4NZYA

Crystal structure (type-2) of dtmp kinase (st1543) from sulfolobus tokodaii strain7
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
209
structure length
209
Chain Sequence
KGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into Substrate Binding Mechanism in Thymidylate Kinase based on Intrinsic Dynamics of the Active Site
rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords Probable thymidylate kinase
total genus 88
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nzyA00
4YONB 5FL7D 2QM7A 1P2UA 1Q1QA 2QUZA 4EQ6A 3GFPA 4NCHA 3NH9A 2A5JA 4TL9A 2JLYA 1G8PA 2V9PA 1IOZA 3V4RA 4CEIA 2W2XA 2WWXA 4HLUA 1FQJA 2EU8A 3K8YA 2YZ2A 4HB3A 4YMUA 1LW7A 4Q9JA 3TMKA 4EJSB 4Q4HB 1LNZA 4BLTA 2GCOB 2ZJ8A 3D31A 4F91B 1DS6A 2FPKA 3IO3A 1DARA 1OH5A 2VYFA 1N6OA 3MUFA 4W5HA 4X8OA 2EYQA 2XXAA 2F1IA 4Q4AB 1S8FA 4WBSA 2OESA 2IK8A 4H9GA 5H1YA 4QG7A 1E0JA 2WAYA 1AQYA 3SN6A 4CT5A 1L4YA 2ZTSA 1G64A 3MRSA 3K0SA 1YKSA 3CF6R 3C8UA 3QPVA 4DSUA 1XTSA 2V8OA 1A1VA 4B76A 3PUZA 4OI0A 3QY0A 1E2FA 2W6JA 1T3SA 3IQWA 4LI0A 3BWDD 4A4DA 3HYTA 1AQUA 1KGDA 2DFKB 3B9QA 1KNQA 1QHYA 5FBWB 4LBZA 4DLSA 1XD9A 1NVUQ 3N70A 3DL0A 4TN1A 4HEJA 4LJ9A 1E99A 3IBYA 1JJVA 1DOAA 2A7QA 3A1SA 3OF5A 4QM6A 2CCGA 1E2KA 1XD2A 1KZ7B 4U5XA 3MG9A 2ZRMA 3P1JA 2IYLD 1DO0A 5C46F 2P3SA 3C4JA 4K8OA 4OHWA 2FFHA 4NHOA 2OLJA 4BZQA 2XNDA 4Q66C 2JLZA 2F43A 5H8WA 3P27A 4B34A 2E1RA 4Q7JB 1QVRA 4N3NA 1TTTA 5FUVA 2CJWB 3PR1A 3WBJA 5HZHA 2X77A 5JHHB 1P2SA 3UANA 1U9IC 2G6BA 2YVUA 1B0UA 1G5PA 4H1VA 1AS0A 3I8SA 4KFUA 2J7PD 1RRPA 4ZDWA 3KKNA 3Q5EA 5FPTA 3O8DA 3OEHD 1WF3A 3IEVA 4Q47A 2PT5A 1II9A 1D9XA 2HF8A 4KBFA 4MITA 2BMJA 4CZ2A 1HA3A 2A30A 1E2PA 721PA 5JFGA 4JLPA 2OV2A 1G16A 1N0VC 3TUIC 2ZVQX 4BLQA 4QOSA 4F4IA 4QGAA 5K8LA 2EFGA 2ZVPX 4MKGA 2P65A 1A4RA 1IJEA 4O0MA 1XU4A 3QKRB 2LKCA 1ETUA 1OT3A 3U6KA 1OV4A 1UBFA 3L43A 3UMRA 4QM7A 1U8YA 1SKQA 1CBUA 2GZAA 4PHHA 2YC2C 4A0GA 2XGJA 3HWSA 5M04A 1E1RA 2BIFA 4PR0A 1KDOA 3LD9A 1W4RA 1G4UR 2A5GA 3WYGA 1VYUA 2HXSA 1GUAA 1F5NA 2WVJA 1MR3F 1L4UA 1XD2B 4EJSC 4JYBA 1M7HA 3EXAA 4FCTA 4CGZA 3TSZA 4BGDA 1Z6XA 1F3OA 4G5QA 5DYIA 2KSQA 1W4BA 2MSCB 2YWEA 3AP3A 1N6RA 1YU9A 4JSYA 4NCKA 1P4SA 4JL6A 3PIRA 4TYWA 5IDVA 4URYR 1M74A 2ZSAA 5ANRB 3K9LA 5TMPA 4HSEA 3RS3A 1NBMA 4BWYA 4PSKA 4PXAA 4URZR 4D0NA 3B1XA 2BBSA 3B82A 2IWHA 4EPXA 4LBYA 2ZI4A 4YDHB 5EP4A 3EC2A 5HR5A 1KOFA 1Z6TA 4L9SA 4TMXA 4PO9A 4KYUA 1BMFA 1OYYA 5KNBA 1Z0JA 2OCBA 4LHXA 4HDQB 3TVDA 3PFIA 1N6PA 5DN6A 4A9AA 5DSZA 3KKQA 2ORWA 4R71A 4JLVA 1VIAA 3B1YA 4PFSA 3GEHA 3W8NA 4IOMA 4US1R 3LVQE 2NIPA 1E9BA 1R5NA 4Q4AA 1WDTA 4PC7A 2BMDA 3FKQA 4MRSA 1HT1E 2Q3FA 1OF1A 4KSBA 1RC8A 1F2UA 2LWIA 3PG5A 1W0KD 2IA5A 2OUKA 2VL7A 2BCJQ 2CCKA 3VKHA 1G4AE 2KWIA 1ZJ6A 2A5YB 2GA8A 2O8BB 1IY1A 2ZS8A 3GLGA 2OFWA 3QG5A 3ZS8A 2WM9B 1YZLA 1MRSA 1N5KA 3IBGA 4LC1A 3MWJA 5FPHA 3WMGA 3RABA 1U90A 1IXSB 2FZ4A 3ZZUA 3VAAA 4DKXA 2REXB 4A15A 1W5SA 4V0LA 3Q7PA 4B32A 3QQ5A 5FL7A 3ZVLA 3OE7D 2O8EA 3LX5A 4ARZB 2PH1A 3K70C 1ZAKA 2HT6A 3RRNA 4C0LA 5D3MA 3CX7A 1Z06A 2GEDA 4CEJB 3PUVA 4B3XA 1XTQA 1II8B 3L0SA 3VX4A 4EPVA 2XNSA 3SR0A 3CNNA 3RWOA 1CKEA 5BYKA 3GFOA 3JVVA 2GKSA 2HLDD 3AF2A 2UZ3A 1FP6A 2FSHA 3KJGA 4EAQA 1IQPA 1HV8A 1N2CE 1TQ4A 4C0QC 4JBWA 1DG3A 4V0MA 3UIEA 2R44A 3FKSA 1OE0A 4F4CA 2BWJA 3B1ZA 3EG5A 4IKEA 1VKJA 4LJAA 2WICA 1F6BA 2PT7A 4B73A 5LPNA 1AZSC 4HZUA 2RGGA 3A1VA 4AYWA 4AK9A 1A7JA 4JLOA 2RGDA 3OAAD 2H16A 3CWZA 5GVSA 3AVWA 3VQTA 1W46A 4UJ5A 3BH7A 1VMAA 2WKQA 2AKYA 3ZZTA 3QIAA 1XXHE 4DLZA 4HAYA 3VR1A 2QP4A 2DPXA 2V55B 1OKKA 5KO2A 2GRJA 3KX2A 2QRZA 5FTNA 4Q7LA 1K5GA 3AP1A 1W47A 1W49A 2ORIA 3PEYA 4LJ7A 5CLQA 3U7GA 2F3TA 5KHOC 3P4XA 3IPYA 4IDPA 5H68A 3U4QB 2FZLA 1P61B 1TQDA 1NRJB 1NMYA 1G41A 3BB3A 3A58B 4WOPA 1OXVA 1DEKA 1Q21A 2V1UA 2ODWA 3FTQA 4BLRA 2HYIC 1RJ9A 2QQEA 2OO7A 1E9RA 1LVGA 2ODBA 2YV5A 4KFSA 4FCVA 3Q3JB 4EDHA 4O25A 5A4JA 2AXNA 1RJ9B 2JLQA 2CLSA 3I32A 3RSOA 5C2JB 5C18A 5H70A 4HDCA 1XTRA 2QQ0A 1MH1A 3AP2A 4IDNA 3U5ZB 2XOKD 2WWGA 4M0LA 3VTKA 2ZR0A 1Z5ZA 3RS5A 4DCUA 3RS4A 3SBEA 1NLYA 3KTAA 1H8HD 4GOJA 1TNDA 4LJ6A 3ZYCA 5FBQB 4DLWA 1VG1A 2ERXA 2XZOA 3X2SA 1S2MA 3TGPA 1UAAA 4K46A 1XEFA 1YZTA 2H57A 4Q9KA 3SYKA 2QT0A 1UDWA 3KZ1E 1XCMA 4CEHB 1TUIA 2FFAA 1EFUA 4PPNA 5SZJA 3S1AA 4XIGS 4LYHA 3VNVA 4ZCMA 3EZ2A 1NJGA 3DKPA 1J7KA 3EARA 5LDDC 5FUXA 4UJ3A 5SZHB 4MRVA 4P4UA 4M1SA 4YMSA 4NYJR 3TUZC 3CONA 4NZYA 4TQAA 2H92A 1KMHA 1TQ6A 3GD7A 2IYWA 4RVCA 2XB4A 5KUTA 2VHQA 1NMXA 2CE7A 2Q9AA 3NBYC 1I4LD 3HJNA 1WA5A 4QFMA 2AKAB 2ZSBA 3LXRA 2OXRA 1G19A 4RZUA 1GZSA 1IAQA 1UADA 1KI2A 1VCMA 2W58A 1M1YE 3TUJC 1GKUB 1QHHB 1RRFA 4D6PA 4EPWA 1G8GA 1HEIA 2FF7A 4JLDA 2J5XA 3K09C 4D4LA 5TARA 2DFLA 2J7PA 5JJLA 4HUQB 4Q02A 2FFBA 4R98A 3WNCA 1U0LA 1FQKA 4F92B 3O8BA 1IM2A 5KU1A 1KIMA 4PQYA 4P33A 4M9SA 3THWA 3I73A 2GK7A 1GVNB 2P5TB 2GXUA 2IXGA 1F2TB 2QNRA 4YLGA 3GLHE 1KSFX 5F2EA 5DI9A 2CL6X 4JYCA 1CP2A 2JGNA 2OXCA 4LV5B 2HCJB 1CS4C 4GPTA 1J8MF 4WVFA 2VQSA 2ZI7A 4IFEA 4W7SA 4FCWA 2VLIA 3X1ZA 4RY2A 5L3QA 4Q4LA 5DGXA 1DAKA 1CR2A 3AF3A 3CRMA 2NO9A 3TVTA 1U0JA 3AB3A 4TMWA 