4O02H

Alphavbeta3 integrin in complex with monoclonal antibody fab fragment.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGAELAEPGASVKMSCKASGYTFSSFWMHWVKQRPGQGLEWIGYINPRSGYTECNEIFRDKATMTADTSSSTAYMQLSGLTSEDSAVYYCASFLGRGAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSAGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Integrin alpha-V
publication title Atomic basis for the species-specific inhibition of alpha V integrins by monoclonal antibody 17E6 is revealed by the crystal structure of alpha V beta 3 ectodomain-17E6 Fab complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2013-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o02H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o02H02
1UWGH 4K3GA 1T2QH 2RCSH 4NQXB 3SDYL 1FFPB 1CDBA 3TIDB 2R4SH 3PP4L 3QIUD 4KV5F 5MENB 3RVTD 4POUB 2Q8BL 2BOBA 1T20A 4MCZA 2AJUH 3MV9E 2W9DH 4HBQA 4KJWD 4NPYB 4DN3L 5BOPA 1R0AH 3WXWH 3VFNA 1EEUA 1YY9C 4NQDB 4WUKL 1DDHA 3LKOA 5CBEA 4LCCC 1LO0L 3VXOA 4WJ5B 4N0UA 1S5HB 2ED7A 3SDAA 1RZ7L 3OR6B 5ACMA 4PRHD 1SMAA 5D8JH 4PGBB 4ZS7L 3X3GL 4L3EB 3WUWB 4PJXB 5FV1L 3SE3A 5CEZL 1RZIA 4NM8H 5J6HA 2P8MB 4TVPH 1IAIM 3QUYC 2NY7H 4IOIB 3RP1A 2A9NH 1R3LB 3VDBA 3MACH 5E94B 4TSAL 5F9JA 4X9BA 3IB4A 5D1ZD 3GO1L 4WFHD 5CWSB 1OD9A 4A6YH 1MJ8H 3CJJA 3TA3A 1TJGH 4Y5YA 4CNIA 2DWEB 4NQEE 5E2JA 3QH3B 5TDPB 4Y4KD 2VXSL 1KCRL 3O3BB 3VXQA 1RIVL 1AQKL 2NX5A 3UYRH 3DV6A 4N9GB 4X7EC 3T09A 4I4WB 2DQJL 3BWAB 1OAZL 1ZT7B 1CFQB 1RI8A 3V6ZA 2FSEB 3MJ7B 2OP4H 2VISA 4JDTL 1UXSB 4LVNC 1CFTB 4P48A 3U7YH 1FG2B 3PWVA 3PWUB 1G7JB 5KTEH 1J8KA 4HCRA 4G6MH 5EWIL 4YHPB 1KUMA 3AB0C 5E9DA 3IU4H 4IOFD 4HIIA 4OZFG 4KU1A 3WFCH 4S1RH 1G7LB 3HG1B 1BJMA 1W0YT 4N8VA 3V5HA 2J5LC 2OI9C 4OCNC 5FOJA 4AQ1B 5M95B 4LEXH 3H2WA 4FHBD 3MA9L 3RPKA 1AGDB 4RBPK 4C54A 5DJXA 3RWJA 4NKIH 4M6OL 1BVKB 2QSQA 3JUZA 4AIXA 1Q9OB 4Y16A 3ARFC 4XNUL 1CXHA 4XC1L 1QR1B 3U0TB 4UT7L 4G9FE 4G9FA 4PJEF 4AM0B 4R0LC 3TIEA 4DGVH 1D6EB 3QUXC 4PJ9C 2IJ0C 1AXIB 1QSFE 3MRPB 3QFJB 1AO7A 2FX7L 1F11B 5KW9L 3I2CH 3S7GA 4GT7A 5D6DC 1G9MC 5GGSY 2ZOKB 1OPGL 4RWHA 1UZ6F 3BGMA 4XNXL 4BQCA 3N1MC 4WDIB 5CJQL 4OD1H 3SBWC 4PJAF 1J1OH 4M7ZC 5EUOF 5C0EB 3NCBB 1EERB 4M7LH 5K9KA 4RAHA 3RWIB 3MLXL 4JFFD 2JJTA 3IDNB 5DD3H 4X7TA 3EJYD 3LSOB 4WEMB 4G43B 4PJFE 1OB1B 4PJFA 4CAGA 5BW7A 3EFFB 4LIQL 4RGND 2DQTH 4NQVA 5IFHH 5EH1A 4P4RA 4F15B 4LMQE 4HGWA 2FEDC 3ARGD 1LDPH 4OQ1A 3DLQR 3TT3H 3T0DA 4ZO6A 3ET9F 3OF6D 4ZTPL 3R1GH 1YEDB 3V6BR 3BHBA 5D6CA 3ARYA 4MAUH 1IEBB 5ENWA 5JW4N 1ZVYA 1RUKH 5I1AB 4KK6D 1K9TA 3X13B 4YWGH 5TQ0H 4EBQH 2VITA 3UZEA 4M8VA 2IALB 4HT1L 3BH8A 5D1QA 4X5WB 5IBUB 1REIA 5GS2D 3BN9D 3QWOA 2BVTA 4IRJB 3TP4A 2VNCA 2E7CA 4OLUH 3FFDB 5I1IL 1YMHA 2E8YA 4KVCH 3RTQB 5D7SL 1FZOB 2P7TB 3IS0X 2WW8A 4TOYH 4JN1L 2BVYA 3L3GB 4QRTB 2FRGP 2ICWJ 5C0DA 1WZ1H 4M1DH 3WIFA 4PJGE 4XNQA 3L5XL 3KPRE 3ZE0F 1NUFA 1J0IA 5LAXB 2R2BB 5I0DA 3ZYOA 3QUKA 5HYJD 3PABA 1MRFH 3TCLA 2GEEA 1CE6A 4XMLH 5HI4D 2NZ9D 1RD6A 5DRXB 3ZKMD 2QLVB 1K4CA 5I1GH 4HUVA 4B0MM 3ULUF 4FXKA 4KROD 3B9KD 3BUYA 5CJXA 5JORA 4OCMC 4APQC 5L8JB 4KKBD 2AXFB 4PJEB 3DMMA 3FO0L 2DS4A 3HI1A 4OFYA 4UAOB 4UOW1 2ZPKH 4OZ4A 4Q9RH 1IAII 3V5KB 4FXLA 3QDHA 4OSUL 1HIML 1WBXA 4KUCD 4X5LA 1T7ZA 1CDGA 4U6HB 4TNVK 3L6FA 3OKEB 2EDYA 4PGDA 1IAKA 1L0XA 2B4CL 1KB5H 3UTQB 1F3DJ 1YPZE 3ROLA 1XGRB 2YD2A 4RWYL 3MV8B 2IH3B 