4NZRH

Crystal structure of the antibody-binding region of protein m (protein m td) in complex with anti-hiv antibody pgt135 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
234
structure length
228
Chain Sequence
QLQMQESGPGLVKPSETLSLSCTVSGDSIRGGEWGDKDYHWGWVRHSAGKGLEWIGSIHWRGTTHYKESLRRRVSMSIDTSRNWFSLRLASVTAADTAVYFCARHRHHDVFMLVPIAGWFDVWGPGVQVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structurally distinct human mycoplasma protein that generically blocks antigen-antibody union.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/protein binding
molecule keywords PGT135 heavy chain
total genus 40
structure length 228
sequence length 234
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nzrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nzrH01
1JZ7A 2GITB 3GIVB 1R3HB 1AIFA 1JP5A 4LRIA 2BMKB 3L3IA 2DICA 4U3HA 3RWDA 4KQ3H 5CBEA 1HQRB 1GGIL 4FMFA 1KB5A 1NH6A 4X8XA 3N06B 3SDCD 3WE6A 5HYJD 3NA4A 3VFTB 1IC5L 5CZXD 4U1GB 1RZGB 4TSAH 5HYJB 1YEJH 3MV8E 3RA7H 3B9DA 2EKJA 3N1PC 3JBG7 4YQXL 2OMBA 4R90L 5E8PA 5KVMC 4Y5YA 1YECH 3SDXB 4AMKL 1DUYB 1N6VA 3MBXH 5T1KB 2VLKD 3BGAA 4K9EL 5HTSA 2HVJA 4M6NH 5LCVH 5I19H 4FZEH 4JZOA 3NA9H 2Y36H 2OYPA 1BQSA 3DUUB 4LMQE 2OM5A 4Y4KD 2XZAL 4P2CG 1S7TA 5B8CB 2V7NA 3OKKB 4NHCH 4MJIE 3MCLL 5BZWA 4G43B 3BP5B 1OAYH 4WWKB 4WTXA 4JO1H 5GGVH 2NY0B 3FT3A 4HS6A 1XR8A 5T1KD 4R4BB 1N7ML 4MHHI 4L9LA 4MSWA 2P24B 1JF1A 3NMEA 4GSDL 4PY8J 1NLDL 1HI6A 3LH2H 3QIWC 4XWOC 5H37G 3FB5B 4HWNA 2F5BL 1F4XH 3GIZH 4WUUE 5K93A 2CDEB 4FHBD 1I3RA 3G5XB 4YHKL 1IKFH 3KYNB 4FQQB 4EIZC 2AP2A 3EFDL 5FM5O 4ORGA 4Y2DB 5EOCL 3RY6A 2D7PA 2D7QA 5DJZA 3LRHA 4IOFD 4L4VD 1DQJA 2XN9E 4X80H 1P2CA 1XF4B 4E41B 1OCWH 2HWZL 4LU5L 3B5GA 1CD9B 1QKZL 2ZG3A 3MFFB 4XVSH 5EU3B 5DVKA 4BSJA 4TTDD 3SO3B 1A6WL 3GMQA 1FDLL 1ZHNA 2WWMD 3E1F1 3PWPD 1YY9D 4TTDC 3MRDA 5F7LB 2V9RA 4U33A 3KDMA 1X7QB 5FO8B 2FIKB 3A6BL 1CLCA 5ID0B 2GJ6A 2XKSA 1EO7A 2QR0B 2Q86A 5CLWA 3QNXA 1BP3B 4P4RB 3IKCA 3N85L 4ZNEA 4YX2L 4M6OH 1Q9WA 4J3XA 3GBML 1I7UB 5D1QA 2CXGA 1ZK9A 2JJVA 3RWEA 1CN4A 1JTPA 3K4ZA 4TVSa 2K9UA 3OPZH 3EYUL 2XWBA 5IFAL 2JIXD 1U8IB 4RGND 1LGVA 2BSRB 4M7KH 5FECB 3PHQA 2OXGA 2UWEA 1IRAY 1BZ7A 1VGEL 1WFNA 2DQUH 4C59B 1NC2A 5DTFA 2DQTL 1YNLL 1ZVHA 3P30H 5DJDB 4HCRH 2IH1A 1NEZA 1KTRL 1NJ9B 5EUOE 4M7ZB 1UM5H 4PGDB 2EYRB 1RK0A 3B9KC 4IHOB 4MAYC 4RMSA 3U0TB 1H0DB 4HLZH 32C2A 4JFZH 1YNKH 4HEPG 1HHKB 1OLLA 4AH2B 4L3CB 1AO7B 1X44A 4ZO8A 4GMSH 2C3WA 4MJ2A 5CCKH 3RY6C 2J8OA 3MX0A 5E95B 4OJFH 1JN6B 4KDTC 4HK0B 3GHEL 4NQEB 2WMPA 3NCYS 1BLNB 1YNTB 5I8KH 4P5KA 4NQSB 2UVEA 3U4EA 1G6RL 1FCGA 2BNRB 3PHSA 1FZJB 2SEBA 3FZUC 4RZCB 5I8CA 2E8YA 1SYVB 1X5LA 5AUMB 1WC7A 1IM3A 4EXKA 2DQDL 4J12A 4YBQD 5MERA 3VD5A 2WUBL 5C0RH 2CR3A 4NWUL 4RFEA 4MQ7A 1FRGL 5DK2A 5F70A 5C71A 4YBLB 1R3IH 2H2PD 3MRGB 4NYLB 4WI4A 2KKQA 3QEGH 5E6IA 2VDLH 5L0QC 4P3DA 3O4LE 1JYWA 2E7LC 1UFUA 3HE6B 3NCEB 2HVJB 1NMBL 2Z9TA 3DECA 4V2CB 3REVB 1XCTA 3O6MH 2GITA 1KT2A 5ELIA 5IROC 1DUYA 5GZOD 3FO9A 2ZZUT 4LPWA 1PX3A 5E1HB 4ZYKA 3BW9B 4Y2OA 2H2SC 2VKXA 3TBYA 3FFCD 1UB5A 2PXYB 1EZVX 2VXUH 5T3ZE 4OD2B 4GG6E 2EDHA 5KOMC 1F4WH 3UROR 5A16B 2JB5L 1OY3B 4UOW1 4JRYE 4UIMB 5HYJA 1JWUA 2EYSB 1PW3A 2ATPA 3TFKD 2Z0BA 2YKLL 5HI4C 1FZOB 4Y8DC 4NJAH 2GUOA 4DVBB 3RTQA 4XAKD 1BQLH 1BOGA 3IDMA 3VXPA 3PWNB 4NSKB 3RKPA 5F3HB 1LD9A 5EDXA 1VCAA 3GSOB 3V7MA 3BE1L 4KQ4H 1FNAA 3FTGB 2NXZC 3KYMB 4IJ3B 1N0XL 2Z35B 2DAVA 9CGTA 4MQXC 1I3UA 4B7LA 3QRFM 1FFNB 1JWSB 3MJ8B 2E9IA 3CUPA 1TQCB 4U6VL 2NNAB 2BJMH 5IIEB 5I66A 1FLRL 1JZ2A 2F53B 5L2KD 4JFDB 1IVLA 4GBXB 2XA8L 4HEME 2H3NA 3EO9L 2YD2A 5E94A 5TE6L 2P46B 4JKPH 4NRZA 1YEFH 2AV1B 4MQTB 2VITA 4PREA 2W1NA 3PV6A 3DVGA 3UTPE 2A9MH 3OR7A 4ZXBC 1SM3L 2WBJC 2C5DC 1R5WB 4LSPL 4M6MH 4YNYB 3HC3L 1MEXL 4HF5L 4RBPK 1XF5A 1KJ3H 3J8F7 4OFPA 3UPRA 4N5UA 5C07B 2VDKL 1CLYL 3HC4H 1U8NA 5IQ7L 4WI9A 5IJVB 4U1NB 1TJGL 2ZUQC 4G80B 4TQEL 4ETQA 4NP4L 5I9QB 4AMKH 2FATL 4JZJA 3S4SA 4B50A 2EXWD 1RUPH 1JGLH 4F8QA 1V7NH 2XWTA 5DUML 5IVNA 1A6TA 1U92B 4L4VA 3CIQA 5EOQL 5D71L 4JRXA 3V0VB 1TNMA 5J3HD 4GUPA 4DW2H 1QD0A 4M7LL 1ORSB 2XWJB 2GJ6E 5EPMA 2EIEA 4CU8A 4TUJA 1B0RA 2Q6WA 4LSRH 5HHME 2BNRD 3WLWC 3QFJD 3FO0H 4P57B 1WBXA 2NXZB 5T33L 4HT1L 4AH2A 3QCTL 4OLZH 3OQ3B 1S5IH 4JPIB 1YYLL 3KPQB 3QQ4A 1T20B 4OKVB 3BRFA 3IFOB 3JTSA 1M4KA 5DJXA 5DRXA 5FIEA 5DD0L 4YHPA 5GRWA 1S7SA 1F6FB 1HK6A 1CR9L 2CIIA 3MRCA 3NACL 4WENB 1KB9K 1KTDA 4RGNE 4MNQE 5D72L 3V5KB 1BMGA 2A74A 4D9QD 5JHDB 2QHLA 4M02A 5D7KD 4NQDE 4PJCF 4OLXL 3V9FA 3GMOA 3VG0H 2HFFA 1WFOA 4XBPA 3SDAC 2I27N 4HIXL 2W9DL 4YDJB 1DP0A 2VO5A 5FOBB 1QRNA 3VFOA 4RNRB 3ELAT 2VJXA 5GRVK 3LOWA 4PJ5D 1VKXA 3MO1A 4AG4L 1LK2B 3Q6GL 5FGBC 4YDKL 5BZWB 4PJGB 5FKPA 4FG6D 1N64H 3BDXA 2NYYC 3CZFB 5GJSL 2AEWA 5I1DA 3MOBH 5BV7C 4JN1H 2A6IB 5IFAH 3ARBA 4OFYD 4R4ND 3BP7A 1N2RB 1FIGH 4YWGH 1R5VA 5DF0A 4K7FA 5F7HA 2OK0H 1A6AB 5C0FB 4MVBC 1E28A 2Q3ZA 1U8PA 4XB8A 5L6YL 3VXTA 1I3VA 1F02I 3MUGB 1CDBA 1ES0A 3PUCA 5C7XH 4HWBH 1A7PL 4L29B 3AM8C 1KPVA 1U8OA 1AR1D 4M1DH 5E9DE 2HLFC 2C1PB 3ARTA 4GMSL 5MI0C 3OXRA 1CS6A 3EGSB 3UZQA 4ESKA 1MRDL 