4NZUH

Crystal structure of the primary monoclonal antibody 13pl fab' from a multiple myeloma patient
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
225
structure length
223
Chain Sequence
b'AVSLVESGGGTVEPGSTLRLSCAASGFTFGSYAFHWVRQAPGDGLEWVAFISYNGSSKYYASFVSGRFTISRDNSSNTLSLQMNSLKASDTAVYYCARAPDCADADCHKGAFGYWGQGTLVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 13PL heavy chain
molecule tags Immune system
publication title A structurally distinct human mycoplasma protein that generically blocks antigen-antibody union.
pubmed doi rcsb
total genus 38
structure length 223
sequence length 225
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nzuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nzuH01
4AL8L 3NIGE 3LS4L 3KPOB 1KV3A 5IJKA 3G04B 3NBNA 1D9KA 3IFPA 3MLYH 4JO1L 1ZANL 4NO3A 4OGYH 3P30L 3SJVE 3TEUA 1FFRA 3FB8A 2H2SD 4RA3A 2IANE 5EZLB 5D7JB 2XXCB 4C56A 1EZVX 3HS0A 5E8EA 3AS2A 3CMOH 4PJ7B 3O2WH 4XCEA 3MLVH 2ZWLT 4XH2A 2E9JA 4LEOA 3FCTB 1OARL 3LH2L 5ALBH 1FNFA 1MF2H 4NIKB 1RZJL 4XPGH 1RZ7H 1HZHL 3B6SB 3BGMA 1ZHBB 4KXZI 1AIFA 3GMOB 3MUJA 1G6RL 1S9WA 3FT3A 4HXAH 2ZUQC 5IHUL 2WK2A 1QEWA 1Q9OA 1I9IL 3GNML 2AJYH 3P2TA 2J4WL 1Y18A 3D5OF 4HXBH 3ETBF 2A83A 4PJ9A 4J2XA 1PG7W 4NO0A 1DFBL 4KHTH 5DUBB 2HT3C 2QV2A 2VQUA 2E8ZA 4XC3L 3ARSA 4RRPG 3RUGE 3VXRB 4Z7WF 1HIML 1OF2B 1M6OB 1ZOXA 1RHHB 4U6VL 2FLBT 1MY5A 4MB4A 4OFPA 4OTXL 1W0WB 3KLDA 4GO6B 4M7KL 4Q9RL 4IRSD 1TZGL 2DQIH 5EIQA 4JFZH 4M5YH 4RGND 3GSXA 3OJDA 43CAA 4XPFL 5EBWB 1XCQB 1YQ2A 3IB4A 1ZKAA 2VERN 1GGBH 3IFLL 3O9WC 3I2CH 4LEXH 3MSPA 3K0WA 4IDLA 2WWKO 4JFFB 4FTVA 3EO1A 3KWWB 2FO4A 2G2RB 3CMGA 1Q8MA 1HSAA 4R0LB 3GO1H 3ET9F 3MRBB 3GJEA 2DQDL 5BRZB 1FNHA 1MLCA 3DMMA 5GQBA 4X9IA 1LDSA 3AXLB 4LSUH 4NP4H 2UYLB 2XWBB 3BZ4B 2D7NA 2OTWB 3NIDE 5DT1L 4YPGB 3VFGL 3MXWL 1INEL 1UB5A 1U58B 4PJ8B 4UBDC 2VITB 3AREA 4MCYA 3F7VB 1DCLA 1MJ8L 4P3CL 4K94C 4NQTA 3RNKA 3TGXA 4F8QA 2ESVE 4DOHE 2MWCA 1HZHH 5CEYB 1KPUB 3CSYB 4LRIC 2D2OA 5HYJD 4ODHL 4PJCE 3FO1A 2H26B 4ZS6D 2MJWA 2VXTH 2A6DB 4K3HA 2AXFA 4MWFA 4MCZB 1A0QL 5GS1C 1JPGB 5T3ZL 5E08L 4U1GB 2ESVB 4RWYL 4D9RE 1X5JA 1JGDA 4YXHL 2AQ1A 3QQ4B 3CDFA 3H3PH 3GBNH 3GKZA 4JHWL 5IQ7H 1W2KT 1AXSA 3IDJB 4U1KA 1QSFE 1AO7E 4IRJA 3GJFB 5IB4B 4LLYA 5LBSH 1I3UA 3X11A 2VLMD 1TTUA 2ZP0T 3KPPB 1CFNB 5D2LA 1NMBH 3MLUL 3QIWB 5J11B 1ZE3C 1O7VA 5F3HB 3E6FB 1LEIB 3PWJB 1BX2A 1DBBL 1Z6JT 4JO3H 5MENA 4OZFB 4NZTH 3AM8C 3LQZB 4R7DA 4J8RA 5GRUL 2APWA 4U1HA 3RVUC 4QHLA 2UY7A 1EJ6A 3OAZK 4NJ9H 5FYKD 4PJAE 5I9QB 2W60A 3I9GH 4LSVL 2PYFA 1A47A 1DQQA 4PRPE 3I85A 5EB9A 4FZ8H 4H20L 4NQCA 3RL1A 4MNQB 3V4PH 1IT9H 2AJ3A 5DQDL 2ZG3A 3TA3B 5BMFL 1DJSA 3RGVB 1DN0B 3FQRA 2OQJB 3O3EA 2C3GA 4S1QL 3JTTA 4CU6A 2Q8AH 1G84A 3J8F7 1MCOL 4HIHB 5L7XH 3W2DL 1S9VB 3GRWH 4M6ML 3T77B 4LDEB 1IGCL 5LAXA 5DD5H 5D1XC 5FA3B 3SN6N 4Y1AB 2IG2H 2AKRA 4U3CA 4N68A 4U1SB 5F9JA 3N50A 1J5OH 4LAQH 5FA4A 3O0RL 3RWHA 5GRJL 4RX4D 1FQ9C 3FB6A 5A3IC 5E8EB 1WFOA 3BWUC 1H15B 3LPFA 2EE6A 3H9SD 3RGVC 5JQ6H 3I6LE 4O00A 3WDJA 3QUKA 4N8PA 1IEBB 3SGEH 1TJHH 2A6IA 3RUGA 1ZA6B 3VXSD 2AJSH 3IU4L 4JFHD 3HZYB 1BBDL 4NT6B 3MPCA 3MBEA 3CLFL 5KN5B 4E5XB 3OKLA 3KPSA 2R69H 1ETZA 4WW2C 4X7SL 2OTUA 1N3NB 4K2UH 1WBZB 3C8HA 1IAII 3I75A 4PJEA 5C0CB 4LGRB 5C09E 5B3NA 2NY2C 3VFWA 1JZ3A 1ZK9A 5F7DA 3HZKB 3CVHA 5JHDB 4WI7A 1MOEA 2EC9U 3EZ8A 4TULL 4N1HB 1C1EH 3UBXB 1V7NH 4Y8AA 3FQXB 5HSFA 3ULVH 1WUNT 5D7SH 3MRCA 4ONOA 4APQD 5HGBB 2VXUL 1OW0A 2XQYG 4ZUVA 4X99B 5BRZE 3S8WA 2G75B 2PETA 4JB9H 1IGJA 3VRJA 5BO1H 5D93C 1XGQA 4G80A 4G6KL 3S88H 2A1WH 5EA0H 2FECI 2RB8A 4D0DA 1NBZA 1CI5A 1EEUA 2AJVL 3F7QA 4OQTA 4OCSH 3BKYL 2YMXL 5GS2D 3MCLL 4TUJA 3MRBA 3GHBH 3LN4B 3IU3B 3ROOA 3GSVA 1BHGA 3EFDH 1TZHB 3ZE2E 4XXCC 5T1DH 5K9OA 1NAMB 3U30C 4WI2A 4O9HH 1B0GA 3MUGA 5FGRA 5K93A 4PGBA 5I30H 2R15A 5HI4C 5DK2A 3H9ZA 2C9AA 1YN6A 2CK0H 3AVEA 3PL6D 3BT2H 3K4DA 3MUY1 1JWMA 2Z8RA 4H25A 4JFOB 4IHOB 2FBOJ 4GRLA 2IALA 3QDJD 5GIRA 3TVMA 2P8MA 4U7KA 4XPHH 2ZUYA 4MGXA 5DEZA 2Q6WA 1CS6A 3GMLB 2AP2A 2JB6A 1K2DB 3ARBC 1GHFL 3S34L 4JFYB 4Z0XA 4M6NH 5C0RL 1CVRA 1UH3A 1EBPA 4PRHB 1FFQA 1PFCA 3H7BA 4J6RL 5D2NB 1X5GA 2C3VB 3PHOB 4PGZA 4XBPB 5CBAA 2R1XA 4MNHA 2Y72A 1BIIB 5D1XD 1CGWA 2JELL 3DTXA 3KAAA 3PP4L 1S7TA 4NO0D 1XF2B 4NUGL 3PWLB 3SKUD 1GGTA 3U83A 1JHTA 2GYSA 4YHKL 3QQ9D 4F7MA 5FM4A 3E6FA 2YKLL 3QIUC 3GBLA 5FHBH 1W8NA 1EO8L 5E1AB 4QCIA 3PXJA 3UTPD 2NY3B 1TZIB 5ADPL 5I1AA 1F3JB 4HV8B 1J1PH 1WIUA 5JUEL 2R1WA 3AS0A 1UZ8A 4QXUH 1HHHB 3SY0A 2ADJB 1FAIL 1D6VL 3ZTJH 3ULVD 3RL1B 3OAZH 4TNVK 5FUOH 3KR3L 1GGIL 1HN1A 2O61B 5TGBB 1B4JL 4M43L 4Y7MA 3V0AC 4GG8B 5ITFA 4G3YL 1X4ZA 2AAVA 4N0FB 4DVRL 5J9PB 5JR1H 3ROLA 12E8H 3T2NL 5BQ7B 3C60B 1AY1L 4XPAL 5DDHB 4G6JL 1KYOJ 4EZMA 4AQOA 4JN1L 3D0LA 4IDJH 4WU5B 1DL7L 1S7SB 2KZ1B 4CDHA 3QCTL 1W72L 1SEQH 2YRPA 4Y4HC 4NQEA 5D5MF 8FABA 3MRIB 2D7MA 3Q0HA 1CZ8L 1X5FA 3PGDB 3HZVA 3OXRA 3CK0L 1DVFB 1DBKH 5F7YC 3TBYA 1S9XB 4JGMA 3V95A 1I7RB 5F7KC 3S97C 3SKJH 2VNCA 4EXKA 1FG2B 4ORGA 2DKMA 3WHE0 1INEH 3BPLC 2BVOA 1MCWM 4JPIB 4E5XA 1F6LL 4F15C 5SWSE 5EWIL 4XCNA 3S36X 5AAWA 4OSUL 