A 7REQB 1JRBA 1QBBA 1XIDA 1XL9A 1EO7A 3VINA 3BAYA 3BZJA 1AMYA 2YA2A 4YVPA 1KM1A 3HQ1A 3HF3A 1XCWA 5I3IA 4E3VA 1LYXA 4GFSA 3TN6A 5KZDA 3VIPA 4CNNA 4H41A 4ZO7A 5TIMA 2I1OA 1LBLA 4BI5A 4QEHA 1H50A 4KQNA 3R0KA 5ABEA 3MI2A 2GFTA 3GTNA 3AIRA 2VDHA 1OX5A 4PUEA 3H2EA 1H1ZA 3ABSA 4H8HA 2OSYA 1H4PA 4IPNB 3VNZA 1ZRQA 3GHTA 8A3HA 5E9AA 3MQLA 3LMYA 4FALA 2J7EA 1EX5A 4JN8A 1FY6A 4CCZA 4HZ7A 3BOLA 1DQUA 3THDA 4PFMA 4B3ZA 4LEQA 4C6FA 1RLCL 2X1UA 3RF9A 4DN1A 3RN6A 2HV5A 1IIGA 5J04A 5A8OA 3T81A 1EJVC 2E40A 3OLDA 3N3TA 3VNJA 3DFSA 3CNYA 1S5MA 1QR7A 4IFOA 2DW6A 2OG9A 4MFDA 2NT1A 3J7HA 1QO2A 1JQXA 3O0KA 4C6EA 4GI6A 3MI3A 4JIEA 4UNIA 4F2BA 2GWGA 1RJRA 4RUBA 3L4WA 4DAIA 2BDQA 2GJNA 3F5LA 5D8WA 1YTDA 3DI1A 3GDRA 1KXQA 2ZX6A 3DBPA 3BURA 4L6DA 2PUZA 1GUVA 2D22A 4RKAA 4XZBA 9XIAA 4UBPC 5EMJA 1J0JA 4V15A 3AXXA 3CH0A 1NWRA 3GC4A 3ICJA 6TIMA 5GJPA 3THAA 4GUIA 3AYTA 2BHYA 4AX7A 1EPVA 4OVXA 1AIWA 4L4OA 1OFAA 4UZUA 2WVVA 1G7UA 1EYEA 3WEZA 4AX6A 2R91A 3PM6A 4O1EA 4CNSA 3S8HA 2OYMA 2FZNA 4JKLA 1R3TA 3VZZA 4LOCA 1M1BA 4ENLA 2BY0A 1XISA 3N6QA 1SZRA 1SYTA 4HB7A 3QBUA 1M03A 2CLIA 2PZ0A 5EMLA 3A9BA 2QCGA 5FI8A 3R0DA 3O3RA 1KFJA 2QDGA 3W1RA 3A4WA 4FNTA 1Z41A 2VURA 3R6IA 1CLKA 1A3WA 3R5EA 1KWKA 3SAZA 4B90A 5FEXA 3QPEA 4ERAA 5GVJA 1XGZA 1MW1A 5D09A 1JGMA 3AUJA 4QLKA 3O6AA 2A3CA 4POCA 3BSMA 1M3UA 1Q8AA 1J7MA 2ISVA 1WAUA 2PDFA 3WF1A 4KGLA 1OYBA 4UR7A 4OGZA 4HTBA 3HPSA 5MKGB 5D04C 1ODUA 3E38A 5KMYA 5LIXX 1DXIA 3A47A 5HMEA 4KS0A 1DORA 5TAOA 2V2CA 4RE4A 1E1EA 2WC3A 4HT3A 1VBUA 4ZFCA 4QNLA 2WWCA 1UMLA 5LYRA 4ZEPA 1JDFA 3HSHA 1AZ1A 1PE1A 1DWGM 2W9MA 3UG4A 4IGMA 2FFIA 5RUBA 4XD4A 4XZHA 1D7FA 3E2VA 1X1OA 3LZ3A 3ARSA 3IV3A 3C3UA 4DJED 5D37A 4AH7A 4LAUA 7PTDA 3L23A 3KUMA 4UTUA 3Q94A 1CLVA 3S9ZA 2CBUA 2PWFA 3IGXA 1AH3A 1XLMA 4H83A 4P8XA 1LT7A 1EP1A 3BW2A 4JTLA 1ED7A 3BMWA 1TKKA 2XSXA 1I1XA 5EL1A 4GJJA 4IFKB 3RPMA 4NT0A 3A12A 1JUEA 1ZBVA 1LP6A 2R24A 3W83A 3WDQA 5H2ZA 4GO8A 4X2PA 5AHMA 1EXPA 1JCTA 3MCOA 5CJMA 5H8UA 1CGYA 4CNOA 1RY0A 1XLBA 2G4FA 1LG2A 3IPWA 4IZGA 2OMAA 2ZZ6A 1E56A 1JZ6A 4M8UA 3TFXA 1K7EA 2IKJA 2E6AA 3G8RA 1BG9A 4O0ZA 2BY2A 5FEWA 2WVUA 4WGXA 1JPMA 2PLCA 3DX5A 4RNFA 1G6CA 4ZMGA 2ZUWA 1FWFC 2POZA 2YZRA 3M07A 3BCDA 3RJXA 3MDUA 5GNYA 1FWDC 3V5CA 2XINA 2OYKA 4BCEA 3DAQA 1BWVA 4AU0A 2NSOA 5FF4A 1JAEA 3VOIA 1D3GA 1FWHC 3DYPA 4NZCA 2QUUA 4QCFA 4GCXA 3VNKA 2E9BA 3RM9A 2W66A 4RXGA 3TW6A 3GWQA 4QE4A 3WBXA 4W7WA 1A5MC 4DF0A 4WLCA 3KRZA 2BASA 5HNTA 3HV8A 1O7AA 2PGEA 4XZNX 3E5BA 3DDMA 5D2VA 1IZKA 3GTHA 5AC4A 1L6JA 5DEZA 3GVWA 4UIOA 2PC4A 1CB2A 4UQDA 4FF5A 1TCMA 5AN7A 1HJWA 2V82A 2GGEA 4JTIA 