4Z7OE 4EUPB 3KHQA 5F7KC 5J11B 5DUPH 2DJ4A 2CK2A 2IQAB 4BZ2H 2ORBH 1NCNA 2I60L 3K74B 1J1OH 3V4VH 2BHYA 3IXAA 4K94H 1NCDL 2J88H 1UXWB 3RDTD 3ARWA 3QI9D 1HKFA 4OZFG 4J4PD 1EJ6A 3X12B 1XF5B 1MHEB 1QPXA 1KPUA 1OAKL 4LLDB 2Z8RA 4YFLI 3QFJA 2D7TL 2Z8VC 5FUZH 2MNUA 5E8DH 3QG7H 4J1UA 1GCFA 1IEHA 3QXDA 5D5MF 1AFVH 2FZ3B 5EU7E 4OQTH 1K6QL 3ZL4H 2MMXA 3QDJB 1S5HA 2MTPA 3ZT5A 4TNVK 3C5ZD 4Y1AE 3TBYB 5IFHL 2IBZY 3MLRH 4PJBB 1ZGLP 3N1FC 4S1DC 3RVWD 1PYWA 3LCYA 2IAMA 3CVHA 1T7YA 2I25N 3G6JF 4RX4A 3WS6A 1D9KC 3EYFB 3QIWA 3IGAA 4X6FA 1CK0H 1CFTA 3D39D 1YQ2A 2PYEA 4LVEA 3DROA 4Q9QH 5I6XC 2DLFH 4PJEA 1KCRH 3ETBF 1RULL 2W59A 1HN1A 4JANB 4JFYA 3TYFB 3I6LE 4Y2DC 4XCCL 4OIIH 3OKYA 2BP3A 1QFWL 3H7LA 4WU7B 3CSPA 1JGVH 1KCLA 1EXUA 2A1WL 3V7AG 3VXOA 3KYOB 1IGYB 4I77H 4X9BA 5DDHB 1R6VA 4RAVB 3O8XB 2RCSL 3TF7C 4KRLB 4PJHB 3FO9B 4FZEL 1TZIB 1LP9A 2G9HA 3L5JA 4ZTOH 3SE3C 1JZ8A 1F8TL 4Q0XH 4AL8H 3FKUS 1BZ9B 4J7RA 1GJIA 3RWCA 2D7NA 2X70B 4KZEL 5DUBA 2Q1EA 5JIHA 4K2UH 2DQGL 2VWEC 5CP3H 3MYZA 1ZLWH 3VXUE 1ZVYA 1SM3H 5GGVL 4ZS6D 1P5VA 3D18B 3VXSB 2BSTB 1MEXH 1N7MH 3DVIA 4Y4KA 2PR4L 4CMHC 1J0YA 4I18B 5BV7B 3LRSB 3GKWH 2FECL 3IKKA 2XRAL 4KROC 3H42H 4G6KL 2VL5B 2UZYB 3FQRB 3SDXE 1NANH 5H2BB 1T89A 4P2OD 1H3VA 3F65A 3ULVF 3KGRA 4ONGL 1A2YA 4X7FC 1LO5A 4W68A 2ADJA 3HAEG 4WW1A 5D1ZD 2Y72A 2CGRH 4ELKB 1FNEA 4DKEL 2R1XB 5CIPB 4C4KO 2BHUA 1HXYB 4P59H 3TPKA 3RHWK 3ZTNL 2HWZH 4OF3A 3NFPB 4YDIL 5CJOH 4WI2A 4L3EB 1YECL 1BGXL 3HNTL 1P7QB 4XNZB 4D0BB 1I8KA 4G8FB 4D94A 2ZKHH 3CSGA 3RPIB 4D9RE 5DZOA 1JJUA 3FOMA 1OARH 5HYSA 4RDQF 3VWKD 3MRNB 3P9WB 3NPZB 4G9FD 4NZTH 1MHPL 1LP9E 2IH3A 4WFED 3TBTB 5CEYB 3VXNA 1K4DA 3HPLB 3AFLA 5IK3B 1RQ5A 5M7QA 5D7IE 4QRRB 1AD0B 1W0YT 3DI2B 3MLYL 2XN9D 3TH2T 1OLZA 1KELH 4RISL 3TWCH 3FT2B 1AR1C 3VXUA 2R29L 2HN7A 1CE1L 4JO1L 3TZVC 5IESH 3OR6B 1O7VA 5ADPH 2R8SH 4NKOA 1HQRA 5CFHA 2I26N 4G7VL 3S6CA 2A6DA 2AABH 1JGUL 3CLEL 1MJJA 4NUJB 2F8VA 4P2RD 2ITDA 3UTQB 2ZCLL 4S2SB 4WDIB 1E4KA 1OF2A 3BT2L 2YD5A 2BSSA 5E4IA 1VEMA 5CEZL 4PJ9B 1TZHA 1BD2D 4APQA 3IFNL 4RA3A 1CFTB 5JXAL 3UTTD 1JWUB 4PYHA 3ZKMD 5E9DD 1I85A 3SDCA 3MRJB 3NZ8B 1DVFA 4JHBA 3FQUA 2Y5TB 3QEQA 2VN7A 3K1DA 3UC0L 3B5TA 1F6AB 3GHEH 1ZTXH 2PETA 5HHXL 2AJSL 4ZODA 5DRZB 5DEFA 4XAWL 5EBLA 2YD1A 3QDGD 4E42B 5I75C 4MNHA 2CLZA 2XG4A 3B3IA 3DTXA 4BQ6A 2FH8A 1SHMA 1TJHL 4O2EB 5E4EB 5HY9A 2C9AA 1G7IB 3B9KD 5GQBA 4M93B 4NJ9H 4OZGF 4YZFE 3OGOE 1VGKA 1JGEB 1U8OB 1KOAA 3DMMB 2ENYA 4LQFL 1Z0NA 1X5YA 1YC7A 4KVCH 3UO1L 43CAA 3MCKA 2VAAA 4KRPD 3TN0C 1PEZA 1HH6A 5MEQA 3NBNA 2NLJB 4ZDHB 4OB5L 5LGKA 1ETZA 1TQCC 3HCVB 4OCXL 1KEGL 1NGXA 3ROLB 5I71C 5JQ6L 4D9RD 3O6FC 3R8BB 2UWEB 5JXEC 4X9GA 3MJ9H 5GPRA 2J4WH 5HDOA 3HS0B 3CZFA 4CW1B 3ECBA 4QY8A 2NZIA 3WIHL 1T6WA 4B41A 5I30H 4LEOA 4R96A 4JJ5A 4WFGD 1CTOA 4H88L 5EFIB 1W72L 2AQ2A 2ZSVB 1WAAF 1MAKA 3DROB 1FV1A 1H8SA 3QIBC 4KGJA 5T3ZD 1JV5B 2YPVH 3LS4L 3PP3K 5HHOA 3ARVA 5IROA 3VXTB 4GKOA 1FVEB 5C0BE 5EB9A 4MGXA 2AJYL 4OJFL 4NO0D 4RSVA 1E4KC 5HI5C 3HI6L 4MDIB 3WNOA 4CVWA 3RJQB 4RAVA 1LO3L 3P4MA 3U0PA 5I8EB 5ACLA 2OS7A 1LO2H 1OTSC 1IAIM 2JE8A 4AENB 1C7TA 3RWDB 1UCBL 3RIFK 3GSXB 2Q3AA 4IOSD 2AJ3B 3CLFL 2Q8AL 1QFOA 1JNHB 5D6CB 2MQ0A 1FSKC 2F54A 2EYTB 3HAEB 2VTFA 3NCFB 5IFHH 5EG6C 1IEAB 1WTGT 5F9AC 4QHLB 4UTBL 1M6OB 2M1KA 2JTDA 1REIA 4LHUD 4WFFE 4P46C 3BSZL 4OM1H 3EYFA 3AS1A 3DNKA 4FZ8H 4BSVB 1S9WA 3LPFA 2HN7B 3ZYZA 3EYOB 2P47B 5F89B 4GW1B 3UDWC 1UH4A 1VDGA 3IFOA 3WUWA 1T1ZA 2G2RB 1FG9C 4FQIH 3BPNB 4LCWB 2CKBA 1C12A 5E24E 5K59E 3TJEH 3NN8B 2EDDA 1R3HA 5HGHA 3ULVC 5IHLB 1XCQA 3PP3H 1CWVA 4LCIL 5J06A 4Z0BH 2A73A 4IRJB 2DTSA 2ESVD 4WJ5A 1BEYL 4YHML 1H8NA 3DIFB 1LK3H 5D1ZA 3EFFA 4XH2B 1KCKA 3W2DL 1SEBA 5L7XH 3OB8A 4MXQC 1ZOXA 1CGSL 2WIMA 1TVHA 1PZUB 2GIYA 4JB9H 4Z95H 1CL7L 1YPZF 2DQTH 4I8DA 2DL2A 3BUTA 3FAWA 4GRLB 2XY1A 1KEMH 2WWKT 3G9VA 2IH3B 4I3SH 4ENEC 3PWUB 5L9DH 1Y0LA 3LDBB 4LAJH 2XYCA 2FZ3A 3C2SA 3FO0L 5DEGB 1K3ZA 2BJML 2P44B 4WV1B 4XPFL 1VACB 4JFXA 3P4NB 4HC1H 4HUKB 3VFRB 1DQJB 5KN5A 5CZXC 1OAXL 1FORH 2VZTA 1JZ4A 3IETA 3BZ4B 4R9HA 5IMMA 2GTWB 4LAQH 3TN0B 3PGFL 1WFTA 4OZGE 2A9ML 3FFDA 1E28B 1DUZB 3J7HA 4M5ZL 4O2CA 2DRUA 4D8PA 4UMGA 1U3HC 4KVNH 5J6HA 4W70A 3IJSA 1GGTA 2P8LA 5JIIA 3S4SB 3BQUA 4DVRH 4I0PA 1OTUD 1YMHA 4UQ3B 3C5JA 3TNNA 1BVLB 1CXLA 4GXVH 4OLXH 1MHPH 3O45B 1YDPA 3PXHA 2HYMA 2CDFA 3C8KB 2X4QB 4YZFF 1FNLA 4HLJA 3QQ3B 4YQXH 3UTTA 5AYUH 5IGXL 4KFZC 4AYFA 2HJLA 1W0VA 4M7LH 3GZKA 4UDUA 3MV9E 4X4ZA 3JWOC 4JCLA 2WBJB 1MJ7H 3HCVA 5ALBL 3K8MA 2WBJD 1P7KB 1QBAA 3MRBB 4YHOH 4M61A 4S1QL 1I8MB 4N0FB 4RFEB 3PGDA 3WIIL 3V95A 5INDB 3LN5B 1E4JA 4D0CB 2Y9RT 3NCJL 1JGUH 4HGMA 3JWOH 3T0WA 2A6JB 1IM9D 2QSQA 5ABDE 5B3JE 4PBVC 5EN2B 4YHYC 2BVPB 5GS2H 3VD7A 2BCKB 3SOBL 4M6OL 3D87B 3W9DB 4AQ1B 3D85A 1UKQA 3CU7A 1X6LA 4LL9A 2X2YA 5IOPB 1S3KL 3T08A 4YAQA 3DJ9A 1WWCA 5LJYH 3INUL 3V5HA 5FGCB 3PL6A 3TBWB 5I0ZA 4ZFOL 2H1PL 4HX1B 5ESAA 1TPXB 3MGTB 4NO0B 3WFEL 2ITDB 3BPCA 3H0TA 4HFWA 3W81A 4NWTH 3HFML 1RZ8B 2IPTH 4QF1A 1PJ9A 3RNQB 4XI5C 5D2LF 2ICWB 3VI3E 4RGOH 4XCYA 4CNIB 2IH1B 1C5DB 5JORB 2VOTA 3MC0A 4HCRL 1YEIH 1OAUL 3FB7B 4LBEB 4WTZA 