4N8VA 1FFPB 5LVEA 3QEQB 1TCMA 1MIMH 2DI8A 3RI5F 3ALWA 1JYNA 4QT5B 1HNFA 1RD6A 1MCDA 5HPOA 4PLKC 2CK2A 2J8UE 1MFNA 4BYHA 3UJTH 2H32B 4Q9BA 1L7TL 1IC5H 3E8UH 4YAQA 4OGAD 3DI2B 3ZKMC 4KK9D 1VFAA 4Z7OE 1CVSC 4HSQA 5DJZA 5IVNA 5I76A 3F12A 3KLSA 4ZPVB 3RAJL 1MCCA 3FQWB 1K4CB 2AEQH 5DJ8A 4OM1L 4RMSA 3QDJE 2AI0L 1R5VB 1EFXB 4R4ND 5T1KA 1A7BA 3MLZL 4Y88A 1EGJA 1T0MB 4YDIH 5DMKA 3H0TA 5C0IA 1SYVA 2W0FB 3PJSB 3REVB 3VFVA 1CGSH 1UACL 2VDNL 3UJIH 4OD3L 1FZOB 2KL6A 5T1MB 3V4UH 2A6JB 3CDCA 4MMZC 3MOQA 3GIVB 3CXHK 1V5JA 2OJEA 1MAML 3BI9X 3SGDH 4K94L 1MHCA 3EDJA 2RAMA 3GB7B 3MACH 3FT4A 2N7AA 1N2RB 3SBWA 1AFVH 2ED9A 4PRHD 4FMKA 5ANMB 5I66A 3QQ9C 3OR6A 3JUZA 4H1LA 5CZXD 4G8IA 4HFUH 4YIQA 4EI6A 3MRQB 3UTZB 3MLSH 1TPXB 2Y36H 2W0PA 4ZTOH 1A02N 4OZHA 1KIRA 5DS8B 4FQPA 4JVPA 3NMEA 3EYUL 1P69B 1UZ6F 4ZOEA 4M61A 3T0VA 4PG2A 4JLRA 4OF3A 3QUXB 1CE6B 4QRRA 1MRFL 1JWSB 2QTEA 4U33A 3T0EE 3U6RA 4IMKC 2DDQH 3VXME 3T0AA 5CJXA 4QRSB 3SDYH 4YBHA 3E8UL 5FV2A 1F4HA 3ES6B 3H7LA 4J3OC 4OGZA 4P3WA 1U3HB 1GGBL 4HPOL 1S9YB 1IC7H 3UAJC 1U2HA 3BKMH 4BM7A 1X5AA 2V17H 1RAMA 3KPTA 4UTBH 5BXFB 2F53D 1KJMB 4OD2B 1ZSDB 3DBXA 2H1PH 2CUIA 3DV6A 4FNLH 2D9CA 3C60D 4PRIA 4OZIE 4C54A 4JDZA 2J4WH 5D1ZA 5K33A 5BVJA 5C2BH 5CJ5A 5HYFA 2D31A 3P4LA 1DFBH 4P2RB 3V4UL 1CFVH 2XFXA 3WFHB 5IM7B 4ZFFA 4U1NA 1KCLA 1P1ZA 1MI5D 1M7IA 3H9YA 1P84J 1G1CA 5AYUH 3WLBB 4MQTB 3BEVA 3S37H 1GCFA 3OR7B 3BFOA 3LOWA 1QOKA 4OTXH 3KDMA 1MCSA 1RUAL 5FOBA 3VRIA 1QPPA 2UUDK 5CWSB 2N4IA 2I26N 4PY8J 5HVHB 1T7VA 3K46A 5FKPA 5FYJE 1WT5C 1Q0YL 2Q76A 3P0YH 4HIXH 3K4ZA 2WANA 1WC7A 1X4XA 1DQDH 1SMAA 1VA9A 3LS5L 4DGYH 4RFEA 4QXTB 1AGDA 3L3HB 5D1ZC 2DQFB 2WMPA 3O2VL 5C0AE 4HK0B 4FRWA 2NXYB 1HH6B 4R4BB 4S0TD 5T3XE 4HKZA 1ZWIB 3TZVC 2FNBA 3QA3A 5FDWB 1OT1A 2VB5A 2E5EA 4KRMB 4GAFB 1MH5A 5T3XD 2C3HA 4FFVC 3BMWA 1IQWH 4LU5L 2D03L 4ZO8A 1FH5L 3KJ6L 3NACH 1QLRB 3TPUA 3G5ZB 5J3HD 1DBAL 2BVUA 4X7EC 1XCTA 4IRJD 1G7LA 3RFZC 1FAKT 3O11A 4W6YB 3O6LL 3EOAB 2VKWA 4XNUH 4F57L 3FOMB 3ZO0A 4FS0A 1YEIL 3KYNB 4EEEA 5F8RC 1AH1A 1KN4L 1F4YL 1V3LA 3W0WB 1UYWH 2FJFA 3WEXB 4ZPVA 2W38A 4HD9A 4L8SA 2CUMA 5L7XL 4JZJA 3VU2A 5CSBA 4BA8A 4M6MH 2EDFA 4XH2B 4I18A 2GJ6A 4Y1AE 1UGNA 5KS9F 1DEEA 4KZEH 3ULVE 1RMFH 2PXYA 2CLVB 2HP4A 3FN3A 3B6SA 3BGMB 2J5LC 2ZOKA 4N0CD 4C83B 5CHNB 5JOPD 5C07A 1OAKH 4JRYD 2G5BA 4FABH 3X14B 1R24A 5DJ6A 1E6OH 2BOCA 4MA7L 1EHLL 1K8DB 1KPVA 4XWOC 3P4OA 1EMTH 5SWQA 3QJHB 5IOPB 2AK1H 1CDUA 4XCCH 1FVDB 2NY5L 3LRSB 5ADOL 3OKEB 4DN4L 1ZVHA 2HJLA 5EO1A 4XVTL 2CRMA 2HKHH 5EPMB 4BH7B 1OPGH 3QAZB 4KTDL 4QHNA 2R56H 1IT9L 1N5AA 5DQDH 4UOW0 2H9GA 3BX7C 3N9GH 1FYHB 43CAB 2XNAB 1QNZH 5J1TC 2VIRB 4LOUC 1G7QB 4UV7H 4YX2L 3EDEA 2QSQA 4WFEE 3MROA 4GUPA 4NQDB 4U0QB 5IESL 1R5WA 1IEAA 4CW1A 2EXWD 1DBAH 5HPMB 1DDHB 2FO4B 2G2RA 4RZCB 1ZHKA 5SV4A 4TNWK 4YR6A 5MHSE 2Q8BH 1AGEA 2VWEE 3VJ6A 3D3VA 1A6VH 1E4XL 1NLBL 3RVTD 2YR3A 3MUHL 1YC8A 5KSUA 3TCLA 1PLGH 5BS0D 4GLRH 4KV5F 5BRZA 2JIXD 43C9B 5D7LB 1SMOA 1K8IB 5DTFB 4ALAH 1PBYA 5DRNA 1ZHLA 4MSWA 3DIFA 1S9YA 3HAEH 4OLVH 1I1RA 5D71H 2ADGB 3IGAA 1IFHL 2OR9H 4PRBA 3SKJL 1ACYL 4UBDD 4ZOAA 5ISZA 1MWAH 1FFOB 4CN6A 1A7RL 5L8JB 4OCSL 4JVUA 4LHUA 1XIWA 4LSSH 4E41D 1H8OA 2Y9RT 2JJVA 4P59L 4ZUWB 4G42B 1WICA 3RWJA 4KU1A 3C5ZD 1FNSH 1ZEAL 3WHXA 5KVGH 2AV7A 1KPUA 3G5XB 2DF3A 2DBLL 3SE9L 1SJEB 2X4TB 4PJAA 3T0DA 5CD3B 2YD8A 3QG7H 5BJTB 1HI6A 4LL9A 4YPGA 1CGTA 2VH5L 4Y4FC 3KLHD 1DQLL 1ZVYA 1RK1B 2NY5H 3IDJA 3STBA 4XNXH 2YHGA 5J12B 1QR1B 1PGRB 2BC4B 1P4BL 4YDKH 4P2YA 1JTOA 2DMCA 3SE8L 1FE8L 3EJYC 1RJCA 3HZMB 1F8TL 4K3JL 4UAOB 3VWKB 1SYSA 2K7QA 5DF0A 2ZUWA 5E2WL 2R2EA 3GMPB 1U3HD 3B9KB 4WUKL 1IGFH 2V9QA 3QEQD 5IFHH 1CLOH 5E5RB 3O9WA 3ULVC 3ZZ1A 4JANA 1AJ7L 1G7IA 5BS0A 1BVLA 1MAMH 2FEEL 4HKBB 4EUPH 2IPTH 5DJDA 4JAMA 1WAAE 2V2WA 3AY4A 5FCUH 2PYFB 4NGHH 3G6JF 3GSUA 2B1HL 2NY4C 1MIEH 4NNYA 2CKBA 5IK3A 3DXAB 5EU6A 5CKAA 3F58L 4HS6A 4LKXB 1MFBL 3D18A 5C0GB 3MV01 4YE4H 1FIGL 1TVHB 4ZNEE 3PNWB 4PJXE 3D87B 4QOKA 1G9MC 1TMCB 3BXNA 3WN5A 3VCLA 5JPNA 4IMLB 4EBQH 1S78C 4ZPTA 3TYGH 3MV8D 3NCBB 4TQEL 2IPKB 3KR3H 3OX8B 3G6JB 4J1UA 4L9LA 3FOMA 4Z7VF 3WXVH 3OG4B 4N0UA 5HHME 1NCCH 1NEUA 1IC4L 3CXDH 2YA0A 3VFOA 5HHQA 4UU9A 3L3OA 5TE7L 4QWWD 1U8PA 2NLJA 1QZ1A 3EDFA 1UCTA 1U8IA 2YPLA 4Z7NF 4NYLA 2P8LA 3V7AG 1QO3A 5F1OB 1AY1H 2A6IB 2GAZB 4XPAH 4D8PB 1ZVSB 4PJDF 4EN3C 4Z7OF 4MHHG 4LP4A 4CJ0A 4JN1H 1V3JA 2A2QT 4YFLI 3BUYB 5ACZB 3FO0H 4M5ZH 2HFGH 1BQLL 2KDGA 4XPTH 1F8TH 2HYMA 1R24B 3DGGA 2M8XA 1NANI 4AK1A 1KPVB 2WQRA 3KPMA 3OKOB 4NJAH 1G7PB 3MODH 4AM0B 4XP9H 4N9OB 2VSDA 1A14H 1MFDL 1S7QA 1FAIH 1QSFB 4JQIL 5C92A 1I8MA 1ZA6A 4PJFE 4GKSB 2FHBA 2GT9A 1UEYA 4QHKI 3QUYD 4NQVA 4OCXH 4Y2DA 5E8PA 2VQTA 4X6EB 1MVFA 2HH0H 1QFWM 1SJHA 2B1HH 4LLQB 4WTWA 3KYOA 2VLLB 2X4PB 1MREH 5DHXB 3VA2C 3VXTB 5DMIL 2N56A 4NM4H 3J7HA 4KUZH 3SO3C 5C0AB 1TJIH 4O4YH 1KT2A 1IEAB 5DMGC 4CW1B 3W9DA 3KYAA 2R2HB 5EUKA 2PTVA 3L5XH 4OCRH 5D2LF 2V7NB 4JO1H 2DQUL 3EJZD 7CGTA 4FQ2L 4LDLB 3PV6A 4KVCH 2AGJH 4UIMB 4FXGB 1J18A 3PWJA 5DZNA 4K71B 3QDGA 1ZT7A 1F00I 3ISWA 5KJRH 1YC7A 2EEAA 2O5ZL 5E5UB 5SWZD 5F9WC 4LPXA 1J10A 2IQ9H 