5GRZA 2CLZB 4PJAB 5C8JB 1U42A 2GSIA 5GRVK 5DJDB 4H25A 5BS0A 1S7VA 3BMWA 3FRUB 5GGTH 3CH8A 3LKPB 5ALBL 5FB8B 1JPSH 2HTKC 1Y6NR 1KTDA 4WWID 1HCFX 4X6FA 3VFUA 1EGJA 1F58L 3CFKA 3RNQA 3VFGH 1G7IA 5I17A 2X4PA 4GRLA 4DVRH 2BJMH 3BP5B 2CPCA 5INCA 1BQUA 2CK2A 3W11C 5JHDD 1IC1A 2H41A 2F54B 3F58H 1AI1L 1NGWA 1V3KA 3O6LL 4JZNA 2CSPA 1HDMB 4HK0B 2X9XA 3O9WC 1M6OA 5DT1H 3SQOH 1N5AB 5JPNA 2V7NA 1SM3H 2WP3O 3M45A 4YDJA 5F7LB 2EYRA 5FYKD 3D1MC 5TE4L 5C9JA 2JIXB 4RAUB 1T3FA 4XC3H 1YC8A 3P30L 4JQIL 1MFCL 2XT1B 4G8EA 1MAML 5IMKB 2A9MH 1MJUL 3HUJF 3RZCA 3ZYJA 3DVNB 5EU6B 2MQCA 5AWNH 3D18B 4ZTOL 4X6EB 3NCMA 4JFHD 2HJKA 5F21B 1CZ8L 1T1ZA 2SEBB 2IPUG 1ODAA 4YGVA 3QIBB 5KBNC 3WS3B 1MIEL 2XTLA 1EEYB 2AJZA 1EJOH 2ZUWA 5IQ9A 1C1EH 3CK0L 2XY2A 3HMXH 4HIEA 1EIBA 1GZPB 4JVUA 4WV1A 1ORSB 3FOMB 1AR2A 1VEOA 2I07A 5CFHA 4OJFH 4YHOL 1FV1B 5DR5L 4PRIA 5LCVL 4XP4H 2DQHH 3OGOE 4F57L 2E5EA 1NCCL 2NY2B 4KK9D 4OZGB 2B2XH 3BE1L 4H20H 1VDGA 2EDDA 3LZFL 3F7RA 3UBXG 5HYIA 1QRNE 5C07B 1Z0NA 2BHZA 1JRHH 3UTTD 2F5AH 4ODWB 1CT8B 1Z3GL 3WD5H 1A4JB 2EO9A 4JG1H 4R97C 3KLDA 3RA7H 4P0DA 2F8OA 4ENED 3MLSH 3QDMA 1QVOB 4J3UA 4D0BA 1PBYA 1I7RA 4JO4L 3AS1A 4N90E 4PP1C 1RV6X 5KANG 5DHYB 5DO2D 1YA5A 2L7JA 3RWHA 2LTQC 5K9JH 5EBLB 1RJLA 4OT1H 3BMVA 4NWUL 3NFNB 2WQ8A 3KYMA 1WQVT 5E8OA 1DANU 1F4XL 2UZXB 2XRAL 3KYOA 1RUPL 2QBWA 4LGPB 4JDZA 4TNWK 5EBMA 4PREB 1MFNA 5EZJB 1FIGH 1NGPL 1CBVH 1KSRA 2R0WH 1I4FA 1KIQA 2IC2A 3VFTA 4Y1AB 2GQHA 4XPGL 3PWPE 1OWWA 3PWPA 4Z7UA 5A2JH 2KQNA 3CU1A 4QRRE 4HPYH 1HKLL 3B5HA 4DKFH 2EDKA 2XWJB 4PJ5A 5KOVC 2AJSL 3U7WH 8FABA 1ZANL 2R1YB 1VADA 1VKXB 5IVXE 2XZQL 2PCPA 5ERWA 1H0DB 4G6AD 2LQRA 4UINL 4OUUA 5C6PB 2RB8A 1WC7B 3NCJH 2CKBA 5I76A 4M00A 5MERB 4Y88A 1U93A 3G04B 3T2OA 3M07A 2VDML 3V6OE 4M1CC 5IW1A 4Y89A 3O11A 1HYSC 3BDYL 4WW2C 1EHLL 4PRNB 5JNYA 3ELAT 4DZ8B 3HUJB 4ZOCA 1R6VA 4WIQA 2P24B 1ACYL 4JM2A 3J8F7 3WIHH 3H3PH 4M03A 3PWJB 4XPHL 4HX1B 4UV4H 3PWNB 4U33A 1X5IA 4LGRB 3HFML 3VE0A 4QRPB 4Q9QL 1ZLVH 3QEQE 1U95B 2E6QA 5ITBH 4TNVF 5FYLD 2G5BB 5KVMC 3CMOH 1H9VA 2H32A 2FBJH 2C5DC 4QF1B 3NBNA 3MC0A 3JV5A 1T83A 4LSVL 5DDHA 3CZFB 3AVEA 3VD9A 3FQNB 1KJ3L 1FLRL 1YYMH 1FPTH 2RIKA 3NFPB 3QIUB 3SO3C 3WV0A 4TSBH 2A73A 3U4AA 3FFCA 4XP5H 4CU6A 5F3BA 1E4KA 5BMFH 3QDJA 3SGKC 5KVFL 5E2TH 1OP3K 2XXCB 2W0FB 4AL8L 4P2RD 4E0RB 4NKQB 5HHOD 2R69H 4HQQL 4PRHB 5FHBL 4JKLA 3GRWL 3PL6C 4LQFL 1FVDB 2K9UA 4QXWA 1N0XL 1RFDL 5GGUB 1I1YB 4S11A 4RFEB 1OGAD 4WHDA 3GSNH 4OTXL 4J1UA 3O8XC 4GW5A 2MWCA 2XWTA 4ZUUA 4OCXH 3MRCA 1OTSC 2D7PA 3GNMH 5GRVL 1ZT4A 1IC7H 2NR6D 1TIUA 2VERN 4LFHD 4Q9BA 5D1ZB 3K1KC 7FABL 2PW2B 2QSTA 3OR7A 1J18A 5DURD 1Q72H 3C6LA 2A6JB 1XF4B 3KYKL 4Y4KB 5D5MA 3P9LB 4LDOB 5HHMD 3C8KB 4JREC 5I19H 2YD5A 4KVNH 5E6IA 3QQ4B 4HZAA 2VDLH 5HYSA 4I48A 4NRXB 3T3ME 4JEGB 2CR6A 3R0NA 3MLUL 4P57B 1ND0B 2I9LA 2V2WB 4JHBA 5L88L 2R0LH 4J8RA 5FO8B 1NMCB 2IFFH 3QHTC 1IGCL 3PGFH 3R8QA 1EEZA 3CGTA 1WWAX 4LPYA 5GRUL 4X4YB 3KPNB 3RX7A 5DTFA 5KZCD 2OJEB 4DVBB 2QHRL 4OF6A 3JV6A 4NQUA 1HXYA 4BKLB 1QBAA 1CD1B 2XPGB 5I8CA 2FHBA 3WS6A 3MUHL 1J7VR 5DS8B 5DJ8B 3LEXA 3RGVD 5E00B 1P7KA 5E5MA 3HR5A 3W9EB 2XA8L 3HAEA 5C0NC 3QXDB 1XEDA 1HSAB 4TPRL 3D48R 1FL3A 5FEBA 2GY7B 2IMMA 3WFEH 4N0FA 2ZZUT 1B6DA 4WFFD 1ZGLP 3VG9B 5I1HH 1U58B 4EI5A 4C83A 1QQDB 2ZOLA 1FVEB 1HQ4B 4A6YB 4JVWA 5CSZA 2KH2B 2HFTA 4KUCF 3NH7L 1B0GA 4IMKA 2VXQL 4LVHC 