1TPUA 1T7LA 1KM3A 4UC5A 1MMFA 2D24A 3WENA 4UQCA 3P74A 2GOUA 3U6WA 2QIIA 1GVFA 4QSFA 1C91A 1P6CA 3VIIA 2QCFA 1SZEA 3USBA 2BS9A 4LUSA 2IPFA 3V1HA 5JBEA 2NWRA 1ICSA 5IBXC 1US0A 3BOXA 1JD7A 2FMNA 3CTLA 3PUDA 4JYDA 5BRBA 3PR2A 4AY1A 4HK5A 3NL6A 2YDRA 1TPWA 4J28A 4OJYA 4IPJA 4GQ0A 2FIQA 1B3VA 1VFOA 1R7AA 1DBTA 3NO5A 2J25A 2GDVA 3CMGA 4KIRA 4GH3A 2CZVA 1V6VA 3KRUA 3ZWSA 5CSUA 1R47A 2PDGA 6REQA 1H60A 3AIQA 4IIGA 1OQFA 3BGGA 1CEOA 1OX4B 1AG1O 2YFNA 1RVKA 1EGZA 4OJ6A 4B15A 3BLKA 4P7OA 3QOKA 3NQ6A 2RGMA 4O1AA 1G69A 2OQHA 1DWAM 2QUVA 1F6YA 4PE8A 2YBTA 1TVPA 1VYPX 3UG3A 4PB4A 1C3FA 3UEQA 3PJWA 2EAWA 2OT1A 5D9PA 1XDMA 2NVCA 2PDNA 3TC7A 1Z42A 4WF7A 4N4QA 2H90A 3FHAA 2ISDA 3S9YA 2OODA 3FKKA 3EXSA 3WH9A 1LF1A 4FSAA 5LKYA 2PD9A 1I4NA 5ENLA 3W22A 2A79A 3NA8A 4HPXA 4PSRA 2C7FA 1JVNA 4PMVA 2CFFA 2JEQA 4YHGA 2NLIA 2D20A 3ATZA 4TMCA 4H7ZA 4HNVA 1RK5A 1K9EA 4NZ1A 2PDQA 2Z24A 3UJRA 1OCJA 3QN3A 4H9UA 5F2GA 1XDJA 4JX5A 5G4EA 4UQEA 4IX0A 4F4RA 3WNLA 4LAOA 3TX9A 5A95A 3TR9A 1UKQA 3L26A 3DH7A 1W56A 2WAGA 1E3ZA 5IOBA 3H7VA 3S1WA 2XIIA 4KMQA 3PFRA 3SR7A 1OBAA 2W79A 5HPCA 2FZ9A 1N82A 2PMQA 4IHCA 1UH2A 4A3YA 2QKFA 1X8CA 3K13A 4DIAA 3M0ZA 3PB2A 4YTUA 2RDTA 4XBSA 3KFTA 3VKAA 5C2XA 4UTTC 5A6KA 3OB8A 3VGDA 3CYVA 5I7GA 2YLLA 2YBUA 2UY2A 2Y2WA 1PYFA 3RMJA 2QCCA 1V3MA 3S5YA 1SU5A 2E6DA 3WLQA 1OCQA 4CU7A 4FNRA 2Z25A 2FVMA 1ZJBA 1QMLA 1JZ3A 1SW0A 3LA4A 2HDJA 4A6GA 4JQ3A 4JCLA 4H6KA 4M82A 2Z00A 3G1AA 2VGGA 4J3VA 4FLSA 1VHNA 5G2IA 1OK6A 1TJ2A 3FDGA 1YADA 1YKWA 4HNCA 3UR7A 3APTA 1TIMA 4EF9A 5JBDA 2PWGA 4IMEA 1O5KA 4NIRA 1SO4A 2PTXA 3H7RA 5FL1A 3KLKA 4RDYA 3Q65A 3WLKX 3P0XA 1V0LA 2OZ3A 3EEZA 3VX1A 2R8WA 3QFEA 1J0HA 2FGLA 4GVGA 5AC5A 3W1TA 4MWAD 3WBEA 3EWYA 3YPIA 1OF6A 2YCKX 3VC5A 2WZIA 1R7OA 2HEJA 5HDRA 1EP3A 4C6IA 4HYRA 5A6SA 1TJ1A 1PCWA 4JTQA 1AD4A 1AQMA 4MUZA 3LSBA 4W86A 2PWUA 3IJ9A 2AL2B 1TIWA 1UCWA 4HU8A 2JALA 3P84A 1HQTA 1PXGA 1Z3NA 2YDAA 4Q8QA 4NYUA 1DJXA 5A8MA 4ZZ9A 4NY2A 2R1MA 4IP4A 1M6JA 4N4PA 4DEFA 3UGRA 2HK1A 1WB0A 1E6ZA 3CV6A 3QOMA 2WLZA 3W7QA 1R3YA 4RDWA 5TQLA 4AAJA 5CH9A 5B7YA 2XZ9A 1UR3M 1TV5A 1WPCA 3O06A 1KRAC 4EK7A 3IAQA 4W84A 2BOEX 3DFYA 1QNPA 3QXBA 5HR6A 4XVDA 2AGTA 1ITUA 2YL9A 5A8NA 3UCQA 4IBDA 1S2TA 1XYZA 1W3TA 4GQBA 2VC7A 3VC6A 3WLJA 3LD5A 2VVSA 1V93A 2WKGA 3MQTA 4ADSA 3OBAA 5AYBA 5CG0A 3CUXA 3RCYA 4IIFA 4OKDA 3W26A 2Y5SA 1J2BA 2PDUA 1U2YA 4HU3A 5HUOA 2BNJA 6XIMA 4XUYA 4ALDA 2BODX 3ZXWA 1K8CA 1U83A 5BYWA 3CHDA 1LJYA 2PDPA 4QDWA 1OX6A 3CWHA 5TD4A 3IUIA 3MTWA 4C6BA 3AWOA 2OVLA 3UNDA 5D32A 3ZSSA 2WJEA 3FK4A 4M6VA 1EKOA 2PD5A 4ZO6A 4GINA 3H6OA 3EKGA 3FA4A 4NJJA 4O10A 