5A2JH 5IFAL 3KPRB 4FQXC 5D7JD 4R26L 1ZGLB 2W60B 2VDNH 1AQKL 4RGMB 3QDMA 4LCYA 5I8OH 1T21A 1OARH 3LH2H 5L88L 2FJHB 3WFEL 1FGNH 5I8EA 1YEDA 3EYQC 3LN4A 4BFBD 4K94H 1MFEH 2N7BA 3X13A 1AHWA 1MIML 3FQTB 4PJAB 5E9DE 3RWIB 2OQJA 5ESAA 2JJWA 4QYOA 5KS9B 1OQXA 4P4KB 3S4SB 1S3KL 4QHUB 3IFNL 3OMZA 1EEZA 3QCUL 1H5BC 4F57H 2F58H 3AY4C 1T83A 4OCWH 1NCWH 3REWB 3C60C 3V4VH 4DKEL 4GRLC 1RURL 1NAKL 2GJZA 1F4YH 3QUYA 4CL7A 2BXZA 5KSAC 4HC1L 4XAKE 4WUUB 2XKNA 2V7HA 4X6CB 3LAFA 1INQB 1IQDA 1EHXA 2EECA 5C08D 1ZLSL 1NFDB 4ZYKA 1KLFA 4ZFZB 4YO0A 4LLWB 1RZGB 5ESVB 1PW3A 3ALXA 2LU7A 4OI8A 2DQIL 4TUKL 1QLEH 3BPOC 2Z92A 1DR9A 3E6HB 5CSZB 1TQCC 3UO1L 4OD3H 1BOYA 4G7YH 1YNKL 5LWYL 5EZIL 4I0CC 4LLVA 1ETZB 2ITCA 5ELIA 4XNQB 5JTWA 2R0WH 5K59F 4NO2A 4W4NA 4F33B 3EJJX 1YPZA 4XCCL 4BQBA 2AGJL 4HUWA 2VAAB 3OJMB 5D1ZD 1HSBB 3QI9B 3G6JE 3TBWB 4LVNB 4XX1E 2AQ3A 3P0GB 4QTIH 4BUHA 4Z7WA 1G0DA 1IL1A 3HC0A 4H26B 1XGUB 3T8XB 3IT8D 1F4XL 3D1MC 5E1AA 5DSCA 5BZWB 3WUWA 4GJTB 4J3VA 4GG8A 5ITFB 3DECA 1U8JA 4K23H 3G6AA 3PDOB 1JTPA 1RIVH 1RFDH 3MGOB 5I71B 3L3DB 1TPXC 1I1FA 3SDXE 4PV9B 3QULA 2G9HB 3VFPA 1MCIA 2DI9A 2RFXB 2PN5A 4KY1L 1I7TA 4QRPB 1U8HA 1XEDA 1FSKB 3JV6B 3QDJA 4JM2C 1PAMA 1JGLH 4RMUA 1U92A 2AXJA 1TZHA 2QEJA 1QFWI 1ACYH 3NVQA 4XB8A 2HVJB 1I3RA 5EBLA 3ZYOA 4OQ1A 3RTQC 3HAEG 3U36A 3X3FL 2Q3AA 2AXGB 1BEYH 4OZGE 2R29H 5F93C 3OPZL 5TH2B 4AEIH 1E6JH 4PJIB 5AEAA 3VMPA 2IANA 1FYTD 3BQUB 4MZ3A 3QIWD 4GW4A 5EO9B 4KVNL 5B38A 3LN5B 3RL2A 1T1XA 5D1XA 5B8CB 1FNGB 4TYUA 1MEXL 1T80A 4I0PC 4G8GD 5ID0B 1ODAA 5FO7B 1OD9A 4I3GA 4U2YA 4JPIA 5D93B 1PJ9A 1IGIL 2EDHA 1CICC 1K4CA 1FGVH 3QEQA 4FMFA 4WFHD 3LQAH 4N0CC 3NFPA 3PDDA 3V4PL 1RVFL 3BAEH 2GY7B 1CD8A 4PGDB 4NO3B 4FFYL 1JFQH 3VFVB 5BZDB 4V1DE 3PGCA 4YXLL 1JGVL 5IMMB 1DLFH 1S7TB 4KMQA 5IT2H 2AK4B 1IKFH 2PW1A 2E7BA 5GPRA 4S1DC 5DD6B 1IGFL 4Q9QH 1LD9A 4Y5XA 1UWGH 1WJ3A 1IZJA 4F7MB 5IFHL 3R06A 4MJ2A 1H0DA 1SBSH 5EDXA 2BNUB 5DJ8B 3QUZB 4HK3N 4BSJA 3BIBX 5GISH 4RNRA 4X4XB 3ARFB 4HS8H 5DO2C 5JOEA 5K9QG 5C08E 4CVWA 4PB9L 3NCJH 4WUUD 4FXKA 4IRJC 1KBGH 2NY5C 5HYJB 3QIBC 2YZ8A 3RY4A 1RUKL 1YEDB 3VD3A 4XCYB 3OAYK 5TDPB 3VXOA 5GS1A 2VDMH 2O5YL 4WFGE 3ILQC 1WBXA 4U49A 2EDDA 2B7DT 1YDPA 3RPIA 1AGCB 4QHUA 1EEZB 3DYOA 1E6JL 4YBLC 3RKDD 4XVJH 3WCYA 4XMLH 4GXUN 1KCUH 1NMAL 3K3QA 4M9OA 4WW2F 3NIFF 3ZDXE 2B5IC 4G9FB 4HJ0C 1U93B 2JJTC 3PWUA 4L4TD 3WIHA 4P23A 1X3DA 4CU8A 1W0YT 5J13B 4O2FB 2HKFL 4JQXC 5K9JL 4M8VA 4P3CH 3GSNH 4I8DA 5F7FA 1IGIH 3ZE0F 2BNQD 3C6SB 4NQEB 4NZDA 3V0VA 3ULVL 2GTZB 3ARDB 3D25A 2J8UF 3KS0J 4NNPL 1DSFL 3CFBA 5EBGA 5TF1H 1D5IH 5BXFA 4FP8H 4HQQL 1F13A 5SWZB 4WI8A 1OB1B 4R0LA 5BV7H 4J4PC 3OAYH 3MLTA 1JPTH 3BO8A 1YQVH 4PJ5D 1NGPL 3RDTB 1LK3H 1GOFA 1IZKA 4Z76B 1MHEB 2RGSA 2FJGB 4M1GH 3SGDI 4R2GB 3DV4B 3LCYA 3QFJB 3GSOB 3CIQA 2DM7A 1IGYB 1C16A 4KDWA 5JHLL 2BVEA 4PJ8A 4P59H 4H26A 3IYLW 3F7VA 5FYLH 3BKCH 1ZAGA 4OZ4A 4DEPC 4EVNA 1A9EA 1FO0B 3S3SA 4Q6IB 4BFEA 2CK0L 2OSLB 3HPJB 4JE4B 3PDOA 3BHBA 1MPAH 3MO1B 5JQHC 3MGTA 5IESH 5GS0L 5GRUH 3PP3H 4ODVH 2VLJB 4R0LC 3MRMA 1UVQA 5EU7C 3L9RB 3IFPB 1FNAA 2O5YH 4JY6A 4W6XB 4QGTA 4U6XA 4FZ8L 3W0WE 4D9LH 2CD0A 3Q5TA 1HH6A 3VRIB 5FOBB 1KJ2A 2WBJD 3D69A 1NFDE 3HFML 2XZQL 2XN9A 4KK5D 3C09C 5KJRL 3ZTNH 1Z5LB 5D71L 2FB4H 1CIUA 1VFOA 3QB7C 4XCEB 5IIEA 3DYPA 3M8OH 2HKFH 4JO4L 3GRWL 2Q76B 3QPQD 4J23A 4N9GB 5JLZA 4IOIB 1BX2B 3JWDC 3VH8B 4NOFA 1YNTB 1A64A 2JELH 2IG2L 2A9NL 4LKCB 5D7IB 1H9VA 3IETB 1JZ6A 1IGTA 2IPUK 5GGUA 4P5MB 2X4UA 3D2UA 3QUMB 3QPQC 3T4YA 1SEBB 2D4DA 2GQHA 2R0ZL 3FB7B 5INDB 1YNLH 3QA3B 5FDWA 4MYWB 5IHBA 3DHJA 2K3TA 3PG2A 5IW6A 4UAOC 4PR5A 2Y5TB 3MV7A 4UQ3A 4FFZH 5DJ2B 1NAKH 5B39B 1DQJA 2IH1A 4QHMA 4PJXA 4R3SA 4PTUA 1ZV5A 2VDPL 3TPUB 4Z5RA 2NY2B 4HIHA 5F7MC 2CDGB 3ILQD 2OS7A 2HJKB 2X1QA 5FO8A 2PXYB 3DVFA 2BNRA 3FAWA 3HR5B 4UNTA 1LGVA 5DHYB 4PYHA 5EIIA 1PQZB 4TUKH 3RJDA 1ERNA 1QHOA 1HXYB 3ARXA 1QYGL 3MRKA 1U58A 3L5JA 4F9PA 3QXWA 4N0YH 2VUOA 3OKDB 1I1AB 3PABA 3KPNB 5JORB 1YEHH 4YUEH 1AJ7H 5I74B 5JHDE 2ZUQB 4PIRF 3BE1L 3BJ91 4N1EA 4Y4KC 3CSYA 4YJZL 5HY9B 1EO5A 8CGTA 4NHCH 5TE4L 2WWMC 1W0VA 5GGVY 3CFEA 2ZPKL 1NFIA 2XTJB 4J4PD 5A16B 1NCNA 3S88L 1CYGA 4YQXH 5L6YH 1S7UB 1E4WL 3RP1A 2ESVA 1DEDA 2XNAA 3M8OL 5SX4H 3B3IA 3Q6GL 3BEVB 5D96C 5D7JC 3VXSA 2YPLD 2AJUH 2J2ZA 3HI1B 4ODUB 2L7JA 4TUOA 5MEQB 1KIPA 2FD6H 3ZKXB 2YC1B 3NA4A 1GZPB 2XPGA 1NCCL 1JNLH 1N5AB 5FV1L 1S7XB 3FL7A 3DVGB 3LIZL 5SWSB 5HGBA 4P49A 5HYSG 3QFJD 4NM8L 4AEEA 2AK4D 2C1PA 5MENB 1YEJL 4JVWA 3MA9H 2BVQB 5M7QA 1TJIL 3L5WB 4FG6C 3HPLA 3I2CL 4TPRH 3PL6C 4BZ1L 5EOCH 2APXA 3BISA 4BZYA 1WQVT 4JZOA 3BD3A 5DVKA 4DZ8A 2YD1A 4JRXD 5I1GH 3B9DA 1CFNA 2AV7B 5D2LB 3RA7H 3OPZH 2JJTA 1OTTC 4EDXB 3W0WD 1OT2A 4FQHB 5CZVH 2R2BA 3OSKA 2R4RH 5DRNB 5E56A 5JMOC 1A14L 1MFDH 5C0BE 3RVVC 4PRPA 1MEXH 3C5SA 1P4LB 5F89B 2EIZB 2NW3A 1PD6A 1FGNL 2AKRB 1DQQB 1EV2E 5DR5L 4IJ3C 1LK2A 2UWEB 5HGDB 3VXNA 1FGVL 1RJZA 1QEWB 2ORBL 4OJFL 4JREB 3MRJB 3ILPB 5FECA 1NBQA 4XBGA 5JOFB 4I18B 5I18H 1DEEB 4XGZA 4UUJB 5IP4A 1J8KA 4W68A 3KG5A 1FC1A 3RNQB 4KVCL 4K8RL 1N6QL 4KHXH 4QO1A 5CHNA 1OAXH 4KJQC 2HG5B 5F71A 3MRFA 