4ELMF 4PLOB 3C2AH 4KKAD 2EDOA 1IRAY 4MA7L 2DQFB 2XKNB 2VLMD 2J8OA 4AENA 3U9PH 2R56L 3AM8C 2VIRB 2N4IA 5E6ZA 4J6RL 3R4DA 4HWBH 1Q0YH 2EDWA 2AGJL 4FQIH 4PJHA 4RGNB 4L5FH 3U36A 5D7JB 3BESR 1EXUB 4CN1A 4YFEA 1DSFH 4K94H 2XICA 5GS1A 3ARGB 2AI0L 5IB5A 5EU5A 4LP4A 3TBYB 5ALCL 5JXEC 4X6CA 2LV4A 4F7TA 4NN5C 1H3PH 1T89A 3OG6B 1ETZA 1KJVA 3PHQB 2JELH 3U79A 5F7NC 5IOPB 2A83A 2B39A 5C0IB 5LWYL 2VZSA 4MNHA 5IHLB 4K8RH 4XPBL 2QL1A 4U1MB 2H9GA 1CL7I 2P5EE 4TUJB 2XA3A 4WI9A 3V7MA 1NCWH 5C71A 3GMRB 3MXWL 4MAYA 2F9BT 5GPRA 2VDQH 4D0CA 3MRHB 5J1SC 5EC1B 4AY0A 5CILH 3MNVA 1RHHB 2NNAA 4NN6B 3KYNA 1ZHBB 3I9GH 3QDGD 1UXWA 4P9HH 2UZIL 4GW4A 3WHE0 1NFDE 2EIZB 1XGYL 4JHWL 5IBTL 2F5BH 4IHOA 2WBJA 3WNPA 2PTTB 4P5MA 1X7QA 2PYEE 4YGAB 1NQBA 2GI7A 3HE6D 4WFGE 1RAMA 5HYJB 4UQ3B 3SDCD 4RGOH 2XOTA 4NSKB 3M1BA 1DQQA 5D2LA 1ZLUH 4BQ8A 3TESA 3U2SB 5FYKL 1WCBB 5ITFA 4NHCH 4KROB 5FO7B 3DRQA 4QHLA 4YXLH 3KWWB 4NFDA 3GFUA 1MCFA 2VR5A 1S8DB 3QG7H 3EO0B 5ABDE 5DLML 2OTUA 2WIIA 3HPLB 2FZ3B 3T08A 1A1NB 1IEAA 4FFWC 1MI5D 3BXNA 1L6XA 2V5RA 4HKJB 4HUMB 4LCWD 4LCUA 4ELMB 2OL3H 5F6IC 1AQDB 1L9NA 5E8EA 2HP4A 4OCWH 4RRPA 2DDQL 5IHBA 3C5JB 1U8LB 4QWWC 1K8IA 3KR3L 2J8UF 2FLBT 4F15C 3TZVA 5C0BE 2WK2A 5C0BA 3O81A 5D7IA 4YQXH 2V5SA 4LSDA 5J11C 1U8MA 2AV1A 3ZHKA 2QSVA 4NZRL 4ODXA 4XB7A 1A14H 4PYHA 4GW1A 1IQWL 1QUNA 5F1OB 4P23A 1QOKA 3DX6A 5EZOL 5F6HI 4R7NA 4YUEL 4ZMAT 4WUUE 4PB0L 2FGWH 5JHDB 4DFIA 2VLJD 4IRJC 2HLAA 4IRSD 3RL1A 5EC2B 2YOCA 3GMLA 5AG9A 4HWEH 1TQCB 4JY6A 4YHMH 5B3NA 4BELD 4I0CC 3GJFK 5HYQB 1KJ2H 3ILPB 5FCUH 1T1YA 1HOCA 5ESVA 2B1HL 1QSEA 4D3CH 1P1ZA 5JOFB 1WBZA 2X89A 2BVOB 1KLUA 2V9QA 1D5BA 5MEPA 5EBWA 2EDEA 4MCYB 1QZ1A 4BA8A 4P3CH 1AXSB 1DFBL 1C08A 2EDJA 1EHXA 4KJQD 5EZIH 3SKUD 1CXFA 3MCLH 3WLBA 5C2BH 2KBGA 4YBQD 4Q7DA 4YZFF 3TN0D 4R8WH 5IF0B 2JKXA 2Y9RT 1BIHA 3RRQA 1URLA 3P11L 2BNQB 2Y06H 5C08D 4U4BA 1ES0A 1JF1B 4FQLL 1MCCA 1PZUB 4C55A 5T1MA 1XF5A 4EVNA 2VE6B 3HC0A 3AC0A 1VFBB 4GKOA 5FUCE 3FO2A 3QNXB 4ZFOB 3KPQA 4UAOC 2VLRB 1V3MA 4NZUL 4NYLB 4MMXC 1MPAL 3N1FC 4TQEL 2VDOL 5J57B 1NMAH 1BPVA 4LK4A 1ZA6B 1IAOA 3QWRD 1FNEB 2FH8A 2P8PB 2PR4H 5F1NA 4UQ2B 3HE7C 5BO1H 1TMCB 3UTTB 1U3ZA 3MFGB 2XTJB 1HNFA 1QLRA 4NIKB 1KCVL 2DBJA 3MV9D 1U41A 2LVEA 4ZO8A 4F80A 5HGBA 1LK3L 3MJ9A 1KENH 5AYQA 1KEGH 3MGTB 4L4VA 2XFXB 4JR9L 5HDLA 2OTWB 1KEML 2VZ1A 5C0JB 1TLKA 3O6MH 1NC4D 5T3XE 3PGCB 4GG6B 3TYFA 1MY7A 5DD0L 1DBKH 3EO9L 2J8UB 4UTAL 3P0VL 3MLZL 2ZUUA 4Y5VB 2MKWA 5F70A 2JK5A 3HRZA 5ICXA 4L29B 3WHXB 2X7LA 1AKJD 2DI9A 3OXSA 1FZKB 2WP3T 1M1SA 1BVZA 1NLBH 1W0WA 3I6KA 5KG9A 1J11A 2O5ZH 3LIZL 1CF8L 4BJLA 3N1GC 2YXFA 4OZIE 4NBXB 1GXEA 4DGYL 2DQDH 4P99A 3EFDH 5D71H 5H8DA 3T2NL 3NZHH 1G1YA 1QFWM 3G5YA 1EVUA 1FDLH 2D0FA 4NN7C 4OZHA 1VFAB 5JA9A 4NHUB 5H35A 1ORQB 3TWCL 1HEZA 3JTSB 4R0LA 4GAJL 1BJ1J 1KC5H 3MYZA 1JL8A 3D3VD 4JRYD 3HI6L 2VXTH 5DWUL 2E7LA 3A6CL 5M94B 1Z5LA 1EHAA 4U49A 2F8VA 2HKHH 2W65A 4MJ2A 1LEKA 5GJTH 2DQCL 2VN4A 2HKFL 2EDNA 1HHGB 4QTHB 3S9DB 1OCWL 1ADQA 2B4CC 3HZVA 2AABH 1E6JL 1RZKC 5FKPB 2OR9H 1T5WB 4PJ8C 4ZUWA 1S3KL 4JFOA 4CU7A 4PRBA 5E8DH 3VXME 3W5MA 4YXHL 3GMMA 4MQ7B 1F8TL 3ARVA 3ULUC 5F72S 1I1FA 5HJ3B 1KOAA 3GBMH 1F45A 5T1DH 3VXPA 1LEIB 4F9LA 3OSKA 1OSPL 3O45A 3G6JF 4D9QD 3JWNC 3UDWA 3QQ9C 3QEHA 4ZUSA 4TUOA 2ZNXA 1HCVA 3DRTA 4NZTL 2Y25A 5JLZA 2R23A 1LP9E 4JO2L 1D5ZA 3EUUA 1YEIH 1GOGA 2FB4H 4LASL 