4PC1A 1QVAA 4UNSA 5F3WB 4YC7A 2Y8EA 4V0KA 2P6NA 1RIFA 1Z47A 3K0CC 2WHXA 3PENA 4KJZA 5DIFA 4GL2A 5HE9A 3I5XA 2V6IA 4BLPA 2C9OA 2FMXA 2VSXA 5JJKA 2OT3B 5CM8B 2QMUA 1GFIA 3WNBA 4MH0R 3VFDA 3LBNA 2KJQA 4JLKA 5JEDA 2AK3A 1QHHA 3ADCA 4LV6A 4OYHA 2D62A 1MO6A 1Z83A 1TL7C 2PZGA 2CL0X 2D2EA 4QKQA 3T15A 4KVAA 3QEOA 4OJKA 5B30A 3UG6A 2WWYA 3U60B 3N5CA 1D2NA 4UNPA 1ZCBA 3GPLA 3EAQA 3R9WA 2YINC 3M0EA 1SXJD 4V0OA 1DAFA 1OFUX 5AJXA 4A0RA 1Z2AA 2GEVA 1NVXQ 3FVQA 4NTZA 3NBXX 3WYAA 2VA8A 1KJWA 4Q1FA 1T3HA 1VHTA 2OAP1 1JECA 5AJZA 3H84A 4WZAE 2BKEA 4JL8A 1RFLA 4MRRA 1XCPA 2UVQA 2QSZA 1NY6A 4TT3A 1RRCA 1GM5A 3JZAA 2BKUA 2GESA 5G3ZA 3BD9A 3CWQA 3UXMA 4KLZA 5EE9A 2VP5A 2E87A 2LKDA 4P3YA 2VRWA 4LX0A 4ZDJA 1XDBA 2XTZA 1DAGA 1KY2A 1J90A 3SQWA 3VKWA 4A0FA 3BORA 4LYFA 1ZNZA 1ZCAA 1IONA 5JMTA 1ZRHA 5AUNB 3KB2A 3GLIB 3NBZC 1II0A 5SZIA 4TMKA 3AF1A 3NDBB 4A82A 3U4QA 2GF0A 2PX3A 2CNWA 4DCNA 2A9KA 1PVOA 2Z6VA 2RH5A 3CF0A 1JR6A 4PQRA 1Q44A 2F9LA 2ZRBA 4JLJA 4BASA 1G1MA 2C78A 3OEHA 4DDVA 2GAAA 4PAMA 4M1OA 2QP3A 3OIUA 4B47A 4TYYA 2QMEA 2QP9X 3I62A 4PO8A 4NYMQ 3K0FB 3MD0A 4OHYA 2QEQA 1R10A 4JJZA 1R8QA 1XB2A 4LJ5A 4TZ6A 4Q48A 5FUWA 4TLEA 4NYMR 1CU1A 1GITA 3ZIAA 2EYUA 2ZS7A 1KI4A 2H18A 3EPHA 3QUSA 4QJ3A 1NN5A 1OFHA 2GEUA 2W2TA 4HDOB 4OHZA 1Q1EA 5KDDA 3NTUA 5KOYA 2GJ9A 1P9RA 4BECA 2F55A 2ZUDA 4FIDA 4LJYA 1WCV1 1ZU5A 4Q00A 3EC1A 5BN5A 3J81k 3PJRA 4MA4A 3GJ6A 3WRXC 2C03A 4NCJA 2GILA 2DB3A 3SJZA 1XEWX 3ZVMA 2WJGA 1GL6A 1FTNA 1CJUC 2YYZA 3GJ4A 4D4JA 1KJYA 2QGZA 3NBFA 5FL3A 3CR7A 1FOEB 3IQXA 4C2UA 1HY3A 2CMKA 2O8EB 2Z5FA 3Q85A 1Q1ZA 4C30A 3HP1A 3R7WA 2OFOA 4TTPA 1IN7A 4ZI3A 2XB2A 1OHHA 3BIFA 2CXXA 1VHLA 1GDDA 1KK1A 4QHSA 1S3GA 5GJCA 4KXFB 4BFUA 3THYA 3ZD7A 3CRVA 1ZM2A 5KNCA 1YRAA 1UEJA 2QT1A 3GLGB 2WWFA 3SBDA 2GXAA 4AYXA 1P75A 2AWNA 3L2OB 1P7CA 2J9RA 2NO7A 4P31A 2ECKA 2IYXA 5P21A 3LRPA 3RS7A 3ECCA 1P73A 5EXPA 1NG1A 2ZRPA 1E6CA 3DEFA 4H1UA 2ZRFA 3FMFA 1XP8A 4TLBA 3BH0A 1IN4A 3QPWA 5FTJA 1BO6A 5CDFE 1M7GA 3RRYA 2YOHA 5HKKD 2H5EA 1T5LA 4XJXA 4IOKA 3NEYA 3W6OA 2CDNA 2VO1A 3KKOA 1P60A 1UKZA 2JDID 4R2HA 4PAQA 4ZKEA 2ANCA 4LSGA 4WXPA 2WSSD 3AVTA 1Z29A 2WIAA 2G88A 1U9IA 3RSLA 3TSOA 4C4PA 4BUJA 4AI6A 4D0GA 2WTUA 2AD1A 5LD2C 1U99A 2ZANA 1QG4A 2P67A 2EWWA 1OLOA 1DAIA 5A5GA 1AK2A 3SJCA 3VR6A 2O0HA 2ZR7A 4KLNA 1EFTA 3QVUA 4M1YA 5JRZA 3QXJA 1M34E 5CIQA 3UATA 3LXXA 3EPJA 3T34A 3DKVA 4MYHA 1VG8A 1XXHB 5FOTA 2ZI9A 4RD3A 4JLMA 3B7GA 1N6HA 3QOFA 2J0QA 4Q01A 5EUMA 4MDEA 3EIQA 1KAOA 1DG1G 2YC4C 1KO4A 3AVXA 1TF7A 2BJWA 3NHBA 4DLYA 3A37A 3QKRA 1SVWA 2JJ1D 1ZNYA 2ZU6A 1MOZA 1LFDB 3GJ8A 4RCZA 3EIEA 4TTRA 5F9FA 5FR1A 1K6MA 4JVLA 3ASZA 3IKJA 1D6JA 4G3XA 3L82B 1ZUNB 2RGEA 1AGPA 2ZAOA 1SVOA 4DEXA 3LFUA 1SKYB 3OAAA 2G1JA 3KJEA 4P4SB 4C0SA 3TJZA 4TYQA 2ODEA 1TF2A 3I72A 3IUYA 1KDRA 3K09A 5HCIA 4KITB 3OEED 2EFDB 2B8TA 4G0NA 1E9FA 3TLXA 4NYJQ 2H17A 4HAVA 1NBME 4PPQA 4E09A 4OKSA 1NNEA 3BXZA 4IXNA 4FN5A 1D2MA 1SHZA 1X8JA 5DE3A 2CNWD 5EP3A 3T61A 4IDOA 2GJAA 4RJLA 3PEUA 4UNQA 3MJHA 3VNUA 2YWGA 1EG7A 2MMGA 2I4IA 2WKRA 2NMVA 4P32A 4YXWD 1DTSA 2CLDX 2DBYA 2YJTD 1RYHA 2J41A 4KBGA 4M9ZA 3IEUA 2R2AA 2E9SA 2GZDA 4PZZA 2RGAA 2IW3A 5E3HA 5J40A 3C5CA 3BC1A 1TX4B 2JJ2A 2X1VA 2AHOA 1X3SA 5BW8A 5JHGB 1OXSC 3FFAA 1ZC4A 3H2YA 4CW7A 1JXMA 4DB2A 3TAHA 1GSIA 3K9HA 4TZ0A 3T5GA 1JNYA 1LB1B 4NP6A 5CITA 3K70B 1TQ2A 1ZD8A 3MAAC 2D06A 3GFTA 3JVUA 1ZD9A 1GKYA 2ATXA 4I1VA 4ASUA 4AYTA 4D25A 3DO6A 2C2HA 2ONKA 3PCRB 4F93B 3K0EA 4Q03A 4B2PA 3GMTA 2CK3D 1U98A 4DUGD 4D4MA 4J0QA 1GRRA 1G3IA 4IW3B 1G6HA 1NKSA 2AK2A 4PX9A 3EA5A 4ZI2A 4RD4A 4HAWA 1D8TA 4C3ZA 2WJHA 1CRPA 4Q7MB 5BYJA 3CM0A 1VG9B 2QMHA 3F3YA 1ZM9A 3PEVA 4F4JA 1LTQA 3W8RA 3RC3A 1OKKD 2GVDC 1N0UA 2XNDD 3T1TA 4IEIA 3THXB 2QTVB 3SFVA 2O8FA 1NN1A 1UFQA 2NO0A 8OHMA 2FJUA 2ZRLA 4M4SA 4DSNA 3SU8A 1FUKA 3KDSE 1JAIA 3AGPA 5DHFA 2DHRA 5FUYA 2ZJOA 3MMPA 1F2TA 3QNUA 1I4TD 2W0SA 4FMBB 2JJ8A 4RZ3A 1GILA 2K5UA 3NC1C 4HAXA 2PBRA 4I1UA 3RLFA 3A8TA 2GCOA 2PJZA 1KKLA 1N25A 4HLCA 5G3YA 3T1OA 5J47A 2CHGA 1RPZA 4AKHA 1EWRA 1YR8A 1KZGB 1W1WA 2QBYA 3EZ7A 1VCOA 1PLJA 2R62A 2FGJA 4CEIB 2EW1A 4G5GA 2NOAA 3AVPA 1RZ3A 4FW9A 4DDWA 4QL3A 1E2MA 2CE2X 4M53A 2ZRDA 4B75A 1PJRA 1ZINA 3EZ6A 2FN4A 2YOFA 2WSSA 1N6KA 3UPUA 1T8TA 4C7OB 4Q18A 1W5TA 3DMNA 1MABB 3OESA 4Z1MA 4JKYA 1HT2E 3QKSA 1P2VA 1B23P 1RVDA 3TQCA 1PUIA 2ZEJA 3T1QA 3D8BA 1JI0A 1OYWA 4PZLA 1O87A 1E2EA 1XXHA 1KI9A 1EWQA 2YWFA 3NHAA 2VSFA 3GLHB 2PLRA 4P0TA 3GJXC 4UXJA 3TH5A 1YQTA 1SULA 3W3AA 1R6BX 5JRJA 3M1IA 1FFHA 2IUTA 5KYKA 3B13B 1Z6GA 3L0OA 2HV8A 3DHWC 1JPNA 4KCGA 1ZD1A 2RB4A 1TPZA 4O2LA 3VR5A 3EW9A 3CNOA 1WP9A 2REOA 5HKKA 2IL1A 2JATA 1NBMD 3S1AB 1KSHA 3ONWA 2C95A 3CBQA 1G3QA 2HYDA 3TK1A 4POAA 1NSFA 3PUWA 2IYRA 3G0HA 1A2KC 3MSXA 1OXUA 4RFSB 3SEAA 1M2OB 1H8HA 3X1WA 4BZPA 4EFLA 5HTKA 1G8HA 1US8B 4A1FA 1G5RA 1QHSA 5AJVB 4EIWA 1Q22A 4A8JA 3AVYA 1Q0UA 1T4GA 4GP6A 2IS6A 5FTLA 1OXTA 2F9MA 3CZPA 4TL6A 4ZV4A 2WWWA 4M9QA 1A2BA 4OQLA 2KBFA 2VPPA 3VU9B 4B33A 4IJMA 3THOA 2FPMA 3ZJYA 4DT1A 5L3SB 4LBVA 2YNMA 1W2GA 1IHUA 1S1CA 1ZVQA 2GDJA 1ESMA 2ZJAA 4PC3A 1KSGA 4A6PA 4B3CA 