1UM5L 3TVMC 1JPGA 4HIXH 1ZA3B 2R0WH 5D7IB 2VISB 5T5FH 4WDIA 4WCYL 3T4AA 3V7AE 4X99B 1NPUA 3VXQA 3KPTA 3K46A 4NYLA 2DQFA 2AK4B 1QFWM 5F88A 4NZDA 1WTLA 3PGCB 5ERWB 4P2OB 4PB9H 3OMZA 4GLRI 4JDVB 4HWZB 4NN7C 4M1GL 4WNQA 2P5WA 3C8HA 1QBLL 3TA3B 1JYXA 4QXGH 3Q3GB 3ARYA 2AV1A 2ADIA 1Q9LA 1R3LB 1EEZA 2BFVL 3GI9L 2YUVA 5T1LA 4MCZB 3JTTA 1NDMB 4FS0A 1KACB 2EYTA 4N0CD 4P23A 5FYJH 5I66B 2HJFB 4WUKH 4F80A 3H7BB 5B39G 3MLRL 4KPHL 4OZHA 2DYPA 4P2OC 3DGCR 4OZFB 3L7FB 5E00A 1FAIH 5FB8A 4LKXB 1F97A 1J86A 3OL2A 3LN9A 5ID1A 1QUNA 1I1CA 3AMKA 3PWNA 1INDH 3DX8A 3WUWB 4EOWL 1T1ZB 1NUFA 1S78C 3P40A 3TCXA 3OKEA 4MAYA 1CFVL 1YMME 4H0GA 3MGAA 3MLXL 2GQHA 1NDGB 1MUJB 4X0KA 1RZ7L 1IGCH 3C6SA 2BX5A 4IM8A 4MZ2A 1T03H 1IT9L 2JK5A 5HHOD 2WQRA 2J7LA 3KPPA 3UEZA 3P30L 4KK5D 4NZUL 2VXTH 2Z35A 5E5RB 5T5NF 4QGTA 3G6DH 3TEUA 5A16A 1JNHA 4B53A 2PXYA 2C4FU 1PLGL 1BFVL 4Z6AT 3MGOA 4OZIE 4KI1A 4HHAB 1J5OH 3C60A 4H1LG 3QPXL 5HHVL 3JUYA 2Q8BL 3MZGB 3BGMB 3KPOB 4P0DA 1QFUL 1FZOA 4Q6YA 4N9OB 3L3OB 2X9XA 4R2GB 4K23L 2XY2A 4KWUA 3ZHLA 5FAAA 4XVJH 4QRRA 4KZDL 3SKJH 2MQ3A 3I84A 1KGCE 4XP6L 1QVOA 3TT3L 5CINL 1MJUL 4TTGA 4AEEA 2AS5M 3DUSB 2D3VA 2DTMH 3MBEA 2NX5D 3QDJD 1TJIH 4PJ5A 1FG2A 2EZ0D 1YJDC 4GAYA 5I8CB 2DI9A 4JM2C 1LQSR 5KN5B 3F7VB 4XPGL 3VRIA 1Z9LA 3QEUB 3I3EA 4XX1G 5B38G 3LD8B 4JJHA 4YDKH 3TH4T 4FFZL 3EW3B 4I4WB 4IRSD 3RU8H 1RURH 4X6EA 1ZLUH 2ZP0T 2GSGB 3EJYC 1QO3B 3LN5A 3MUHL 1FIGL 1RUQH 2VDQL 4I3GA 2BOBA 1Z9MA 4YDIH 3WBDA 4ORGB 3BWAB 3UJTL 5C1MB 1ACZA 2A1WH 5DEGA 4UQ3A 2VERN 1Y0LB 2GW5A 5D1ZB 3G6AB 4JPWL 1V7NL 3C8KA 3BKML 2O5YL 1TCMA 4KI5F 3VGGA 4XVUC 5D93C 3SE9H 1QLRA 4QNPE 1NGZA 1J8HB 2HFEA 3PQYB 1IE5A 4HJ0C 2V2XA 3DXAE 3HUJA 5DUPL 3G08B 4L1DA 4BZ2L 4X4XA 3X14B 2KUTA 3K1KC 3MMEA 3T77B 4XAKE 4YPGB 1GRWA 4J8RA 3QUYD 15C8L 1UJ3A 3FRUB 1EERB 2BVQB 2O5ZL 4X98B 3CX5J 2Y4SA 3WUZA 3TV3H 2XRAH 3H42L 2BVPA 2A9NL 2HTKD 5GZNC 3NABH 4MVBD 1R3JA 2ADFH 5C08A 2P7TB 1IGJA 4FXKB 1ONQA 3DBXA 4EVNB 1FN4A 3HG1B 5JO5A 1SMOA 4OQTL 1GGUA 3AY4C 1UH2A 5IMOA 1GGCL 5T1MA 2EEBA 3BOVA 4LRNL 3F6LA 5F93C 5EWIH 3WS3B 4TQEH 5B3JF 2BNQD 4MA8H 1NCAH 3CFEB 4HLZG 1A6UL 1BAFH 4P9HL 4L8CB 1Q0XH 1DQDH 4P4KC 4HG4J 3STLA 3NIFE 5FM5M 4OM0H 5MENE 4X6DE 2NTSP 1EGJA 1JPGB 5BS0A 2VDRH 5E8EA 5MHSD 1Q0YH 1WWBX 2W0KA 5C86A 4Y16D 4XNYL 1KIPA 5SV4A 1UCTA 1QFWH 4MB3A 2EXYD 4WNQB 3V4UL 3QXAB 3D85D 3TNMA 3LV3A 1ZT1B 2VZOA 3CU1A 1EEQA 1H3UA 5JNYA 4K3DL 4Z18A 1LEIA 5JQ6H 3SKUD 3VH8A 1KG0B 3BPOB 2IQAA 3D85B 2W0PA 1BM3H 1H9VA 5JA8B 3F6IA 1KXTB 1I8IB 4JHAL 1GAFH 4DJMA 3QI9B 5FO9B 5KSBE 3KPRD 3MRMA 4TN9A 3O0RL 1XGPB 3UYRL 1EXUB 4YHLL 5CS7A 4JFDE 35C8H 4NBXB 1YEHL 4WHDA 3RWIB 1DBKL 1KJ2B 2YPVL 2R0KL 4MWFA 4PLNC 1M7IB 3OWEA 4HIIA 4YEFA 1BFSA 4NCC2 4NKDB 2I24N 2HVKA 5KVDL 5FEBA 4KJQD 4ZFZB 2AJZA 3MNWB 3ILQC 5IBLC 4PJHA 4U6XB 3THMH 1AQDA 1YN6A 4HCRA 3VRIB 2J88L 4I3RH 3KPOA 1XMWA 2AJUL 1FYHB 4MA3B 4KJQC 5JW4N 3C2AH 1ERNA 4LKXA 4WWKA 3NH7H 4M7ZC 4F2MA 2AK1H 2WBKA 3JZ7A 2FEEL 1WITA 1F4YH 1A3LH 4PJEB 3VW3H 3QXDB 3ALPA 2FX7L 4KHXL 2VLME 5J12C 5IVZA 5IMLB 5BO1L 1CFVH 1UKSA 2ARWA 3PP4L 1DUZA 2V5RA 3MLSL 2P8MB 2HFTA 5ANMB 4YE4H 1JPST 1ZV5A 3WLWD 4CUCA 4YWGL 3O6KH 5C2BH 1MFDH 2H26B 4OUOA 3GGWA 5JUEH 3AC0A 2OK0L 2BVUA 4Z7WF 2JCCF 4O4YL 4PJBA 5DD6A 1U8QB 3C6LD 1U8HB 2HP4A 5GS1B 3ARGB 3HC0B 2WUCH 5D9SA 5CP3A 1HHJA 1KYOJ 3H7BA 4G9FE 2AEIT 5HYSB 3NTCH 1A4KA 2DM2A 5D2NE 4G80A 1CDJA 3C6SB 4ZG1A 2NXZD 5T1MB 4OCNC 4ZSOE 1CCZA 4N90D 4NKMB 3KJ6H 4D9LH 5L7XL 4QHKJ 4TULH 3MMEB 4GRWH 3T0VA 4PG9B 2J6EA 2UUDK 3W39A 5IK3A 3BMWA 2DQCL 4UT7L 4FA8A 4KZDH 2OJEA 3VD3A 1A1OB 1SVZA 3V8OA 2GT9B 1I1YA 2Z4QA 1YMMA 7CGTA 4NM8L 4PLJD 4PIRF 4PJ8A 1A1MA 2R1WB 3QCVL 1JK8A 1AJ7H 3NPSC 4FP8H 5DD3H 4P2RB 4JFPA 4ODBD 2E7HA 4O9HL 1ZHNB 2IANE 2DF3A 1I9IH 3P2TA 3EUUA 3JTTB 1E4XI 4GS7B 3UTQA 3WLBA 5FHAL 4ELKA 3HAEH 1CDGA 5D96C 2APWA 2Q76B 3QCUL 3FO2A 3T3PF 5HHQA 2CMRH 3FJTA 4FFYL 1LEGA 2DWEB 5I1KH 4X5XB 3BPOC 3QB7C 7FABL 4PGDA 4WW2B 2VDQH 3SY0B 3VA6A 1AKJA 3S35X 3QJHB 1NEZB 5CGMA 4Z0BL 2IBGA 3L1OH 4LK4A 4XNXL 1MCRA 2Z92B 2E6JA 4QRQA 5GS3A 4URTB 2A77H 1AI1L 2XQYG 3OZ9L 1RUKL 4G9FB 3KXFE 4M48L 5HGGS 4R97C 1CU4L 1U3ZA 1KTDB 3EJJX 5CIPA 3HLAB 2RQ8A 4HFUH 3O6LL 3P4MB 4ZAKB 4ZOBA 4UZGA 3SKMA 1F6LL 4OV6F 4Z7UA 3VJ6A 2AQ1A 3QIUB 3AS3A 4G7YL 2JCCA 4I4WA 3QDMA 4ZUUB 3CVIH 1I1FB 4WY7H 1DN0A 5TQ2H 1CL7H 4N1EA 1S7QA 4I77L 4D0BA 3G04A 5TF1L 1FGVL 1JUFA 4YDJA 3HMXA 5IVXE 5GGSB 2C3XA 3L5XL 3QNYA 4MQ7B 4ZTOL 1IBGH 3T0BA 4L1HA 5FA4A 2XPGB 4K3JL 5F9JB 4DUWA 3KDMB 2PKDA 2YN5A 1IL1B 4MXWL 4LLQB 3U82B 4U1IA 5EU6E 5IT2L 4WO4B 2H32A 4U2ZA 1TVDA 3WJJA 4GXUN 3QNZB 2K7QA 4LMQI 1RVFL 5I1JH 1T83C 3BJLA 1A7OH 4MLIA 4L9LC 4C83B 1AGBA 1FVDB 1NC2B 4HIIB 4LSVH 1GGCH 1L6ZA 5D2NA 5FO7A 4ONFL 4M93C 4LSTL 1GHFL 2QHRH 3TNNB 1ORQB 4PGJA 3EJZD 4S0SD 32C2B 4NZJA 3RVTC 4HPOH 3H9SE 5HY9B 3ZDYE 3KPLB 1TETL 5T1DH 1G7MB 4CAGA 2D31B 3GHBH 4LNVA 1BWWA 1HWHB 2ZUYA 3E6HA 3M07A 2NX5E 5GIRA 3BZFB 5I17A 3QXWA 1HHHB 4PJ8C 5IHUH 3KHOA 2EEDA 3NFPA 1WGOA 1SJVA 4XNYH 5F1SA 4XT1C 3ARSA 5L88L 4BA8A 3BIBX 3D39B 2XICA 3MCKB 2HMIC 3MV7E 3SJVB 3GSNH 5C0EB 5FDYA 3WDHA 