2VDKL 3ZL4H 3RKPA 3MGAA 1YN6A 1QSFD 2EDRA 3UJJL 2ESVE 5JIKA 3RY4A 4HC1L 4QNPE 3RIAK 4Y2OA 4D2NA 4MWFA 4GQ9H 4YBLB 1OM3H 3DBXA 3QULA 4FXGA 1XT5A 4GAGL 5ADPH 3IDJB 4MSWB 1NCAH 1MLCB 5I71C 5E99L 1NCDH 4P2RB 2FL5A 4WO4A 3HS0B 2FJFA 3EYFA 4QT5B 4JPIA 3EBAA 4ORGA 4JFEE 1GPOL 1NGZA 3PV6A 3UJIL 2BSSB 2GITA 1FYTD 4NO3B 4TYUA 4Z8FL 5EULV 4C56E 1BQSA 3BZ4B 4POZD 1I9EA 1L7IL 1BD2E 1A1OB 4RDQF 5FF6A 4UOW0 3EOTL 4JFDA 1RY7B 4RA0C 3D69B 6FABH 1HQRB 2HWZL 4XCNA 1ZAGA 4ZPVB 3G08A 5B4MC 1CXLA 4OF3A 2WWKT 5AZEL 1KULA 3UC0H 3DUHA 4OZFH 5DURB 4YHZH 1DBBL 1A0QL 1DANT 3O2WL 3SDXF 5CHNA 4I2XE 4UBDD 4JZOB 3K74B 1JYXA 2GFBB 5HHMB 1P7QA 5C0RH 4AT6B 1IC5L 1YDPB 2ID5A 1OP5H 3K81A 2P5WA 3DXAB 2QR0A 5D1XC 2AQ1A 3MV7A 1BQLL 3ARXA 4OF0A 4PGEB 5C6TH 4I0PD 3MRKB 4K55A 3QRFM 1P2CB 2YUXA 2HMID 3H9SE 4JRXD 4LU5H 4HS6B 5KZCB 4HIJA 3F8UB 4F7PA 1I3VA 2YPLE 1G0DA 1MCOL 4Y5XA 1XIWC 3RFZC 1VPOH 2BC4B 1YNLH 4CW1A 3UPCA 4TN9A 4FQQB 2GCYB 3GSNB 2HFEB 1AC0A 3SDDD 3RGVB 3ZDYF 4PJ7A 1JGEA 3L3HA 4MNQD 5TDOB 5HVWA 2D31A 1AJ7H 1UWEH 3GHBH 3ZKND 4GO6B 2CGRL 4X80L 5I73C 3OJMB 1KELH 4Y0GA 4H5SA 4KJWC 1MCPH 3LCYA 1YQVH 3L9RB 2B7DT 2HN7B 3VFVB 1N5YH 3B9AA 3RPIA 2V5YA 2F74B 4ONHB 3MBXL 4JZJC 1KCSL 4K2UL 3F7QA 1R5VA 2C7UA 1FFNB 2CO6B 1I1AB 1QFWI 3F7VA 3KPSD 4M5YH 4OGAD 4WEBH 5IJKC 5C0AD 4M7JH 1CQYA 1U8JB 4JG0H 2ED8A 2PO6C 4LL9A 4LQ1A 4YDLB 3QCTH 5BCAA 3CDGA 3M8OH 4X98A 3SHSA 4OKDA 3MLYH 2Q87A 2IQ9L 1JFQL 4WGWB 5KVGH 3ARBA 4P5TA 5DEFB 5EFIB 1UM6L 4PRPE 4PRPA 4N0RA 1J9CT 5C86A 4G8IA 3DARA 3GDBA 5L9DH 5SV3A 3BUTA 1A3LH 3MROA 5IUSA 5BQ7A 4F33B 2VZ3A 3O3DA 4L8CB 1MFBH 2AK4A 3C8DA 5D7KE 1JGLL 1U8QA 1WAAF 5HYFA 4HW6A 3KLHD 4U6VL 4JDVA 3SDXB 4Y4FA 1NMCC 2HT2D 4GSDH 2PYFB 4CMHC 3BEWB 4XMPL 4TSCH 3AROA 1ZHNB 3QRGH 5I8EB 4PRDA 3QDGB 4IOFC 5BZDB 5EPMB 2CDGB 4PR5A 3IAGC 3I6GA 3G5VA 5IV2A 4UDTB 4YPGB 5B3JE 3NTCL 3ZKQD 2ADJB 3IU3A 5HGAA 5DSCA 3V5DB 2VAAA 2QQLH 5IESH 1S7TB 3VH8G 3SDCB 3U0PA 1RULH 5CCKL 4PG2C 5D9SB 1ED3B 1Q38A 1IGIH 5E6YA 2NTFB 3LKQA 1PKQB 3L95B 4HZLA 4X4ME 1GOHA 3GSXA 3QUML 5E2VL 2CXGA 3HKFA 5SWSE 4Z7VE 4S0TD 1NCUA 1EO8H 1QP1A 4P46A 3CVHL 3FO9B 1NDMB 1FNFA 5F9AC 2YEZA 2EDLA 3FB6A 4U2YA 4MXQD 2FJGA 4NNXA 1Q94B 1C7SA 2AK1L 4PV9B 3IFNL 4ZO7A 1MI5B 1TCRA 1IM9B 4Z7NE 4XAWH 1YJDH 2DMCA 3V0AC 1XCQB 4LCWB 3P73A 4DKEL 1GVIA 5CEYB 4NJ9L 2YRZA 2K7QA 3EJYC 25C8H 5HHQA 4MQSB 4XPAL 3MRGA 4RGNC 4Y19D 1XR9A 3GJEA 1SY6H 3C9NA 2ZUVA 4Z7QF 3RWGB 3VXUA 3VXRE 3FOLB 3C6SB 3FB8A 5B38B 3S8WA 5IVZA 3VXTB 5JUEH 5ESAB 1BREA 2R4RH 3F12B 5DMJB 5AD0B 3IDYB 4HFUL 4OLZH 3ZO0A 4ZUTB 4KK6C 4FNLH 4R96A 3MO1A 2BSTB 1NEZB 1BJ1H 2X4QB 1BBJB 4HXBH 2BDNL 1V5JA 3PXHA 2P47B 3BPNB 3BZEA 3BN9C 5E5RB 3CH1A 3VFWA 2V17H 2VLKE 2VLJB 4HJ0C 3DUSB 1Q1JH 1DUZB 4U6XB 5DA0B 4HJJL 4NJAH 4RGMB 3WUWG 3S4SA 3BZDA 1HHHA 4V2BA 1EMTH 4K3EH 3GIZH 4X8JA 4F7CA 3V0WL 4O02H 1IGFL 2EC9U 4KH2A 2V2XB 3QUMB 4FG6D 1BP3B 1A8JH 3GSOA 1HH6B 3IDUA 3RVXD 2UWEE 5I6XC 1LEGA 4FTVB 4E9LA 2GIYA 3DSFH 2ZCKL 1PAMA 3WXVL 1IL1A 4DK6A 3CVHB 4NKMB 3L7FA 1OSZB 3IXAA 4M4RA 1R5WA 2OZ4A 5I15L 3S34H 4BQ6A 3KPTA 1XF1A 4JO3H 5HI4C 2NZ9C 2ARJB 5BXFB 2APWA 4QXUL 4KROC 3B9KC 4HGKC 3V4VL 4OB5L 1CQKA 5C08B 4M48L 4KWUA 4BYHA 5JMOC 2NW2A 1KT2B 4UUJB 2GJ6A 4KKBC 2ZKHL 4X6DE 1LILA 2DQGH 4X6DA 3VWKB 1DL7H 3VMOA 2LU7A 3SQBA 3BO8B 1W72H 2J6EH 3ARDA 4GMTH 2FIRT 5DUPH 1OLLA 2CK0H 3HC4L 2R0KL 4FRWA 