4NZGA

Crystal structure of the n-terminal domain of moloney murine leukemia virus integrase, northeast structural genomics consortium target or3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKALLERSHSPYYMLNRDRTLKNITETCKACAQVNAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase p46
publication title X-ray crystal structure of the N-terminal region of Moloney murine leukemia virus integrase and its implications for viral DNA recognition.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Viral protein
total genus 29
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4nzgA00
3L2WA 4BE0A 3OS0A 4E7LA 4BDZA 3OYKA 3OY9A 4E7JA 3OYBA 4E7IA 4BDYA 3L2QA 3S3NA 3L2VA 4ZTFA 3OYEA 5FROA 3OYNA 3OS2A 4BACA 3OYFA 3OYCA 4BE2A 4BE1A 3OYMA 3OYAA 3OYJA 3S3MA 4E7HA 3OYLA 5FRNA 5FRMA 3OYIA 4ZTJA 3OS1A 3NNQA 3L2RA 3OYDA 3S3OA 4IKFA 3L2UA 4E7KA 4NZGA 3OYGA 3OYHA
chains in the Genus database with same CATH superfamily
1PVSA 5CHZA 3OS0A 4YPHA 3FHGA 3OYKA 3OH6A 2V75A 3D4VA 4E7IA 4EA4A 4BDYA 4UOBA 3OH9A 3CWUA 3L2QA 1PU8A 4AI4A 4AIAA 3OYNA 1WEFA 1LWWA 3F10A 4E9HA 2NOHA 3VW4A 3KTUA 4DK9A 1YQRA 1PU6A 3OYMA 3OYAA 3S3MA 1HU0A 3CVSA 2YG9A 5AN4A 1ORPA 5FRNA 5FRMA 2NOIA 1N39A 1DIZA 1KG7A 3N0UA 1WEGA 3OGDA 3L2RA 1MPGA 4PIIA 3OYDA 4EW0A 4NZGA 3FSPA 4BE0A 1XQOA 1KG5A 4E7JA 4EVVA 1KG6A 2NOEA 1RRQA 1XG7A 2OFIA 2W03A 1RRSA 2JPSA 1XQPA 1KG2A 4E9GA 3LCNA 5KN9A 1U84A 5KN8A 1PU7A 3OYJA 2NOBA 3CVTA 3OYLA 1ORNA 2NOLA 4B21A 2NOZA 3IH7A 3CWAA 4B22A 3OS1A 4B23A 4YPRA 3S3OA 3L2UA 4YOQA 3CWSA 3OYGA 3OS2A 4OFAA 3OYHA 4BDZA 3G0QA 3OY9A 4AI5A 3OYBA 1KQJA 2W04A 1P7MA 3IHOA 2JHJA 3R2XC 2H56A 3L2VA 2NOFA 4ZTFA 5FROA 1NKUA 3FHFA 3OYFA 2XHIA 3I0XA 4E9EA 4EA5A 4E7HA 1WEIA 1KG3A 3KNTA 4OFHA 4B24A 1NGNA 4ZTJA 4IKFA 4E7KA 1LWYA 1MUDA 3F0ZA 3L2WA 4HSBA 4E7LA 1P59A 2OFKA 3S6IA 1EBMA 1KEAA 1LWVA 3S3NA 1N3AA 2YG8A 1YQMA 1MUNA 3I0WA 1KG4A 1LMZA 4UNFA 3OYEA 2ABKA 5DPKA 1N3CA 4BACA 2JG6A 3OYCA 1M3HA 4BE2A 1M3QA 3CWTA 4E9FA 2I5WA 4BE1A 4OFEA 1YQLA 2JHNA 4EW4A 3N5NX 1KO9A 1MUYA 3OYIA 3NNQA 4EJYA 1VRLA 1YQKA 4EJZA 1FN7A 3CW7A
chains in the Genus database with same CATH topology
3L2WA 4BE0A 3OS0A 4E7LA 4BDZA 3OYKA 3OY9A 4E7JA 2V75A 3OYBA 2W04A 4E7IA 4BDYA 3L2QA 3S3NA 3L2VA 4ZTFA 3OYEA 5FROA 3OYNA 2W03A 4BACA 3OYFA 3OYCA 2JPSA 4BE2A 3VW4A 4BE1A 3LCNA 3OYMA 3OYHA 3OYAA 3OYJA 3S3MA 4E7HA 3OYLA 5FRNA 5FRMA 3OYIA 4ZTJA 3OS1A 3NNQA 3L2RA 3OYDA 3S3OA 4IKFA 3L2UA 4E7KA 4NZGA 3OYGA 3OS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2W A;  4BE0 A;  3OS0 A;  4E7L A;  4BDZ A;  3OYK A;  3OY9 A;  4E7J A;  3OYB A;  4E7I A;  4BDY A;  3L2Q A;  3S3N A;  3L2V A;  4ZTF A;  3OYE A;  5FRO A;  3OYN A;  3OS2 A;  4BAC A;  3OYF A;  3OYC A;  4BE2 A;  4BE1 A;  3OYM A;  3OYA A;  3OYJ A;  3S3M A;  4E7H A;  3OYL A;  5FRN A;  5FRM A;  3OYI A;  4ZTJ A;  3OS1 A;  3NNQ A;  3L2R A;  3OYD A;  3S3O A;  4IKF A;  3L2U A;  4E7K A;  4NZG A;  3OYG A;  3OYH A; 