1CD1B 1NFDF 4YXKH 3WE6A 4X9GA 2BOCB 2VAJA 4K3GA 2V2XA 1ED3A 2PW2A 3EGSB 4GKOA 1OTTD 3QJHA 2V5TA 3GMQA 4N5UA 3PHQB 3CMOL 1IEBA 1LO4H 4NQDE 1A1MA 3B9KA 5E2JA 1YNKH 1JN6A 2X1WL 2F74B 2Y23A 4BZ1H 3RWDA 3JWOC 2BJML 4TVPL 2RBLA 3W9EA 4QTHB 2NTSP 3BPNB 4YHIA 3S35X 3LZFH 1T2QL 3BDYH 3S9DB 4L4VD 3ULUH 4OZGF 1KYOK 4RFOH 1U8LB 4RMWA 1BAFH 3PGFH 4JR9L 3VFOB 1UB5B 3D18B 1MELA 1GAFH 4N8CL 2AJZA 3A6CL 3VFWB 3AROA 2XWJA 5C3TA 5D6DA 4K55A 4ZSOB 3QUZD 2YEZA 4CVZB 3TBVA 4OD1L 4OLYL 2GAZA 4FZEL 2O5XH 4NSKB 1NBYB 4JPWH 1HWGB 2J1KA 2IFGA 4MDIB 3I02B 1Q72H 3OKKB 1CT8A 1DUYA 4BELD 4AMKH 5HXMA 1BJ1J 3L3OB 5HHVH 5GRVL 1P84K 1HHIB 4HK3J 1EXUB 1JV5B 4AM0A 1AO7D 3CDGB 2GK0B 1NCUA 5TPWL 3KPLB 4M1GL 5I2IB 1CICD 1G9NL 2BOBB 2B0SL 5TDOA 3VA6A 1BBDH 3V6OA 4G9DB 1NAMA 1FL3A 3LEVL 1XF3B 3BUYA 5EC1A 3LHPL 1XR9A 1NCAH 1HI6B 5DD1L 3DUSB 1G7MB 4YHLL 2X89D 4WCYL 3V8CA 3HE6C 5HYQB 1RZKC 5LGJA 4OZIF 5T3XH 1LO0H 1P7KA 2OL3H 3S35H 1ADQH 3BGAA 2V9TA 2NY6C 4NN6C 5I1KH 1QFWL 1AHWC 2DWEA 2X7LA 4ODWA 1D5XB 4ODTL 2YUVA 1I8MB 5FUZH 1P6AB 4G6ML 3Q6FA 4NRXA 1AFVL 4ZODA 1YY9C 5FF6B 3KS0H 5D7SL 1IEHA 1MHHB 3RPKA 4DQOH 4LASL 3ULUL 1ZA3A 4L4JA 4U1MA 5DRWB 4DAGL 4ODHH 1CDGA 4OCLC 1ZT7B 4WVRA 3V52H 1RVFH 3BAEL 2VR4A 4JRYA 1JGLL 1YEIH 15C8H 3HTLX 4M93C 1I1AD 5F88A 3B83A 4HJ0D 3TBTA 3AS1A 4PJGB 4FA8A 4X5WB 4P5TB 1BVLB 4NQXA 4Q0XH 4V1DA 4EDWH 1I3GL 1Z9SA 4CAGA 5INCB 3HUJE 1BEYL 4XB7A 3O3UN 4HWBA 1NC4B 1WFUA 3P4NB 3KHQA 3AMLA 4M7LL 5ERWA 4X9FA 3RWHB 1MUJA 3X13B 1MQ8A 1LEKB 4I48B 5AWNH 5TGBA 2ZUUA 4XTRC 2AEIT 4KJWD 5E0QA 5I30L 4PB9H 2EDRA 1JNNL 4N0FA 1KBGL 3A0OA 2HLFC 3TZVA 3O6FD 3B2VL 5GHWH 5TPWH 1UZ8B 4CMMB 3KNBB 4M4PA 5J3HC 3DRTB 4HBCL 2VDPH 4XVTH 2Z0BA 5CEZL 1Z2KA 5JA9A 2OTUB 5HJ3B 4JQVA 2CIIB 1AC6A 1RZGA 2WSKA 3EKCA 5I1DA 4M61B 2VISA 4PJFF 5T3XL 4QEGA 2VO5A 2I25N 3FQXA 3QUYB 1SBSL 4EUPG 4DUXA 3P77A 3MV8E 5B4MC 1B6UA 4ZUTB 1SQ2N 3A6OA 4CBPA 3TJEH 1UXWB 4QT5A 5SX5H 4OT1L 3CJJA 5C2UB 1BFOB 3BH8B 3HMXL 4L3EA 2LABA 1U41A 5EUOF 4X7FC 4MQXC 4ZUUA 2HWZH 1YY8A 3GMMB 3RKDC 4ONHB 5DJZB 1YEEH 1LP9B 1TJHL 4ONFL 1JHKH 2CGRH 4ZS7H 5GGTA 1JZ2A 3QWRD 4L3CB 2H32H 4LIQH 1DLHB 4I0PD 2ADFH 1E0OB 4Z6AT 2WV3A 1EFXA 4FHBD 4MB5A 1QSEA 4WJ5B 1TQBB 2ZNXA 5DUML 4P46C 4L29B 4LSRH 3UTTE 5D1QC 4QRPA 5I0ZA 1U8HB 4CMHB 3HE7A 5CJXC 2C5DC 1V05A 2K7PA 2GEEA 1J12A 3NACL 1GRWA 4P4RB 4UIMA 3RVWD 4S1SL 1WV7T 3MJ9L 4WEUD 1MHCB 2Q6WB 1SM3H 1A1NA 2JB6B 1F6FB 1DL7H 2JF1A 4WDIB 4MDIA 4HKXA 4LSTH 5IJKC 2YD4A 1I1YA 4N5EC 3S36H 1R3JA 1TJGL 1VCAA 4XBEL 1CLCA 4GOSA 3SE8H 5I1GL 1K5NB 2Z4QB 3RWGA 3T65A 5CGTA 2C3VA 3PHOA 3SDDB 1ORQB 3F5WA 5HYIA 4NPYB 5FK9A 1DBKL 2GK0A 1ZWIA 2FJHA 2M2DA 4QXGL 5EA0L 3GK8H 3BWAB 5C08A 4WUKH 4OZHB 4M6AA 3OQ3B 3QIUB 5ID1B 3FN9A 2VDQH 2W9LA 3O4OC 1H3PH 1OAYH 2ZUSA 4MNQE 3BW9A 1XR9B 1P7QA 5F6HJ 3CZFB 5H8DA 5FCUL 1CE6A 4QRRB 2EDTA 5DA4A 4Q9CA 4MD0A 1RHHA 5LGJB 3DX8A 4HPYL 3A6BL 4X6FA 4G43B 5GSVA 4NQCD 3VGGA 4WI3A 2KQNA 2ITDB 1JWUB 3L3JB 1IC5L 4JM4H 1N6UA 3O6FC 2CDEA 4GQPH 1XCQA 3DWTA 3PWPE 4F7TA 4ZYKB 2XRAL 1TVBB 4DKFH 2QL1A 4OLXL 3JVGA 5DD6A 1PY9A 1C8PA 2ADFL 4O2CA 4O5LH 4NKDB 2GJ6B 4Q6IC 4N5ED 4HWBH 3T09A 4I18C 3ZYIA 3H8NA 3A67H 2FBJL 5I71C 4PRIB 2XZAL 5JIIA 3TIDB 1AD0B 5DEFB 2F8XC 4PUBH 4PRAB 4XC1H 1MCBA 4MJIA 5HHMB 4XCYA 2LU4A 5JNYA 4Y5XB 4UIKH 2BSSB 4Z7WB 4ACPA 3AREB 4MCYB 3LQAC 1K8DA 3SDXB 3OGCB 2WIMA 4YPJA 4KQ4H 3QI9C 4LMQI 3SCMA 5F1NB 3ECBB 4JJHA 4K7PY 4Z0BL 4NFCA 1IBGL 1L6XA 3I50L 3QNXA 3LKOB 4P9ML 2XG4A 1G0XA 1Q1JH 2NX5B 3T0XA 1N59A 1MI5E 3GI9L 1A6WL 5HYJA 1E4WH 2OR9L 3UTSB 2GSIB 1BQSA 1EX0A 1PKQA 1T1WA 1LVEA 3GSWB 2F54B 2R23B 3HG1B 2UUDH 3EYUH 3QQ4A 3HI5L 3SDXF 1FYTA 5FUOL 4UINL 3RPIB 1RUQH 2D7OA 2FO1A 1R5WB 3QDJB 3MRGB 4NO5B 1D5MB 1IM9B 3BIKB 5SWZA 2EYTA 3VD9A 1JK8A 3SDYL 5D1QB 4OUUA 2NY0C 4AEHL 3SQOL 1OAUH 12E8L 3RU8H 3LN9A 3P77B 4NFBA 1TQBC 3PQYB 1MCRA 4F80A 4WW2B 4OLXH 3GUTA 1DVFC 1G6RB 3F7YB 3V0VB 2HMIC 5MEPB 4WFFE 2I60H 4Y4FD 3KLHC 1FFOA 4FFWC 4GW4B 5EO9A 4ETQB 3HUJB 4Z95H 1FZKA 3ZKQD 1SYVB 2W0FA 3EOAA 4KJQD 2XZCH 4L5FH 4Y16C 1F45A 1UA6H 3CVHL 3VFRA 4EXPX 3WFBL 4FFWD 2PCPA 2UZXB 3Q6GH 4LFHD 3ZTJG 2F53A 3FQRB 1PSKL 5HI5C 4LP5A 2NY0B 4JZJB 3MGTB 3L7EA 2HRPH 3O2WL 3G5ZA 4JFQB 4K9EC 3VGDA 5BJTA 2DKSA 2EH7L 4RRPA 2IAMD 3QIBB 1L4IA 3WUZA 5C0JA 3VDCA 3CFCL 2JCCA 4D3CH 1RZJH 4XPGL 3VFNB 2FL5A 4IS6B 3F58H 3PGCB 4NQCE 2BRRL 4N0RA 3RHWK 2W92A 1MJ7L 4P4KD 2ZSWA 4GW5B 4K8RC 1KIRB 5DS8A 3DX6A 1CICB 1RURH 4MNGE 4PGEB 3SO3B 3WS3B 4HC1H 3HA0A 3VRLF 1Q0XL 3RVUD 4LVEA 4WDIA 3NZHL 1L7IL 3L9RA 4MAUH 2IBGA 1GOGA 4R8WL 4PFEA 4S0SD 1LILA 4M6OL 3WFCH 4FXKB 2EKSA 3QH3B 3P4MA 1CFQB 4Z7QE 4P5KA 3NABH 1CDJA 5HD8C 3IDGB 3S3PA 4WTXA 4YDIL 2RR3A 5IF0B 3JWOL 4WW1B 4AENB 4QNPF 4KQ3L 4LRNH 5L9DH 3QIUA 5EIVA 2OTWA 2E27H 5IVXE 4WGWB 4HT1H 1IQWL 4GUPB 4NQDA 4BFGA 3U79A 3FFCA 3DUUA 4KKLD 1OL0A 4I0PB 1P9MC 4WRLA 1T04A 3LRSA 1CTOA 4HUMB 2FECL 2FDBP 3TN0A 1LE9B 3D2UB 4FXLA 4GMTL 5EU6D 3O3BA 2ITDA 4M7ZC 4ELKB 4UT7H 4APQA 1BD2A 1C5BL 1OVZA 2MPAH 2AJYL 3VI4E 4MD5B 3BRDA 4G9FE 2VLRB 3BZ4A 1GAFL 5JW3L 5FUCE 1UYWL 2AABL 3MRKB 3ZE0E 5TDNB 4UOJA 2VITA 2J8UB 3MXVH 4MXVE 