2JJVA 2HFFB 3SKJH 4EIGB 2X9YA 1X6NA 5HHVL 1MHEA 4O2CA 4G8GE 4G8GA 1FGVH 4F37K 2HJLB 3RZWA 1EFXB 4EI6B 3QZWA 1ERNA 5ILTL 3GBLA 4P2OC 4D0DA 1DVFD 3MV9B 1OAQL 5CSGA 1OAXH 1HH9B 1FNLA 3MLRH 2XWBB 5F97E 4PGZA 4PJIE 1BOYA 1G7PA 3KPPA 1ZWIA 3BPCA 1NC4B 2CIKB 4H0GA 3LS5L 5FGBA 1YEHH 4H1LA 3RWEB 1DQDH 3MFFA 1KIPA 4JLRB 1QBLL 2EYTA 1TETL 2NY0D 1CN4A 3HNVL 1BOGA 4LLWB 4TULH 4Z95H 4TRPL 1A6UH 1AKJB 3HR6A 2DIBA 4LLQA 1Z9MA 1TQCC 4O4YH 1I9JL 2XI9A 3IVKA 1QYGH 1RU9H 1I9RL 4IJ3B 1HWGB 3K8KA 4K7PH 4L8SB 3T77B 3RDTA 1F4WL 5LGHH 3OJDB 1U3HA 4OLVL 1QFUL 1FYHB 1CD0A 1WSST 3MRRB 3QEUB 5DRWA 4XNZB 2H26B 3GMPB 4NQXA 1FFPA 1MREL 2YA0A 1BEYL 3TIDA 1OAYH 1S9YB 3O2DH 5MENE 1UKQA 3P77B 1FO0A 5E2UH 3D3VB 4ZXBD 4JRYB 1NAMH 4MA3B 4ESKA 1B4JH 1CGUA 1MRCH 1OF2B 3GM0A 4E42B 3IAQA 1NBVH 4NQDE 1FL6B 5IBUG 12E8H 2DKSA 3P4NA 3SKMB 5CMAA 2NXYB 4WJ5A 3UTPE 1S5HA 4QY8B 1AD9A 3EGSB 3S98A 3OR6A 1BVLB 3B2UC 3OPZL 4MDIB 1KBGH 1SYSB 3SPVB 5KSBF 4PGBA 2D03H 4FS0A 4L3EE 1C5BH 4LPUA 4PJXE 4PJXA 2QQKH 2ZJSL 1RMFH 3SCMD 4HV8B 1RZFL 2EIBA 3KAAA 3A6BH 4OLXH 1AFVH 4KK9C 2WLYA 4NT6B 4NUGL 1R3LA 5GSRA 5FA4B 2NCMA 1RSFA 4M6AA 3H42H 1A64A 2M8XA 5MP6L 1J8HD 4NNYB 2AKRB 3O41B 5DJAB 3VA2C 5T3ZE 2DWEA 4JQVA 5HVGB 4ENEC 1BAFL 5E2WL 1DQLL 4U7SA 1ZHLA 3HRPA 1QSFB 2I25N 4WVRA 4FFZL 4GQPH 2ENSA 2A6DA 2YRLA 4JY5H 1CFQA 43C9B 4NDMB 4N0CC 4CDHA 3LQAL 2FSEA 3MJ7A 1UXSA 1CFTA 1JE6A 4Y5VC 1JNNL 2FH6A 4YIQB 2UYLA 2GSGB 4YHPA 1NMBH 3FHQA 3VD3A 5ICYB 3RX5A 1NJ9B 4XHQA 2YHGA 2OSLB 4U7MA 1N6QH 1G7LA 4WTWA 5GRXG 3HG1E 4OIIH 3U30B 5GGSA 2WIMA 4JB9L 5ACLA 3IFPB 4RAVB 1AGDA 3EYSH 1FYTB 4F3FB 3ZDZF 4JE4B 5JW3L 1BVKA 1KACB 4EN3D 4Q97A 3LDBB 1IC4L 2R29L 1P4BL 2YKLH 5BRZA 3U0TA 3VGEA 1RZ8B 2AEPH 1GIGL 4OAWB 4G6AC 3T65B 4AM0A 1Z6JT 3P0YH 3X11B 3TNNA 4BZ2L 5IGXH 4G6FD 1QLFB 1KG0A 1N6UA 3DTXB 4CJ1A 4WHTA 1KXQE 5CEZE 4DQOH 3MRPA 3QFJE 5DJCA 3GI8L 1F11A 3ILQD 1SMOA 3WFHB 4KV5E 4OD2B 1BMGA 2NLJA 2VZOA 3QCUH 2NW3B 4U1SB 4XB8A 4YR6A 3QEGH 2HVJB 2YZ1A 4WDIA 3QG6B 3VGGA 4Z5RA 3DUUB 3G5XB 5CBAA 4MD0B 1DEEB 3LKSA 3IDNA 4I0PB 4GAYA 5T1LD 1OB1A 2RCSL 2M2DA 1M7DB 3GSUB 3KPRB 4WTXA 4JRXB 2W1NA 3ZLQC 1J05B 5KSBB 4E41D 2AJUL 2Y07L 2W9DL 2PXYD 4G6KL 3UPRB 5KSUA 3V52H 1IGMH 3F6IA 4MXWL 1F4YH 3BP4B 1HILA 2KKQA 1JZ8A 3SDDB 1KJMB 1IEBA 4LOUD 5ISZD 2G9HB 3X13A 5KAQG 1JWUA 1J0YA 4KTDH 2Z8RA 3VXNB 5D8JL 5HPOA 4ZAKD 2X1WL 5DMIH 4KFZC 1SVCP 3ISWA 1KNOB 3VGAB 5L2KA 4PD4K 3L5WA 4XWOD 1UACH 3FFDA 2FLRT 1FHGA 3DIFA 5F7DB 2NY7L 2JJSA 3EZJB 5DJ2B 3FL7A 3RTQA 2OK0L 3VD4A 2CLVB 1N59B 2YD1A 4G8FA 2OLDA 5BVPH 4MYWB 3N1QC 5AAMA 3L3GA 3X14A 2Y5TA 4L9LB 2E6PA 1X3DA 3KPSB 1MJ8L 4YK4B 1JRHI 5C0AB 3IXTB 5MHSE 4LLUB 3U4BH 4YE4L 1J10A 3FTGB 3QIWC 1T0NB 2R2BA 3UYRL 2EKSB 1HHKA 1VFUA 1V7MH 3FQUB 1OAKL 5ID0B 2NR6C 1S7SB 5C09D 5TDNA 3CXDL 4HBCL 3M17B 2HT4D 3RUGF 4X7SH 2IAND 2W9LA 3E2HB 3V4PL 2D0HA 1OT2A 4N5UA 3JWOC 1U2HA 2Z8SA 5K9OB 1A6AA 4PJEE 1I7ZA 2OCFD 4QLRA 3ARED 4M9OA 4DGIH 5I1KH 3WFCL 1Z9SA 4KPHH 4S1RL 4XBPB 4X4ZA 3SGJC 1RK1B 3V5KA 3OX8B 3Q5OA 2FHCA 1BX2B 1J0KA 3W39B 1PX4A 1J12A 4NKIL 4WU7B 2MKLC 3C5ZD 4YLQT 1KGCD 2EXWC 4ORZC 4OFPA 5T3XH 3RY6A 1WIOA 1CDJA 1XAUA 1DJSA 2IH3A 2J4WL 3MV8A 4LHUD 3ZDXE 4PJAE 5C8JA 5EUOE 1AGFB 4QHNB 3FMGH 3OZ9L 3E6HA 5DJDA 1IKFH 3FRUA 4KUZH 5HVHB 3LKPA 4JGJA 3KNBB 3RGVC 2VXVH 5I8OL 5ELIA 3STBA 5I1CH 4RMQA 5I9QC 4M6NH 4KMTH 4Z0BH 2VLLB 1UWXH 