4HQVA 1W8GA 4WKFA 3L67A 2FPTA 4JICA 4GCAA 2ZXDA 8XIAA 3OZPA 3M0LA 3B0XA 3PWAA 3UZ5A 2PBGA 3Q37A 5H91A 3EX6A 3H2MA 1TUXA 3AISA 4S3KA 3W7EA 2XIJA 2OWXA 1FXPA 1M53A 2QT3A 4MB4A 1K9FA 1GNXA 3QPZA 1EOMA 2BB0A 1GYNA 4HK6A 4LVGA 4TV5A 2MNRA 2VNCA 1ISXA 1IQ8A 3LM3A 1C7SA 3DG3A 2R6OA 2WCGA 1WZAA 1CXIA 4O8AA 1GKQA 1W3KA 1ZS2A 3UWWA 4AD5A 1LLWA 4W5ZA 4JFUA 2NV1A 2QGYA 2PTWA 1HJXA 4FB7A 4MY9A 4JFWA 1EB3A 3VIOA 4CCDA 4LAZA 4Y9AA 4C6PA 2JIEA 2BBFA 4IBKA 1GQJA 4YTTA 2CZFA 3MCNA 3Q2DA 4QS5A 1OSEA 1W3LA 1A5KC 1V5XA 3HQPA 3A3WA 1XUUA 3BL3A 1WDRA 3PSWA 5BOEA 2BXYA 2Q8LA 1H49A 4BI7A 2NLYA 3FV9A 3UF9A 5DT7A 1K1DA 3HFTA 3TLLA 1HJUA 4KCWA 2CHNA 3GU1A 1VQTA 2HMCA 4PRWA 2QJIA 3WY1A 4L7ZA 2V3DA 1JZ4A 1KGUA 3LX9A 2GOKA 1OF8A 4DJEC 1SSDA 3DFNA 4G9PA 4H6QA 3MHFA 2Z1XA 2DZAA 4PCSA 4F9DA 1QCWA 2YFOA 5FJIA 4OJLA 2DSZA 4TXEA 3HURA 3BSGA 5IHRA 2R94A 4JOMA 5CC5A 2V5JA 1TZ9A 3VZYA 3TEVA 2YL5A 4LANA 1S1RA 2R14A 3SRFA 3DFQA 1W1TA 3BG3A 4DJDD 4KIEA 2WKLA 4CD4A 1ALDA 3BG5A 1EO5A 1J93A 3IGHX 1RD5A 3PZTA 1H51A 3QZAA 1BVZA 4O19A 1TTJA 6ALDA 2ZZ2A 1RBOB 1UBPC 2LLEA 3RMEA 3LRMA 2XZ7A 1PHWA 3CC1A 3VGGA 3M7WA 1EFZA 1RCOB 3K1DA 3O07A 1JYWA 4HA0A 3PZVA 4DZIA 1L6WA 4RLIA 1NP0A 2J27A 2ZX9A 4B5UA 4DJFD 1EZ2A 4UNKA 3ES7A 4A4AA 1QRQA 4Q8UA 4J5NA 1U1JA 3L4TA 3BJTA 1TQJA 4Z2HA 2XN1A 3CM4A 1OG0A 3ZJ6A 3R25A 1MEIA 1A5AA 4QIUA 1DIOA 2QAFA 3TROA 4C7DA 1AUSL 3FVDA 1VJSA 2YIHA 1T96A 1B9ZA 2QCLA 1UG6A 3DUGA 1VIZA 2P5NA 3NJ3A 1FP9A 2W92A 1IEIA 1WDDA 3OEXA 3GX9A 3CZEA 4HA3A 2DT0A 2JFEX 2OFJA 3TAOA 7CGTA 2OTDA 1L2UA 3GTXA 1EIBA 5EBAA 1C8YA 3SSZA 2QUMA 3OPSA 1QWGA 4DWSD 3WK0A 4DO5A 1M68A 4AVOA 3HM7A 1MQQA 1BRLB 3FYPA 3PZGA 2CNCA 1NFGA 3ITXA 2QQ6A 4M7SA 4FX8A 1QPNA 5FEPA 1YE4A 5E9XA 3GYCA 1XG4A 2D0HA 4DO4A 4M6QA 3S6TA 2AAMA 3GXTA 2D3LA 1KBBA 1K7XA 4R85A 3GBEA 5K9XA 1NWTA 3ZT6A 5DMNA 1NDVA 4EAYA 3IWPA 3SI9A 1SO3A 4LNYA 5AC8A 3A22A 4M7TA 4EACA 1OFPA 4NG3A 3MMWA 1ZP3A 1VBGA 3AALA 3G6LA 1PAMA 1WBHA 3TYZA 3DU0A 4JTUA 1IT7A 2WJZA 1P4CA 3EMCA 3DOPA 4OBTA 3M5XA 3QGAC 1MVYA 3L0NA 1XD0A 4NZ3A 3BMVA 1N55A 3CUFA 4PGLA 2Z1BA 3GR8A 4PTVA 3AMDA 4GGHA 3JU2A 2F2HA 2SFPA 1X6UA 1OGGA 1PIIA 3V35A 2C16A 4GVIA 4V28A 4RNHA 3WEOA 2DQXA 2BLEA 3SY1A 3BG9A 3W7HA 4C91A 4PB5A 2G8ZA 1LT8A 4I5XA 4KCVA 3CL8A 1YNQA 1RA0A 5CBIA 4X9YA 5A6BD 4F66A 4NJKA 5LIYX 2E6YA 2ZC8A 2QULA 2QGHA 3U9IA 2CXGA 3LPFA 2IPJA 1W8SA 3IIZA 3C6CA 3L4YA 2EJ1A 4X61A 1DIDA 2OX1A 4NXKA 3W2LA 1JYVA 1KRBC 1VFLA 2PWHA 1UP2A 1QOQA 3BVJA 5B7ZA 4KESA 4DYEA 3M64A 3ID7A 4HOWA 1MNZA 1XICA 1GOKA 4ZSTA 1FA2A 2GUBA 3N12A 4ERGA 4M81A 4LB4A 5BU6A 1Q45A 3K4AA 3MBDA 4V27A 1DJNA 4AVNA 