1FMJA 1NG9A 5JZVA 2QZ4A 3Q5DA 1G20E 1G291 4L9WA 3ZVNA 1BS1A 4AKIA 2JIZA 4TL7A 5F98A 1QG2A 5DHAA 2IS1A 4KFRA 2IEYA 3GLFE 2F6RA 2ZJBA 3U44B 1G17A 1ZYUA 2YKGA 4ZIRA 3PVSA 1HH4A 1NVWQ 3W5IA 1EX6A 1ZUIA 4D2IA 3RRMA 4CT4B 4TMZA 4BRWA 2F3RA 5FR2A 121PA 3QKTA 3G82C 4PHGA 2ZR9A 2B21A 4B43A 1LF0A 2RKOA 5AR1A 4DWJA 2CL7X 3ZVRA 2GWHA 1PLKA 5TXGA 3TKLA 3CB4A 4XSHA 4FWTA 1TADA 2O8CB 1OSNA 4C0AC 2GZHA 3NWJA 4LWZA 2ZPTX 4II7A 3FFBA 1OH7A 4HB0A 3KUCA 4Z8XA 1CXZA 3FWYA 3GJ5A 1KAGA 2C5LA 1M7BA 4G1UC 1OH6A 4OQXA 3FKSD 4RSGA 4LUCA 4DJTA 4WW0A 1FP7A 1UEIA 1N3BA 3N2EA 5HE8A 1VYVA 1DAEA 1R5OA 1XRJA 5BXQC 3AVUA 5JS8A 2GF9A 1QF9A 3W34A 4GMXA 1OIXA 4BFXA 2DFTA 5KSOA 1CR0A 2PEZA 3O8RA 3LW8A 3C16C 2ZRNA 1XPUA 5FBRB 4A92A 3QEJA 2QE7A 4NCIA 1ZM3A 1YZKA 3DOEA 2HLDA 2O8BA 2X2EA 1E1QA 2C98A 3GLIA 5J4YA 1G3UA 4V03A 3GLGE 5FOVA 2ZM5A 1FNNA 2WOJA 1ZBDA 1KO8A 5DLQC 4QJ5A 5L3SA 1N6LA 1VCIA 6Q21A 3P32A 1WRBA 1ESNA 5CK5A 1XF9A 4ZDIA 1OIWA 2GXSA 4U00A 5EXXA 1AJEA 4QGFA 5DH9A 3HPRA 2ZYWX 3UMFA 2NZ8A 5E95A 3GP8A 3C14C 1E0AA 3DPUA 4S35A 2V7QA 1GAJA 4E03A 4KHZA 2BEJA 1C4OA 3SYNA 1DE0A 1E9CA 1VECA 1YR6A 1C1YA 2R9VA 3MCAA 2FA9A 4DLRA 1V43A 4GDFA 4I1SA 2ZUBA 3B2EA 2VTKA 4DCVA 2OILA 1J8YF 3PUXA 4TQ9A 2BMEA 3HR8A 2QENA 2OG2A 4OQNA 3UWKA 2Q6TA 2DWOA 2RMKA 1K8RA 3B1VA 2O52A 2VSOA 1KY3A 1JBKA 3D6TB 1W36C 1KO1A 4ZPXA 4LK2A 3H86A 3KFVA 1NJFA 1Q20A 2FWRA 2QN6A 3VHLB 4IEEA 4UXIA 4OI2A 2VHTA 3WY9A 1S0UA 4HLQB 3WMEA 2N46A 1P5ZB 3GLHA 1E94E 3DOFA 1W0KA 2KE5A 3I4LA 3ZH9B 4LYJA 4RZ2A 2GCNA 1E9SA 4JZKA 1JXOA 3FB4A 4JLBA 4BE7B 2Z4SA 5FOUA 3B5JA 1E2LA 4DC9A 3CO5A 2CEAA 2J46A 4Z1MD 4A2PA 3ZIAD 1W4AA 2RGXA 1OPXA 1MABA 5FFMA 2A5DA 3RDPA 1QBKC 3BBPA 4IRUB 3I5YA 1E79A 4QHYA 3UK6A 4PQFA 5L3VA 1CJVC 2G0NA 2L0XA 2QGNA 4D26A 3KQHA 2ZE6A 3CX8A 3RYTC 3A36A 1FTSA 4BRUA 1S1MA 5CJ2A 4TQUS 3QI2A 2F7SA 4LY6A 2QBYB 2P5SA 2J0VA 2P6UA 4KAXA 4ZKDA 1UBCA 2VP2A 3I92A 1G8FA 1BYUA 2FSIA 4L16A 1NN0A 3TNFA 2FDCA 3GEEA 5E4FA 4GNKA 1KK3A 1SKYE 2C96A 2QROA 2O8DB 3HPQA 2HT1A 3VHXA 4Q4JB 1E9DA 2G1KA 5C1BA 3U7FB 2QM8A 4KFTA 1NKTA 1EFCA 1SZPA 3BB1A 1SXJB 1Z22A 3D3QA 2RHMA 5CK4A 3TR5A 1XMIA 3RRZA 2BMFA 2G3YA 5J4HA 2OHFA 4FI3C 3KQLA 3B1WA 3SE0A 3U3RA 3THXA 3FMIA 5UKDA 5B64A 3REGA 3EPKA 4BQSA 1S96A 2F1JA 3K9GA 3MJRA 3RWMB 3IO5A 3R20A 4JKIA 4K81B 3THWB 3PITA 3QXCA 1WB9A 4OK5A 2UZIR 1JEDA 1Y63A 2ZIAA 4NKRA 2WKPA 2J7KA 2JJ2D 1S3SA 2ZE5A 3WMFA 2NGRA 3REFA 4MYTA 4B2IA 4BPBA 1PUJA 5IK2A 2D74A 4FMDF 5EE5B 2ZRCA 1X6VA 3UWOA 4M21A 5DI3A 2QPAA 4V02A 3RHFA 2D7CA 2VP0A 4GFDA 1F48A 2I1QA 1IBRA 3V4FA 1N6IA 3R9XA 1CIPA 2R8RA 4B71A 4LCBA 3QBTA 2DCUA 4AY2A 3E2IA 1JR3A 4M8NE 4B6EA 2W83A 4KI0A 2ZQ5A 5FI0B 4ASUD 1ZU4A 4Y0AA 2EQBA 1GG2A 5GJBA 4DHEA 4M1WA 4N0DA 4XD7A 2PZFA 4R2IA 4JL5A 4GRAA 2ZAMA 2X19A 3CPEA 1TMKA 3DMDA 2XITA 2H1LA 1QHNA 3BRWD 2C04A 2Z4RA 4NE2A 2QSYA 1T0HB 1GP2A 2HF9A 2VHCA 3IIKA 1E98A 3LX8A 2KB0A 5FOSA 2XEXA 1N0WA 1QZXA 4KU4A 2O8CA 4XWKA 2RCNA 3ASYA 1E2NA 1T6NA 3FMOB 4BFTA 5E7MA 2REBA 4CDGA 2ODNA 2JLWA 4CRWB 4QJ4A 1GTVA 1KHTA 4AKEA 4EUNA 1GNPA 4CEHA 4X8LA 4ABYA 2AR7A 3HR7A 3NKVA 1Q3TA 2IWRA 3FOZA 2ZE8A 2ZXUA 1R4AA 3CH5A 3CF2A 1QDEA 4C0BA 1MRNA 2XXAB 1Z6AA 1E2GA 2HDNB 5JJIA 3W90A 1K5DA 4XTCS 2O0KA 4N0EA 2JCSA 4KODA 2BBTA 3KTAB 1P72A 2VIIA 3QXSA 3KXKA 2Q3HA 3JZMA 1P9NA 5LBIA 2OBMA 5JCZA 2GNOA 3AUXA 3WRYC 1XTKA 4LDJA 3U3KA 4P4SA 1ZP6A 2CBZA 3VR4A 1SVMA 1KK2A 1J2JA 4B48A 2FSFA 2YOGA 4BFSA 1Q1BA 1W36B 2FSGA 1U81A 4JBXA 4NBSA 3QSYA 3DVLA 2PLFA 4DLXA 4EQ6B 4M2LA 1Z6YA 2IBMA 1LS1A 3LLUA 4Q7KA 1W0JD 2ANBA 2WOOA 1G7CA 3WYFA 1ODFA 4B3GA 2QI9C 4HZIA 1FW6A 4HLDA 3QF7A 3CRQA 1YJ5A 5BQ5A 1OW3B 3SHFA 2V6JA 4YMVA 2B92A 4PHTA 1WMSA 1US8A 3LQQA 2FV8A 4UKDA 3AF4A 3AH8A 5HCNA 2NO6A 2IUUA 2GXQA 2IC5A 4LRWA 1SGWA 3AQ4A 3PEWA 3BS4A 3HU3A 2WJYA 3KQNA 2Q21A 2XSZA 4YMTA 1MKYA 1AS3A 1JJ7A 4D80A 3AEZA 2CCJA 2YHSA 1R0XA 2MSEB 3LLMA 5EE1A 4HZUB 1GNRA 1FL9A 2V7QD 4PZYA 1JQLB 1R5BA 4M1KA 2EFEB 4B74A 3T1VA 4BFWA 4DEYA 4GZLA 2JAQA 3KKPA 4NDZA 1E2IA 5B57C 4XWAA 3LVRE 1KK0A 3P26A 4LZZA 4QC2A 3EWAA 4KYIB 1HE1C 3VMFA 4IXMA 1P3JA 4QHTA 3SI7A 2DFNA 3UMSA 5GJWC 1HQCA 1II8A 1N5JA 2IYVA 1TF5A 3BJIC 4BLSA 1TU3A 2FG5A 2RGCA 1UPTA 3B85A 1VIYA 1ELOA 3D7MA 1FUUA 1JB1A 5KSYA 3PXGA 1FNMA 1AKEA 3CLVA 4TTQA 5G41A 1AGRA 1T5IA 2WWHA 4JMPA 1U0HC 3EWSA 4DVGA 1OH8A 4DCTA 1JAHA 4LPKA 3BERA 2GETA 3N2IA 4NONA 1Q3HA 4OBEA 2VBCA 2IYZA 3U3OA 3W6NA 1H8ED 3CNLA 4Q19A 4PTLA 5CJPA 3LBIA 1M8PA 1IXZA 4US0R 1E3MA 2OM2A 3QF4B 2EFCB 1E2JA 2ERYA 1EK0A 1FPMA 2GVZC 4BEJA 1ZW6A 4TMTA 2WJIA 2C9YA 2SHKA 1F2UB 2ZI6A 5JLJA 2GAOA 3SOPA 3GLFA 1CR1A 2MMCA 3TSWA 5AUPB 4LHZA 4QBFA 1E2QA 5EZ6B 2WV9A 4ZO4A 3TW4A 3VR2A 1T0JB 1UKYA 1Z63A 3ZGXA 5ELXA 1CF4A 2AFHE 2GJSA 4PAOA 2B6HA 4HAUA 3WXMA 2IS2A 1UM8A 2ONJA 3Q8XB 1FX0A 4CIDA 4HYYA 1W48A 5BN3A 3R9IA 1D9ZA 2OAQ1 1GWNA 2V4ZA 4TYNA 3FHCB 4GOKA 1KTVA 1YZGA 3TIFA 3V9PA 4FD2A 5CYPA 4DIDA 5EXSA 3A1WA 1OB2A 1KI1A 1MT0A 2RAPA 4MRPA 2DWPA 5DNYB 1XBTA 1FX0B 5L3RA 4L4UA 1NIPA 2CLCX 2OBNA 1MO3A 1AM4D 4P4TA 2IXEA 3B6EA 2IYYA 1ZM7A 3FE2A 4LBWA 3TE6A 3M4YA 2RGNC 3C15C 1IY0A 1E1RD 