4WWKA 3RX8A 3CX2A 1UB6B 3BP5A 2B20A 1SHMA 1FNGA 3H6JA 4OD1L 4NUJB 4MJID 3TT1L 1GGTA 2F54A 1C5CH 4YX2L 3QUYD 4YHKH 5JO5B 4KKLD 2R8SL 1OLZA 3FRPG 3DVIA 5IR1B 1Q0XL 1JHTB 1V3JA 1Y6MR 3DROB 2DM4A 1N5AA 5IFHL 4KKAC 4NBYB 4YFLF 4UIKH 1M05B 1MWAL 1IKNC 4H88L 1A6WH 3ULSB 1UH2A 4PV8B 3CVIH 3QAZC 2JIXA 4RAUA 2L0DA 3H9YA 4HSQA 2GTWA 2O93L 4AEIH 4MAUL 5IMKA 5T1KD 5E1HB 4YDLC 1RUKL 5KJRH 1IM3A 1G9MH 3DVNA 4F9PC 3LRHA 5TQ0L 4EBQL 3QA3A 4QEGA 5EU6A 3L5HA 4XNMB 5AYUH 4Y19B 3MRNA 3D18A 2CRYA 3STZB 1YZZA 3PGDB 1W0VB 3QIBA 4OQTL 5ICZB 4BK4A 2VKXA 3ZE0E 3RL2B 1UM5L 3L7EB 4KVCL 1TNNA 5FO9B 1ZS8B 3E6FA 5DZLA 3ALWA 1UKTA 1GZPA 1YMMD 5GRYA 5D93C 3P9MA 3FOMA 3D39D 4OCYH 4RZCA 1FV1A 3I02B 2E3VA 1ZLVK 4M6ML 3RVWD 3VXSA 3ULUE 4OZGA 1QLEH 1T22B 1ONQB 1JWSB 4HIHB 3ARPA 4KQ3L 4JM4L 1X5ZA 5C07E 4HS8H 3NCFB 4LSUH 5IVXB 1XF2A 1A5FL 1CT8A 1O5DT 1A4JA 1CG9A 3QYCA 2FNBA 2G2RA 1FAIL 4KK8D 3TYGL 3TBVB 4LCIH 4U31A 5FYKU 2E9IA 5DHVA 1S9VA 2R1WB 4ZFFA 2YD8A 4K3HA 3MOAL 4V1DD 4I3SL 1FFRA 5EO1B 2B1AL 2E27H 4K3DH 3SGEH 4JPKL 5EBLA 2M26A 5EIIB 2PN5A 3K46A 3HE6C 1FCCA 3IKCB 4R26H 2R0ZH 3SDCC 5DUMH 2ZPKL 5I2IB 4B5EA 1NCBL 4JCMA 5I30H 1SJVA 3VXMD 3PDOB 2E7BA 2ADIA 2OQJB 4CN6A 4PIRF 2AEIT 4PREA 1CE1H 1AXTH 4MJ5B 3ARZA 4FQ2H 2DWDB 1G6RH 1J86A 1XH3B 4Y1AA 4Y1AE 4YO0A 1F2XK 3P4MB 2ARWA 3WDHA 1H5BB 4W4OA 2XWJA 3WE6A 4RFNB 4JKPH 4GUPA 1R3IL 4G80A 2R1YA 1OVZA 1CIDA 2IBZY 2W60A 1JPSL 3F65A 1FORH 1KXVC 2O26U 5FYJD 1QRKA 3LEYH 3QPXH 4J3TA 3CC5A 5DJ6A 1WC7A 4G3YH 4MQTB 4HMDA 4L4TE 2ARJQ 2R2HB 5GQBA 4I18B 4ZUVA 4ZDHA 3G04A 3MRLB 4OFDA 5CZXC 4XBGA 1DVFB 1FE8L 1RQ5A 4I8DA 1VFMA 3LH2H 4MD5B 3WJLC 2XIDA 2KL6A 4HMCA 3HUJE 1KPVA 4DZ8A 2JCCF 4G7VH 1B6UA 4N1CA 4YDVB 3SQOL 3ULVF 1SM3L 1NCNA 4JKKA 4G9DB 3AS2A 3PWJA 4HX1A 4R90H 3PWNA 4JFED 1CGSH 2NY0B 4MVBD 3SE8L 1BM3H 4Q0XH 4GBXA 3RIFF 2Y7QB 4P2CG 4QRPE 4PRAA 4XC3L 1GGIL 2J7LA 3C08H 1U95A 1BIIB 2BCKB 4IRSC 2KQMA 4RGMC 3V6FB 4P59H 3C5SB 4LP5A 4QF1A 2AAVA 3QJFB 1FN4B 2ATPB 4ODUB 2FO1A 3FQNA 3K1DA 5DJ0B 1NL0L 1EJOL 1C16B 1HNGA 3OV6A 1EFQA 1Q9WB 5D7LD 3HMXL 3KXFA 1ZLWH 2DQEH 3QIUA 2ZUTA 5JTWA 4ZPTA 5E70A 5E7BA 3ULVL 2YSSB 4KJQC 5JW5B 1P9MA 3D2UA 2CQVA 4YBQC 4C4KO 3TN0C 2DQHL 3V95A 5FCSH 5EN2B 5DVLA 4E0RA 1VACB 2F58L 3QUZA 4MLSA 4PRHE 1WWWX 1D9KA 5ESQB 2F5AL 3V4UH 3WD5L 4UTBH 4OLWH 4UB0L 1FVDA 1VEPA 5CP7A 1I1YA 3RA7L 1ZGLB 1HINL 1I7TA 4RNRB 2ZUQC 5BZWA 3SCMB 1T21B 2EC9T 1CR9H 4LRNH 2IMNA 2VDNH 2HTKD 2UVEA 1I8LA 2WMPA 5GRJL 4HIXH 2BOCB 1CFSB 3TC9A 5D1ZA 4WFHE 2PW2A 1F13A 1YNKL 1GZQA 2FJHB 4U0RB 1JWMB 4Y4KA 2O61B 5IBLD 3P9LA 2ZSVA 3WL9A 5EO0A 1CBVL 4UV7L 4AQOA 2R0WL 3T0EA 3T4AA 1QSVA 4NP4L 3T0XA 3SDAD 2X4TB 1GOFA 4ISVA 1CLCA 2HJFB 4NRXA 4YHNB 2DAVA 3LVEA 5I16A 5FO8A 2VDRL 2ZCHL 5JR1L 3U7WL 2VDPH 3INUL 3DGCR 4NZDA 1A7RL 3GBNH 3VFMB 3B9EA 4LGSB 1CLZH 3NIGF 3NCEB 4R3SB 2AEQH 5CZVL 4X4YA 2JCCB 4U1LB 2NY4B 2ZG2A 3SE4C 2IBZX 4BKLA 3A67H 1LE5B 3VFRB 3CDYA 3O3UN 5J1AB 4A2LA 4I5BA 5DS8A 3TA3D 4L8SC 2NY3B 5DJ8A 4BUGA 5GISH 5IJVA 2J3SA 3W9EA 2NX5D 1D5IH 2CRZA 4XNZC 1JK8B 3QXDA 4WTZA 1ZLUK 1HSAA 2YN3A 2W0PA 1TZIA 1U8PA 5ADOL 2FO4B 4XBEH 1A22B 4ODSH 2P1YA 4G6FB 1MCIA 1U58A 3TO2B 2FECI 1QQDA 5D7KD 1FVEA 1HQ4A 1SJEB 2X4RB 4A6YA 4ETQB 2Y1VA 1EX0A 2CRMA 5J4MA 3W9DB 4XI5D 2VABB 3R06B 3Q1SH 4JFZL 3DX8B 4NRZB 1V05A 2DQFA 1U8NB 3CMOL 2XKNA 4QRQB 3RU8H 4X0KB 2VIRA 1NFDB 3KJ6L 3DNKA 1KN2H 