2XSBA 1OC5A 4UTWA 3DC0A 4JNMA 4YVXA 2XG9A 3A4AA 1I9CB 2F9RA 2FYMA 1Q65A 4QDMA 3IIXA 2C1GA 1UJQA 1U5JA 4M5PA 2E4TA 3S5ZA 2ZDRA 3L28A 3MSRA 4FXRA 4DM1A 1CB7B 4UOZA 4MMWA 5HA7A 5JQ9A 3SURA 3GTIA 2I5IA 5EMYA 3K4DA 5K9CA 4QP0A 5HINA 1B9BA 4UFJA 1XLCA 4U5IA 4K68A 3S1VA 4QEEA 4Z42C 3LNPA 3OA5A 2CLFA 4YYFA 1OIMA 1LL7A 1M7OA 4GMEA 2X1RA 4UTJA 1WZKA 4W8AA 2WSRA 1GZ1A 2O4QA 1IWBA 4QE5A 3TN4A 2WM1A 1W3NA 3T0CA 3SUVA 5U4NA 4KPLA 7ODCA 4ICMA 2RTSA 1NEYA 3CIXA 3F4NA 4IG2A 1EC9A 2IKIA 3ANYA 4GYFA 4L80A 4TOQA 3PNUA 4NHVA 3VD7A 2E5BA 4FZIA 2BSLA 4JNYA 3VU2A 2C3ZA 2Y24A 1PIGA 1RJPA 3MI6A 3BCJA 4O14A 2HBVA 1RK6A 3TN3A 4MZYA 3BPWA 1P6BA 1PKYA 3V18A 2AQVA 2ZRWA 3NSMA 4MWAC 4Y9MA 4FX6M 1EXBA 4FXFA 3GVQA 1T5AA 3LERA 2A3EA 2P53A 4XO6A 3UCDA 3L25A 3NDYA 1VJIA 4FO4A 1SO5A 3K8LA 1E43A 4Y8FA 1V02A 1W3HA 3HG2A 1Z69A 4W5UA 5CZ0A 2ZTKA 2FZ8A 2VZVA 1JDDA 4I8DA 4L64A 4WX2A 2ZZ3A 2VEMA 2OOFA 4JTTA 1TB3A 4WKAA 3HN3A 3NXFA 2CWXA 3HMJG 4W8BA 2EKCA 1WXYA 3C0LA 3HV9A 3VUPA 2V3EA 3PF3A 1WZLA 2W5FA 1NFPA 4R3UA 4MJ2A 5HR7A 3W4RA 4JQ2A 4D6IA 3ZLFA 1I60A 3APYA 1UB3A 4RK8A 3EX3A 4AD0A 1JF5A 7TIMA 4WOZA 3EA1A 3TCEA 1D2KA 3IJ8A 3GXMA 2QDEA 4NSBA 4IF2A 1VH7A 1CGUA 2VMFA 3TONA 3OQEA 2I57A 4LSBA 3UVIA 3DKLA 1H1NA 4M51A 2J24A 1MZHA 4C60A 1QO6A 2WKJA 3TJXA 1DWJM 1IXNA 5L6UA 1KBIA 3TU9A 1MW2A 1GOWA 3GU9A 4GPNA 1ZNNA 3OYZA 4HNLA 3GH5A 3NZQA 3AS0A 1M04A 1ZHAA 3I4KA 3OGSA 1ME8A 5ABGA 4GHAA 1PL9A 3C2YA 2XGIA 2BXZA 1AJZA 3LLDA 2PRHA 2XIBA 2DUXA 4XUGA 3TQVA 2QNEA 1TTIA 4G7EB 3GM8A 1FDZA 1IEQA 2D73A 4ACZB 3UZXA 1W3JA 3ITOA 2PWVA 3B9DA 3JVAA 4JTGA 3QKZA 5DO8A 1PX8A 2Z6IA 3W88A 1GKPA 3UGVA 4AZ7A 5XIMA 3ORWA 5M5DA 1IXOA 1IXPA 4QS6A 4IMDA 3N9RA 2FVKA 2HQAA 3WH8A 1VIWA 3WLPA 3M41A 4CQBA 2DVUA 2GJLA 2PAJA 5M03A 1MZRA 4U5KA 3SCWA 4R34A 4AIOA 3NQBA 4DWSA 3K8KA 3TCSA 4ZTXA 3MSYA 4M1RA 5K2ZA 3B8DA 1LL6A 3LTSA 3B3DA 4JCMA 4FOUA 1MEWA 1MXSA 1RR2A 3COTA 1VS1A 3VD9A 4H6EA 2X7WA 4S2CA 4CVUA 4BF9A 4IM4A 3VM7A 2WNWA 3CH9A 2F6KA 1PZ1A 1A5SA 3VOHA 4JTFA 3B0UX 3CIVA 4NXSA 2OR2A 1AW1A 1OADA 2PS2A 2ZX8A 2YLAA 4MIMA 1ZQ5A 3GNXA 2BOFX 4MPQA 3GSMA 4HSNA 1WXJA 3OIHA 2VZTA 4LNCA 1T8XA 3AHTA 1A5CA 1GJWA 1TA3A 4L1XA 1W1YA 4O16A 4FXSA 2I17A 1D3HA 1KTCA 2YZ5A 3AZRA 4B5SA 4QSHA 4JQAA 4GGBA 2VFIA 4IJCA 3C2OA 3GAKA 4AZIA 3WLOA 5JH2A 1UWIA 3P82A 1F8MA 1DQXA 2X05A 4N9BA 3E0LA 4PYSA 3I4EA 4IXXA 2Y8VA 2O9OA 1OB0A 3S1XA 3WNOA 4GYPC 1P6WA 3WUGA 3N9SA 3PZIA 2CKSA 3U4FA 2XVLA 1XYCA 1EH9A 1HJVA 2VYOA 1MQPA 4QAIA 3PG9A 1JDAA 4O18A 1S3TC 2AL1A 3H24A 3FDKA 3ZSTA 3HZ3A 4DJDC 1XLFA 5ABFA 3A23A 4DLMA 4LT9A 4N2YA 2PCEA 3G1YA 1K03A 3LGDA 3VCNA 5I23A 