2OZ4A 1K3ZA 2NLJB 1T83C 4Y5XC 1F02I 1H5BA 1IILE 5MP6H 4ONGH 1WWCA 3EYFA 3JWDH 5HGAB 2EYSB 1DBJH 5DJCA 5FO8B 5CFHA 3N06B 2R8SH 2GUOA 5MHSD 4X4ME 3JV0A 2DKUA 3SGEI 1EZVY 4L4VA 3IKKA 4L4TE 2LFGA 4ZFGH 3X12B 3CH1B 3NCYP 1FPTH 2EIBA 3SDAB 2NY6D 1XF4B 5CP3A 3LD8C 2DYPB 4MQSB 1R3HB 3CSGA 4PD4J 5DK0B 4CRPA 2VABA 1EO7A 3E0GA 4XVUC 1IKNC 2AS5M 4HK0A 5ALCH 2DQUH 1UCBL 4KKLC 3C9NA 3RBSA 1HINH 2G5RA 3GJFA 5FYKH 1U8QB 4X4YB 3NABL 2O5ZH 1T20A 4LVNC 2XWTB 1SY6A 4KJWC 4FFVD 2AV1A 4KQ3H 5F6IC 5C2BL 5K9KB 2ZCLH 3QHFL 2UZIH 5KVMC 2Q86A 4PREA 1MLBB 3EHBC 3QO0B 1QKZL 4PY7A 3WFEH 2EIEA 3L7FB 1W72A 2R1XB 4MNHB 4RGOH 4P46B 5CGYD 5E9DA 4AJ0A 4NJ9L 3ZKND 3GSXB 3OJDB 2EXYD 5L2JB 3NIDF 4P0DA 3RHWF 4K9EL 1WCBA 2EC8A 5EUKB 4UMGA 4PJHE 4RIRA 3MNZA 4X0KB 2M1KA 4OFIA 2Z35B 1A6TB 2Z31A 5T5NF 3V52L 1DN0A 2IFFL 2Y5EA 4DN3L 1CFTA 2DN7A 5BV7C 2VE6B 1LEGB 1IGTB 4GRWH 2CJUL 4UT6L 4JANB 1JNJA 3VCLB 5JPNB 2VDQL 4RGMC 4ONGL 2WW8A 2FEEI 4JDVB 3QBTB 1EGJH 4XMKL 3D48R 2P4AB 4UU9B 5CAYB 4YZFF 2FR4B 2F53B 4QHMB 5EORL 3NCCB 2O61A 1UWEH 3KYMB 3GIZH 4X83A 3C5ZA 2K1MA 2DM4A 3AAZA 1RUKH 5FHAL 2Q1EA 1NBVH 5CEYA 3GM8A 3LV3A 4EI5C 1Z9MA 3KJ6H 2IGFH 1BWMA 2AJSL 5DO2D 3TA3C 1CBVH 5ACZA 4DAGH 3STZB 2Q87A 2VZ3A 4Y16A 5TF0A 3MRFB 4XMLL 2EDJA 4GBXA 1MNUH 4OFVA 3OKDA 4KDTC 3KPNA 5DVLA 5JORA 4CN1A 2PW2B 3MROB 4H88H 4EKXA 1RFDL 3DX7B 4UILL 4XGZB 4DVBB 4TOYL 3F7PC 2GTWB 4U6VH 3T3PE 3QIWA 1R3IL 1EDQA 1I9RH 4JHAH 1UJ3A 3GI8L 4GW1B 2BK8A 4MQXD 4KQ4L 5FKAB 3C6LA 1YJDH 4NKMB 1HHGB 4HS3B 2YBRA 5J7CC 4JB9L 2V2XB 3PDGA 3OKOA 5GRWA 5KG9B 4UB0L 2EZ0D 3HI1A 4TUOB 3TPKA 2EDNA 4I0PA 4D0DB 1XGUA 3P0VL 1FLTX 5KSVB 1IE5A 3WIIL 1RJYB 1XGPB 5BRZD 3U2SB 2HFEA 3D3VE 4AEIL 4K3DH 1J7VR 4EN3A 4X7SH 3TV3L 1NCBL 3JTTB 3VXMD 3H9SB 1A5FH 4MD5A 1FL6B 4UT9L 5FM5M 2CLZB 1T5XA 5L8KB 1CGXA 1Y0LA 5AZ2H 3L5IA 4PJCB 3ARGB 2AK4E 2BSED 4FN0A 4E41A 3ARFD 1A2YB 3LD8B 3MX0A 4XP1H 3TVMD 3IJSA 1VFUA 2AJXH 1VSCA 4LHUG 4CJ1A 4TSAH 3T3ME 3VXUE 5TDOB 3K2UL 1I7UB 1ZLVH 4P5TC 4QYOB 3CC5A 1NGXB 4Q74A 5HGGS 1KLGB 2D3VA 3N1GC 4JO2L 2AVGA 2VXTL 1GHFH 2XZZA 1E4XI 2WNGA 1C5DA 1MVUA 1CT8B 3E3QE 4IRZL 1OSPH 3RUGB 4HF5L 5GRXG 5IQ9B 1V8HA 2VSCA 4WGVB 5DRZA 4OIAA 3GK8L 3EOTH 1HOCA 2YK1L 2WZPD 2FCBA 1LK2B 3B5GA 4ZTPL 3TF7C 3O2DH 1BIIA 2DQGH 2X70A 2A9NH 2UWEF 2BOBA 3AB0B 4MJ6A 4Z7UE 2WBJC 3O8XD 5J1AA 4DKDC 1NCTA 1U8QA 2BFVH 2DB8A 1N8ZA 2EH7H 5IGXH 5FECB 4JHAL 1KEGH 4KK5C 2Z31C 1J9CT 3SJVD 3EO0B 1BJ1H 1MHHA 4NCC2 4LKXA 1JPFB 3QQ3B 4U1IA 5K9QI 5LG1A 1P53A 2WINB 3HZKA 5D7KD 3QXAA 3QEGL 4X8JB 2C4FU 3QO0A 4TVPD 4NM4L 3UBXA 2BMKA 3QZWA 1OTSC 5CJ8A 4PJGA 1D9KD 3M1BB 5LXGH 4AT6B 4Y4FB 4P46A 5E9DB 5D4QA 1BJMA 4JRYE 1INQA 4OZHE 4RA0C 3T08A 3LEXA 3SKMA 3TNMB 2QKIB 1NH6A 1D5BB 4X7TA 4XAWH 3TA3D 3TBWA 3WXWL 3UTPE 5HHQB 1DANU 3O4OB 3CFKA 3CH8A 2JB5H 2PXYD 2VE6A 4NZRL 1HCFX 2OXHA 2FHCA 2DL9A 3SDAD 4V2CB 5J12C 1GGCL 4X6CE 2DLTA 3W2DH 3Q48A 1JMXA 3K8KA 4P57A 4PP2A 3ROOB 5LGKA 5IWLC 5CJBA 4JDZB 4I0KA 1RZJC 5FYKU 1KCSL 4ORGB 1TFHA 2VXVH 3RI5K 5DD5L 3UJJL 5EZOL 5LQBH 3C60A 2A9MH 2ERJC 25C8H 5FYJH 2ZJSL 1LP9F 1AXTL 3EYOB 4LLMB 1JRHL 4IDJL 3O0RH 4DWHA 3JTSB 1IARB 3QDMD 4KZDH 3ULUF 1AO7A 1JWMB 3BZFB 1E4KC 2P5WD 1JPTL 5GGSY 3CCHA 5CWSA 2WUCH 4ZOBA 1C5BH 2MPAL 4PRIE 1TTFA 2WBJB 3B9AA 1MI5A 4GKNA 3IU4H 5H2BA 1GZQB 4KJYA 4YDVB 3KJ4C 2EICA 3OKKA 4XCNB 1IM3A 2E7HA 4ESKA 3T0ED 1Q9WA 3QULB 1CL7L 3MJ7B 2MCPH 4KAQL 5EN2A 1E27B 2KH2B 3H0TB 5C0IB 3ZT6A 4K07A 4OF0A 5C0NC 1NSNL 2GCYA 1KLUA 4LPYA 4HWEH 4MVBD 2OLDA 5MEOB 1ZHNB 2WQ8A 2I07B 4PRNA 1UJTA 5E4EB 3T3PF 1UJ3B 1H3XA 3RAJH 3ARGC 1T89C 1S5IH 1N2RA 3STLB 4MJ4A 3QUYC 1Q1JL 3VGAC 3TYFA 1F3JA 4HV8A 3T2PA 5IMKA 4HCRL 1UADC 4MAYB 3QJFB 2FB4L 5GXBB 1OGTB 5B8CA 2Y06H 1ZHBA 4NKIL 2VXQL 4ZUUB 1F4AA 4LCYB 5IB1A 3BESR 4NRXB 1FO0A 3WV0A 3GFUA 4QNPE 3MJ6A 2HFEB 1WLHA 4HBQA 1T1ZA 1G9EA 1FVEB 5EU5A 2ZJSH 3EFDL 4EN3B 1AXTH 5E4EC 4CNIB 2A83B 1U8MA 4PV8B 3GKWH 3MACL 3D39D 2ED8A 3SKNB 1UVQB 4J3WA 1GPOH 3VXRA 5J9PA 2EH8H 1I8IA 2X44D 5D7KE 2LAAA 3K8MA 2F8VA 5DMYA 5DMIH 4C83A 3OTTA 2UWEE 3D69B 5CINH 4MJ5B 4TTDC 1J8HA 1VENA 2XI9A 3U1SL 3BWAA 3GSRA 4U4BA 2MOVA 2XQBL 1LEKA 4BZ2H 3RY6A 1I7UA 4O58H 3UPAA 5I1HL 3LKRA 1RZIA 3PGDA 1N6QH 3HRZB 4Z95L 4JY4A 2QQNL 3TO4B 2W07A 1X5XA 2Z92B 5CSZA 1MRFH 1IAIM 3VWJB 4NC0B 3ZE1E 3SDDA 3ARRA 1TLKA 5GSVB 1MFAL 5ACLA 2YD7A 3QYCA 3UJIL 3IRZA 1ULVA 3IFLH 1UWEL 1S5HB 1AR1C 1T22B 4TNVF 1XR8A 3C2SA 5HJ3A 5EC2B 1IC7L 1HSBA 3QI9A 2W1NA 5D6CB 2ERJB 3WLBA 5DJ2A 2VISB 1B4RA 1MAKA 2ARJQ 4JPVL 2ED7A 4GG6F 4NN6B 1RZ8B 3L3GB 1GL4B 1U8JB 3MRHB 3WNKA 5ADPH 4NDMB 1VPOH 4HGMA 3HS0B 2G60H 4LK4A 5FKPB 3RWEA 2D31B 5SWZE 4LGSB 3VXSE 4Y19B 1NCDL 2IBZY 2GJJA 4E42B 4AG4L 3WIFA 2KPNA 4WWKA 1HEZA 3OKNA 1GOHA 1QVOB 1KJ2H 4LMQE 1QUNA 4PS4L 2CKBL 2E3VA 2PO6B 3SQBA 5CGYC 3BDBA 5E6IB 1AXSB 4IM8A 5TQ2L 3REVA 5EUOE 5J6HB 4JDTL 3FTGB 3NFSH 4ZSOE 1KOAA 3WUWG 4XNMA 3RTQA 2ADIB 1LO5B 5E08H 1MHEA 3GB7A 3MFFA 3RKPA 3P11L 5C09D 4MA1B 4MVBC 2JCCF 3EYOA 2VWEC 2XQBH 5EUOB 5F7EL 5ANMA 4Z77A 1T89A 4FOMA 4V2BA 5JNYB 1X7QA 1CXHA 1GC1L 4OQTH 2BY0A 2QSCL 3QXUA 1ZTXL 5HHOA 1XCTB 3WDHA 3OGCA 1UB6A 