4XWGL 3MLTB 2DTMH 4DOHB 4JFFE 4P2YA 4QXGH 4LEOB 3MREA 5T1LB 2AERT 4Y16D 3MLVL 4RGNE 1UM4H 2N56A 5D7JA 4R7DB 5CAYB 3CMGA 1EXUA 4FP8L 4TSBL 3S3SA 2DQIH 3ARGA 4E41B 3FT2B 3NZ8A 2PXYB 1N4XL 3HLAB 3BZFB 4XP5L 2A77L 3BISA 3GSWA 4KGLA 2H2SD 4OI9A 1QNZL 5BMFL 1CD9B 1AGEB 5E2TL 1AO7D 5JIIA 4TUKL 2X4UB 5TGBB 5ISZB 3B3IB 3O6KH 4HAFA 2A74A 2BK8A 2DLFH 3UJTH 2R69L 1MHCB 1E4XL 3PP3H 4URTB 3FN0L 5HPMB 1KLFA 2EDFA 4TUJA 4ZAKB 3LRSA 1CGTA 4XXDA 1BFVH 2EDXA 2X2YA 3GMRA 1UT9A 5B8CC 3MRHA 5EC1A 4AG4L 3FT3B 5F7EH 3EJJX 1RHHA 3GNML 4DTGL 3PG2A 4NC1C 4C59B 1F4AA 3F5WA 4OF8A 2PW1A 1IC7L 1U8KA 2GY5A 2EIZA 5EA0H 4QTIH 1PYWA 5DMKB 1DN0B 5D2NA 3UPAA 4XP6H 5I74C 2APVA 4BZ1H 1MLBA 3LDBC 4POZC 4Z7WA 5HYJE 5HYJA 3O6FC 4GRWF 1CS6A 2VDLL 3GSVA 5D1QD 5DI8B 5FUZL 1LO2L 4RMTA 5C09B 5HHXH 3U2SA 3LV3B 2R0LL 2LVCA 1MAJA 2W0KA 1FVCA 3GMNA 3KWWA 4P5KA 2BZDA 2WNGA 3A0OA 1LNUA 3GUTB 4UBDC 2XN9D 2Z92A 5B22A 4EKXA 1S8DA 3MA7A 2YPVL 4LSPH 4OCRL 1JHLL 3GB7A 1PLGL 5DJYA 4KJPD 1IGYB 1CD8A 3HPLA 2FZ3A 2I60L 4WHCA 1R3JB 1A1NA 4MJ6B 4OF5A 5J89A 2IAMA 3SKNB 4LLAA 2GJZB 4MA1B 4HKJA 4Q2ZB 3GI9L 5J7CC 4ELME 4AIOA 3T04D 3C5ZB 2ZCLL 4PJCF 4GKZB 4K7PX 3VG0H 1U8LA 4HD9A 4J3XA 2HMIC 1T0PB 2XZAH 4CGTA 3VRLF 3GK8L 3LQAC 1NEUA 1X5GA 1YECL 1SBSL 4M62L 1MFDH 2G60L 3H7LA 4OLEA 1QBMH 1K6QH 4X8XA 3SDDC 1TDQA 4I3GA 2CH8A 4LCCB 3V8CA 4JFPB 3DMMD 1M7IB 1A9BA 1UJ3A 4S2SB 3V0VA 2A6IB 2YPKB 1BLNB 3ZKNC 1UB5B 1E4WL 4Y4HA 2AXJA 3BKCH 4OGYL 5JHDE 4MJIB 5JHDA 4O5LH 4HWBL 1Q0YL 3LMJH 1N8ZB 2EKJA 3ARUA 3QUYB 1CTNA 4LMQI 4MNGB 1RZGB 2C1OB 4L5FL 2ZG1A 5JW4R 3CNKA 5JIHA 3ARSA 2X40A 3I3EA 2OXGA 3JBG7 4K94L 3ILPA 4LRIC 5FYKE 1LHZA 1X5FA 4L9LC 3BIKB 3T2QA 4OGZA 4OGAC 4XP9L 4W6XB 3KJ4C 5BS0D 2YS4A 4XMKH 4MCYA 2JELL 5T1KB 1AXSA 1NUNB 1MQKH 1KB5A 3ZYZA 3BKJH 1UCBH 3MOBL 5J1TC 1K5NB 4JFHE 4S1SH 3RBSA 4AH2B 5EB9A 4KTEL 1Z0MA 2JF1A 4QRUB 3JSSA 5DEGB 1NCWL 2ZUXA 4LVNB 1DP0A 4ZNCD 2BNQA 2YZ8A 3NACL 3E2HC 2EICA 1A6VH 2VDQL 5GGTA 4DWHA 5FDWA 1JF1A 4I77L 5FYJL 4GRWB 1YMMB 1R3HA 3I9GL 3UZQA 4HF5H 5FUOL 4P9HL 2VE6A 3D39B 1VFBA 5KOMC 2ITDA 3QNXA 4WCYL 4DCQA 4LNRA 2VLRA 1UEYA 3CFIC 4XVJL 3WSQL 4NM4H 2F5BL 3KLHC 5K9QG 5T3ZH 2ORBH 3QFDB 2Y4SA 1ZSDB 5BV7L 4QYOA 2HT2C 1NFIA 3ARFB 3K0WA 4UQ2A 3MNZA 1D7FA 4XZUA 1OW0C 3RZCD 4OLYH 3UTTE 3UTTA 2VZUA 4QHMB 5E4IA 3FO1B 2HTLC 3QUXB 1YEFH 5DD5H 4NHCL 4FZEL 3HA0A 1ZT1B 2MHAB 2LFGA 4LFHG 2GUOB 3MGTA 1HN1A 5IHUH 3EO1B 5HVHC 4PJCB 2XFXA 1EH9A 2OTWA 4V1DB 4H0IA 3PP4H 4GG6A 2RR3A 1JGVL 2Q8BH 2J8UE 5JQ6L 5EOQH 2P8LB 1JF6A 3UROR 4MB3A 5MEOB 4DN3H 4KDVA 1AD0B 1AIFB 2YBRB 4PRID 1IARB 4Y2DA 3FB5B 5CS7A 3CLFL 3VXMB 3WHXA 4WUKH 1RUAL 1FZKA 2IG2H 2YD3A 2OL3L 1LO0H 3S5LB 1YNTB 5DD6B 5CJ5A 3HMXA 3G6DL 1RZ7H 1U8OB 3FJTA 4B53A 3MBEC 3X3GH 1ZA3B 2WV3A 3WFZA 3BVNA 3PUCA 3QDMD 5CEZH 1RZJL 1HKFA 1LP9B 3PIQA 3GMOB 4UI2A 3H0TB 4P4KA 4Z76B 5F7HA 3IFOB 3S96B 4W6WB 2ESVB 3BFOA 4TSAH 4X7CC 5DFVC 2KDGA 2MNUA 3MUGB 5DMYA 4RSVA 5KVDL 4DZBB 1JZ6A 2FGWL 2H1PL 2VXSH 1KCRH 5BV7B 1D5XB 1HHGA 1RIVH 1WK0A 1OP5K 5EOCJ 1ACZA 1VERA 3P4LA 3LB6D 1T5WA 2DQJH 4YHML 1BZ9A 2H45A 1OAZH 4HXAL 4YZFE 1KJ2L 5FCUL 4DKAA 1AHWB 2QV2A 2X70A 4RFOH 4PJ5D 4JFEB 4MQ7A 3NOIA 2I5YL 1MCWW 1JNHB 1LEIA 1EBPA 5EWIH 5GS0D 3GHEL 4P3CL 4HS3B 5FYLE 4FMKA 3U9UA 3IFLL 5F89B 4FFVD 5TF0A 3Q6FB 4BSVB 2P4AB 3MA9H 4R8WL 3GSRB 4PJBF 4ODTL 2WINB 3SY0B 2F53E 4FG6C 2Y06L 1INDH 1A1MB 