#chains in the Genus database with same CATH topology
 1PVS A;  5CHZ A;  3OS0 A;  4YPH A;  3FHG A;  3OYK A;  3OH6 A;  2V75 A;  3D4V A;  4E7I A;  4EA4 A;  4BDY A;  4UOB A;  3OH9 A;  3CWU A;  3L2Q A;  1PU8 A;  4AI4 A;  4AIA A;  3OYN A;  1WEF A;  1LWW A;  3F10 A;  4E9H A;  2NOH A;  3VW4 A;  3KTU A;  4DK9 A;  1YQR A;  1PU6 A;  3OYM A;  3OYA A;  3S3M A;  1HU0 A;  3CVS A;  2YG9 A;  5AN4 A;  1ORP A;  5FRN A;  5FRM A;  2NOI A;  1N39 A;  1DIZ A;  1KG7 A;  3N0U A;  1WEG A;  3OGD A;  3L2R A;  1MPG A;  4PII A;  3OYD A;  4EW0 A;  4NZG A;  3FSP A;  4BE0 A;  1XQO A;  1KG5 A;  4E7J A;  4EVV A;  1KG6 A;  2NOE A;  1RRQ A;  1XG7 A;  2OFI A;  2W03 A;  1RRS A;  2JPS A;  1XQP A;  1KG2 A;  4E9G A;  3LCN A;  5KN9 A;  1U84 A;  5KN8 A;  1PU7 A;  3OYJ A;  2NOB A;  3CVT A;  3OYL A;  1ORN A;  2NOL A;  4B21 A;  2NOZ A;  3IH7 A;  3CWA A;  4B22 A;  3OS1 A;  4B23 A;  4YPR A;  3S3O A;  3L2U A;  4YOQ A;  3CWS A;  3OYG A;  3OS2 A;  4OFA A;  3OYH A;  4BDZ A;  3G0Q A;  3OY9 A;  4AI5 A;  3OYB A;  1KQJ A;  2W04 A;  1P7M A;  3IHO A;  2JHJ A;  3R2X C;  2H56 A;  3L2V A;  2NOF A;  4ZTF A;  5FRO A;  1NKU A;  3FHF A;  3OYF A;  2XHI A;  3I0X A;  4E9E A;  4EA5 A;  4E7H A;  1WEI A;  1KG3 A;  3KNT A;  4OFH A;  4B24 A;  1NGN A;  4ZTJ A;  4IKF A;  4E7K A;  1LWY A;  1MUD A;  3F0Z A;  3L2W A;  4HSB A;  4E7L A;  1P59 A;  2OFK A;  3S6I A;  1EBM A;  1KEA A;  1LWV A;  3S3N A;  1N3A A;  2YG8 A;  1YQM A;  1MUN A;  3I0W A;  1KG4 A;  1LMZ A;  4UNF A;  3OYE A;  2ABK A;  5DPK A;  1N3C A;  4BAC A;  2JG6 A;  3OYC A;  1M3H A;  4BE2 A;  1M3Q A;  3CWT A;  4E9F A;  2I5W A;  4BE1 A;  4OFE A;  1YQL A;  2JHN A;  4EW4 A;  3N5N X;  1KO9 A;  1MUY A;  3OYI A;  3NNQ A;  4EJY A;  1VRL A;  1YQK A;  4EJZ A;  1FN7 A;  3CW7 A; 
#chains in the Genus database with same CATH homology
 3L2W A;  4BE0 A;  3OS0 A;  4E7L A;  4BDZ A;  3OYK A;  3OY9 A;  4E7J A;  2V75 A;  3OYB A;  2W04 A;  4E7I A;  4BDY A;  3L2Q A;  3S3N A;  3L2V A;  4ZTF A;  3OYE A;  5FRO A;  3OYN A;  2W03 A;  4BAC A;  3OYF A;  3OYC A;  2JPS A;  4BE2 A;  3VW4 A;  4BE1 A;  3LCN A;  3OYM A;  3OYH A;  3OYA A;  3OYJ A;  3S3M A;  4E7H A;  3OYL A;  5FRN A;  5FRM A;  3OYI A;  4ZTJ A;  3OS1 A;  3NNQ A;  3L2R A;  3OYD A;  3S3O A;  4IKF A;  3L2U A;  4E7K A;  4NZG A;  3OYG A;  3OS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...