1KTNA 1CI1A 1XLDA 2I16A 4O11A 3ARTA 4HYWA 4W8LA 1N8IA 3W1XA 3BV7A 3EX4A 1VRDA 5A5WA 1EJXC 5CC7A 4IBJA 1XC4A 1EX1A 1Q4NX 2V67A 3WL0A 2P3EA 3VNLA 1OJXA 4DJFC 3LOTA 2D3NA 4H7VA 2PDYA 4KWUA 4UOJA 1NAL1 4OV4A 1QK0A 3T2PA 3UERA 3TXVA 5FCZA 2DPEA 4MLRA 2FZDA 3KRSA 2J79A 3PP7A 3PN8A 4NZ4A 2XVGA 1OFDA 3LLFA 2ZA3A 1KFBA 2A3HA 5I3DA 3SEPA 3IJIA 1KM0A 1C8VA 1GQNA 3W53A 1KM5A 3V7PA 4Z2JA 2DZTA 3C5QA 3FS2A 4LVBA 2EBNA 4JZ5A 2FFFB 2ISSA 1K77A 4JN6A 2IPGA 5JXQA 4PZVA 3TNBA 2J74A 1KV8A 5E1QA 1VHCA 1DJGA 1E88A 1P1MA 1XLAA 2BVDA 4HGXA 1WCGA 4U28A 1GQLA 4L5ZA 3GG1A 4BWLC 2AKZA 4QISA 3H2CA 3H4GA 1E4NA 3W86A 4L61A 2VM8A 1V3JA 3KZSA 1N2VA 3NL5A 5BZAA 4Z1YA 1HP4A 5CSSA 3A64A 1JNDA 3ZR4A 3VUSA 3MPGA 2I5QA 3OLIA 3QFWA 4WD0A 4WDTA 2GLKA 3MJYA 1Q8JA 2QAPA 1CIUA 3RLUA 1W5MA 2E9MA 3AMCA 3T0TA 3NPVA 4YL2A 2NT0A 4Z2LA 1NQ6A 1O60A 3RRXA 5DMLA 3D46A 3L2IA 1XC6A 5AVNA 3R7MA 3EX1A 3UZJA 3O7UA 2X42A 4JIHA 1JCMP 4GE8A 3H7UA 3XINA 1HF6A 3TC6A 2NSXA 1ISZA 5XINA 3RLHA 4IQDA 4DM2A 1FH7A 3LQLA 2HXTA 4ML9A 3AXIA 3WD2A 2CLMA 2VP8A 4Z1AA 1P1XA 1EC7A 3REQA 3TOYA 1LBMA 4NRRA 3UJSA 1CENA 4QITA 2ZZ1A 3GG8A 1E1FA 4PCPA 1PUDA 2WHKA 3N6JA 2H9AB 4LBRA 4ZOEA 1RH9A 3U7VA 1EF2A 3AYSA 4AD2A 1SZFA 4AC1X 3H54A 4EPBC 1XIBA 3A24A 3BLEA 3GFYA 2JCHA 3N11A 2VZUA 3TNOA 2G3FA 1YRRA 3GZ3A 3TQ0A 2AGKA 2ICSA 1RXOB 1OM0A 4GQQA 5C54A 3VIJA 1DWIM 4BKNA 3W7JA 4CD6A 1HKWA 1MRQA 1SFSA 2QVHA 2DP3A 3EDKA 1XDLA 4FA3A 4MY1A 4XK2A 4XWUA 8XIMA 3TAKA 2ACUA 2VC6A 3QSTA 4HOZA 5AC6A 1R5YA 1CXHA 2G50A 2AMXA 1QXLA 1PJ9A 3EKLA 2ZRXA 3MBFA 2VELA 1E6RA 1NQKA 4LAKA 5HJXA 7REQA 1JCXA 1LZOA 2CBIA 1IT8A 4YS1A 1X7FA 5A2CA 1R3WA 4DNHA 2YPIA 2NUXA 4LYRA 3WQWA 2PRMA 1PZ0A 3EOLA 1AK5A 5C6MA 4MAZA 4NASA 2XWDA 1GT8A 3L2AA 1BGGA 2CLPA 2VWSA 3NQMA 4MNKA 2ZUMA 3NQDA 4R53A 3I6EA 1UD3A 1NWSA 1IZCA 2IQDA 3CT2A 3C3NA 3PHAA 4Z0SA 1F3XA 3QSRA 3UCCA 1QJWA 3STEA 4K1GA 4FK9A 3W7KA 4EANA 1VAHA 1C90A 3CT7A 4UMCA 2XDFA 3IV8A 4ZL1A 1C29A 1N8WA 1XCFA 2NQZA 2Y0FA 4PC8A 1JPDX 4Z1DA 2UWFA 3KXQA 1OIFA 4ZENA 2QYGA 3F5KA 3PBVA 3SN0A 4H8UA 4GIEA 2DZUA 3C4UA 4RXFA 3DFOA 1XGDA 2Y61A 3CV7A 5GNZA 2XTKA 1TWZA 2C15A 3RLGA 2B81A 3AXHA 4B5XA 4LUTB 1OT2A 1MUMA 3SFKA 1HGYA 1XI3A 2Q09A 2OLHA 3B9NA 3CQIA 1ONRA 4J2MA 4BY3A 1RP8A 4RE3A 3QGKC 3WIJA 3B8UA 1BTMA 1EUNA 4PUUA 1PX4A 2GVGA 3S9IA 5C9RA 3O05A 4XKMA 3VIHA 1KB3A 5CEWA 1KD0A 4UTHA 4YIWA 7A3HA 3H2FA 4MWAB 5A8GA 3ZIZA 2Y2IA 4O28A 4FOKA 1KRCC 3MVIA 4I9JA 2EG6A 4NAEB 4MKVA 1RY8A 1E4MM 3GDBA 5LSMA 3CUGA 5A2AA 5BRQA 2PE4A 3A3XA 1P7TB 3NQ2A 4IWWA 2QDHA 3AJ7A 3PPFA 3F2DA 1R87A 3VIGA 3EDFA 4Q6XA 1BPLB 3EEGA 4Y9PA 1UWRA 4MWAE 2YSWA 