3LQRA 3O47A 4Q1AA 4HATA 1LF5A 2BC9A 2XOKA 4F38A 4Q1DA 1RW4A 3MFYA 3GLFB 4V0NA 2CHVA 4IDQA 4GSYA 5IK2D 4B3BA 4ZIRB 4WIAA 4IVQA 1W36D 1TEVA 2KI5A 2W6JD 3L8ZA 5AUQA 3WHKA 4F7WA 5L8VA 3OFND 4A8JC 4AURA 3QF4A 2V54A 3K9NA 3K0CA 1ZUHA 2QY9A 4JJKA 4NU0A 4W5WA 5GADl 2VP6A 3AF0A 3AVVA 4A6XA 1E4YA 2AD5A 4IOJA 1G6OA 4I1OA 3NVAA 2BBOA 4TT3D 3ADKA 1EFHA 3OZXA 4A2WA 1RKBA 2RHDA 4XVUA 3W6PA 5C4GB 4DT1B 3B9PA 4MKHA 3ETLA 4RKEA 1L7VC 1G7SA 5EE3A 2O0JA 3B78A 2PX0A 4LC0A 3LO5A 5BWMA 3AUYA 3OE7A 2I3BA 2QAGA 1VPLA 4I4LA 2ZROA 2B7CA 4GOXA 2DWQA 4ZCIA 4M1MA 1AZTA 2GHIA 4JVNA 2ZRAA 3T5DA 5JWRA 1CJTC 3EIHA 3SQXA 3OEEA 2J59A 4NL4H 3SZRA 1HTWA 3AKEA 1SVKA 2BM1A 4URWR 1P6XA 4IOLA 1DO2A 2ZRHA 4MYCA 5TV2A 4DB4A 1U94A 4AD8A 3Q7QA 2ZS9A 5EQTA 4URXR 2WJVA 1ZC3A 4DLVA 4YXWA 3NIBA 3QENA 1YR7A 2F43B 3ZLJA 3AM1A 1KI6A 1Z8FA 5K8UA 3FYHA 3SJAA 1HUQA 2XZPA 3BK7A 1Q12A 3QJYA 1BYIA 1GNQA 4DLUA 4XOIA 3RNLA 1J99A 1ZNWA 3AKYA 3WP1B 3K1JA 3SYLA 3ZQJA 2JASA 1OHHD 2Q9BA 3LWNA 1TUEA 3ZS9A 2A5FA 2QG6A 821PA 3LW7A 3BAFA 4BFZA 1ZIOA 4A36A 2ZRJA 4FWIB 4TSFA 2J0SA 2QL6A 1KI6B 2WPDD 2QTHA 1P2TA 1TAGA 3F8TA 2V3CC 1AN0A 3QE0A 3IPXA 4M1TA 2AWOA 1X1RA 4C2TA 5FH9A 1XJQA 2ZRKA 3SHWA 2BEKA 5EP1A 1SVIA 1YVDA 3KUDA 1T9HA 1ZMXA 4E5UA 4TLCA 3KXLA 3TRFA 2IYTA 3K0AA 5LD2B 1T3LA 2QAJA 4PHFA 4V0ME 3O8CA 5FOXA 2WMOB 1XJCA 4E07A 2G0TA 2G83A 1W44A 4PC2A 2ZRIA 4A2QA 4KV9A 3ZZ0A 1L2TA 2ZETA 4NCNA 4I81A 2OCAA 3TBKA 2QAGB 4LV8B 4Z54A 2QAGC 1GKIA 3M6AA 4YDSA 3LA6A 1D2EA 5FBLB 1NVVR 4WA7A 1CEEA 1G3RA 1PZNA 1BH2A 5J5CA 2OFXA 1Z3IX 1SXJE 1KJZA 4GBMA 1BMFD 1X1SA 3ZQ6A 5A0FA 4OQMA 2IEZA 2JLUA 2ZJ5A 5EP2A 4PANA 4MGYR 1X8KA 2C99A 5DN6D 2AL7A 4MGKR 1NP6A 3LBHA 3FMPB 4EJSA 1T8UA 1DAMA 1OXXK 2P6RA 3X1YA 1JEEA 1XCGB 2ZSFA 4D82A 4G5SA 2BDTA 1ZNXA 2VF7A 4FMCF 3CUEF 1XMJA 3GQBA 2PCLA 1GRQA 3VX3A 3NG1A 5D3QA 1DAHA 1R7RA 3IHLA 2G9NA 1X86B 3P4YA 4DSOA 3CPJB 2OCPA 3RANA 2EWVA 1IJFA 4OI4A 2X8AA 1JR3E 1DELA 1Z0IA 2QORA 2ORVA 4CVNA 1YZUA 2QU8A 3BGWA 1VTKA 4YMWA 1RYFA 5LB2A 3R8CA 1I4DD 1NLZA 2IF0A 4LJ8A 4DLTA 3UKDA 3SS8A 1KI3A 4RD2A 1KMHB 5HPYB 2AXPA 3C7KA 1SHKA 4AG6A 621PA 1U8AA 2ZJYA 4URVR 4WXRA 2D2FA 1SQ5A 4JIMA 3FHTA 1BKDR 1G3MA 4QBGB 1EGAA 1DVRA 2BCGY 4KVGA 3OFNA 4G5RA 4AWXA 1J70A 1NY5A 1WQ1R 2R6FA 5HZKA 1A82A 5BN4A 2HJVA 3BE4A 4E22A 3KJHA 3H0KA 1G9XA 4BZXA 1E69A 3DZDA 3ICQB 1TU4A 2DR3A 5AJWA 4AKGA 1Z28A 3DM5A 4LOAA 2PZEA 221PA 3L0IB 3L8YA 3LY5A 3CRW1 3I3SR 4NYIR 4TYPA 2N42A 4Q4JA 3U3MA 2HJGA 3X1XA 5DISB 2C9CA 2ZJ2A 1WBBA 1RE0A 4AG5A 4MRNA 4EKDA 5JI2E 2J45A 3GJ7A 2BJVA 3QXHA 4D4KA 2FOLA 1E0KA 2CVHA 2O8FB 2EFHB 4NYIQ 3VR3A 1PLLA 4URUR 1MO4A 5LB4A 4PSVA 1G8YA 3EPLA 5EZ5A 3PQCA 1QRAA 1GRNA 2IHBA 5TDHA 1KO7A 2FEMA 4BFYA 3TW8B 2P2LA 2I1VB 4LPSA 5FI1B 5JSZA 3NEJA 3HYRA 1Z08A 2WIBA 4G5OA 3WP0A 2ZSDA 521PA 3BFVA 3KFXA 3KL4A 1YRBA 1E96A 3CZQA 3AGQA 4DUGA 2R6DA 1CULC 4OK3A 4RFSA 1DADA 3I8XA 2EVWX 5CYOA 1XTJA 1X8LA 1OFTA 3QBVA 4B44A 2N1BA 2Z0MA 1YHNA 4HB2A 1T91A 2BV3A 2D3WA 4FMCB 2BVNA 3A6PC 1NVVQ 4B3DA 1FZQA 3RVBA 3KKMA 1R0WA 2QTFA 1IXRC 5F9HA 5KNDA 2VP4A 3IDQA 3GCGA 2D4HA 4XTRA 2ZRGA 4ACBA 2C77A 5TVKA 2WWIA 5FPSA 1UBEA 2FGKA 5JCPA 4GMDA 4C0KA 3GJ3A 1G7RA 4EPTA 1V5WA 5KSPA 1KO5A 2ZSEA 5CDFA 5B58C 1RRGA 3E1SA 4QRHA 2XJ9A 3IIJA 1AKYA 4OI1A 2ZU0C 2JA1A 3NC0C 3U61B 3NXSA 1W2HA 2GBLC 3LDAA 3QKSB 2F1HA 5D3MB 3TAUA 1JALA 3E5HA 4HAZA 3EA0A 3MWLA 2NO1A 1UDXA 3SDZA 4TMVA 4QXAA 4XVQA 2PJRA 1CLUA 4JLAA 5JECA 4X8MA 4OL0A 1Q57A 2Z43A 2ZREA 1IY2A 4UXHA 3X1DA 4JBYA 2RGBA 4Z51A 3C41J 3LV8A 1KKMA 4TL8A 4EPRA 5IRCD 1XPRA 1H8EA 1R2QA 3QKUA 3CKLA 1UKVY 1GOTA 4TSFD 5J4KA 1E9EA 1OJLA 2J3EA 1EXMA 1VCNA 2QPTA 1GL9B 5TY0A 1P62B 4C0HA 4OHXA 4N1AA 4RD0A 3HU2A 4RD1A 3SJBA 1KNXA 2PEYA 2J0UA 5EUQB 3ADDA 2A3RA 3Q72A 5B2ZA 1G7TA 3R7WB 2VEDA 3U2QA 1E1QD 3A1TA 1DPFA 1MO5A 4Q9HA 2F1RA 4FMDB 2JJ1A 1FMLA 3RC8A 2WZQA 3BFXA 2A2ZA 5G53C 3P20A 1QHXA 2HEIA 2W6IA 5K8TA 5EXTA 1CJKC 1ZM4A 3QG1A 2CHQA 2VP9A 4O3MA 4PPFA 1EFRD 1W0JA 1ANKA 2IYSA 4MDFA 2NG1A 4WZ6A 5FTKA 4QNRA 4IVPA 5JI3E 4HUQA 2ZYTX 5K8IA 3A4MA 4EFMA 4M9XA 1Z0FA 1NF3A 2JEOA 2XX3A 1F60A 2IXFA 2FNAA 2CVFA 3OIVA 3PUYA 2BM0A 4UNNA 3U7EB 3I1FA 5JWHA 2R65A 1Z2CA 2QE7D 1N5IA 2XZLA 3GEIA 1GL7A 2GTPA 4X8HA 5FTMA 4FINA 3FHOA 1LY1A 4MYUA 1G18A 5KDLA 2C8VA 3DZ8A 4FXPA 1HE8B 1HYQA 3DM9B 3L0PA 4DDUA 1Z0AA 5AJYA 4JVSB 2H8KA 3EZFA 2PCJA 421PA 4O2RA 4R9UC 1N5LA 5DI3B 3U44A 2JLSA 4XSGA 3FPAA 4NH0A 3T35A 1S9DA 4LGMA 4QBHA 2DY1A 4ESHA 3KQUA 4KSCA 3ZDQA 1E32A 3IILA 3MWKA 4A0HA 4DIEA 3EZ9A 3WBKA 2JIZD 4M22A 2QPOA 3DDCA 3KJIA 4BEBA 1IN8A 2HUPA 2AFIE 1H65A 3H4MA 4DBLC 4LHVA 1COWA 4JSTA 5E7IA 2NQ2C 3W3ZB 2NPIA 3CX6A 4DCSA 5KTYA 4ILEA 3VKGA 5IT5A 2OBLA 1EESA 1XTIA 2BBWA 1ONBA 3VU9A 3R8FA 4L5BA 1SXJA 1YZNA 4D81A 3AV0B 1XEXA 2CK3A 3EX7C 4NMMA 3K70D 4A8JB 2O8DA 2PMKA 1S4QA 3A4LA 4MUAA 4PC6A 3A4NA 1XEXB 5KDOA 4D0LB 2G77B 3K0AB 1XEWY 2J1LA 1XPOA 4IDHA 4L8GA 5JWOA 2IUSA 5JS7A 2IF2A 3I61A 2NZJA 3CPHA 1EFRA 3T06B 1XMVA 2XTMA 1IN6A 1OFIA 3F5FA 3AVOA 4CYMA 1COWD 3QPUA 4DZZA 3AKDA 2R6CA 2HCBA 5SZKB 1OIVA 5AUOB 2ATVA 1E79D 2FX3A 2WMNB 1ZIPA 2FPLA 