3O6KH 4OGYL 4OZ4B 4YHNA 4EVNB 2H1PL 4JGJA 4ODUA 4AY0A 1QR1A 4HFWA 5IBUG 2OSLA 3DMMC 1WEJH 3BP6B 4Z78B 1DBBH 4D0CB 4JJ5B 1FLRH 3QFJE 5EULV 3QHZH 4IBLT 1KGCE 1CFVL 1HE7A 1MCOH 4CVXA 2ZCLL 5F7NC 4PJBA 3O4LB 5KAQG 2FJFB 4IMKA 4LCCC 5BW7A 1U8OB 1RIVL 4K8RD 2XICA 5HHNA 2E7LC 1MRCL 2IJ0C 1JWSA 3TZVD 4HWNA 2BVQA 3L5WA 4NNPH 2X4UB 2VLKB 3O41B 3QUMA 5MI0B 2YUWA 1HQ4A 1J87A 3IS1X 4A2MA 1Q9LA 1MAJA 1FZKB 2P5EE 5FGCE 2GCYB 3LMJL 1KLUB 2XWBA 5E7FA 2VLJE 4NUJB 2OX5A 3RGVD 4HXBL 3MV7B 5D1QA 3EO9H 2B8OT 2PCPB 2A38A 3EOTL 5E8NA 2CJUH 1HSAB 3JWNC 1MCPH 1KC5L 1MCFA 3SBWC 1T6WA 2ZZUT 4KHXL 3QEHB 4RISL 4PGJA 3VXPB 5IMKB 4MA8H 1A8JH 4BH7A 5AWNL 2P45B 2E6PA 3QJFA 1JYVA 1I8KB 4KKAC 2FSEA 5I75B 2XFXB 2UYLA 3VFSB 3K8LA 3WYRA 3SKOA 1M1SA 3LRHA 1G7QA 1FVEA 5EU5B 1FH5H 3VG9B 5HVGB 4BK5A 3ILPA 2AEPH 4ISVA 5EBMA 4ZNEA 3I75B 3KDMB 5E99L 4KI1A 5F7EH 5GZOC 5E94B 3VD5A 1CBVL 3K1KC 1I8IB 5EPMA 2ZCHL 5AZEL 3ARTA 5DEFA 4QHNB 1TNMA 5EIIB 3G5YB 5E03A 5D7LA 1F3DH 4N8CH 5L8LB 3ZTNL 4HZLB 4XP4H 2Z93B 4H1LH 1AP2B 4YXLH 1P7QD 4PGEA 2NY1B 3D85A 3MCLH 4IRJB 2HVKA 3PHQA 2DJ4A 2DOCA 4EIZC 2ZCKL 3E2HC 5H35B 2ID5A 5T1LD 5TQ0L 2XG5A 2X9XA 3RGVA 1LEIA 2RHEA 1T1WB 3O3EB 5LKNA 3QO1A 2WM0A 1MCWW 3VXQB 1NGQH 1B0GB 4YBLB 3UX9B 4H5SB 1U8LA 1FYTB 2ADGA 4PRBB 2P47B 5EZJB 1G9NH 2ICWB 4XPHL 1U95A 4P5TD 4H25B 1AI1H 1ITCA 2IBZX 2BDNL 4ZSOA 4RMRA 3WHXB 3L3GA 2APTA 3H3KA 1GC1C 3MLUH 2GUOB 3N9GL 1NEZG 5BVPL 1QNZL 5FXCH 5C0RH 3QFDA 1BD2B 2SEBA 3TVMC 3GUTB 3BRGC 3WIFB 3I02A 4E41E 5IR1A 1BFVH 4LCIL 5ANME 3EDDA 4YFLF 4JY6B 2YD5A 2P5WA 3CFJA 4LNVA 1X9QA 4C4KT 2EZ0C 3BE1H 2YD6A 4JFED 3KPLA 1JGUL 4BSWB 4LQ1A 4FP8L 3EOYG 4HQQH 1LO5A 4ZS6C 3HZMA 5EU4A 1CGYA 5JOFA 1N6VA 4G8FA 2IH3A 3T0EA 1YNTA 5LJYH 2HJLB 4I2XB 5EO1B 5D7IA 1LE5B 4OI7A 4MXWH 4Z7QF 3FT2B 4J12A 1I9JH 1CLOL 3T4YB 1FNSL 1ZEAH 4K3DL 3O3AA 2FD6L 2ARJB 1QBLL 3G9VA 5IGXL 3T2QA 1U3HC 1W8OA 5I6XC 3N1PC 3VXUB 2P5EA 4QF1B 2YKLH 2I24N 4QRRD 3TIEA 3RVTC 1F90L 5IK3B 5AZ2L 2EO1A 4RIRB 4X0KA 3WN5C 4KJPC 4PR5B 4YHYC 4JG1L 3RZCC 1P2CB 3ESVF 2FGWL 4HWUA 3NPZB 3T4AA 5GGSA 1FC2D 5DYOB 5E70A 3NZ8A 3T2NH 3FMGL 4ODVL 3T0WA 2DLFH 1OGAE 3LS4H 3MV9E 5GZOD 4LLDA 1UENA 5GS0D 3WNPA 4HGKC 3O8XA 2XYCA 1GGIH 4Z7UB 1IMHC 2DQTH 1AC0A 3O6LH 5HYJE 1ZHLB 4F7CB 4L9LB 4HWBL 3LSOB 3V5KA 1KNOB 5C0EA 1AKJB 4K2UL 3WXVL 2FRGP 4P9HH 1JPST 1IC4H 2FEDD 2Z31B 5C0BD 3DUUB 1IL1B 1WISA 3D9AL 4I48A 1T04B 5F1IB 4LHUB 4LSQH 4MS8C 5FOJA 5DWUH 3D39A 5JR1L 4XC1L 3KYMA 1M7DA 2IAMA 2NXZC 3PWVB 5KSAD 1XF5A 2RIKA 5LQBL 4DK3A 2H3NB 4S2SB 5C6PB 5KW9H 3IJHA 1CDYA 4JPKL 1RULL 3ARVA 2GK2A 4PRPD 2Q7YB 5D7LE 2CR6A 4KZDL 1JF5A 1MFBH 5I8KL 4ZAKB 3CPLA 2Y07H 1EEQA 1MJJA 4UNVA 2NY1D 3L3IA 1T1YB 4R7NB 5C6TH 2Z8VC 3B43A 4LCCA 1F6AB 4HKJA 1L7TH 1V3KA 4DW2H 4W4OC 3VWKC 5C9JB 2EYRB 5C0AA 4XP9L 3BKYH 4NQUA 4S10A 4GRLB 5FB8A 5T1LB 1UH4A 2F8OA 2KBGA 4NFDA 5ILTL 3MMEB 5EWIH 2R9HD 3HMWH 1CR9H 4X5XA 1D6EA 4FQLH 1ORSA 2QSTA 4UINH 4OCXL 1CDIA 1CL7H 1SJHB 1G9ML 5FKAA 3DHMA 3WIHH 4GBXB 4ZD3L 3OB0H 2W9EL 4NQDD 5IMLB 1L0XA 2E7MA 1BIHA 1R6VA 1CXIA 2FWOA 1BFOA 1KT2B 4FQXB 4HWEL 4S1SH 4O4YL 4D9RD 5HD8D 4YUEL 3MLRL 1II4E 3GBML 1NLDH 4L1DA 4X4YA 1BECA 2I60L 3FB5A 1JL8A 4NKOB 4NN7C 4OM1H 4OQTL 3S36L 2H2PC 1TJGH 1ZTXH 1BQLH 4B5EA 1S5IL 3KPRE 5JO5B 4XX1G 4LARL 3D0VB 4PREB 1RUMH 5AG8A 4NWUL 1TZIA 3H2WA 4GRMA 4PJDE 1JP5A 5F88B 1BQHB 2GJ6D 2VC2L 3WLWC 5DWUL 4AH2A 2P46B 1FLRL 3GMRB 1WZMA 3A6CH 3FQUB 5IFAH 1NGWA 2DWEB 1X5LA 2PO6D 2X7LB 3QUMH 5KSBE 3IFOA 4LSSL 5BZDA 1BM3H 3D0LB 3QPXH 3RTQD 5L88H 3PP4H 1UKQA 1RJZB 4NUGH 1PG7H 4ZFOL 5C07E 4C56D 1CFTB 4ZFZA 5CD5D 5F9OL 1QSED 4P48A 5DHVB 3MZTA 3MFGB 5I8KH 4XBGB 5JPMA 4Y89A 3ULUD 1BF8A 4HGWB 3V8OA 5C09B 4CADB 4HFUL 5TJWK 3S4SG 4NM8H 3BP7B 4WHTA 3ARGA 4K71C 1AR1D 4XT1C 3SE3C 4WTZA 2GJZB 2Z4QA 3RWGB 5TFSH 3EO9L 3RIAK 4WHYH 3ZKSD 3HN3A 1NJ9B 2EDWA 1ND0A 1QFUH 4GBXC 5I1HH 1NC2A 2FR4A 1INDH 4UTBL 3U7WH 2JK5A 1AR2A 3FO9A 5HGHB 1HXMA 1I9EA 3EO0A 1G7PA 2GY5A 4RMVA 1NCAL 3KXFA 3QISA 2IH3B 1PYWA 1YYLL 1ZLUH 1LE5A 1FG2A 4KKCD 4JO3L 4MD0B 4LNRB 3IRPX 4GS7B 3UTQA 1HDMA 5LWYH 3MLVL 4CMMA 4NZTL 2ITCB 3KGRA 4RBPK 3U0TB 5E99H 3S96A 4L8BB 2X4PA 2X4RB 3I6GA 2ATPB 1REIA 4F7EA 1FZJA 1MIEL 1MY7A 2JIXB 4DQOL 4Z8FL 1RUAH 3ZHKA 2UVEA 4XP5H 2G9HA 2YA2A 1KULA 1T0MA 3HC0B 5DMKB 3VG9C 2RFXA 3BYYA 3DX7A 1RZFL 3UMTA 4OCWL 3V4VL 4F9PC 4A6YL 2F19L 1J0HA 1OP9A 4XXDA 1EA9C 4RGNB 3MLTB 5I18L 1GGYA 3BQUC 2OM5A 5ENWB 2C3XA 5J4MA 2HFTA 4POYA 3F6LA 4LLDB 3IKCB 3ARYA 4O58L 5CZXC 4EUPA 1IAMA 3QDGB 3W11C 5GJTH 1QBAA 1A7PH 2R9HC 4L8CA 3U36B 2XY2A 3O2DA 4J3UA 5FIEA 3TCXA 4TSBH 3V6OE 4ZDHB 5CEZE 5I16A 5J0BA 2CLRB 4I3RL 4TVSa 4N1CA 3N85H 3ARGD 5TE7H 4M7KH 5C0FB 3RZCA 4C56E 1QFPA 4KK8C 3UJTL 4JFZL 4M5YL 1Y6KR 3UTZA 1T7XA 3MJGX 5F1NA 4H8WH 1XF5B 2GSGA 3RL2B 4P57B 1AHWB 1AQDB 3LS5H 4DGYL 3ZSSA 3BH9B 4AQ1B 4PJ8D 2AQ2A 4Y19E 5IV2B 2X4OA 4KFZC 1MCNA 2DWDB 4Y5VB 3HRPA 1RU9L 4WY7H 1QLRA 2DRUA 3BDYL 1OM3H 2A0LD 1H3WM 2BDNH 4PGCB 1A2YA 4KTYA 3P73B 4K7PX 5E2UL 2UVFA 2H45A 3UROR 4NJAL 1MWAA 4PBXA 1OLZA 5ICYB 1EHNA 3X3GL 2WBJA 4JQIH 1NANH 1Q9KB 1QKZH 4HUNB 5IMMA 3W39B 1ZHNA 2JJSC 