5IEHA 5CJ5A 3KPRB 4HUUA 2Z4QB 2YN3A 3ULUF 4HBCH 4NO2A 2GTWA 5C9KA 1JHLL 4OLVL 4PRHA 1PVHA 4MAUH 3W2DH 1XGPA 3B3IB 3DTXB 4KI5C 5IG7A 3AVEA 4XP5L 5I16A 3QI9C 1KCSH 2BNUA 2Q86B 3CFKA 1ND0A 5JA9A 3DPBA 1U36A 5F7FA 3LIZL 4LCCC 3TJHD 2OJEB 1ZHBA 2XN9A 4G3YH 3QUYA 4EOWH 5DJ2B 4QRSA 1PGRB 2P8MA 1DBKH 2BRRL 2XNAA 5C9JA 3HMXL 4RMRA 5EU5A 5D7JA 1IAOA 4JQIH 4OFVA 2H3NB 3RWFA 1RZ7H 5IMKB 3H9SB 2C3HA 1KUMA 2WP3O 2X4QA 4YBHA 4LAQL 1NBZB 4KK9C 3CFJA 4Q9BA 1QSZA 5GS1A 1T4KA 2Z93B 2MOVA 4MJ6A 5CILL 1UM4H 2UUDH 4O02L 1LO0H 4G8EA 4L8DA 3IYLW 5HSFA 4LHUB 4QO1A 4KK6D 4N0RA 4OBSA 3ARDA 3MV7D 1FDLH 1OT2A 3VGBA 3HE6C 3I85A 5FOJA 5D1XD 1XGQA 5IB5B 3SKJL 3WEXB 3MNWA 3ROLA 4LPUA 3HA0A 1GC1C 1LO2L 4DAGH 2AJSH 4JFDA 1OHQA 3CNKA 4OFDA 4KMTL 2FSEA 4GW4B 1HWGB 1NLBH 2CXKA 3ARGA 2DJSA 1PQZA 1U2HA 2GSIA 4QXTA 4ELMF 4JPIA 2E6QA 1U8QA 4U4BA 3SDCC 2VLJD 5BS0E 5F96H 4HULB 1NMCC 4YDVB 3QAZB 1D7FA 4OTXL 4IDJL 3QDGA 5ITBH 3CFDB 1RFDL 4LEOB 4JO4L 3UBXI 2L4OA 1HEZB 3B9KA 1QSFD 4XNMB 2NX5A 4OB5H 3U36B 4IS6B 1KTLB 4JRXD 1CQYA 1ITCA 1JRHH 4UILH 4H1LB 4H8WC 4X5XA 5DA4A 2DWEA 1S7QB 1RZKC 1A02N 4PJIF 3MA7A 5KS9A 1RUQL 2VLRE 2DKMA 2O5XH 4WW1B 4BFIA 3SDDC 1CE6A 3RNKA 5E7BA 1EDQA 3HS0A 4KJYA 3TFKC 4WFEE 5KSAD 4OZ4B 1VACA 4JFXB 4KRPB 5B8CA 3TA3C 3ZTJG 5IB1A 4WJ5B 5FCUH 3W11C 3V6ZB 1QBMH 3CXDL 2OTPA 4QLRA 1HYSC 5JXEA 5IB4A 1A3RL 4XBGB 4I5BA 5CEXB 1ZLUK 1I9IL 4LPYA 1CF8H 2E9JA 5HPMA 4QHUA 5BVJB 4OF8A 1FP5A 5ETUB 5D1XC 3PWJA 1EZVY 4RX4D 5HVFB 3U7WL 4JY5H 5DQ9B 3SGEH 3FOLB 4MX7A 2QEJA 3V6OC 5TDOB 4JZOB 4UNVA 3OAUH 4PG9A 3QFDB 5E2UL 5FV2A 1TTUA 4LCWD 3S4SG 5T5FL 3GBNH 5DS8B 5HYIA 1G7JA 2KH2B 1G7PB 3DXAD 1LNUA 3VXMA 5E9DB 1MCCA 3O11B 1TCRB 2X6MA 2R2CA 3BDBA 4FQXD 4FZ8L 2ZCKH 3BN9C 1XGTB 2YD9A 3TBVA 4JLRA 2VZUA 1MF2L 3AREC 2VNCA 4JQXA 3VFTA 3A67H 3B2VH 3WCYA 2EDYA 5JPNB 3QBTB 1HQ4A 3L3DB 1WIPA 3HI1A 1CQKA 4R26L 4Z5RA 3T0EE 2B4CL 2IAMB 3X3GH 2AGJL 3MTRA 3X12A 2IAND 4IRJA 1WICA 4KTEH 3KPLA 2MPAL 3QDGE 4QRPE 4X7CC 5F7EL 3U30C 2PTVA 3L5XH 3CH1A 4HMDA 4Z7WE 4FQLH 3H3PH 2X1WL 1YEGL 5DMIL 4HAFA 5J0BA 1F5WA 5JR1H 2DMCA 3ARGC 3T8XA 4NRXA 4RMUA 1AQKL 1NDMA 4L9LB 4P99A 1DL7H 3PQYD 2P4AB 4ZNCD 5FUCE 3BP5A 1G9MC 1G9NC 2VE6A 4WV1C 5SWZD 3SKOA 3PXJA 3BI9X 1NBVL 1ACYH 3H0TB 2QR0A 4IJ3C 3QPXH 4Y2DA 1JGEA 2PTUA 1QSFA 1ZEAL 4NCC1 1QFUH 1RZFL 4R4NC 4PRHD 4XC1L 3LMJH 2QSVA 1A1NA 1NGWB 4BQ9A 4EI6A 1QRKA 2VISA 1I3GH 3MBED 1JZ6A 1ZLWK 1FLTX 1FZKA 1R5VB 4UV7H 4RAUA 3DMMD 3TIDA 1L7IH 5IOPA 1FYTE 5EZJA 1N0LA 3MNVB 4XP4H 1V3LA 2OR9H 3BZFA 3UYRH 4U1JA 1INEL 3TZVA 5FUCC 3TC9A 2YEZB 2UYLB 2AK4D 1P2CB 5F71A 3T0EB 3H6JA 5SX4H 4DVRL 1EFXD 4R96B 3BGFC 3U4EB 1P4IL 3QUKA 2NXYD 4JZNA 3NAAL 2ADJB 1A6VH 2O61A 3L95B 1YEIL 4WFFD 4U1HA 5FO7B 1Z9SA 4UT6L 1H3WM 3RL2A 4OZIA 3KPSA 3VRJA 2YD6A 1UA6L 5EU4A 1PFCA 5D7IA 2NX5B 4QRUB 4ZFGH 3BPNC 3HUJF 1CFSA 5SWQB 3B4NA 2AJUH 1MAML 4HPYH 5SWZB 4FABH 2FYYB 5JW4R 1CD8A 4X5WB 5KSUA 1S9XA 2CK0L 2HG5B 1PKQA 3MZTA 1FZMA 5J57B 1ADQL 1MJ7L 1RJYB 3K3QA 5ALBH 2MSPA 5CMAA 1S7VA 3QQNA 5HVHB 4EKXA 3VH8G 1BBDH 3WIIH 4N0FA 1RIUH 3IDIB 3MLWL 3OR6A 3U9PH 4PJBE 4HWEH 3ROOB 2VMFA 3RWFB 5DTFB 3CDGA 4FN0A 1MCOH 4LARL 4G6JL 1Z3GH 1BQHA 2AI0H 5IMOB 3F7VA 4ZUWB 3LEVH 3DV4B 2GJ6D 4BQCA 2EXYC 4LHUA 5LQBH 4OZFA 4L8DB 2VDOL 5DRNA 4U0RC 12E8H 1F90L 4LLYB 3QUMB 4X9IA 1B2WH 5ICYA 3CFCL 4N1HB 5MEOA 1RZJL 4NPYB 4PG2A 2RFXA 2FX9L 2EYRA 3U0TA 3KS0J 3PHOA 2NY5H 3QO0B 5IWLA 1ZGLM 3L3DA 1EHNA 4XP9L 2Y06H 4NKDA 4PJHE 1Q9LB 2X7LA 4FQXB 3BHBB 1JTOA 4IIQC 4Y1AB 3MLUL 3LEXB 1S7UB 1U93A 4OLEA 2GHWB 3RAJH 3D39A 4NKQB 3LS5L 1H5BB 4JLRB 5DJZB 5EULV 3WD5H 4Y5VA 2J3SA 3QCVH 1NGYA 1XR9A 1DBML 3PNWB 2AK1L 2H9GA 2GAZB 5IG7B 4I18A 3UYPA 3VW3L 3PWUA 1A6UH 1DLFH 4L5FL 2NY1D 4M6NL 1B6UA 3B6SA 4J1UB 3RBGA 5HGDB 3WKML 1P1ZA 4AEHL 5K9QI 5HYFA 4N9GA 4ISVB 4NQXB 4Y4FD 4L4TA 3CH1B 3RNKB 2HJKA 3S88L 5HBBA 3O81A 2P5EB 3GM8A 1QYGL 2W38A 5E56A 5B39B 5DURD 1FAIL 1ED3B 4PJXA 3TYGL 3OAZK 2YD7A 1M71B 4HJ0D 1INDL 5I18H 2DYPD 3ZYOA 1JHKH 3O41A 1A4KB 4JVPA 1CR9H 4OUUB 3QP3A 3WFBH 3BKYL 1RV6X 2LTQB 3WO4B 1RMFH 3QH3A 4MX7B 1FHGA 3KR3H 5JXED 3K2UH 1IKFL 3DUSA 5CWSA 2CDEA 1I9RH 3D1MC 3PWVB 1LNUB 5HYEA 2DMBA 2FEEI 2G60H 3MRHB 1J12A 2IANA 4IRJD 1NJ9A 3IDNA 5C07E 5L8JB 2W0LA 4GKNB 1A9BB 1OCWL 2OR7A 5C09A 3FFCA 1AHWC 4MXQD 5EIQA 2FHFA 3FN0L 3SE4C 1GVIA 3CSBA 4NRXB 4WWKC 3HAEA 4OZ4A 4Y89A 3FMGL 2VDPH 4FTVB 5DQDH 4X6DF 1LEIB 1YQVH 3IU3A 3L9RB 2M8XA 4PGCA 3RL1B 4AG4H 4KRMB 3AMLA 4PJ9C 1FFRA 5KVDH 3RGVD 5I1JL 2RHEA 3JWDL 5H94A 1B0RB 3BFOA 4XPAH 3ULSB 3FRUA 2G2RA 3VFVA 2LABA 1FGNH 1CIDA 3FQTB 1JHTA 3FRPA 3OKLB 5IR1A 1KPRB 5F9DC 1GOGA 5EC2B 4AIZB 1FV1B 5MERB 3WN5A 2FNBA 3SKNA 4MNGE 1HH9B 1R3IL 2V6HA 4M48H 1G9ML 4JFEB 3FN3A 1KN2L 5DYOA 5DO2D 5DVOA 2XZZA 3RWHA 3WS3A 3ZKND 1VFMA 5DJ0B 1UWGL 3O3BA 5HGBB 5SWSE 4MNQA 2EDEA 5EU6B 1JUFB 4F7CB 1S9VB 1LEKA 1MCEA 4FXGA 1S7XB 3U48A 3W0WD 1YA5A 1UZ6F 3SDDB 2BNQE 4LSQH 3IDXL 4HBCL 5EO9A 1NCDH 5ACZA 5F88B 4HJJH 4P5TA 5BMFL 1X5AA 2YKLH 2YRZA 2KZWA 1AP2A 5KG9A 1FL6B 1F8TH 2GJZA 1LO4L 4NO3A 5AEAA 4PGBB 1S9YB 1KIPB 1L7IL 1ZWIA 3IJYB 2BMKA 2DN7A 3WL9A 2OR9L 4D9QE 2NZ9C 1G1YA 