2H7VA 2Q3MA 2KBEA 1XZQA 2LCFA 4BLOA 1NN3A 4MKFA 3IIMA 2V1XA 2XJ4A 4XWOA 2ZYVX 4DRZA 4OJQA 2IT1A 2QA5A 4MQBA 4RZXA 4MKIA 1E2HA 4R7ZA 3SNHA 1YR9A 4JS0A 2NPFA 3BB4A 3NH6A 2NTYC 1TEXA 2GK6A 1UKEA 2FFQA 2QMOA 2W2VA 4XVRA 1JR3D 1DBSA 1Z07A 1KSJA 2DYKA 3QXXA 4LHYA 4GP7A 5DYGA 4IFBA 4ITRC 5EJEA 5FBVB 4C7OA 1OB5A 3FDIA 4QBIA 2W00A 1QHGA 2GCPA 3BFKA 1G5TA 4KO8A 3BOSA 2JDIA 3WNDA 3V00A 5J4VA 2X2FA 3U3JA 3MWYW 1XNJA 5AWFC 1WBDA 1CTQA 4ERNA 4Y0VA 4IHQA 4Q9IA 4Q9LA 2ZYUX 5CM9C 1AS2A 4Q1CA 1QHIA 3CW2A 5CLLA 5L3QB 3U6BA 1WXQA 2OLKA 4ACAA 1O3YA 1SXJC 3TR0A 1BOFA 1R8SA 2HXYA 2P0EA 2WJJA 3T12A 4OK6A 2GJKA 5KPDA 2BHRA 4RFVA 2J0UB 3LNCA 4RD6A 1KDPA 4B35A 2WAXA 1NSTA 1KI8A 2WPDA 2GBLA 3LH5A 2D7DA 2IYUA 3CR8A 4Z8YA 1KYIA 3U7HB 4HB4A 2IX3A 4GZMA 4S2EA 1I2DA 2OZEA 1VYTA 4PSAA 1S9HA 1Y3AA 2R6GA 4Q4HA 5KPJA 1A5TA 1CJMA 3BH6A 2IYQA 3F0TA 3THYB 1R0YA 1PV4A 3A1UA 2RGNA 2IHYA 3CIOA 5KSZA 4QGGA 4RKFA 4B3FX 4U7DA 4JT2A 4EFNA 3B8HA 4OHVA 3C5HA 3IHWA 4Q1EA 3UG7A 3W9YA 1C9KA 1L8QA 3KQKA 2JLXA 1AA9A 1BIFA 1MV5A 1AIPA 1UBGA 2JLRA 4TLDA 5GVRA 1E2DA 1U2RA 5C4MA 4JT4A 4LHWA 1JPJA 2XTNA 4I99A 1VDZA 3HU1A 3RS2A 4W5JA 5TB5A 3AVQA 2O5VA 2Z83A 4IVRA 2W0MA 5FPYA 3GJ0A 1P9WA 1SVSA 1XFAA 2OCYC 2OEPA 2WBLC 2ZI3A 3OIYA 4OQFA 5EE0A 2J87A 4GI7A 4EPYA 2ZJZA 4C9BA 3RS0A 4AIIA 5CIWA 1CR4A 4HUTA 2XSZD 5DO9A 1E4VA 3G5UA 3KXIA 3Q9LA 4PO1A 1E9AA 3W5JA 2JLVA 2PMDA 3WHLA 4DDTA 4BFVA 3K0FA 2VHJA 1CRQA 4DXAA 2W6ID 1YZQA 4MGIR 2GJ8A 3KB1A 4XH9B 5JEEA 4QGHA 2B8WA 1SVLA 3K53A 2PL3A 2TMKA 1XJ0A 3SFZA 4UNRA 1HURA 3E70C 3ZD6A 4U02A 3HDTA 4G01B 4LJ4A 1XX6A 2ZITA 2QRNA 1KMQA 1IN5A 3IGFA 5JBQA 4WAUA 1HQYE 3RAPR 5JSZB 1XD8A 1NIJA 5IF9A 1KI7A 1XMSA 3LAWA 3CRRA 1LS6A 2AX4A 3ND8A 3SC3A 4ON9A 1VG0B 1D5CA 2FU5C 3FGNA 2IS4A 1R0ZA 2Q9CA 1M6NA 1JQJC 2BOVA 2MSDB 4WZBE 4B2LA 3PV0A 3OHMA 4MGZR 4ESVA 1W4CA 3ADBA 1UF9A 1LV7A 3QVVA 4XD7D 4HLUC 3EASA 4UQOA 1UJ2A 1NL3A 3ND9A 4JVMA 1NMZA 1Z0DA 2VF8A 2OSBA 3MGCA 2R6AA 4MUBA 3H1TA 5FOWA 5GJVC 4NPHA 2ASEA 4ZCLA 4Q5IA 1Z0KA 4TLAA 4YQFA 1KDTA 2CJWA 3ICEA 4CF7A 5FPKA 2AN9A 2YWHA 4W9MC 3AKCA 3GLIE 1GIAA 4TWZA 5G40A 3CH4B 4Q21A 3OIWA 1XWIA 2VH5R 2ZI5A 2VHUA 4QNMA 1E0SA 1WE2A 4RCYA 1I2MA 3TQFA 1W7AA 4AC9A 3B60A 4ZDKA 1G21E 5AK0A 4C0JA 2ZUCA 4US2R 5CB6A 1XZPA 2OE2A 4Q1BA 4L15A 2WSMA 2FH5B 4LYAA 4PPGA 2ZE7A 2UKDA 1YE8A 1NI3A 1U8ZA 4HI0E 5CB8A 5J4LA 2XAUA 2FEOA 4JLNA 2FE4A 4B6FA 1N6NA 4DSTA 4CEJA 5IHPA 1EX7A 5E7JA 2Q0HA 3MLEA 3NDPA 4GT1A 2A78A 2B7BA 1NLFA 4ARZA
chains in the Genus database with same CATH superfamily
3D2AA 3DEYX 1VZ3A 3I37X 4KQWA 4MP3A 4RS4A 1P2UA 1PR1A 1HLDA 4UEWA 3WYCA 4BO7A 2R1UA 4C2AA 4CHTA 1TKRA 4K40A 1H2EA 1JSCA 1PS9A 3GJYA 3NH9A 4TL9A 4ZCPA 3ROKA 4UDNA 4JP1A 4BP3A 4Y2XA 3V4RA 1GR1A 5K3AA 3IQZA 4BVJA 2J4CA 3QXGA 3EXIA 1PFWA 4DANA 1LW7A 1R4NA 4EJSB 2V7GA 2GCGA 2GPSA 4PNZA 3ZGZA 1LNZA 2CFCA 3QMWA 5KTPA 1YIDA 3D31A 5I9SA 3X1MA 1DS6A 3D6FA 3IQIX 1DARA 5KVCA 5HBGA 1PQPA 2ZSHA 1OH5A 1TC2A 4ENSA 3OKAA 3Q8KA 5FCDA 2W6QA 3RSZA 1N6OA 1GGEA 3NRBA 2EYQA 3ASVA 4X8OA 5CHEA 2F1IA 3T7TA 1TJNA 5ALWA 3CLUC 3GUZA 3P2KA 4RDIA 3KXPA 2WJ6A 3AEXA 3OCWA 3KZCA 2FMKA 4Z4CA 5HIKA 1UM9A 2AA3A 2JFXA 4H9GA 3PICA 2IHKA 3SXUB 5JH7B 4FYIA 4KB5A 3C6KA 2YXDA 3FR7A 4IDFA 3VR3D 7MHTA 2H4YA 1MW8X 5IS2A 2O8NA 3IUJA 1EB8A 2HA7A 2EW8A 2V5AA 2ZTSA 3FYUB 3JS5A 3K0SA 3QOYA 3C8UA 4B6SA 1XTSA 1EHCA 1U1EA 3RCBA 1MBZA 1EWYA 1A1VA 1W96A 4OMFG 4L28A 1P1BA 1E2FA 3PKJA 3O38A 1DBWA 3VSBA 4BAZA 4RSMA 2PLAA 3GGJA 2PQMA 1YJBA 1L5QA 2HLNA 2WNIA 3G2QA 3NT5A 1FP4A 3E53A 5LBUA 4EENA 3MXOA 1KNQA 2QLTA 3EXG2 3DMYA 1R5JA 2Y71A 3JRNA 3O2NA 2R5NA 4C4RA 1YF3A 1EGVB 4TVSA 3PJDA 1NVUQ 2FPSA 5AW2A 2XHZA 1IL0A 3D6HA 2VR1A 3GLRA 4KR6A 3HEBA 1DOAA 1Y7PA 1ZD4A 1WW3A 2EEPA 1XD2A 5K6TA 4IXDA 3ET5A 4EWLA 3CHYA 1I7LA 2HAEA 3MTQA 1M34A 1YOVB 1R15A 2BFEA 2P3SA 3AUJB 2DHEA 3OM8A 1U02A 4P08A 3H05A 5DPMA 3CCCA 4IX1A 1DAPA 3G2PA 5KWVA 2XNDA 3PUKA 4IZOA 4R3UC 2F43A 1AMOA 1PW7A 2VHXA 1D04A 4QPZA 2B78A 3KVVA 4Q7JB 3GQVA 3PNPA 4N3NA 5JCZA 5LQNA 4KSYA 1AV6A 5HZHA 1XQWA 2M6SA 5AVOA 4WKBA 5K0TA 2YVUA 4NQZA 3T99A 4N03A 3FSRA 3PR3A 2LDBA 5D2CA 3T7JA 3WGHA 1F06A 1UKBA 2VI5A 1VPEA 4DW8A 3A9SA 1P7YA 1IHDA 4KXLA 4L78A 5FPTA 3VMMA 4TXHA 4HH1A 5DNUA 3EGEA 2IOFK 1QCZA 4C7VA 2NT3A 1JHMA 3GG9A 1KP2A 1XROA 1D9XA 1JILA 2PNFA 3FJ1A 3FPSA 1WUJS 3OZCA 1HA3A 2A30A 1A27A 1E2PA 1XCJA 3DP7A 721PA 5I7OA 4DDKA 1XFDA 2MU1A 2MDTA 1N0VC 2BELA 3MMNA 4OY3A 2P27A 4RE6A 4BLQA 4QGAA 4YYEA 5L51A 2GPYA 4F3KA 1PL7A 2P65A 1HDGO 2XWSA 1OT3A 1OV4A 5B1IA 1LBEA 1UBFA 3TDNA 2C4TA 5KCMA 5A2GA 4M7RA 5IJ9B 2ILTA 4OFXA 4Y98A 1EVZA 2YJGA 1Q1NA 2AOTA 2YC2C 4R7GA 3HWSA 5M04A 1KDOA 3V2GA 1EX1A 1W4RA 2A5GA 3IAM1 1FFYA 3WYGA 1GUAA 1F5NA 4OLHA 1MR3F 2Q7XA 3KUXA 1L4UA 3OIDA 4R9VA 4CKXA 4JYBA 1ILWA 4NOJA 2HJ9A 4FCTA 1GN9A 2RAVA 1HTBA 1QX3A 3CTPA 1DC4A 3TGLA 2KSQA 1W4BA 4NCKA 3CEPB 3PNVA 4MW6A 5TMBA 1BNCA 3PIRA 4AM8A 1NVGA 5IDVA 2J32A 1M74A 5ANRB 5IVIA 1E62A 2I7CA 4MEAA 4BWYA 4PXAA 3LCJA 3UXEA 5GOZA 4H3VA 1L5NA 2IWHA 4AVYA 5HRAA 4LBYA 3VDQA 3VAYA 3HCWA 2LBPA 4YDHB 1ADYA 1XE3A 2A9RA 3MSCA 3S2YA 