4KJYB 1JHLH 4PPTA 4R90H 3BVNB 4WO4B 4EIGB 4RSVA 2NR6D 1IM3B 1CXKA 1A7QL 1N7ML 5EOQH 1MQKL 2VXUH 4POZC 3U6RB 1JGUH 1XGYL 3SDDC 4G8GE 4MB3A 4NC1C 5IVXB 5KSBF 1D3CA 3U9UB 5ISZD 4FQXA 3D2UD 3P9MB 4F7PA 4FABL 1FN4A 5KSBA 4POZD 1E6OL 1QSVA 4MA7H 3HE6D 1OGAD 1Q0XH 4IOFD 4HUXA 4G6FD 1WWAX 2AJVH 5KVDL 1GC1H 4FTVD 2MFNA 4ZS7L 5B39A 3W5MA 3R06B 4I9WD 3ZL4L 4UV4L 4EOWL 3LDBC 4OKDA 4Z9KB 2X4QA 3MREA 1AGFA 5T1KD 2FYYB 4IEFB 2ENSA 1X6NA 1WEJL 1N5YL 5KS9E 5FGSA 3HR5A 5ICXA 1EERB 2BNRD 4AEFA 4KH2A 5D8JL 3IDYB 2DIJA 2HLFD 3BD4A 2V5YA 3U4EA 4OZHF 3V79C 2MMXA 3INUH 3MV7E 5IFJA 3HCVA 2MTPA 3LB6C 2VR9A 5FUZL 5TDPA 4U6YB 2W9DH 3LKRB 4TRPH 3I9GL 1U8MB 4U1KB 3FN0L 1BZ9B 2BHYA 2PKDA 3O6FA 4QXWA 5I8CB 5E2UH 4UT7L 4XVJL 4DKEH 3PWPB 1JGEB 1B2WL 3CVIH 5C7XL 3TFKC 4S1QH 4IRSA 4LLMA 3RDTA 1EK3A 3NCMA 4JRWA 4O2FA 1S7UA 3MXVL 5DD3H 2VQ1A 1BGXH 1ZLWK 5ESQB 5K9JH 1XR8B 5IBTL 2ESVD 5FFLA 2VJXA 1AO7B 2NW2B 3BZFA 3SDCA 2P24A 4M7LH 5A3ID 5DRXA 4O51A 1GXEA 3FFCB 3MOBH 4U3XA 3UCRA 3O11B 1PYWB 2DQHL 5ITBL 2EEDA 3A6BH 1BFTA 1HDMB 4UB0H 3V6ZA 1IAOA 2CDFB 1K4DA 1CGVA 5EZIH 1M05A 4DJMA 3DVGA 3QWOB 3QAZC 1G7HB 4HIXL 1A9BA 4F58L 1NGPH 1DQDL 3ALPA 2DL2A 3QDAA 3OAUL 2BCKA 3R8QA 5KVDH 1QRND 2ZUTA 3MV8A 3I6GB 4L9DA 3QFJA 4JFDD 5DVOA 5JHDD 1YMMD 1BFSA 1R5IA 1DQTA 5FYKL 1QSEB 1KXVC 3QDME 1CR9L 5E8DH 4I77L 4JFPB 3W81A 1PDKA 4YDKL 1DANT 2DBLH 4L29A 3SE9H 1KG0B 4HUVB 1N64H 4PLOB 5DK3A 3DOSA 4L3EE 5HGAA 4FQ1L 2NY7L 3OJ2C 4Q6IA 3MRHA 5CJQL 2UZIL 2ZNWA 4QRUA 4X98A 5DJ6B 3I84A 4EUPB 1MCEA 3GZKA 3WBDA 4GSDH 4K7FA 1HK6A 4F3FB 1JE6A 4GAJH 2VLJA 1HQRB 2DQJH 4LGPB 1U8KB 4XMPL 1A3RH 5CEXB 1R3JB 3CSBA 3QIBA 3MLRH 5JZ7D 1IRAY 2J12B 1J0IA 3K2UH 4QRPD 1D5IL 2I5YL 3U4BH 1ZGLM 2EIZA 4JKPL 2VABB 3FN0H 1KN2L 5CUSH 5I1IH 4LBEA 5KN5A 4NPYA 2XN9D 1ES0B 4L9LC 1CK0H 2O93L 4JAMB 1NGQL 4HFWB 3MRJA 1LK3L 2AXHA 4KKBD 5DD3L 1AGCA 3O2DL 3MRPA 2VDLL 4X7DC 3SKNA 1BOGA 2DYPD 4DTGH 5IB3A 2FX9L 4Z77B 3Q3GA 3PE9A 4LCWD 4KI5F 3IETA 4DGIL 1EVUA 1UM6H 1J1XH 4M3KB 3MOBL 4QOKB 2JJSA 3QH3A 4X6FB 2V5SA 1L6ZA 4IS6A 3WN5B 4P23B 5F9OH 1RV6X 4ZQKA 4MJ5A 1BWWA 1K8IA 2HG5A 3HE6B 4PLJD 4G8GB 1NL0H 4I4WB 3TP4A 2X1XR 5F1SA 5I6XB 3T0EC 4RMTA 3OG6B 1XGQB 4G80B 3WS3A 3L5HA 1OWRM 1CLZL 2LE9A 3D25B 1QTYT 3O4LA 1JUFA 1WSST 3BVNA 1DDHA 5T5FH 1KCVH 2JTDA 2DAVA 2I9LA 5IHZB 5C0ND 2YXMA 5DJAB 3QZWG 4JFDE 3IU3A 1KELH 4Z7VA 4P46D 2BNRB 43C9A 5HHXL 5DTFA 5CD3A 3IDIB 4TN9A 4XPTL 4Z76A 1U3JA 2X5PA 1TTGA 5D72L 4APQB 4XNYL 2BXYA 1YYLH 3ABZA 3RIFF 2MHAB 4JO4H 1J86A 2VLJD 4JZNA 1XH3B 3THML 4GH7B 3UDWC 5JOPE 1UFUA 1MJUL 5DMJB 5C6WH 3SDXA 1H5BB 5F96H 1QBLH 3AAZB 3IAQA 2W91A 4QKXB 5GISL 3UYRL 2I5YH 3U4BL 1KIQB 5IW1B 4P4KC 1SHMA 3AFLA 3QNXB 4YDJA 5DFVC 3GMLA 4HLZG 1I85A 1K2DA 1VEPA 1S7XA 4KXZH 3F65A 4M1DL 2R2EB 3GMPA 3U4EB 4WWKB 1OAZH 3TN0C 3KYOB 4FFZL 2F54A 2DYPA 2R23A 3HG1A 5SX5K 3WLWD 3DSNA 2PUQT 2YRLA 1LDPL 2Y6SC 2L4OA 3FTGA 1FCCA 1BZ9A 2LU3A 5MEQA 4X6DB 5ILTH 3GHEH 1UM6L 3RWFA 1U6AL 4OB5L 4TTDD 5DJCB 3U0WL 2YRZA 1IM9A 3BIKA 1Z5LA 4NNYB 4JZOB 2VLRE 2CKBB 3DXAA 1JGEA 4I3RH 3SE4C 1CG9A 5HVFB 1FP5A 3QG7L 1B4JH 4M43H 1R0AL 2F5BH 2VL5A 3LIZH 1KJ3L 1J05B 1FZMB 4JQVC 4JREC 1XF4A 3O8XC 3PQYA 4PTTA 4QCIB 4NKMA 7FABH 3S6CA 3N1FC 3QEQE 1CN4A 4JN2A 5C0AD 2AJXL 1P5UA 1U91A 3D85B 1KXQE 4G6JH 5KW9L 5KOMC 5KVFH 3WFZA 3VH8G 2XIDA 3UTTB 3I6KA 1I4FA 5DQJA 2XA3A 3Q6FB 2UWEA 5CEZD 4DZ8B 4PJ5B 1NUNB 4W81A 3K4AA 5IW6B 2VZUA 2XWTA 4XWGH 1ROWA 1OSPL 2IADA 2DJUA 4PJDB 1RK0B 1T0PB 5GS3A 4RX4A 4XHJC 1JPSL 4TVPE 2OL3B 3MRRB 3RBGA 1A6WH 1FJ1B 1VADB 32C2B 2YK1H 2BVYA 5EU3B 4KKBC 4DGVH 3C2AL 1NUDA 4HEME 1W72B 1VACB 3CAFA 5I73B 3OF6D 4MAYC 2X40A 1JHLL 2FL5B 4U1JB 1A6UH 3U46B 1RJLB 3ZLQC 1RUQL 3NCFB 4Y4KD 4BSWA 2Z35A 3RVVD 5D5ME 2COQA 4KTEL 1P9MA 1U8PB 3R0MA 5KTEH 4JKMA 4NC2B 3R8BB 8FABB 2F58L 5I15L 3BJLA 5GS0H 1BF2A 5AD0A 4HAFA 1HQRA 3QP3A 4LCWB 1Q0YH 2VUYA 5H37H 4FQJH 4C57C 3L95A 5GGQH 5DUPL 1D9KC 2BVOB 1U6AH 4JDVA 4OB5H 3V6FA 3MTRA 4LLQA 1ES0A 3U7WL 3DO7B 4NZUH 4NZRH 3TO4D 4BK4A 4I3SH 5DI8A 1Q94B 2XA8L 3AC0A 3IDNA 4QGYA 2NXYD 4KJPD 4JFFD 5E1HB 4LAJH 4DUWA 3QQ3A 1X5IA 4FQIL 1GYAA 3GMQB 2AJZB 1S7QB 3C8DA 4KK9C 3F62A 2A9ML 1GZPA 1DVFD 3RWCB 2DTMH 4KI5E 2CIKA 2X1PA 3D3VD 3R1GH 2W9DL 4AT6A 5F70A 3SE3A 1BPVA 3O8XB 4LIQE 4F2MA 4CKVX 3S5LB 4XNUL 4FQCH 2B4CH 3MOAL 3NPSB 4R97C 5E8OA 4XRCB 5JDSA 1T0NB 4YEEA 1T7ZA 3ARED 3T4AB 3PJSA 3V0WL 1PY4A 3VGHA 4WFGD 4ONHA 2V7NA 2Y4SA 1EAPA 2MKWA 4UT6H 1NMCB 3GJEB 3U4AA 4WI9A 4NQSA 2A0LC 3MR9A 4KZEL 2F5AH 2PR4L 4HLZH 3AXLA 1FL5A 3WSQL 1T5XB 4DZBB 5ITBH 3C5SB 3OR6B 4PJCA 1R3HA 3JWOH 3DETC 5EORH 1EFXD 2Z8WC 3O45A 1CF8L 2CRZA 4LEXL 2V7HB 3QWRA 5I8EB 2KZWA 4LLUB 1B0RB 4BFIA 4BKLB 3B8YA 5HGDA 3VXNB 5FB8B 1PX4A 5JDJA 4Y4HA 1NFDA 2R2CA 1B9ZA 4YO0B 1O5DT 5ETUB 2QHRL 1YEFH 4YHML 4Y8DC 4KTDH 4GAYB 3DX9A 2WWKT 2XA8H 3QUXA 5K9KA 2V5MA 3C09B 5HHPB 4PJHA 1MJJB 2VXQH 4FFYH 1KB9J 4R97B 3D85D 2P5WB 3CFJB 3FKUS 3RNQA 2BY3A 3L7FA 4H88L 1VB9A 5IT2L 4X6DA 4XNQA 2EDBA 2PF6A 5L2KA 1YPZB 2RQ8A 4TSBL 5IEHB 1KTRL 2OMNA 3R1GL 4NKOA 5SWSD 3EGSA 1TDQA 1Q72L 1A4KA 3EAKA 3NN8B 4JKPH 3CZFA 3VXMA 5JXEA 1S3KH 