2FGZA 3LB0A 4RE2A 1DIEA 4JL1A 4MB1A 1WNOA 3O8AA 1JFXA 3HTWA 3KOYA 2BXVA 5AHEA 3WLHA 5CLTA 3UT0A 4GO9A 3W7CA 2G3NA 1H3GA 4JTEA 3URAA 2QEZA 1XYLA 3Q67A 1UASA 1VD6A 4AZ5A 3GC2A 2OZ0A 3SM0A 5I00A 3T55A 3WH5A 2EHHA 1ZJIA 1XYBA 3PTMA 2F6XA 2WHJA 4HCLA 1MXGA 5DMYA 1WOBA 1B3ZA 3GNOA 4QGCA 4RPQA 1WUFA 2WNNA 3WEMA 4P7NA 2VENA 1Y8BA 1NFBA 4LF1A 3MY9A 3ATYA 4D8AA 1UWUA 5E6ZA 2WCSA 1FOBA 3A21A 3TYUA 4GBUA 4DXKA 5A8PA 3CLMA 1A3XA 2IXVA 3A3HA 1B54A 5DMMA 1OFBA 3AIUA 5BW6A 3WZ0E 5MKGA 1ME9A 3B97A 2E9LA 4JEQA 3LHTA 4PB3A 1JJKA 2Y5EA 4UR8A 4UQAA 4LU0A 2GPTA 1BYDA 3G8EA 3P5YA 1VGAA 5G1YA 4GC3A 3H12A 1NU5A 4DBUA 4AWEA 1QHPA 1XHGA 1TMQA 3VAVA 5JMUA 3HPAA 2PDBA 5HNRA 4BK9A 1Y0EA 3VO0A 4V1XA 3RNDA 1CYGA 2PODA 4A8IA 1C92A 3KRBA 1QHOA 2ZE3A 5DCBA 5AYIA 4MJMA 3FJ6A 2VJXA 2HRWA 3GDLA 3GH4A 3VE7A 3RO6A 4DX3A 2VD9A 2G97A 3TQKA 1W31A 3OBKA 3WO8A 1IV8A 4XSLA 1TE1A 4A35A 4GH9A 3SGUA 3TV8A 4NZ5A 2C19A 1MW0A 4MZ8A 4ZQRA 1F05A 3WQEA 4IFKA 3W7RA 3IRDA 4NUWA 4FP1A 1A5LC 1GHSA 2PA6A 1DHPA 1H7XA 1RSCA 2WQPA 4AZHA 2QHAA 3CHVA 2I9EA 4AZGA 3BC9A 1EYWA 4JFTA 2FH8A 5AHLA 3ZJ7A 4GISA 1BFNA 2OYLA 3L5MA 1QU4A 3GNPA 3HQNA 3M0MA 1AMKA 5FESA 3ZMRA 2VCCA 4A3UA 3FJNA 4K3ZA 2Y2LA 3FYOA 2G0WA 4FI4A 1PDCA 1X6LA 3S1GA 3OHMB 3G22A 2VR2A 4O52A 3ES8A 4IMGA 3P62A 1UP3A 1R3VA 4EWND 3BLIA 3D5HA 4JKMA 4JEJA 1V02E 4E4FA 4QHRA 4TUFA 3OZYA 5BOFA 3ITYA 4ICNA 2ZXBA 1VBRA 1X6NA 1E1CB 3V16A 1A3HA 1J6PA 5CBJA 4WGHA 1XRFA 2VCAA 1TV8A 3TSMA 9RUBA 1KFLA 1YPIA 2GDUA 1O1ZA 4GFIA 3U7BA 1YU1A 2ISFA 5IXEA 5I03A 3VGEA 3OG3A 4Q4OA 6XIAA 3TK7A 3VDGA 3D0CA 3PANA 2IPWA 4J40A 4QQUA 3V0SA 3G5EA 2XFWA 4O54A 3LI0A 1E15A 2W6RA 1W54A 2YGYA 3CB8A 2BHUA 4CQ9A 1F4AA 5CSYA 1YUEA 4M19A 3FFSA 1Q6CA 1KCXA 2WOQA 1VFUA 4R88A 1RAKA 3EOSA 2WHMA 2Q6ZA 2BFGA 5HK4A 2RDXA 2WZEA 3M5VA 4C6MA 3LHUA 6PTDA 3L4UA 4ZQCA 4UOQA 4HNUA 1YXCA 4QG8A 5HPOA 4Q8NA 4D1JA 3WQOA 4NKCA 4QX4A 4Z1CA 3CIWA 2WSKA 1BF2A 3BV4A 4YLWA 1JI1A 1R85A 1R38A 2HROA 4WXZA 1DJWA 3TVAA 5D33A 4AD4A 5TF0A 1RP9A 4LJ3A 1IYXA 1I2NA 4XIAA 2VXNA 4NZJA 1DJZA 2EPMX 3S2NA 3NNTA 2J8TA 2V2HA 2DSUA 4HU4A 5CZTA 1QFEA 1Q7ZA 1V7YA 1OX4A 1XGEA 2ZRYA 3GY1A 1Y5XA 2XN2A 1ADSA 1ECQA 2FGBA 1TV3A 2BMBA 5HMFA 1DVJA 3RGTA 3P14A 3VDHA 2QV4A 5CPNA 5HANA 1DXFA 4MNMA 1KFCA 2NQHA 1JCYA 4WY0B 4DI8A 1KKRA 4DWSB 3C86A 5FAGA 1TO3A 5FOOA 2XWEA 3AXMA 1K4GA 2CCRA 3GG0A 4L1WA 4AUBA 3GU2A 3RIKA 3O6CA 1ADDA 1KFWA 3LV5A 2FDMA 1F3WA 3FEQA 4PMDA 3UR2A 1WKFA 4JX4A 4DUWA 3PTQA 1L6YA 4UB9A 1PHQA 1EJRC 1HVXA 4YCPA 4RNJA 2C13A 3TUUA 2VTFA 5TNVA 2GVLA 5E5CA 4WHBA 2Y2KA 2P10A 2H8XA 4H9VA 1TA3B 4JQ1A 3POHA 4S1FA 4A2SA 3NQ7A 