2XKBA 3WHIA 1KY4A 3ZHVA 4RUKA 5CD1A 3AFMA 1RIIA 3LUJA 4NPAA 1KOFA 1XAIA 2NT4A 4QARA 1WTAA 1F0PA 2B20A 2A84A 3KAJA 4TX1A 1CUVA 2GZ3A 1NE2A 1VZ2A 2HU2A 3L1IA 3LCVB 4KYUA 5E4TA 2OORA 2F8MA 1GRCA 3HSYA 1UBMS 4MV7A 3ZY5A 5BN3B 1M0EA 2DOKA 4JUCA 2VDOB 4HXYA 4Y2SA 4MO9A 3PFIA 4A9AA 4DJ5X 2IEDA 1UBSB 1E4EB 2D1YA 3FWKA 3KKQA 3EIWA 1GAQA 2C2GA 1VIAA 1MEJA 3D4BA 3JPWA 1O96A 1GCGA 1UBNA 4UEOA 5KAMA 4R4JA 1UJ4A 1H2FA 4WSOA 4N7MA 2VDNB 1XTVA 5IBRA 3ZK8A 3ZHQA 4EJMA 1SG9A 1E9BA 4HX5A 5BY2A 1R5NA 2Z2IA 2NXWA 4KSBA 1YL7A 3ZLBA 3JQDA 3K5PA 3L0BA 2IA5A 2IUYA 1DUVG 3EF3A 4K86A 2OC4A 4JI4B 3RIEA 3OZFA 3RIHA 1F7UA 4M7PA 1DMRA 3ODGA 5KHAA 1G4AE 5CR9A 4ARCA 2A5YB 3G7NA 3HEAA 1YQUA 3GLGA 1N57A 1N4DA 3B1FA 3CO0S 2EJCA 2R4TA 2WM9B 3KLPX 3ROEA 1YZLA 3O82A 1MRSA 1SOWA 1L3IA 3QFCA 4BO5A 3D8UA 3Q40A 1TCAA 2VYQA 4M55A 3RYIA 4FI3F 3OIFA 3RABA 5AKYA 3T3PB 4DMHA 2GJ4A 2OGTA 1U7TA 1FFDA 1UK9A 1BMTA 1TTQB 1JLLA 5KNBH 5F3RA 4ARZB 3QYFA 3A25A 2PH1A 4WUTA 1O94C 3INTA 1L1FA 3IAHA 1IEXA 2FEWB 1W8IA 4WKPA 3LGXA 3I0NA 3CX7A 5D3MA 1J1UA 4WBNB 1GZ7A 4FCCA 1EUYA 5B3JA 3ZV3A 3HO1A 3GK3A 3G0CA 1UT5A 5ECWA 2A1UB 2XRMA 2PH7A 3E0QA 2UZ3A 4X60A 4GKBA 2BFFA 1JFRA 3RUDA 1N2CE 3NEPX 3IRVA 1TQ4A 5BW5A 4DUYB 2PH3A 1IJBA 3F90A 3SR4A 4V0MA 1X39A 4E5NA 1JL3A 4UHEA 1PWEA 3NV9A 2HA0A 3B1ZA 4YIHA 1CUHA 1GY8A 3EG5A 4IKEA 3UHAA 3N2KB 3ZCVA 4BB9A 4YN3A 4AO6A 3NKFA 4GEGA 1AZSC 1MIOB 3DDOA 3GIDA 3A1VA 1A7JA 4NOKA 4XB2A 3GH1A 1GJRA 3I05A 4L2IB 3CT6A 1XQVA 3AM3A 3C4QA 3D6UA 3F9RA 3VQTA 3ZHYA 4S3MA 3BH7A 5EG5A 4BGEA 4EG4A 2J3MA 4G85A 1AD2A 1U0GA 1QUEA 1XXHE 2BGNA 2WDZA 4O4HF 4BO6A 4Z6KA 4OGKA 5BNZA 2X4GA 5JTUA 3CN7A 5AOBA 2IY9A 2VYCA 2IYEA 2GRJA 4B5LA 1KDVA 4Q7LA 1T25A 3R4VA 2JIDA 3F9IA 2H2DA 5DSXA 4F2PA 5IP5A 3TL6A 4JC5A 2ORIA 1XTZA 3IC5A 4LJ7A 4ND2A 3U7GA 3ORRA 3DWFA 3IPYA 4LHSA 4FYJA 5KNCH 3U4QB 5TEWA 2FZLA 3VR2D 1P61B 4XA8A 3P52A 1G41A 3TFQA 1Y3IA 4X90A 3ER6A 3FTQA 4C08A 2Y77A 2VJDA 5BYAA 2HYIC 1BFUA 2OO7A 3V1LA 3ZZ1A 1LVGA 2ODBA 2YV5A 4F3NA 2R1ZA 4FWBA 3ABOB 4EDHA 1QO0A 2JFWA 3G9UA 5H0IA 2AXNA 4CODB 1XA4A 4MR7A 3BCUA 4BVFA 4HMOA 3GL9A 4WJLA 5FDFA 1DX6A 3AP2A 1M2NA 1KTIA 3EGXB 2GSWA 4XPZA 2QTAA 4I50A 1YB4A 3JVEA 5JQGA 5DWQA 2A86A 2ZDGA 3IMKA 4GOJA 1TNDA 3BMQA 3RTEA 4E4YA 1BDBA 3R5JA 1LSSA 2WIKA 5JC8A 1QFMA 1LVHA 3Q0EA 1R50A 1YAJA 5C8YF 1WZCA 1F5SA 1UAAA 1MOQA 5H5JA 3FFWA 1YZTA 4Q9KA 3A6HA 2IVFA 2QT0A 3KZ1E 3T1HB 1XCMA 2AVNA 4O1HA 1G38A 2FFAA 4A3SA 3KLNA 4PPNA 3DE0X 5SZJA 4XIGS 4LYHA 4L1KA 3PQ4A 3EARA 4C20A 4U0KA 4RIFA 5B3KA 2CSXA 4TXLA 4UJ3A 4MRVA 4P4UA 3GRKA 1SCQA 2IYOA 4OA5A 4OP3A 2C82A 2Q4BA 4NZYA 2A0WA 4TQAA 1L1QA 2QMYA 4YCNA 2C7QA 2PD3A 3GD7A 3OM9A 1SMKA 1NW5A 2AXEA 1W59A 2Q9AA 2G1AA 1I4LD 2NUBA 1M2HA 1KRWA 2R6ZA 2ZSBA 2O2IA 2Z5LA 2W6NA 2QXTA 4RZUA 3HXPA 4S2UA 1GZSA 4MEBA 1RP7A 4ALNA 2HMYB 5F7ZA 1GKUB 2ZW9A 1QHHB 5EEHA 3SICE 3ZJ5A 1K0FA 4D6PA 4CQJA 1FP4B 2PV7A 2YMLA 3G59A 1UKAA 4AMYA 4X92A 4FFWA 4HDKB 5HOEA 3K09C 1O6ZA 4J90A 1ZDMA 1DDGA 2JFZA 3C24A 2W5UA 4Q3EA 3HO8A 3NTVA 1HEUA 1JQBA 4R9NA 4LECA 2QVYX 1MAHA 2V59A 4HUQB 2FFBA 3QKWA 4Q02A 4B8WA 5HM8A 4CV1A 1SBNE 2FCAA 4FOSA 5JH7F 3AL2A 1BZYA 1NVMB 1U0LA 3B1JA 4JY7A 1FQKA 2C4KA 4FDAA 3KZVA 2UZ4A 1WSWA 3HUUA 1IM2A 5BNWA 5FEUA 4KBYA 1QO7A 3HBFA 3OY7A 4BEWA 1OZFA 1QIKA 2PL1A 4KKXB 4M9SA 4YT5A 3BTSA 4MLCA 1GVNB 3OCYA 4G8DA 3TZCA 4D3ZA 3NHFA 2AN3A 1YS1X 4YLGA 1EQ2A 4REOA 3TX6A 5F2EA 2L82A 1NUTA 1K8XB 4JYCA 4D92A 1YMQA 2H1CA 1J0DA 1U8TA 4TN5A 3HVKA 4F9EA 4CF3A 3CLHA 3C3PA 4C3OB 5CA0F 3F73A 2NO5A 3L77A 3WGMA 5CX4A 2QTLA 4W7SA 3GPIA 4Q3KA 2NV6A 3DXXA 3WBFA 1GLVA 1NKVA 2OMEA 3PC8C 1GTJ1 4M0DA 1E60A 4OJNA 4TZKA 4WFIA 3BMOA 4E4TA 5EIEA 2JCXA 3KDPA 2NO9A 3HZZA 3NANA 3K2EA 3G8CA 3QLJA 3AB3A 4J7AA 4ZALA 3TVTA 2O3RA 2YTZA 3TYXA 3ZPXA 2VJAA 1ZLXA 3HKCB 2WHXA 1VA5A 3IXQA 3L8HA 4MWEA 4ONEA 3SF8B 1QORA 2JEYA 2QN3A 1XZIA 1XA3A 4Y2GA 3VPHA 2O2XA 4H2DA 3URMA 2N9UA 5JAHA 1MVLA 5JJKA 5EIHA 5CM8B 2J6HA 1SKMA 3E22A 1LX7A 4IIBA 1YS4A 2NQ8A 1X70A 4MH0R 3D7RA 4W99A 3U81A 4OQDA 4JLKA 3ADCA 2FAXA 2VTBB 4K8RB 4OYHA 1W85B 3FH0A 4H3SA 4BJ1A 1U63A 1NULA 1ESZA 1TL7C 2RHRA 2OXEA 1HDCA 4R1LA 2W2LA 2EJUA 1K8QA 1WW8A 4Y2RA 4C3UA 2F64A 3QEOA 4QXRA 5DSTA 3P9SA 3D5EA 4FPXA 4MI3A 2WWYA 5AKGA 2DUJA 1D2NA 2N0SA 4KX5A 2YN4A 3L92A 3GPLA 3V42A 4AECA 1O95D 4KDRA 3RW9A 3K73O 3UGKA 1KPIA 5K4AA 3I09A 5BWCA 2AQ8A 2R8YA 4KOEC 1SCNE 2Q5HA 2XQFA 1YI0A 1WV0A 3ZV6A 3ZGNA 3WVNA 3K15A 1A72A 5HIMA 4I36A 4F06A 2IYNA 4LWQA 5TGDA 2PMEA 5EIAA 4UVIA 2VS1A 1BJTA 2C2KA 3NBXX 4MV1A 3WYAA 3DHNA 2Q5LA 3IAUA 2HQSA 1IOVA 2VA8A 2ZYDA 1KJWA 3E0XA 1ISGA 2PD4A 3O3NB 2XUIA 3KEGA 1JECA 3A9RA 2AZDA 4DRXA 3C1OA 1Z2OX 3R41A 4JL8A 4MRRA 3U7QB 5DWVA 2NUAA 2P9TA 1J7JA 1UDBA 2A59A 2XWJI 3ZWNA 2PTGA 1GADO 3PUIA 1OI7A 5G3ZA 5HILA 4E13A 4ZYVA 1Q0TA 1CUWA 2CNOA 3GFVA 1PNTA 3QWAA 3UXMA 1H9BA 2GN0A 1CHNA 4L4YA 1W19A 1QYWA 3V7YA 3VVMA 3F2VA 3P9ZA 1ZZEA 1M8KA 1RDFA 1Q14A 2XTZA 1J90A 3EOAI 4FOLA 2ZFUA 4DJAA 2QM3A 1KBQA 3CTMA 2Q28A 2CDBA 3BORA 4LYFA 4ED9A 4KG7A 3AR7A 4EB0A 3DT6A 2P4HX 3GC6A 4P36A 3VSDA 4RA6B 4OXRA 3P9XA 3GLIB 1FU7A 