4U49A 4NM8H 3OKMA 4MHHG 2BOCB 2J8UE 4N9GB 3LQMA 3OXSA 5HHOE 1EO5A 2O93L 3O6FD 1JNJA 1U3YA 2HJKB 4OGYL 3RIFF 4ZUWA 2QHRL 2DM4A 3Q5TA 4NWUH 2YPLA 4ZUSA 1S9WB 4LVHC 4HPOL 4NKMA 1FNGB 3V6OE 2VH5L 4UDTA 4BELD 1F3DH 1U6AL 3E8UH 3FO1A 2DOCA 4GG8A 5E7FA 5E94B 3LY6A 5FF6B 5HI3D 3SDAB 1EHXA 2OCFD 3OKOB 2CGRL 1AXTL 2P45B 1HKLH 2GAZA 4IRSC 4W6WB 2DLFL 3VGEA 2C1PA 4LRNH 3FFCE 2NY1C 2QADC 5BW7C 4BSWB 1T7WA 2FHCA 1U91A 4PJFF 1UEYA 5D93B 4HV8A 3ZKQD 4PRHE 2P43B 3LD8C 4LIQL 3L5HA 3O8XC 2XQBH 5IIEA 5SX4I 1NFKA 2VDRL 4BYHA 1CU4H 3K81A 4NJAL 3AXLB 3GSVA 2GY7B 1F58L 5D70L 5JZ7C 4S11A 3C2AL 1G7QA 4TUOB 5I1DB 2N4IA 4QYOA 2ESVA 1RFDH 4JDZA 3VFMA 2Y6SD 4ZOEA 3P4OB 1A3QA 3BKJL 4NHUB 5K33A 4F33A 4ZXBA 3G6JB 3BEVB 4PJAA 4X5WA 4YUEL 1BJMA 4NGHH 3LQAH 4FXLA 2JELL 5DHYA 1GIGH 3MNZA 2W91A 1EGJH 1BQHB 2VSDA 1EO8H 4ONOA 5F8QC 3X11A 1IQWH 4F9LA 4G43A 3H9YA 2QQKH 2Q20A 3Q6FB 1ZS8B 3O9WD 3BT2H 1A6TB 2XFXA 4IRZH 4PGCB 3RL1A 4CW1A 1U95B 5D5MB 3NIDF 1NFIB 1F13A 5DD0H 4Z77A 3W5MA 4Z7VF 3NTCL 5DR5L 4F58H 5IB3A 5IJVA 4YXLH 3MRIA 1C5BL 2EH8H 2ICWA 2DQCH 4UT7H 1I1FA 2WWMC 2F5AH 5DDHA 1CGVA 4U1SA 4DOHE 1H5BA 4ZS7L 2ADGA 3WNKA 3UJIH 1B9ZA 5C0NC 1SYSA 1UM6H 4LKCA 4U1LB 4P46D 4WWID 1JMXA 2HT3C 4I2XA 4F3FB 3CFIC 5IW1B 3GUTB 1KB5B 1OOAA 3P9LB 5KW9L 4RISH 1A3LL 3ESVF 4JFHD 3G6JE 1FL3B 4HIEB 4XGZA 4ZOCA 3VDBA 1FAKT 3QO1A 2YC1A 1B0GA 2EDWA 3HLAA 2NW2A 4CN6A 2AABL 1SJHB 3RWGA 2IC2A 2Z93A 4YO0B 2HJFA 5JW5B 5J4MA 1GPOL 4HMEA 3RUGA 5ICZA 4YX2H 1G0YR 1YC8A 3L3KA 5JOFA 2PO6A 4KK8D 3OKNB 2CLRB 4M8QB 1U2CA 3KPPB 5L2JA 3FO1B 1MI5A 3O2VL 1BZ9A 4K3EH 2EDRA 4GLRH 2XTJB 3HG1D 1ZVSB 3HC0A 3DV6B 3ARDB 1DQQB 5CSZB 1A7PH 2H6PB 4YC2B 3EYUH 4EJ1C 1W8OA 3O45A 1P4LB 1NKRA 3MLVL 1UYWL 1X5IA 5DWUL 3P77A 4Y88A 2F5BH 2FIKA 1UH3A 5ESQA 3WLBB 3B9VA 1YQVL 4EI5C 1IGFH 2AW2A 3QZWA 1J88A 3FB6B 2PYED 3O2WH 1AE6H 4GKSB 3RPKA 1NGPL 5HDBF 3UJJL 4IMKC 3T1FB 3BGFB 1JF1B 5I6XB 3CMOL 4Y4FC 1KNOB 2ICEB 3WNNA 2JIXA 2ZCHL 3K7UA 3MXVH 4ONHB 1S9KC 1IBGL 1D9KB 1S7RA 5ID0A 1FL6A 1AP2B 2ARJA 3UMTA 4APQD 1A6WH 1RZFH 4QNPF 3EO0A 2ZCKL 4KJWC 4PRBA 4M3KB 5ICXA 4LEXH 1NSNL 3NZHH 2IQ9H 5C0CE 1KYOK 5GGRA 2HRLA 3WL9B 3LAFA 1P84K 3M1BA 1PSKL 4XRCA 3NCYP 5EU3A 4WTWA 5FK9A 4JPVL 2MCG1 4HUWA 1IM9A 3QDJA 3I9GL 3Q5YA 2AV7A 2PW1B 3GJFK 3QI9A 3QRGL 1NL0L 5GXBB 1OSZA 4QCIB 2ZOKA 3MJ9L 4QXWA 5F1OB 1AHWB 1D5BA 3EYVA 1FNGA 4GRWE 4R26H 4I0CC 4M03A 4JFEA 4KKAC 1RUKH 3LKSB 5DZNA 5IM7B 4XX1E 1HILB 4OLUH 1AGEA 3QWRD 3QIBB 1JHTB 1FVCA 1W72B 1YN7B 5ADOH 4ODWA 4BH8A 2Y7QA 4LBEA 3O6LH 3VI4E 2Y6SC 5TQ0L 4UILL 2DQHL 1GGBL 5EZIL 2R1YA 5JR1L 4OSUL 1RIVL 2HRPL 1QSED 3GSRA 2LTQC 4GJTB 3QQ3A 3DYPA 3DO7A 3S37H 5E5MA 2X4RB 4WUUA 5TQ2L 4Y5XA 2O5XL 2Y23A 1W0WA 4QWWD 2HH0H 2BNQB 3STBA 4K71C 4HXBL 4NM4L 3NCCB 4GAGL 1P4BL 2YWYA 3QXUA 1D9KD 2VLKB 5DFTA 2D4FA 4ZFOA 2EE2A 3HE7A 2ZUQB 2VLRD 4MAUL 4EN3A 1PAMA 3P3YA 1Q72L 2H32H 2PW2B 4MJIA 3O6FA 3VMNA 4AK1A 1BBJA 3BDYL 4BKLA 1MQKL 2OP4H 3PJSA 1TZGL 5A2IH 4FFVD 2HKHL 2WSKA 3BAEH 3HNVH 5JDSB 4ZPVB 3CFCH 4OD1H 2PR4H 3TYFA 4O58L 2V5YA 4Y16C 4TSCL 3UYOD 1PX4A 3HMXH 3L5WB 1X5FA 1AXSB 2EIBA 2FX8L 4CMMB 2DQDH 5GJTL 3RTQC 5C0JA 1R3JB 1I9JL 3G5ZB 1HNGA 4XP9H 1DEDA 4GW4A 3S34H 4DGVH 1R24B 5LKNA 3CFJB 4R2GC 1YEFL 5D7LD 1KCUH 2X1XR 1J87A 1BEYH 1TETH 1ZT4B 3HR5A 4IIQB 1FO0B 1JF6A 1NC4A 4LF3B 4QOKE 4ZUSB 4BSWA 5LWYL 1KLFA 5F7UA 1YPZE 4MJ5B 3NIFF 3CVHL 1EMTH 1ADQH 2YC1B 3QO1B 4Z0XA 3I2CL 1XIWC 4Z95L 1LP9F 4P3CH 4LLMA 1IQDB 5E9DA 1DLFL 1FC1A 4NO3B 3B43A 1MELA 3OV6A 4QOKA 4TPRL 4DAGL 3OB0K 5EU5B 1KF9B 4P46B 2NY1B 4HUVA 3LQAL 4KMTH 4OLVH 1WF5A 3A6OA 4IRSB 4LOUC 4JGJA 4RRPA 3UTZA 1AGCA 3QUXD 1IEAA 3S88H 4GKZA 3VWJD 5J8OA 3BP4B 4MA1B 3T65B 3BZ4A 5TE7L 2IMMA 1HHGA 3MV9B 3EKCA 2ZJSL 2FD6L 1C5CH 4MS8D 4C57C 1KELL 2FECI 1J10A 3VD9A 2VDNL 3QWQB 1OWWA 4GW1A 5DJAA 3MRMB 1B0GB 5FYKH 4Y4FA 3MUZ1 3BP7B 4X98A 4I48A 5IB3B 4KVNL 3SDAA 4X9HA 4K7FB 3EDJA 4HKZB 5FM8A 3QR2A 2CLVB 3OGCA 3D0VA 2EC9T 3LMJL 2IPTL 2CDGB 4YXHH 4JKPL 2J6EH 3R1GL 5I8OL 3T1WA 4JCMA 4R2GD 3EYQD 4AEFA 4HDIA 1ITBB 1IKNC 3I6KA 2BERA 5TDNA 3L3HB 1LO0L 3DIFA 1A47A 2YD8A 2EIZB 5GGVY 4NQCD 3CPLB 4NQDA 4ALAL 4OZHF 2GUOB 4IMLB 1TQBB 5DC4B 4K7PX 4P2QA 3TVMB 1OT1A 3CDFA 3EJYD 2CRYA 4EUPG 2Y5EA 3WNMA 4XPTL 5C92A 1MCPL 3MREB 1B3JA 2P49B 4KK9D 4LNRB 5H35B 4QHLA 4JY5L 2EXWC 3BJ91 4LP4A 5C6TH 5MEPB 3PIQA 3BQUB 3BP6A 4NNPL 3GO1H 4PJ7B 4XPAL 1C1EL 4QRTB 1G7HB 4WI7A 5ANMA 2P5ED 4UU9B 3EOAB 5ISZE 2VUOA 1ZA6A 3TO4B 1MI5B 1RPQA 2R1YB 3MRCB 1T0MB 5LBSH 5C0GB 4H25B 4PJCB 1HYSD 2NY7L 2EE9A 3QXVA 3SO3C 4TUKH 1U9KA 3RWGB 4EVNA 4OF0A 1JNLH 5C6WH 2R4SH 5DJ6B 2VLKA 3GK8L 5GISH 2A0LD 2ZOKB 2I9TB 3GSUB 1N3NB 4J2XA 1UXSA 2V5SA 4JZJC 3HZMA 4JREB 4ZFZA 1XF2B 4KKAD 3GJFH 2IADB 4PJ5E 3BVNB 3JSSA 1A7QH 2VIRB 3L95A 2ATKA 3VE0B 1IGIL 3T3MF 2NTFA 5ICXB 4ODWB 2HAZA 1RZJH 3LVEA 2GK2A 2AVGA 2PO6C 1WJ3A 4CL7A 4PR5B 1C08B 3IU3B 3L9RA 1CF8L 3HTLX 4PS4L 4OLWL 3OJDA 4F7TB 4ISVA 4PP2B 2NYYD 4KV5E 2P42B 2B8OT 3U7YL 4JM4H 5CD5D 5E70A 1OSZB 1IQDA 4XP6H 4LFHD 5C0BA 1JNNH 2F9BT 2OR8A 3GI9H 1MCIA 1YY9C 5C2UB 4KUZL 3QZWB 1FGNL 4CNIA 5EZLA 1SEQL 5EBMA 3V5DA 3QRGH 1I85C 