1QP1A 3T0EB 4PJ8C 4AMKL 1QRNA 3FRUB 4D0BB 4RAUB 3VG0H 1UWXK 5B21A 3HLAB 2BNRE 5GGVH 3ARFA 3CX5J 1F97A 3E3QC 4PJEE 1BQHA 1JRHI 4YLQT 4Y1AD 2EIDA 2ARJA 3MGOA 3MV7D 1OGTA 4V1DB 2E9WA 2B0SH 4JRXB 2PYEA 4ZO6A 1ZANH 3EJZC 4NNXA 5E5MA 3HNSL 6CGTA 4G8EA 3P30H 2ICEB 2PR4H 3MRDA 1JTTA 3QXVA 4HH8A 1D7FA 2QQKL 3T8XA 5F9DC 2X6MA 3HNTL 4OZIA 2WINA 2XWJB 1WBXB 4WWKD 5DC0A 3C5ZB 3D0VA 4I5BA 2YPKA 1MFAH 5BZWA 5DVNA 3WUWB 2OL3L 3S35L 4XP6H 3EYVA 4ODBD 1JNNH 3S7GA 2Z91A 1QFWH 3DURA 4QLRA 2BSTB 2D03H 3QNZB 1PKOA 3PWUB 3K74B 5KVEL 5ALBL 3SKMB 3TNMA 2AXGA 4PYGA 4MJIB 3V5KB 5T5FL 2D7TH 4PB0L 4RGNC 2M26A 1A22B 4KKAD 4P2RD 5EU7E 5C0EB 1MQKH 2VRAA 5CIPB 2NZ9D 4KGLA 1BZQK 1NC2B 4H20H 2DM3A 1OSZA 1DN2A 4RWHA 1KSRA 1IGML 4WV1B 3JV6A 1H3GA 3ECBA 2QADB 4GRLD 1OB1A 1CDBA 1RUPH 4RDQG 2R4SH 3MYJA 2H8PA 3MBEB 4K8RH 2NTFA 2VR5A 1PKQB 5IBTH 2EXYC 1G7MA 2MCG1 4L8BA 1WWBX 1MHPL 3JTSA 3L3IB 4R7NA 1H8NA 5TF1L 2IPTL 1UKSA 3NFPB 1YY9D 4YXKL 1F6AA 3NFSL 3OB8A 5FM5O 1EBAA 5C8JA 1E27A 3B2UD 1S7VB 2WAHA 2F15A 3EFFA 4LPWA 5F72S 5KSVA 1LO4L 1D5XA 4R96B 4CN4A 1WF5A 4AZ8A 2AK4A 5ENWA 2J6EA 4YDVA 5CMAB 2QSCH 5HDLA 5HDQH 3U0TA 1VGKB 1C7TA 4Y4KB 2R29L 4DN4H 1JVKA 3B9VA 2VXSH 5F9WB 1G6RA 1KCRL 2FIKB 4LF3A 4RFOL 2CLZA 2CLRA 1Y0LB 3HNTH 1GSMA 3HFMH 4ETQA 4XRCA 4LHJB 5DUMH 1LNUA 3PL6A 4O2EB 3MXWH 1J0JA 2OZ4H 4GXVH 4HH9A 4U7SA 5ERWB 2G5BB 5D96B 5KVEH 4PRNB 1VERA 3MC0A 3MR9B 3WFDH 1H0DB 5C9KA 3F7RA 5DJXA 3VE0A 3EOBB 5FYJL 4JPWL 5F97E 1BREA 2Q20A 3KPQA 3BP4A 2HJFB 5IB2B 3GI8H 5DK2B 3OKEA 1MVUB 5DURD 2BZDA 1UXSA 3DSFL 3TYFB 1CCZA 1YN6B 4R4FH 1K5NA 2IF7A 3CD4A 4MDJB 5IB1B 2H9GB 1XFPA 5ICZB 3OAUH 4LSPL 4HX1B 5F21B 1JI1A 1A7RH 4JJ5A 4JM2A 1JYXA 4NCDA 5IV2A 1KB5H 3LEVH 3EIFA 4NHUA 4UQ3B 4WFED 3C5JB 4HGWA 1P7QB 4PLJC 3CZJA 1U8OA 4JFYA 3QG6A 4O9HL 4HG4K 2HN7A 3DVNA 2JCCE 1KTKE 2C1OB 3D39E 4LDOB 1OOAA 2R0ZH 1BVKB 2ZOLA 2I27N 2Y1VA 1KJVB 3TCLB 3QIWC 5CBAB 1MREL 3TIDA 1PZUB 1HQ4B 5EOCJ 4BSVB 3SOBH 5F7LB 2AEPL 4JM4L 1CLZH 3MJ9H 3B9KD 4OAWA 3VGEA 1OCWH 2NCMA 4HIIA 1RZIB 4PJIF 2VDML 1ADQA 4KRPB 3CFBB 5GGQL 5CJOH 2WUBH 1JJUA 5IWLA 5DFVD 3QUXC 3HLAA 4PBWD 4OBRA 4B7IA 1X5KA 2XV6B 9CGTA 1HH9B 2YSSB 2WLYA 3ULSA 5ISZE 5TE6L 1IC1A 1XF1A 1NFIB 1DLHA 1NC4D 3SY0B 2OXGA 3NA9L 5A16A 1YEHL 1FZJB 4ZTPH 1BD2D 5GZND 3WFDL 3H9HA 4G7VL 3BN9D 1XIWD 5IMOB 1ONQA 1RK1A 4ELME 4JY5L 1ZLWH 1JNLL 1FVCA 3O6FB 2BC4A 2NXZD 4L3AA 4P4RA 4XXCA 4ZAKD 3DRQA 4ZUSA 1U9KA 3UC0L 4WIQA 4N90E 2GSIA 3MRMB 1URLA 2YA1A 3I3EA 5EUOA 3OKNB 3U30B 5F6HI 1Q9WB 3SJVA 3HCVB 4YEFA 5I1CL 3B9KC 3QEUB 3HMWL 1GIGL 5CEZH 5GGUB 4XAWL 4HUUA 1FNEB 3MRIA 5J06A 2BNQE 1ORQA 3F5WB 1G7IB 1Q38A 1ACZA 2VYRE 4M3JA 3TT3L 4HULB 3SEPA 1TQCB 2ZKHH 4PRDA 1M71B 3MFFB 4CVXB 3TT1H 4PJBB 1PEWA 3X17A 3MA9L 5AAMA 1KCSH 2FZ3B 1UH2A 2YPVH 3TLRA 4PGCA 5I19L 3UYRH 3EW3B 1QSFD 1L9MA 2LVEA 1OWWA 3H6JA 4XPBH 3BXNB 2VLKA 5DR5H 4U31A 4O51B 2IBBA 3FB7A 5INDA 2ICWJ 3HUJA 4CDGC 3T1FB 4P9MH 4OJFH 4QTIL 3ULUC 4HUVA 2XZQH 1WCBB 1NGZA 1OAZL 2X4NA 1TCRB 3CDYA 4OUOA 5HHMD 3IDUA 3F6IA 1IAIH 1I1AA 3K80A 5FYJD 2CGRL 4PJXB 4AG4H 3LKPA 4LIQL 5E8NB 4PV8A 2BCKB 4M1CD 2I9TB 5FO9A 4KROD 4LCUB 1NC2D 2H6PA 3W5NA 5ECJE 4NWTH 5T1KB 3O41A 1I7ZB 4A2LA 2ZUXA 2B5IB 3EYSL 4ERSL 2FH8A 2PYED 2FSEB 1MRDH 4M1CC 4LBEB 3M17A 2VOTA 3QXDB 3S37X 5HVWA 4Z7VE 2R1YA 3IDXH 1CICA 2O26U 1YYML 4ISVB 2B1AH 3KPMB 5EBMB 1WIOA 3BPCB 3FT4B 1YEGL 5DC9B 1WT5A 3MREB 1QFUL 1XGRB 4G8FB 5IG7A 1WBYA 3L3KA 2PTUA 1L7IH 3LKQB 1OF2A 2AI0H 5H94B 4AIZA 2ZG2A 5I17B 4R8WH 1LE9A 2DQDH 1CDHA 1S7WB 2ZKHL 1DE4B 4OIIL 4QRRE 2DQCH 1K3IA 4YC2B 4P5KB 3STZA 4CVUA 3O3AB 4MMXC 3O3BB 3D9AH 1VFBB 3GSWA 3SKOB 1TXKA 4L1HA 2BY2A 1PSKH 3NH7L 4KVNH 1N0XH 5GGTL 1RZKH 4KRPD 4YZFE 4GBXD 2P7TB 4OV5B 5CSGA 4DFHA 2HT2D 1J0ZA 1P2CA 3TN0D 1HNGA 1KIPB 5E2VH 3W11D 4D3CL 1JZ4A 4NOBA 1F4WH 3HI6L 1T2QH 4XI5C 1BP3B 5T3ZD 1IGMH 1RZFH 5ACMA 2OJZH 3AREC 3HE6A 5F3BB 2Z93A 2B4CL 4JFDA 3CH1A 4ZAKC 2VLRA 5ABDE 1IAIL 5CINL 2NW2A 1SJVA 5J11C 5T33L 4ENEC 1QVOA 5DJYB 2B2XL 1CE1L 3HAEA 2NW3B 4ZMAT 3QDMB 1UWGL 5DLML 1G1YA 4ELMA 1VDGA 3EYFB 1FFNB 4LLAA 1DTUA 3I3BA 2ADIA 2HA1A 2ENYA 2V5RA 3JUYA 3CFDA 1X6LA 4ZD3H 2C3WA 4ZXBA 3V5DB 2IQAA 4G3YH 3IAPA 4JFQA 1AXIB 5E00B 1JPGA 1HHJB 1P4LA 1T1YA 4LHUD 5DK0A 4HKJB 4ODTH 3OR7A 5SV3A 4JG0L 1P7KB 2BNQA 1GGUA 4WUUA 4KK8D 2ZSWB 4GW5A 3UAJD 3TH4T 3WE6B 1F42A 1U0QA 5DD1H 4GG6A 3QFDB 4WWID 5ESVA 3GI9H 1ZA3B 2P5WE 5F3HA 1NQBA 2AXFB 1IJ9A 2AERT 1CFBA 4OFYD 3OXSA 1N0XL 5GGTH 4XP4L 2Q8AL 3BPOB 3KYKH 2LTQB 4LHQB 3LY6A 4R7DB 2EKSB 1YJDC 4JN2B 3P4MB 1U91B 4OF7A 1IKNA 4R4BA 4QTHA 4YHIB 1N4XH 1HIMH 2PO6C 4RGOL 3S3JA 3VXUA 1KB5A 4WO4D 4LAQL 1WCQA 3LPGA 4NQCB 3T3MF 2VLRD 3DSFH 2OR8A 3MRNA 1CF8H 1QFHA 4J3TA 3SQOH 4I2XA 3P0YL 5TFSL 4PTTB 5DYOA 4U7MA 1X5ZA 5M95B 3KPSE 1KACB 2DICA 4GRMB 4WNQA 1AD9B 3LB6D 3EBAA 4FQXD 2NZ9C 4P3DB 3FQUA 3H42H 4YWGL 1EJOL 4YHMH 1I8KA 4U2ZA 3L3DA 4U1JA 2WP3O 4GRWB 2FH6A 2Y25A 1TCRA 2FIRT 3MRLB 1QRKA 3CVHH 4ZFOA 1H15A 2EE2A 4OLZH 1I7TB 5LGHL 3MRRA 3F8UB 2CMRL 3B2VH 5FYLE 4LCUA 2YEZB 4CVZA 3TBVB 4CADA 1Z3GL 4TNWF 1CL7I 1TENA 1KTDA 3BZDA 3HZYA 3LKNB 1E28B 3BPNC 3GO1L 4LPTA