4LEIA 2PAFA 1TRHA 4Z5XA 4TMKA 1A8SA 2Q0QA 4QUJA 4ZTBA 5ICGA 1O5IA 2PPVA 4A82A 3NBKA 2YQZA 2VJBA 3FCCA 1YZFA 2VDWA 4JEUA 1JJIA 2MHCA 2PVPA 3BIXA 2SICE 2A9KA 2C07A 2R6HA 4L74A 4ND7A 1HNXB 1NBWB 4K03A 4D9KA 4M7OA 3IUQA 4PQRA 3I5AA 2UUPA 1KP3A 3CUUA 1VXOA 1C0PA 4IVNA 1S4MA 2QYOA 4DDVA 1NQAO 3CRNA 2E37A 1E1NA 1JX6A 1UK7A 3FCOA 4X1IA 5CH8A 4BUCA 2I6SA 4BWFB 2BFOA 2Q49A 3FLBA 4TYYA 1BSVA 1XIVA 3WGKA 2QP9X 1KYVA 5EKTA 3TRIA 1W9MA 4Y6RA 3TKYA 5JOQA 1T2DA 2C0CA 3O9VA 3FFTA 1I7SB 1M8GA 4A5SA 5CEFA 3M89A 5LYJB 2O54A 1EX9A 3AEQA 4JJZA 1R8QA 4FDVA 3GZNB 1XB2A 4LJ5A 4Q9DA 3RWBA 1CU1A 1GITA 2K4MA 1KI4A 3GJTA 2H18A 3EPHA 3GCWA 2Q4DA 3QUSA 1FLAA 1NN5A 1Q6YA 1QGED 3D4NA 5EZYA 5GV8A 1NP7A 2I78A 2GJ9A 3BDVA 4LGVA 4PFKA 2H4HA 3OFJA 4K9SA 1DQRA 1OX4A 3MT8A 5KOHB 3AKZA 3I52A 1YCGA 2V6GA 4HTFA 1M75A 2VNAA 3GJ6A 3WRXC 5FAKA 4C05A 2FB9A 3Q3IA 4JLWA 2HK6A 4AT1A 4AULA 1DIAA 2QD4A 2EX0A 3JQAB 2AG0A 2WUEA 3I76A 3VJLA 4U6NA 3DLPX 3ELDA 2YYZA 3TN7A 1H0KA 2JGIA 1YZVA 1YSCA 2QGZA 3CR7A 3KIPA 5FL3A 2CMKA 4RTOA 2Z5FA 3Q85A 1UBRS 1Q1ZA 3ND7A 3HP1A 4C30A 3R7WA 4I55F 1MLDA 2BFWA 2OFOA 4N40A 3WZ2A 4XWGA 4JQSA 1EEXB 3D7SA 4UEKA 2VAVA 1U4OA 4CT0A 1WOMA 5BPFA 1VHLA 1GDDA 1XP5A 4FLFA 4OHCA 2HSJA 1XGKA 1S3GA 3GJQA 4CETA 1JEYA 1DJMA 4GE3A 5JALA 3G1TA 3V4PB 5LYJF 4A1OA 1XDWA 5KU7A 4EZBA 4QNNA 4D4HA 2AWNA 3AT1A 1SCKA 1SNYA 3L2OB 4ZI5A 3WAGA 5KKAA 3G1UA 1ZVVA 7AT1A 1RQLA 3JXEA 1P73A 4LDAA 3P96A 1NG1A 5CVJA 2D5CA 1JKJA 2NUTB 4LE1A 4B2YA 2GPWA 3OJWA 4QPNA 2UDPA 5ALXA 4X1YA 1VLLA 3RBVA 1R6DA 3ZU5A 1TLTA 5B4UA 4J2HA 2OGUA 1BO6A 2UU9B 1M7GA 3WNQA 5C7IO 1Q5PA 2YOHA 3R0ZA 4KPEC 2JF0A 1C30A 4AQDA 3ENWA 4DLNA 1K6JA 3J80A 1CQJA 5J2TF 3CLUD 4NS4A 1JDPA 2X0EA 1M2OA 2CDNA 3EXFA 1N5DA 2XNJA 2CLOB 4PAQA 4ZKEA 3B9RA 2ANCA 3B1KA 1QANA 3H4TA 3UYKA 4OBBA 5E8RA 5LOVF 3AVTA 3ZUPA 1CDOA 3JWEA 1JB9A 3ULKA 4ZAYA 4IUDS 2GKGA 2YICA 4MJ3A 3JQGA 2BR3A 1D5WA 2FRVA 3OLWA 1KZ6A 2R1VB 1I1HA 4V3BA 2AD1A 4EZEA 5CFNA 4XGNA 1U99A 4DV3B 1GTG1 1NW9B 1BKSB 3P9PA 1YV9A 5K09A 4EHHA 2QLMA 2CVOA 1Y8QB 4E30A 1OLOA 1YO6A 2F1KA 2XYPA 4U8HA 3LPCA 3HRKA 3L06A 1AK2A 1WMDA 4AS3A 4ENTA 2O0HA 4KLNA 4B9AA 5A5GA 5LQRA 2CYCA 1N9ZA 3QVUA 4FR0A 3BG5A 3FKJA 3QU2A 4K9OA 5CIQA 3UV7A 3EPJA 1LPSA 3T34A 3DKVA 4MYHA 4O4IB 4PRYA 1JIVA 4RD3A 1O94D 1D4FA 4JCCA 4RA9A 1BCRB 4YHBA 5AI6A 4PG5A 2J0QA 4Q01A 5CNJA 5EUMA 4F0JA 1WMFA 1F6DA 3IS3A 3HBMA 1JQAA 3JASA 3VZQA 2JIBA 4B4WA 3KP1A 1KEWA 1KO4A 1X8XA 4R1MA 5FQOA 1MOSA 2P6OA 3DE5X 1M1NA 1NMSA 1XHEA 3GJ8A 4BVGA 4H6XA 4DCJA 1Z34A 1K6MA 2P9YA 2X3UA 1D6JA 1AGPA 2H7CA 4DEXA 5KQPA 3LFUA 1SKYB 2WSBA 4NICA 3KJEA 3G2LA 3TJZA 5TS3A 4TYQA 2ODEA 1TF2A 3I72A 2CW5A 3IUYA 2IDKA 3K09A 5HCIA 3UA4A 4AJKA 3DO8A 4JI1B 2ODPA 2H17A 1NBME 1NNEA 1X7ZA 1D2MA 3OUUA 1UK6A 1JJBA 4WV3A 5DE3A 2CNWD 2I91A 5EP3A 3LDUA 1ZCJA 3BEOA 4LFCB 1RBYA 1SFRA 4D44A 4RJLA 5G2OA 2QR2A 1VKHA 4UNQA 3SHQA 3VNUA 4JN6B 1R66A 4HQ6A 1NUQA 1R6VA 2C0PA 2PKEA 3Q12A 2O0MA 3I12A 1MIHA 4S1WA 5IT9A 1Z2DA 3GAFA 4UDYX 2CLDX 4NFLA 4BLUA 1RSZA 2OMKA 3RFUA 2J6CA 1XG5A 2XQGA 2R2AA 2E9SA 3P45A 1R9MA 3H9BA 4P2GA 2IW3A 1WULS 1VFPA 4FFRA 3OU7A 2PS3A 3C5CA 4YI3A 4ZZ2A 2QX6A 2X0FA 1TX4B 1YUNA 4ZTUB 1X3SA 1PHRA 4MS1A 4WN3A 3WGOA 4YV0A 5EPEA 5JHGB 3QMVA 4MMZB 2GN6A 1JXMA 2YCBA 3VDRA 5IFKA 3LZCA 1J9ZA 4E33A 4TZ0A 3T5GA 5I4CA 1LB1B 1SXIA 4LDRA 3K70B 1A7AA 1Z15A 2ZUEA 3BL5A 2NAPA 3JVUA 1QGAA 1ZD9A 4U7HA 2O20A 2GFIA 1N78A 4K6MA 4OHMA 2IP2A 3HS3A 4HS9A 2C2HA 2ONKA 4WLOA 5BW4A 4AP9A 2Q62A 2AS0A 2OD2A 4R8RA 3HXLA 1UAYA 2CK3D 1HO3A 5DGCA 2ZULA 3ROMA 2OXIA 1PJAA 4QEKA 1SOUA 2E4VA 4KUHA 2AK2A 2NYVA 2XNCA 2GHRA 3EXHC 4X6LA 1RAIA 2IIVA 1WOYA 3DUFB 1CRPA 4HAWA 5AP9A 3C3EA 3AMVA 4Q7MB 2NUPA 3MS4A 1VL6A 1KMIY 1JLSA 3F3YA 3FHLA 3IA2A 3K1AA 1N2JA 3W8RA 4FFPA 4MRMB 2O57A 1OKKD 3R2JA 5C5DA 1TM7E 2PUVA 1N0UA 2YUTA 4YYZA 3ND5A 3C7AA 2OKCA 5E7QA 2HW8A 3TTXA 2QTVB 2NZYA 4G97A 1NN1A 5LIRA 1DG9A 2ZRLA 3QVKA 4HZGA 1ABEA 3SU8A 1N1EA 4EB3A 3AGPA 5DHFA 3JQ8B 2DHRA 3UMCA 4PVCA 3MMPA 4R8LA 4OGWA 1F2TA 3DXYA 3QNUA 3T4UA 3EDOA 1QHFA 2W0SA 3DOIA 2ZUSA 3FNGA 3I2HA 4MWOA 1GILA 2FUEA 1ADJA 4AC9A 3RLFA 4ND8B 2PJZA 2V6BA 3RKRA 5G3YA 2IDMA 4FOPA 2CHGA 2PKQP 1RPZA 4AKHA 5LZ4A 1EWRA 1O2DA 4LNHA 1V5FA 3NYIA 3QHPA 4OQPA 5E2BA 3SF0A 4YJ2A 4TTSA 4WKCA 3SYTA 3EZ7A 1J5EB 1PLJA 2C2XA 4BEVA 4CEIB 3C8MA 4BO1A 5JPDA 2ABWA 4BNLA 4I1RA 1XEAA 5K45A 1GTZA 1WPXA 2B1QA 2VK8A 4DDWA 5LP6C 3QUBA 2CF6A 1E2MA 4B75A 1PJRA 1Y3HA 3GDHA 3N3BC 4HGQA 1CT9A 4Q3LA 1WEHA 3UPUA 3F47A 4CKEB 2BKVA 1QZZA 1N9GA 2JCBA 4PAWA 5JYEA 2VN8A 3QKSA 2AOUA 3I9FA 4BMYA 3NYRA 1RVDA 2WYIA 1L0BA 1TJ4A 1U8CB 2FX2A 4L5JA 1NW7A 1JI0A 1NJ2A 4LNAA 4MV0A 4BC1A 1Y4DE 2QE6A 1O87A 1E2EA 1B74A 1KI9A 3QVJA 1SIWA 2NTNA 1P91A 4H1TA 4H7DA 3MYRA 2PLRA 5D1HA 1GUZA 2B2NA 4P0TA 1OASA 1T5DX 1Q83A 1TO6A 1SULA 2XD9A 3V8RA 3VR6D 5L95A 4JA0A 4WKOA 2VAWA 4W5TA 2GKOA 5JRJA 2P4QA 3HA7A 3M1IA 2A0YA 5TIIA 3L0OA 4NECA 2CJPA 1C81A 1JPNA 2HMSA 3DHWC 3SX2A 5DXJA 2I0FA 4YRMA 1AH2A 4MI9A 2REOA 3KTDA 1AZWA 3O1HB 5GONA 2IL1A 5HKKA 2AYYA 1RCUA 3OMWA 3CEMA 3RAGA 5CVEA 4Z99A 3CBQA 2GPNA 4FC7A 3TGWA 