3QPQC 4GG6F 4RMWA 2R39A 4UTBH 1HHGB 1FO0A 1ULVA 3F58H 5FA3B 4JHWH 5EIVA 5EIIA 5B4MC 2JF1A 5I15H 1BECA 3LKQB 4AT6A 1HDMB 5J9PA 4MQXD 3W39B 4PRNA 5I8KL 4FQXA 2N56A 3C09B 5CEZE 1MJ8L 2LE9A 4PJHF 3L6FB 4DCQB 3KYKL 3KPRE 3O3EA 4JQXC 1D5MB 1HINH 2Z91A 5C0DB 4UIKL 5I76B 4NQEE 3TCLB 1G6RA 1A1MB 5HGHB 1ZMYA 2VXTL 2YR3A 5L6YH 3GJFB 4HXBH 4YHIA 3G6DL 3MJ9A 4E41E 4Y1AA 4M1CD 1N5AA 1NC4B 4LF3A 4MJIB 4H8WL 4XHQA 4Z7WA 1I8MA 4M1DL 3BKMH 4BZ1H 4MS8C 3EIFA 3UZVB 3CK0L 3BKYH 5HHOB 1OSPL 2XTLA 3VJ6B 4I18C 4CDHA 1DLHB 3QUXB 3QDMD 3WXVL 4WO4A 3ZE2E 2I60H 4LLMB 2FIRT 3HZKB 3CC5A 4NO5A 3AY4A 4N1CA 4C58B 4OCRL 1CICA 2NW3B 4AENA 1ACYL 5DD6B 1NAML 2JELH 4U6YA 2K1MA 2GI7A 4GRWB 2VLJE 3C08L 1MCOL 4LARH 3WFHB 4DUVA 1BQLL 4JFFB 1T0PB 2O61B 3O3DA 5B38B 5DMJB 3FMGH 2VLJA 5ICZB 1A0QL 3C87A 1A9EB 5ITFB 3LEYL 3CDYA 4QF1B 3HKFA 4WGWB 2D4DA 1DSFL 4PD4K 3ARZA 1P69B 2X1OA 2QSCH 2NPLX 4JVWA 1IGYA 4M5ZH 4LLYA 1IC4H 3MA7B 5KS9B 1X4ZA 5BRZA 3FOMB 5IVXB 3WFDL 5FYKE 4YXKH 5I74C 2R9HD 2DS4A 3IJSB 2XA8H 2X89A 3B5HA 4F7EB 3QWOB 3MCG1 4XWGL 5HHNA 1ODAA 5I1HH 3MV8B 1BOYA 5BXFA 4KXZH 4YK4C 1KC5L 3ZT7A 2CO7B 4LHQB 4TNVF 4GXVL 4PPTA 3O8XA 3BN9D 5EOTA 2IANB 4G5ZL 1Q38A 3SGJC 4E41A 4ODTL 2J5LC 5EUOA 1SJXA 2ZUTA 3RVVC 3SKMB 3S35H 5I73C 1URLA 4NQCE 5DMGC 4ZFOB 1S7RB 3V52H 3DVNB 3DRTB 1MWAH 2I07A 3MREA 1G9NH 1OP3K 3RWCB 4HKXB 4NQVB 4I48B 5IJKC 3QIWB 4MNHB 4HUVB 2V9QA 4B7IA 3P9MB 5FYKD 1SY6A 4NGHL 2BSTA 2OL3A 2XOTA 3PWPE 4M7LT 1WEJL 5EOQH 5D71H 1JI2A 1HXMA 3JWOL 3L3HA 3ARQA 1EFQA 2X05A 4PJCE 5BV7L 2CIKA 2DQEL 1BVLA 2QQKL 3KYOA 3LEVL 4XVTH 3QJFB 2J6EL 3R1GH 5I8OH 3T3ME 4FQJH 5D1QC 1VFAB 1NBZA 4P23D 3P0VH 4UBDD 4JG0L 2FJFB 1P6AB 4XZUA 3QUMH 3TVMA 3RZCD 1RK1A 4YHLH 3QUZB 4CVXB 1RZIB 1LILA 1YUHB 2ZUSA 4MMZC 3WFEH 4F58L 4RQQB 1N3NA 3CLEH 3GSUA 1X5ZA 3IFPB 4Y4HC 4O2FB 4HT1H 4XPTH 2GJ6B 1MCPH 2KBGA 5C0AD 4OZGB 4DZ8A 5LG1A 1NCBL 2B4CC 2M26A 4KY1L 4LLWB 5LAXB 3RPIA 4QHNA 4CKVX 2XA3A 5KAQF 5DQJB 1Q9WB 4K7PY 2MKLC 4A6YB 1BREA 5C0GA 2ITCA 1L9NA 1XF4A 1GZPB 3ZKXB 3QHTC 5HYSG 4CBPA 4MQSB 4KJPC 4F7MA 8FABA 4AM0B 1OP5H 1AD0A 2V7HA 3Q48A 3QIWD 2CUHA 4ODHH 2VLKE 5ILTL 3X14A 1U8IA 2YUXA 5DJ2A 4XNUH 4RMQA 3K8KA 4U0RB 1QBLH 1WV7T 2EDKA 4S2SA 2NW2B 1PSKH 1MRCL 3AB0C 4X6CF 4ORZC 1OL0A 5K9KB 1BWMA 6FABL 4LCYA 4G8GE 4L3ED 3O3BB 1X5XA 2F58H 2UWEF 4Z9KB 4ELMB 5CJBA 1Z5LB 1JV5A 3TBSA 1ED3A 4PJXB 4HXAL 1CE6B 2L7UA 3QISA 1L0XA 3QHFL 3SGDH 3WS6C 4HUMB 4X6BA 5CAYB 4U6HB 5EO1A 1ORQA 5E99H 5B22A 1CVRA 3KPNA 4OLUL 5HVHC 3NN8A 3LKRA 5C9JB 5E2VH 1RSFA 1BD2E 3ES6B 4U1SB 1E27A 4CRPA 4OIAA 1T3FA 1D6EB 4XBEL 2LU7A 3CD4A 5FHBH 4NQSA 3ULVL 2BC4A 2V2TA 5D7KE 5GHWH 4R97B 3QT2A 1IAKA 4NZUH 3HZVB 4PUBH 3MV8A 4XNZC 5F6HI 1QG3A 2F8XC 1OP5K 3QHZH 4NM4H 4YDVA 5BJTA 1T5XB 4Q9RL 5T1KA 2B2XL 4Y1AD 3KWWA 5EO9B 5C07A 5KS9F 5JXAH 3TIEB 3MA9L 3MXWH 4BQ8A 1RZKL 1U8MB 3QDGB 1OQXA 2Q8BH 3AXLA 4OQTA 1YYML 3DVGB 1LO4H 4KI5E 3ZYJA 1PZ5B 1G7IA 1SVCP 5HPMB 4IS6A 2FWOA 3RRQA 3EHBD 4MDIA 3V2AR 3UC0H 5DHVB 1NSNH 3NZHL 2CRMA 1I7TB 3JWDH 4Z8FL 2O26U 1KFAH 4PJAB 3PHQB 4K94L 3SCMC 1XR8B 4N68A 2DIBA 3KS0H 4FFYH 3RGVA 3ZSTA 5HHPA 1HINL 4PJXE 3TVMD 1FG2B 1MY5A 4TOYL 1CG9A 5DLMH 5F72S 1MHHB 1CBVL 3GBLA 1KPRA 5GGTH 1JPSL 1AO7A 1MIML 2VH5H 3GSVB 1OAQL 4GG8B 4QRRD 5FF6A 2DIJA 4LDEB 3VXPB 5DZLA 1KTLA 2QTEA 2FJFA 4Z7VB 2F54D 4FQIL 1XF3B 3L3OA 1GYAA 4K71B 5JPNA 4NQCA 3K4DA 4TVPE 1K4CB 4OSUH 4X5LA 3VFWA 5HJ3B 4ODUA 2BVYA 1FPTL 3ARBC 3WXWL 1IT9H 1I8LC 2EH7H 3QQ4B 3DI3B 5HHMB 1KCVH 3NFSH 2NW3A 4WV1A 3HPLA 2PNDA 1PQZB 2GSIB 3P73A 2X4UB 1JWMA 2X4TA 3Q0HA 5A3IC 5LXGL 3PL6D 4KC3B 3U0PB 3F62A 2C3VA 1D5MA 5C0DA 1OB1B 2CLZB 4XGZB 3VG9B 1WQVT 4JFPB 2AXGB 2H9GB 4FNLL 2DM3A 2WM0A 4NO2B 4UDTB 3M1BB 2VQ1B 4RGMC 1E6JL 4PTTA 3SE9L 3MRGA 4L8BA 3GMNA 2LVEA 3VFNA 1TVHB 1FFOA 1AC6A 4P4RA 3HI6H 1IGFL 4Z7WB 3T3PE 3IJHA 2XKNA 4HC1A 4JB9L 4PRID 1AE6L 4OLYL 5EFIA 4XCNB 2RCSH 1MJJB 4NUJA 3RIAF 3UXFA 2AAVA 3OG6B 3HNVL 4I3SL 3VFSA 2Q6WB 3VU2A 2DLHA 2CMRL 1CGXA 2Q7NA 1TMCB 1YY8B 3P0GB 1DE4A 4P4KD 3MRIB 3SEPA 2NNAA 1AGDB 1DBBH 1A7RL 3MRRB 4YR6A 3WSQH 2Y7QB 3U0WH 2UWEE 2CLRA 4M8QA 4J4PA 5FUOH 5JMOC 3TGXA 2P5WD 1CT8B 3G9AB 5KVGL 1KBGH 5GRXG 3VXRA 4XXCC 2B1AL 3UPRB 4GAJH 1U95A 1J8HA 3SCMA 4M00A 3DRQB 4PJFA 4M61B 1H0DA 5DR5H 3V52L 4UQ2B 2B5IB 1QA9B 4FQCH 2VYRE 1BVKA 1FL3A 3GJEA 5L0QB 1MCBA 5CP7A 3S9DB 5J11C 4P3CL 4F9PC 5F1IA 1H15B 3ARBB 1KLUA 3RL2B 1FNSL 3FT4B 1BJ8A 3DURA 4JG1H 5L8LB 1DQLH 4PJ8B 3CFBA 1JPTH 5F9OL 3QQ9C 5GS0D 2OZ4H 3ET9F 3BQUD 5JOEA 4Z78A 1IEBA 1CGSH 5IB2A 3R8QA 2NR6C 1S7SB 3MUY1 2ZJSH 4K94C 4N8VB 2YEZA 2AJXH 3MV7B 3MRBA 2JLLA 3P0VL 3O3DB 4JG0H 1CGUA 3TJHC 2ICWJ 3VFVB 1OARL 1HQ4B 2FJHA 2NY7H 3QUML 4NHUA 3V6OA 5JHDD 4JO3L 1T1WA 5DD1H 1FYTA 5JW3L 5EN2A 5JHDA 4X7TB 1K5NB 1IARB 3NABL 2X9YA 5IV2B 1A6ZA 2EKSA 3FQNA 3WHE0 1EEYB 5D2LB 4NDMB 5ESVB 2AEQL 3EBAA 5TGBA 1ZVSA 3O0RH 2HKFL 4Z7UF 3QIBA 4GUPB 1YEEH 4D0DA 3UPAA 1T6VN 5E8OA 2CDFB 5DXWA 2YRPA 3MJ7B 2DJUA 3UAJC 1X9QA 2R0KH 5DWUH 4U7MA 3ULUE 2R2BB 1J0HA 1XT5A 5HHQB 5TJWK 3FFDB 1NUDA 3Q1SH 1Q0XL 1AGCB 2D9QB 2BNQA 4XI5D 4P57A 4HWUA 4KAQL 3R0MA 4IBLT 3RGVB 3GI8L 5L2KE 