4W93A 3A4XA 1ZBCA 2YL8A 5MF5A 3T6CA 4A2RA 3QMSA 3W7LA 1U5VA 3T05A 3S47A 3LPPA 2TSYA 4NAFB 2R1KA 3WUBA 3IK4A 3JW7A 4Y6GA 3GLCA 1QNOA 4I5RA 3BQ5A 2VEFA 3UD6A 2GJRA 1MUWA 3PAJA 1M01A 4O50A 2Y4SA 4Q4MA 2A2IA 1WE5A 4ATWA 1FHVA 4AWSA 4RZ4A 1NF0A 2VHLA 4H00A 1CXEA 3VD4A 5F4SA 3ZLGA 2GK1B 2X41A 2HNHA 4N9CA 3POCA 4NVTA 2G3MA 2XH2A 1QI4A 2NWSA 3NQAA 2PP3A 1TCDA 2YB1A 4RE0A 4HTYA 2RGLA 1W3IA 5LGXA 3H23A 3KE0A 3WD4A 2QMKA 2FHFA 4FPSA 3GTFA 1B30A 1H61A 4IUGA 1VBJA 1E70M 3G3MA 1J9YA 1O5XA 2QF7A 3T4WA 3LCIA 1OVDA 3RJYA 3BAJA 1XIFA 3GNDA 4C6OA 5HATA 4YTRA 2WSYA 5EFFA 2FFCA 4DLFA 1F3EA 1H8PA 1PTAA 1PS9A 3SRHA 4IFRA 1QNSA 5CZKA 4HMCA 3PZOA 1P48A 1UR8A 1PPIA 2D49A 3QY6A 4JHMA 2XFFA 4KFPA 1WKDA 3E3HA 1H7WA 1VFSA 4W4QA 3B03A 3QVQA 4AVFA 2RKXA 1VCFA 4WJEA 4F0MA 3W2MA 3QR1A 5AB3A 3BO9A 5E6YA 3FVMA 2UY3A 1XYAA 5HJLA 5AYZA 1GVYA 4HVXA 3QW4B 2HPIA 3G1VA 3O2LA 4I90A 1Q2SA 4HZ8A 4LC6A 4M0XA 2NQ5A 2XJ7A 3WQ6A 3LHZA 5ABHA 1UIOA 2FMOA 1E6QM 3DEQA 2YL6A 3AOFA 2DIEA 2R1LA 3ZR6A 1EEXA 2VI0A 3DZ1A 4NILA 3WQ4A 4FAMA 3EMQA 4P8UA 4C7FA 3H55A 3RFAA 4RCXA 1C8QA 1SJBA 1OFOA 3ECQA 1PX3A 4DO7A 4JIQA 2Y6ZA 4PULA 2FH6A 3EWCA 4IICA 1HGWA 1YDVA 3W7OA 5D2TA 4PODA 3AHVA 2V69A 4HNNA 3BLPX 1MXDA 5LA1A 1YEYA 4J3UA 3OJGA 1OFEA 3I7QA 4TV6A 4F8XA 3LZ5A 4AYSA 4PR4A 1VJZA 1KCKA 1W5QA 2JK2A 1I1WA 1U1HA 2FTPA 5AKQA 3SBFA 1ZCCA 3DKJA 1B1YA 4LYPA 2A1YA 4M29A 2Y63A 3GDKA 3M1ZA 4ATLA 1ZAJA 2WSQA 1E0WA 4B2DD 1UC5A 3F2BA 5DBUA 2X7VA 1I2OA 3TMQA 2DDXA 3I6TA 3W00A 2A6LA 3LPOA 2D1ZA 3TQPA 5A8QA 2ACSA 3MUZ1 3PS7A 2A3LA 2B7PA 3GHSA 1EWEA 4Q4RA 4AC7C 3VKBA 3LCXA 3REQB 1GZJA 4LS0A 2OWCA 4WUIA 3T8QA 4C1LA 5AHFA 3GHUA 3M7SA 4GH1A 3EGJA 1QDSA 1E0TA 1UUQA 1MUCA 3NEVA 1KNWA 4CQ8A 2GJPA 3M4HA 2C1IA 3SQLA 5PTDA 2NW0A 4AWUA 5DT5A 4GXMA 1WO2A 4F0KA 5LNWA 2G3IA 1S5TA 1RD6A 2JQXA 4HNOA 1QO5A 2ZZ5A 1HXJA 3L4VA 4O57A 2X1SA 2Y7EA 3CAWA 4K37A 1R86A 1B31A 4YTSA 3MSGA 1SM9A 2A3AA 2VR5A 3KVLA 4B16A 1BWKA 1VPXA 3VCCA 3CQKA 3MS8A 4ILSA 3UYCA 1UQYA 1HO4A 1GVIA 3WBAA 3KWSA 3WQDA 4A8RA 4AMAA 3RX4A 2WJFA 1SMDA 3B9EA 2C0HA 3MP4A 1EIXA 3CHEA 2OLAA 1SMAA 5DBTA 4AEEA 2J9YA 1FWAC 4S23A 4QFUA 1UWSA 1JEZA 1CPUA 1U22A 3MO4A 1OC7A 2DT2A 1IZJA 3U2OA 3RK8A 2XD1A 4HMDA 1HW6A 2PGFA 5CGMA 4IUOA 1QOPA 3GUGA 1A49A 2PPGA 3UG8A 5D30A 2VGIA 3F4DA 3VTRA 4DBSA 1GW1A 5CC6A 3V75A 1UYQA 1GVEA 1VCVA 3R58A 3AHYA 4CD7A 1CCWB 4FNUA 1EUAA 4AD3A 1XH1A 4DAFA 1RQBA 1CBGA 4Q8MA 3VGHA 1UC4A 1E6NA 2FZMA 5HOSA 1ZJHA 5DXXA 3T9PA 2J8FA 4C6NA 3SADA 1E4IA 3ABOA 1U5HA 3TA6A 4UMBA 1J79A 5DQPA 1EJ7L 5J5DA 3H8AA 5C55A 4HJWA 4LB3A 4WJXA 4R9OA 3B4YA 1B3XA 3S6DA 3W1MA 1XFBA 2WANA 