4EKGA 2BZSA 4FJ1A 3G17A 2KW5A 4M0FA 4AX4A 4PYLA 1QUFA 3N05A 3TK1A 2W93A 3DEKA 3PSHA 3JYPA 4YTEA 3RTDA 1KEEA 5HA5A 2RK3A 3G0HA 2JKZA 4G0ZA 4O2BA 3VYTB 1EWKA 3C3JA 4ZAFA 3SLGA 1H8HA 1RAEA 2Z8ZA 3DE4X 3X1WA 4EFLA 5K4HA 3PL1A 1G8HA 4M60A 4EG0A 1G5RA 4MAAA 4QQKA 3HDJA 5IAGA 3OKFA 4PXYA 1OTXA 4KWHA 4EIWA 3AVYA 3W3AD 2F8LA 2X8WA 4GP6A 2IS6A 4U7TB 4CKBB 5AJTA 1OV6A 1ZXLA 3FNEA 4CTOA 1Y3BE 5F5NA 3TW8A 2KBFA 4B33A 2VNKA 4EKEA 2D6FA 3HJAA 3K9CA 3KHUA 2CMHA 2BZ0A 3MOSA 1P6UA 4EBBA 5L3SB 2B5VA 1V4BA 5HKLA 2Y76A 3WLOA 4ECEA 4WZBA 1MN6A 1DC6A 3A1NA 2PD6A 4X1OA 3CNQS 5KYGA 3I45A 2C7PA 1NP3A 1KSGA 2KLHA 3VTFA 1GU1A 5G4KA 4B3CA 1NG9A 3GGSA 1I36A 5JZVA 3TCKA 3R76A 1G291 4PPYA 3RTCA 4L07A 1BS1A 2C1ZA 1XZFA 3R44A 1VE7A 3WK7A 1APBA 5LP6A 4EDFA 3DQPA 1QPZA 4EYKA 5BUQA 4Z3KA 2YKGA 3F97A 3W9SA 4HFNA 4ZQFA 3UFBA 5J5AA 4EATA 2ZKIA 2C4MA 2ECQA 3S7ZA 2OGWA 4WOBA 1P7VA 2E4ZA 2OA0A 4E15A 3M3HA 1REQB 5K3FA 4HD8A 3F2IA 4O08A 4C0XA 4CLOB 121PA 3G82C 4XYGA 3LC7O 2QZ9A 5EWJB 1OA0A 3PHHA 4JGBA 1HGXA 4MB6A 4IRMA 2JRCA 1VKZA 4B3TB 4DWJA 3ZVRA 2AE2A 5TXGA 1PWHA 4NZPA 4O4JB 5KCZA 2XBMA 1KR5A 4LWZA 1KF0A 2P9QA 2ZPTX 2XF8A 4II7A 2VUHB 2PZJA 3UGQA 3Q8WA 4GI1A 4GP9A 3NATA 4Z8XA 2MOKA 3U19A 5CDGA 4EA7A 1CX9B 4YXFA 1OWPA 4ZHQA 4JBHA 4GDMA 4QPDA 4OQXA 1QF7A 1P19A 3FKSD 3UT0A 4B4DA 4HHEA 4WW0A 4DY6A 2YFHA 1DKRA 1QJ4A 3PX3A 1NZDA 3OZEA 3ZH2A 2HA6A 3N2EA 4J3JA 4P4NA 4DM3A 1DAEA 1QYRA 1N8KA 4Q3BA 3ZBQA 1FRQA 2JH8A 4C22A 2XYRA 4GMXA 4DA8A 2P4SA 3A28A 1RMYA 3Q87B 1DBIA 1TLLA 1XJ5A 3OOYA 4BFXA 5BQXA 2FR0A 2ZSUA 3ZNQA 1YB7A 1SJ9A 3FSEA 1CR0A 3S68A 2IHZA 3P2OA 1CUSA 4FFNA 2ZXFA 1KEZA 1Y5IA 5GINE 4BU1A 4PLWA 4QT0A 1KBZA 1KWGA 3EQ7A 1G20B 1QTNA 2QRGA 3KUKA 3DT8A 2BI7A 1L9XA 4NCIA 3ZV7A 1ZNQO 1UP7A 1L5RA 4G4IA 4I9UA 3DR3A 3DOEA 3M3DA 5JADA 3GV0A 2B4YA 2X8LA 3D3WB 3N8NA 1QRDA 4K9LA 4PXSA 3N0VA 1O0CA 3COPA 4R1PA 3UA3A 4AZ0B 1QDUA 5A04A 3TF5A 5LL6P 3G88A 3O8NA 2ZM5A 4NZ9A 3RK4A 4KWIA 4PRLA 4QJ5A 1K4YA 2CXTA 5HVNA 2FP4B 1H05A 6Q21A 1DWQA 3HA5A 5LQSA 2QL5A 4N8EA 2EFYA 5ESXA 3GUVA 1XF9A 3D2CA 2JB9A 2DQZA 2XB6A 2W8ZA 5JO0A 2DR0A 5TRTA 3VC2A 5M29A 3AL0C 4OXKA 3M6VA 4RLHA 4TMYA 3G2HA 4QGFA 3HPRA 5CYFA 3ROTA 3DBLA 1X7WB 2BE7A 2NZ8A 4MVCA 1O96B 5AM3A 1QIEA 3GP8A 3HP7A 1NM5A 2Q99A 1XCOA 4YCCA 1E0AA 3ZX5A 2Q3EA 2YVAA 3FDFA 2PUDA 4CM9D 4E03A 4JWTA 4XIYA 4CXMA 2E4AA 2WYWA 4I8DA 4J94A 2BEJA 3OURA 1KMMA 1DE0A 1E9CA 1VECA 1YR6A 1C1YA 2J3DA 2ZJ7A 3KOWA 3MCAA 4NV3A 1YDEA 4WERA 1UH5A 4I1SA 4KMOA 3DC2A 5I6DA 5ALMA 3KLBA 4LDQA 5CG1A 2IFTA 5K0LA 3NALA 3CT4A 3DBVO 3PUXA 1IXYA 3DDZX 5K8JB 1MVOA 1S2NA 4M38A 4ANFA 2UXDB 4OU4A 1RT9A 4I46A 4Y67A 3B1VA 4AMBA 2IY8A 1E7YA 1KY3A 2EARA 3VPGA 1W88B 2FP3A 4KDCA 4C6TB 1L5YA 3EBLA 4LK2A 4ZPXA 3KTFA 2NYAA 3KFVA 3PA6A 3VH3A 1NJFA 1Q20A 1YI8A 2FWRA 3D3NA 3KQPA 4J0FA 3VHLB 4IEEA 4EY5A 2WV7A 4ZCTA 2VK1A 1Y9EA 1EAYA 4PZ0A 4JOCA 3N0WA 2H2FA 1RMQA 2WFMA 4HGOA 4N0QA 3DOFA 3KHKA 3FOAA 3KWLA 3QW4B 2B9VA 4RZ2A 4MHTA 4V0QA 1E9SA 2R86A 1JXOA 4JZKA 5H4HA 2QXYA 2UV8A 1R88A 5JZMA 1EM6A 2CJFA 3CO5A 4A2PA 2JHPA 2PDAA 1R16A 2GD0A 2RGXA 1QLJA 3FGZA 4YRFA 5FFMA 3STHA 4B7XA 3LY9A 4E7OA 3EDRA 5TNXA 3HUFA 1E3TA 4OG2A 3EZNA 3I5YA 1BEZA 1WY7A 2CHEA 3BMNB 2WU8A 3DWGA 2QJTA 1H5QA 1RCTE 4PQFA 3SLKA 4CM4B 2G0NA 3KOZA 4PONA 2R48A 2BCEA 1XRLA 2IU4A 4FR2A 3VBEA 3LWBA 3RYTC 2VZ0A 3DO5A 5HRCA 3KD3A 4DG9A 4I9GA 1LQTA 1ZSVA 2J0VA 2I6GA 2C31A 3IOBA 4ZKDA 2R5FA 2RHJA 4FEEA 1LNQA 4P3NA 1URPA 1ZHFA 1BYUA 3AOGA 2Y05A 2RH8A 3K7EA 5DCLA 5H59A 3GEEA 4J7CA 4GNKA 5E4FA 5L4NA 1I3NA 2VPQA 1EVKA 2HT1A 2M6LA 3VVCA 2FN7A 4DG8A 3WB9A 2QM8A 2YASA 2XMSA 2CSUA 4R16A 3HXMA 1SZPA 2FWAA 1Z22A 2P69A 1C1HA 1CUZA 1WB5A 1Z5PA 3RVRA 1TK2A 1MORA 1DGQA 2V7XA 1LLFA 1DQYA 2YXLA 1KZHA 1A96A 4FI3C 1E1DA 3B1WA 4PYOA 3RTBA 5AOVA 3AI7A 4FYWA 3EPKA 3LYHA 8ADHA 4UHBA 4QYXA 3ED5A 3R20A 4GSLA 1J2YA 3UJCA 1AKUA 3QXCA 1GUBA 1WB9A 1N7JA 1QH1B 2UZIR 1Y63A 2ACVA 2WKPA 2QN8A 3IAS1 4UUPA 3KAQA 1MEOA 3M2TA 2NGRA 4F5ZA 3RREA 3W2GA 4HKTA 4B2IA 5E6SA 1IHPA 5IK2A 2VF4X 1C80A 3HO6A 4FMDF 4LW8A 3UWOA 5IZCC 3RSFA 2XVAA 4M21A 4GBJA 1DRJA 2Q0SA 2VP0A 3R9XA 1KEPA 5D85A 4FQ5A 5JAPA 3LKVA 1EE2A 4ZHSA 1Z6PA 2VBFA 2I2CA 4LCBA 3QBTA 3Q1KA 4B71A 3E2IA 3BL6A 1THZA 2JBAB 4RY9A 2QRJA 2NX2A 2L2QA 4BQOA 1QIMA 3F8WA 4RV9A 4RW0A 5IZ4A 3RT7A 3L7DA 1CUFA 2WKSA 1S2LA 4JL5A 3NETA 3UBMA 3G8AA 2VLBA 3DVRX 4HRVA 3CPEA 4PNPA 4FHDA 3LYAA 4J1TC 4IMJB 3I9JA 1N7GA 1YS6A 5IKPA 5M34A 4JFAA 5F52A 4Z7OB 1NQ5A 2A0FA 1TDJA 2QSYA 3SKYA 2WT4A 2P41A 5DBGA 4DSZA 2HF9A 2GR9A 2O2EA 1X80A 4HPWA 3HHPA 3HCCA 4GVLA 1N0WA 1QZXA 2O8CA 1V3UA 1M5TA 5DTEA 5I7AA 2BEVB 1T5HX 3ASYA 3QJ5A 1T6NA 5HIAA 3FMOB 4BFTA 5JY6A 3UENA 4EHLA 3D2BA 4HDNA 2WM2A 4MQ4A 1GTVA 1PEAA 4EUNA 1GNPA 1M54A 2H2HA 2VUIB 5HK9A 3FNBA 4ABYA 2I03A 2BZ1A 2IWRA 3HMKA 1Q3TA 1T4BA 4KQMA 1WZ2A 1Y89A 2EL7A 1QDEA 8AT1A 4II2A 2ZB3A 3L18A 2XXAB 5CXUA 2PUFA 3W90A 3BX1A 1ZOOA 1R3UA 2O0KA 2B61A 2Q5OA 4N82A 3RF6A 3UJ7A 3VKVA 4MPRA 2BBTA 1AT1A 2YHUA 3KXKA 2Q3HA 3FGPA 3JZMA 4PRKA 3VHXB 5ALVA 4BNYA 2GNOA 2R87A 3WRYC 4S24A 3A6LA 5ECDA 4ZVSA 3AFIA 3U3KA 3H83A