5CBAA 4PY7B 4HUWB 4QRUA 5HGAB 3VRLE 3RVTD 1UM6L 4DK3A 5K9JH 2A38A 3AU1B 1OP9A 5DI8B 4EZMA 4G6MH 2CQVA 1OD7A 3GSNB 1K9TA 1NBQA 1XR9B 3U2SB 3DSFH 4PJGE 4YGVA 1DQTA 3MRQA 4HS6B 2A73B 3G5VA 5IGXH 1RJLA 5F96L 4BH7A 3SJVD 5DJXB 3EO0B 1B6DA 5DRXB 1JFQH 1MFAL 2LAGB 3MACL 4ZAKA 4YGAB 1A1NB 1GOFA 4TRPL 2IQ9L 4P4KA 1KPVB 3OGCB 4PGZA 4QRSB 4HIHB 1CICC 3TBVB 5SWSB 2AQ3A 5BO1H 4O5LH 4JFFE 2BFVH 3HN3A 5GGUB 1XEDA 5EZJB 1JRHL 5BJTB 4QXUH 4U1MB 1JWMB 2X4TB 5DK0B 5FHBL 1JTTA 5IHZB 2YZ1A 4U1NA 3WNPA 4LSSH 1C5CL 3H9HB 4Y5YB 3BWUC 1A21A 2XKNB 2W65B 2QSTA 2WUCL 2ZUWA 35C8L 1MCNA 5IBTL 1G1CA 3O8XD 4ZPTA 5CSGA 1S7WA 4E41D 3SE8L 1T1XB 1VKXB 1FL5A 4L4VB 2LV4A 1WWAX 4WI8A 4WTZG 3E3QE 3IB4A 2H45A 1BZQK 2N7BA 1Q9KA 2IALA 2BY1A 4H26A 2DKUA 1QEWA 4XNQB 4N0CC 2XZCL 1M7DA 4CADB 3HE7C 4PRIB 4OCSH 1FE8H 1KV3A 1MFBH 1NGZB 3KYAA 4R7DA 4NNXA 1FCCA 3R0NA 1LMKA 4MZ3A 4JREC 2MHAA 1I75A 3HR5B 3BEWB 3RP1A 3WN5C 3G5YB 1AY1L 3BUYB 1VEOA 1QLFA 2MQCA 2C1OB 3MBXL 3H9ZA 1EBPA 4UB0H 4PJAE 3OXRB 1VFAA 5FO8A 1CDYA 2QSCL 4HG4K 4TSCH 4ZPVA 4KTDL 2V5MA 2GCYA 1T80A 4KPHH 3L5WA 2CLVA 3CDCA 1D5XB 1ZHLB 1QLEL 3WN5B 1YEKL 1EK3A 3T2NH 4FTVD 2Z92A 5LXGH 1QTYT 2R2EA 1IAKB 3O9WB 4RWYL 5EO0B 4HUXB 5BVPL 4U1HB 4OZIB 2BY0A 3QFJB 2PW2A 3LSOB 3CK0H 2YWZA 4LHUG 3RZWA 4YPGA 3IAGC 2BOBB 4YK4B 1QACA 1IGCL 3F5WB 5KSAA 3ESUF 2ZG2A 3CCHA 2FO4B 4Z7QF 1HCVA 1N8ZB 4Y5XB 5I1CH 1FZJA 2SEBB 5H35A 3W0WA 1QP1A 4JN2B 1XFPA 4P5MA 3MOAH 2G9HB 4HQQH 3MRRA 4OFKA 1C16B 3VD4A 2CKBL 3AU1A 4GH7B 5DI8A 4FP8L 1QKZH 4XVSL 5CBEB 2XZAH 2BSSB 4QEGA 3JV5A 1NCCH 5IQ9A 2OJZH 1T7XA 3RIAK 3MRKB 2RR3A 1A0QH 3TNMB 1B88A 3LKPA 1I3GL 4EDXA 2R2BA 3ZDXF 1A7NL 3LKNB 1TZGH 3L5IA 1MJUH 2JKXA 3ZE2F 1F3JB 2ZPKL 3HC3H 3UDWA 2YMXH 3GMNB 4O58H 4K3GA 5DMKA 5D4QA 3VXMD 3B2VL 4KUZH 4E0RA 3PWPA 3VDCA 4YR6B 1OPGL 1TZIA 3U4BL 4RFOH 4EQ3A 1DN2A 1U91B 4NP4H 2NY6C 1D6EA 1ONQB 4NFCA 5EBLB 1CIUA 3PF2A 4M4PA 4HKJB 1T7VA 5DYOB 1JGLL 1XGRB 2OTWB 5I2IB 4UT6H 2DQJL 1HOCA 3R06B 5F9OH 3H3PL 4HFUL 3QIUD 3S5LA 1FJ1A 5JHDE 3SPVA 5IFJA 2FJHB 1SQ2N 5KSVA 5I17B 3T1FA 4UIKH 4LLDA 3KPSE 2V2XB 5DQ9A 1MRFH 2COQA 1XIWA 1NAKL 3CMGA 4QRRE 4PJFE 3NA9L 4E9LA 3LQZB 5CD3B 1F00I 2W9EL 5E00B 1WEJH 1G6VK 1N6UA 2CIKB 3G5VB 4KGLA 2ICES 4XP5H 5FGSA 3OKOA 3ABZA 1MOEA 1TCRA 3IFLH 4KHTH 4OZHE 4X9FA 2HMID 4NKOB 3V4UH 4HAGA 1WBZB 4YHOL 1DFBH 1NDGA 1I8KB 4G8FA 3BPLC 4Y2DD 4L3EA 4G3YL 1UB5B 2WWKO 3O3AA 2IBZX 1F11B 1TVBB 3K80A 1QRND 2WBWB 1NAMH 1TTFA 1N5AB 3TV3L 5E6YA 2P5WE 4J3SA 3F7PC 5LVEA 3WJLC 2DIAA 2QQLL 3V4PL 4JQIL 3WO3B 2VN4A 3I50L 4NRZB 4JHAH 1FRGH 4UOW0 1UZ6E 4XBGA 4MA3A 2KQMA 1KULA 5GGRY 3IDYB 5GSRB 5T1DL 3BZEA 3BH8A 2I07B 5CILH 2W9DH 3FQNB 3JXAA 4POZC 3DSFL 4KJPD 4RAUB 4FQXC 1SBSL 3FQUB 3VFMB 1C08A 5EOCJ 4NC1C 5JIKA 2UV3A 2E7CA 4OF7A 5EIIB 4CU7A 1A5FL 1MLBB 1U8JB 3WDIA 4J3WA 4QRPA 2CO6B 1F42A 4MB5A 3AS2A 4UUJA 5ITFA 3N1MC 1MFEL 1XCTB 3CDGB 1EAPA 1JZ3A 1IAIH 1OF2B 4WCYH 5DEFB 4JPKH 4S10A 5E6ID 3A0OA 5D5MA 3TO2B 2CD0A 2AI0L 4ZUVB 4ZFFA 5ITBL 1JGDB 5L8KB 2ED8A 1AD9A 1JPSH 3STLB 5JOPD 4ZYKB 2EDBA 1ZANL 5EC1B 5KSBB 5IBTH 3TA3D 3F5WA 1H3PH 5KSAB 1RHHB 3UTPD 3KLSA 1UADC 4LSRL 4PLJC 2R0ZH 3L7EA 3D2UD 3KNBB 4PRPE 3X11B 4MYWB 3RUGB 4E42A 4R3SB 4NQEA 3V6BR 5E08H 5BV7H 2EH7L 4XPHL 3QCTH 4OLZL 2G5BB 1B0WA 3HZMB 4HS8L 5B21A 1U41A 2FO1A 4PUBL 2D0GA 1E0OB 1YYLH 3ARPA 5INCA 4XCEB 2BHZA 3RAJL 1IGIH 4JEGB 2VLLA 3FTGA 3VFRA 1EUUA 5IHZA 2H6PA 4OCWH 1RZKH 3V79C 5EPMB 3IDUA 3TN0D 3I6LD 4JAMB 1TTGA 3OB0H 3MLPA 2VE6B 4GT7A 1ROWA 4FOMA 4DWHA 1BOGB 3IDMB 4YHNA 3TM6A 1NGQH 2VLJB 4D2NA 4R7NB 4NUGH 4DKFL 5H8DA 1EV2E 2FBJH 1DZBA 3U7YH 1IEBB 2IAMD 3T2PA 4BUHA 1NCBH 2F8OA 4OLYH 1YMMB 1RUAH 2FLRT 4HKBA 1BD2A 4POUB 2EDLA 5D6DA 1WWWX 2XWTB 3AREA 1RJZA 3BP4A 5I76A 2MHAB 2XTJE 1D5ZA 2GTZA 3AUVA 3FAXA 4YDLC 5KS9E 4O51B 4OTXH 2AXFA 1MLCA 5KAQG 4RQQA 3U0WL 1J7VR 1DCLA 1F3JA 2WK2A 4EUPA 3Q5OA 3VGDA 5DHXB 1MRCH 4Y16A 4GAJL 1NMBH 4PD4J 4Z76A 3T04D 1MNUL 4QHUB 3W9EB 4H5SA 4LCWA 3WXWH 1DQMH 3MQIA 5I1LA 2AERT 4HDIB 3N85H 5CJ8A 1TJGH 4OIIL 5HGDA 1HE7A 5GRZA 2FHBA 3K2UL 4KKLD 1UXWA 4OGAD 5FOBA 3C6LC 3PL6B 4WFGE 3TBWA 4S1RL 1MCLA 5DS8A 4KK5C 3GMRB 2AXGA 3RU8L 3OTTA 1M6OA 2CKBH 5CBAB 3W9DA 4X8JB 3NACH 5C8JA 4P2QE 1U58A 2GK0A 3DOSA 3OAYH 4HK3J 3D3VE 3S35L 3CCHB 3EGSA 3KJ6L 4D9LL 4F2MB 2V5TA 5KZCB 3KPSD 1QSEA 3DRTA 1FQ9C 5BOPA 1U8HA 1C12B 3DHJA 3OR7B 1OGAB 3WHE1 3O3AB 5GRUL 3U7WH 5GHWL 2R15A 1V3JA 3QHZL 4OI7A 1J05B 3BD4A 4PYGA 2WANA 1PYWB 1DR9A 5MENB 4PV9B 3RY5A 3VWJC 3CUPB 5JORA 5HHNB 1X4YA 3AS0A 1OPGH 1UQSB 3ILQD 4NPYA 4JN2A 4U1IB 3WSQL 4EDXB 1I7ZA 5EA0H 1EX0A 5TDPA 5C3LD 5HJ3A 4PV8A 5FDWB 3X13A 1IILE 1G9MH 4L9DA 4JANA 3Q6FA 3QFJE 4GW5B 4GRLD 5B4MD 3VCLB 5IQ9B 3HZVA 1D5IH 1Y6NR 2AEPH 4NSKA 4Y8AA 3M8OH 1RZIA 1WZMA 1HKLL 1DVFD 4YBQC 1WCQA 3T0ED 2Z31B 4MNGA 4M4RA 3QEQD 1ORSA 5F6IB 4NFDA 1GZQA 3HNSH 1F3DJ 2OBGA 2BSED 1CBVH 5K9KA 4YHZL 3PWVA 1PY9A 3HZYA 1LE9A 2MPAH 1AD9B 4CVUA 4WI3A 3D0LA 4C4KT 4DUXA 1H8OA 2VDLL 5DJCB 1EVUA 4HJJL 1CGWA 1KTKE 2NCMA 3VDAA 4G6ML 4MNQD 2LVCA 5DMYA 2ZUXA 4P2RA 5FA4B 3IS1X 4F9LC 3TESA 4CVZB 4JKKA 4BKLB 1GZPA 3JV4B 4ODVH 3JTSB 2FWOB 2I5YL 