3DYOA 4GIAA 2C91A 3N2XA 3N2BA 3JZUA 4DRSA 4K39A 4QRNA 4GNJA 3UJEA 1TREA 4IGSA 1OABA 4XISA 3FNDA 2OQLA 2O9RA 4R27A 1A5BA 1EPXA 3IIPA 5M17A 3DG7A 1UR0A 3BSHA 2WPBA 3UNTA 4KCTA 5G4WA 2CW6A 4HHMA 1IGWA 4GKTA 3UG5A 3NAVA 1TPDA 1KXTA 2CETA 4WCJA 4IT1A 1W1ZA 3CLWA 3EAUA 2Y2QA 1G7VA 4N9EA 4XBKA 4AFYA 2POTA 3EWZA 3EPMA 4KT2A 2DGAA 3KS4A 4PMNA 1KW1A 1Q6EA 4O1FA 2P3ZA 2O4MA 3WQPA 3LLXA 4HOXA 1Q3NA 4IGHA 3STCA 1T41A 3RO8A 3FJ4A 5AECA 3CUHA 5CAKA 4DBEA 5CQ1A 3GR4A 4O1DA 3FCPA 2DZSA 2B0MA 3L2LA 1E5NA 4U33A 2HBXA 2A6NA 4TMBA 2I5GA 1KM6A 3WYZA 5KITA 2X1IA 3ZQ9A 4F2UA 3W2JA 3GVRA 4GZJA 3SCNA 3S5OA 4Q4PA 4BQ4A 1G67A 3KLLA 4C6QA 4Y2WA 1K9TA 2G95A 1QNQA 3W6YA 1IE7C 1AVAA 2QCNA 5FIPA 1ADOA 1BGAA 1PSCA 1RLDA 3W71A 4HZMA 2QW5A 1F61A 2W61A 1ENUA 3P80A 1XYFA 3IJ7A 3CYJA 2WO5A 1J11A 1IIHA 2YXXA 2PTYA 3TZNA 3QLLA 2Y7GA 4RV3A 1SO6A 3TTOA 3PUGA 3FXGA 3GIQA 3RDKA 5IBXA 5IRPA 1BRLA 2HTMA 3FY1A 4O8RA 3W82A 1RQHA 1K8XA 2WPGA 3NL2A 4JTKA 4B4HA 4YN5A 2D2GA 2PLJA 2O92A 5LIKX 2D2JA 1YDOA 3HB9A 4PMUA 3DC8A 4W7UA 4JDYA 1TWSA 1G4TA 3TDFA 1QNVA 5FJTA 3UP8A 2XIMA 4OTKA 3NM1A 4QQ3A 4H4IA 2OLSA 3DFTA 4MADA 1CNVA 2JF6A 3KVMA 2NQ9A 1GVOA 2JGYA 3NPXA 1KCZA 4H8NA 4Q7BA 5G2WA 1YHTA 2ATMA 4TIMA 3PBWA 3RPTA 1W1PA 4H2HA 3WDRA 3UJ2A 1N7KA 2GGIA 2FJUB 1UOZA 5F2IA 4PEEA 1DJIA 3W23A 1LLOA 4XX6A 4PTDA 4CQDA 3MUXA 1E6PA 4ZCWA 4FNQA 5IHSA 3AZSA 2PTDA 5D2XA 1Z6KA 1H11A 1R9YA 1YE6A 4E6MA 3NZRA 1DL3A 2I9UA 4RZ5A 3LN3A 1XLHA 3CV2A 4OBRA 3STPA 5XIAA 4DXXA 4FXJA 1FHUA 4GHRA 3S6OA 2WMIB 4YWSA 4ZE5A 1V6XA 4MOZA 4XG1A 3EDDA 4O0KA 3N14A 3TYDA 3A5VA 4PL2A 4AY7A 1RBAA 4E2VA 4CNUA 3BICA 1GHRA 3SB0A 2HS8A 4GVFA 3SN1A 3KBVA 3TIMA 4A05A 1XIEA 3ZJKA 3FW6A 3N4AA 3SW6A 2Y8UA 3AYVA 2WW5A 2XVNA 2VL4A 2ZRUA 3QYQA 2ZZ4A 1F9CA 2Z0IA 3ARZA 2CZDA 3P93A 4MZ1A 5ECUA 3UBPC 3S2JA 3A6OA 3WMBA 3ME3A 1HJQA 3ZS4A 4G1NA 3KBMA 3UPWA 4D71A 4BHYA 4PUJA 3AC0A 3UY8A 4TVCA 5C0QA 4B92A 3N29A 5K4ZA 2QJMA 1OY0A 1A0EA 3ZO9A 1MO0A 3SQSA 1KLZA 4UTTA 2A4AA 2PDWA 3MUCA 4W9TA 3QHMA 3M5ZA 3MV01 1XKYA 4WDWA 2WYSA 4C6CA 2FLIA 4US5D 4QE1A 4X2RA 2EJAA 1E73M 2A7NA 2VOMA 3R79A 1ZJAA 1TPH1 3RXZA 3WQ8A 2YCLB 3LS9A 1OZMA 4GJ1A 4TTUA 3K1GA 1Z32X 1FCQA 5HAOA 4GRSA 3WLSA 1V6TA 1I75A 1P0BA 3H2OA 3NGJA 4AY8A 4ORMA 3S5SA 3BQ6A 1EEPA 2INEA 1C8XA 2RDWA 4QAWA 2R9RA 2YR1A 4YPJA 4DNMA 1PZ3A 2V5BA 3CHFA 2PURA 1BXNA 2PCQA 1AFSA 3UW6A 1EJUC 2YA0A 3GFZA 3M0JA 3QY8A 1XLJA 4XAFA 2PRLA 3EB4A 1HFBA 5GJMA 2WV8A 5LNSA 1UUMA 4Q4SA 5JIPA 3WELA 4X63A 5BXSA 1TR1A 1GQKA 2DFAA 5FL0A 1MDLA 1PIFA 3EOEA 1B4KA 1TZ7A 4AHPA 4EXAA 4C7GA 2QJHA 4EXQA 2ONEA 2OKOA 4TR9A 2PI6A 2VDIA 4CKQA 1HZYA