1BFOA 1NFDA 4DEPB 1MFAH 5GRJL 5AG9A 4EI5A 4YHPB 1QLFB 4PJBF 4QRPB 1AO7E 3MLZH 4G42A 1J1OL 4XMLL 4ERSH 4QXTB 3ES6A 2IF7A 4HWEL 3BESR 4K3JH 2B7DT 6FABH 3DETD 1LWRA 4JFQA 3C5JB 1T7ZA 4TNWK 5I16B 1KIRB 3ULVE 1WBXB 2DQEH 1K8DB 3WMSA 4OZHB 3MV11 4OV5A 1OGTA 4MCYB 1A14H 5HHMD 4L4TD 3O3UN 1YPZA 2NY2D 3P0YH 4JAMA 4XVUD 3VMOA 2R1WA 4DQOL 3V0VA 3JUZA 1UT9A 3V0WH 4MJ5A 1B2WL 3STZB 3KPNB 1RIHL 1UVQA 4OI8A 1MHEA 4HFWB 1B90A 1K4CA 1S8DB 4NO0A 5BQ7B 4H5SB 1EJOL 2H41A 4NC0B 1I7UA 1NQBA 2CDGA 1XF1A 2F19H 3RTQD 4TVPD 1OWRM 1I7RA 1PG7H 3WFCL 3U9UA 4F7CA 2OI9C 2VQ1A 5GGQL 5GRYA 5IF0A 3RVUC 1JE6A 1EPFA 3H3BC 2BNUB 1HSBA 3JVGC 4ONGH 2I9LB 4LCYB 3C9NB 4Q58C 2XQBL 2C3VB 4WU5B 2BCKA 5KVEL 3DUHA 1MWAB 5HHPB 1ZE3C 3ISWA 1NMAL 2XN9B 3DX9A 3DXAB 3N50A 3UCRA 2EDOA 2ZG1A 4MDJA 3CC5B 1T22A 4FQCL 3MUGA 5CD5C 5MP6L 1TPXC 3BPCB 3FONA 4I0PD 4X6EB 1NEUA 3W5NA 4H25A 4HKBB 1CXKA 4A6YL 4JKLA 4G6FB 1DBJL 3B83A 3PHOB 3QO0A 1KEGH 1KFAL 3EO1B 2R0ZL 1EGJL 2A83A 2AKRA 3ZO0A 4G6JH 1P7QD 4IOIA 5DLML 1MHHA 4IDJH 4WHTA 3E6FA 4HS8H 4WEUD 3P73B 4PGEB 4XXCA 2AJXL 2DQGH 1YEKH 3QNYB 1EFXB 1BJ1H 5CZVL 2V9TA 3ARGD 4P3WA 5GSRA 4NKIH 2APFA 4OGXH 1FVCB 3LRSA 2BY3A 1KCRL 4WW2F 5DHVA 4C54A 4NUGL 3EOBA 3BN3B 2VABA 4C56B 1QA9A 3UTTB 5A43C 3S3PA 3MBEB 4GRMB 2YZ8A 5T3XD 1U8JA 3DURB 2IPKB 4HQQL 2VQTA 3KWWB 1KT2B 5CJXC 4K7PL 2VQUA 2X5PA 3H3KA 4Q0XL 3ARFB 2PUQT 4PJIB 4UOJA 4PBXA 4MSWB 2RJMA 5GGUA 5GS0L 4PJFB 2JJSA 2VR4A 3OKEB 3T4YB 3IRPX 3ZHKA 1HIML 5IV2A 5E1AA 5I1LB 1ZTXL 3VFSB 2ZPKH 5A2LH 3OAUL 1B4RA 1GOHA 4JPVH 1T1WB 4M43H 3SQOH 4G6AD 1F11A 5KBNC 3S97C 4O9HH 4UAOB 3I3DA 3O3EB 3B9AA 1CZ8L 1NL0H 5AZEH 4CN4A 3OJVC 1H15A 1J0JA 2C26A 3IKCB 5J12B 3L3IB 5FFLA 3HE7D 4RRPG 2CJUL 3GEWB 2DD8L 4DGIL 1MF2H 5E4EC 5DC9B 4Z77B 4JDZB 2DWDA 1VPOL 3DRQA 3VH8B 3IFPA 4P59L 3QUZD 1MSPA 3H9SD 1A8JH 1UYWH 3MLVH 3ZMRA 3WJLA 3O4LD 4J8RB 1G7JB 4GMTH 3GM0A 1SMAA 2AGJH 5C0AA 4GO6B 2XNAB 1FNSH 3EOAA 4JG1L 5F7EH 2X4UA 4XMPL 5DJDA 5FCUL 3CXHJ 2ZCHH 4NQDD 3VXRE 4LLVA 5FA3A 3OKNA 4MAYD 1JPTL 1QLRB 5E8EB 3NGBC 1FN4B 3G6JA 3HG1A 4JY6A 1IGJB 3ZTJH 1UVQB 4OFYA 4Q6IB 3QA3B 3ZKNC 1CLOH 2VXQL 2H2PC 5CGTA 2X4OB 3REVA 3C6LB 4ZUTA 3RDTB 5FYJD 4YH6A 3S36H 3UTSB 4JRWA 3U6RB 4YBLC 5IKCB 1MQKH 1S9YA 4PLKC 2XZCH 5HPOA 3OF6A 3KG5A 1UCBH 5E2UH 4XMKH 1JL8A 3EO1A 3U9UB 5DD1L 1UZ8A 2Q8AH 3GBNL 3LB6D 3ME0A 4GS7C 3V6FA 4R0LC 4MXWH 2QQLH 1JF5A 1IGTB 3SHSA 4OGYH 3U4AA 4ETYA 1FSKB 5JHLH 4RZCA 2IBBA 5DRNB 2D7TH 5FUZL 2XXMB 3ZHDA 1T22B 1EVTC 3D9AL 2P7TA 5BXFB 3SGKA 3DX9B 1DEEA 4PRPB 2Y07L 1OW0C 1KJVA 2IADA 4MB4A 1KJ2H 3MR9B 2D0FA 1EEUA 1RIVH 3TJEL 3ZDZE 3FT2A 4ONFH 4N0UE 1UJ3B 2VDML 4MWFB 4L8SA 5I0DA 3DVNA 1CFBA 3QUKB 1WAAE 5F44A 2GJJA 4PP1D 3T2NL 4XMLH 1WC7B 1SYVA 3OAZH 4RMTA 5K9JL 1AHWA 1D5BB 1UA6H 4FQLL 2WV3A 2PCPA 4K8RL 1OP3H 1T21B 2CR6A 1I8IA 5DRWA 5J13B 5EZOH 3HPJA 3C09C 3LPWA 4JY4B 3HE6A 1NFDF 1DL7L 5TE7H 1IJ9A 2XWBB 4H0IA 2ZNWA 4LQFH 5GGRB 5AD0A 3D69B 2NQCA 4HJGA 5BRZB 1I7ZB 5TDPB 4UINL 1CD1B 4ZDHA 3V0WL 3BAEL 3RWEB 3O4OC 4JO3H 1PG7X 3MRJA 4M9PA 4KDWA 4H26B 4MJID 2X4PB 1DANU 1MCKA 5KSAC 4XC1H 3HFMH 1I9JH 1Z3GL 2ICEA 1KCSL 5IW3A 3PABB 2VLRA 4Q7DA 1FORL 1X5JA 1HYRC 5BS0B 4LSSL 2KQNA 3WIHH 2XV6B 4D3CL 3BUYA 4TSAL 3IFNH 3DXAA 4NIKB 5I1EH 1SJEA 3K4AA 5HD8D 1SBSH 3SE8H 2YHGA 3HZKA 3I75B 2R56L 2NY4B 5TH2A 1CGTA 1XIWB 3RFZC 3FB8A 4O2FA 5KJRH 5TE4H 4Q2ZB 1EHAA 2UY7A 3U1SL 1YMHB 4J4PC 1BIIB 4PTUB 3ULVD 5D1ZC 4F7PA 5ISZB 1LEGB 1FH5H 1W2KT 3MRFA 3MNZB 2VR9A 3UBXA 5J6GA 5BQ7A 5B39A 1MFEH 4OCSL 3LKNA 3T0XA 4DKEH 4NNXB 1N4XH 1TIUA 4Q9CA 4PGEA 4ODSH 4NJ9L 2MCPL 1TXKA 4N8CL 3QA3A 4BH7B 2VC2L 2W65A 4P49A 1YUHA 1QSEE 2P8LB 4TRPH 1OAZH 4OV5B 4S1QH 3T09A 4OF6A 3TO4C 1KIQB 3WKMH 5HDBE 4PG2C 3VI4F 3GSQA 4Z0XB 1KPUB 5T5NG 1I1YB 5E2WH 4ZTPH 3VWJB 5FYLL 3WHXB 5J1AB 2XXCB 2J8HA 1OM3L 1UWEH 5JW5A 3IFLL 5JLZB 5F7NC 4KHTL 1QPPA 1U92A 3RX8A 5JTWA 4FQ1H 2X7LB 5F1NA 5MHSE 1AGBB 1FVDA 1BFVH 1VB9A 4L3AA 4NC1E 1TQBC 3C9NA 3LKOA 5F7DA 3WIFA 3WFZA 4LU5H 3SN6N 4NNYB 3VMPA 2HT4C 3U7AA 3QDJE 4YXLL 2ADIB 2LU4A 1FFNA 2WAHA 2Y06L 5GZOC 1WFUA 5IEKA 4OKDA 3I50H 5DJ8B 3O2WL 1BD2B 4JM4L 1HHIB 3S3JA 3FQTA 5IW6A 4CJ1A 5I8EA 5C6TL 3CMOH 2C4XA 1A6AA 3X17A 5C0FA 5DSCB 5GIRB 2VABB 3A6BH 4C56A 4WVRA 3ZE0F 4X99A 1DBMH 1SEQH 4HH9B 4M62L 4V1DB 3RKDC 1Y18B 2D7MA 4X6CE 4LRIC 3WFHA 1K8DA 3C6LA 5EORL 4ZUTB 1CFNB 3EOYG 4HS3A 3MJ6A 3D3VD 4P5TC 5E8PB 4QHMA 4HJGB 4QXGL 3HI5H 1VESA 5INDA 1K5NA 2YMXL 4U6TA 3FL7A 5C0CD 4IOFC 4YNYA 1F45A 5GISL 2A6KB 3EYQC 5IBUG 2CRZA 5TPWH 4U7KA 4XBPB 1T2QH 1AKJB 4TVPL 4ZD3H 3PABA 4GMTL 4N0YH 2V17L 1I4FB 4PLOB 1A7QL 5F3BA 4YHNB 3TPUA 4PRPA 3JV6B 3GMMA 4WHYH 3VWKB 1U8MA 4LLQA 4YLQT 4JPWH 4X6DA 3LKSA 1IL1A 1KN2H 2H1PH 4U3CA 4FFWC 2DQJH 2H32B 1RJYA 4OCXH 4OQ1A 2DDQL 4PLKD 4PRDA 1QSEB 4L8SB 2HTLC 1MWAA 1QNZH 2HLFD 4PRAA 3S8WA 3IF1A 4E5XA 3G04B 2IGFL 2A0LC 1QBBA 3VFUA 3DO7B 2B4CH 4ZUUA 3X3GL 4G8GB 2X4PA 5J6HB 1UJTA 5JPMB 1Q8MA 4OCRH 1NAKH 1KN4H 2YPLB 3IDXH 3LZFH 1WISA 5H94B 4WI5A 3I6KB 5HHVH 1ZT7B 4UT9H 4UV4H 4M7JL 2VDPL 1BF2A 5DQDL 2VWEE 3RY4A 3EDFA 5HXMA 4DKFH 4Z76B 1INQA 2APVA 2FBJL 3NCBB 1JGDA 4JHWL 2E9WA </