5IB1B 3RVXC 4XNUH 3G5ZB 3K8MA 1HHIB 4HUXA 5D7LB 4UT7H 1NC2B 3SJVA 1EAPB 4P2QE 1NGYB 1F3JB 5IEHA 2A1WL 4JM2D 3PJSB 1G1CA 3OKOB 1PSKH 3ZE2F 3CFDA 4JGUA 4FFWD 4RDQG 4LARH 4GMSL 4MSWA 2FX7H 1MLCA 2J1KA 5KW9H 1M71B 1NBZB 3HZMA 4P2RE 5GZND 3GZKA 2PR4L 2X9WA 5HHOE 3HS0A 1B90A 2EH7L 4QT5A 1KPRB 1TVBB 1ITBB 1ZGLM 1OPGH 3GM8A 4GRMA 4XNXH 3ZHDA 5DA4A 5KSAC 3WIHA 1UC6A 4NO3A 1T5XB 1YQ2A 1OGAE 3QDAA 3EYUL 4RFNC 4AIZB 3BZ4A 3FKUS 3MLXH 4ZODA 5DVKA 4HFWA 3BRGC 1IVLA 4YDKH 5I18L 4HCRL 2Z0BA 1A1OA 5C6WH 4LIQH 4NRYB 3C87A 1D6VL 2WLZA 3D69A 3O6ML 3UYOD 3H3BC 3IJHB 3PWLA 3FFCD 4ZPVA 4MCZB 3D25B 4I18C 4FQXA 4QXTB 1UG9A 2IF7A 3VFNB 2Q7NA 3JTTA 3QDJD 1DVFC 2WWMD 4KDTA 4ODHL 1FH5H 4ZTPH 5DVMA 3UO1H 1QR4A 2GFBA 3LKOB 5HHME 3LN4B 1YDPA 3JV4A 1JPTL 3GKWL 3KDMA 3D0LB 3DXAA 1S7UB 3OKLB 3MTRA 3U0WH 1KCLA 2ILLA 5D71L 5J6HB 5I1IH 4RMVA 3MRKA 5MHSD 1P2CA 3RY5A 2OS7A 3VRJB 2HRPH 3I75A 3CSYB 3NIDF 5D7SH 4HS6A 1Y18B 2BMKA 1KC5L 4X9GA 4UILL 3L3OA 2BC4A 4S10A 5C92A 4FQQA 2GCYA 3GSNA 2HFEA 3C6LD 4Y5YB 4CNIB 4NZJA 4BSWB 3L5XH 2W9EL 4DJMA 5GJTL 3HZKA 3KHQA 3G6JE 1D5MA 1BQHB 3KG5A 3DV6B 5B38G 4WFFE 4C4KT 2R9HD 2WBKA 3UZVB 4ZXBC 3RHWF 2DM2A 4PJBB 2VISB 5TQ2H 1RJZA 3L9RA 1GAFL 2HN7A 3D0VB 3PWVB 4HJGB 1NEZG 5CUSL 2Y6SD 3ECBA 3FCTB 2F74A 4ONHA 1EV2E 3HE7D 4HEME 4WY7L 3FO0H 1LK2A 1EUUA 4UT6L 1FFNA 4N8VB 2VLME 1U91B 5C9KA 1I1AA 3MRMA 4UZGA 1FIEA 3REVA 1YEIL 4KQ4L 4LDLB 1UQSA 3RWJB 3SCMC 4OGXL 3JV0A 4PUBL 1S5IL 1YEKL 1I8KB 4M5ZH 4Y16B 2ZG3A 2B4CH 1JUFA 1RZKH 2LTQB 1RURH 3QJHB 2O5YL 1E4JA 3EDJA 3TIEB 4GQ9L 3PNWB 4X99A 4RWYH 4C57C 4U1IA 1OM3L 5T5FL 2C3HA 2VL5B 3B5GA 3OAZH 3ULUH 3NABH 3MRQA 4U0RC 5ADPL 1AO7B 1NCAL 5ALBH 5AAWA 5DRZA 1NCDL 1XGQB 2P48B 2GAZB 3RJDA 3UBXI 4Z7VB 2Z31A 1S9WB 1F58H 1MCWM 4L8CA 3HHRB 3T8XA 3BGMB 1JNLL 2W07A 3S36L 3SDXE 5K9KB 2CO7B 3K8LA 5KVEL 3PQYA 2IPUK 1AI1H 1MCNA 3BEWA 3MRDB 3O6LH 4X7TB 5KANI 1J5OH 1ZHNA 5I8EA 4FQ1L 1LWRA 3TH3T 3QDGE 4LPWA 4NQVB 5EPMA 1DBJL 3WKML 1T4KA 3QQ3A 4HPOH 3ULVC 1QBBA 1B4RA 4H26A 1SBBA 5IHZB 4UDTA 4KMLB 4XVTH 4YHZL 4HKZA 3P30H 4HWBA 3VXRB 1MFCH 2ADJA 1J87A 3BHBB 4P9ML 5D6CB 5ENWB 4EN3C 1S7TA 5IKCA 1MJUH 4XCYA 5KSVA 2C3GA 3O2VH 1HI6A 4PJ8D 1J88A 3BH8B 5D1QB 3G6AA 5BVJB 4ZTOH 2GW5A 1CZ8H 1PKQA 2VJXA 3L95A 4XVUC 4IIQA 3VMNA 1T2XA 3WFDL 1MIEH 3ZDYE 1I85A 4MAYD 3C60C 1YMHB 3ILQC 3AXLB 5HHPB 2XN9B 4LU5L 1NDMA 1YYLL 4NGHL 4M3KB 2ADFH 4TTGA 4R4FH 4YHOH 3ARWA 3S3JA 1Q94A 2UVFA 4M43L 5DR5H 5C0DB 4X7DC 1VPOL 3EOBA 4HKBB 1WT5C 4XNQB 1MI5A 3WIFB 1IM9A 2WBJD 2E7MA 4F57H 4PP2A 3CFJB 4KK5D 1XCQA 4IOSD 4LCWE 5MI0C 2EC8A 3LZFH 5CEYA 2UWEB 3W82A 2X1QA 5JDSB 3HB3D 4XXCC 3SO3B 1P6FA 3CFCL 3TCLB 3GHBL 3OKDB 1UWEL 3RWGA 2PNDA 3FOLA 1K4CB 4NO0A 4HUVB 5IW3A 5GGVL 1H3TA 5ESAA 1EDQA 4N9OB 1MCQA 4J7RA 3NMEA 3F12A 3WBDA 4LOUC 4Z18A 3QQNA 1FFOB 5GRWA 4ZUTA 3DMMB 3ETBF 2H3NA 2BSTA 1KLGB 1NEZA 1NCTA 3PL6B 4NWUH 1CLYL 2X1XR 1MAKA 4M5YL 1QEWA 3IDXH 4GG8A 1WTGT 4ZAKC 1R24B 1F4HA 2VLJE 3HI5H 1TXKA 2YK1L 3DUSA 2VMFA 1DUZA 1MHHB 3L6FB 4XWOC 1QFPA 3QCTL 2ZP0T 1RK0B 5JQHC 3M8OL 4PGDB 1IAKB 3ES6A 3F7YA 4M9PA 5EOCH 1CFBA 4XPGH 1WAAE 1WAAA 4X9FA 5DUBA 4MX7A 4NKDB 1HKLH 1P4IH 3TZVD 4QCIA 2FIKA 4A2MA 1HH6A 2AJSH 1MUJA 5HI3D 1T1WA 4FTVA 4H25B 8CGTA 5L9DL 2XZQH 4PD4J 3VDAA 1K2DA 4UINH 4LLVA 3WN5C 3F62A 4BFEA 4BUHA 1MFBL 1VGKA 4FQJH 5F7UA 4Z7UF 1T1XA 5INCB 4F7MA 2VDMH 2ADGB 2HT4C 1MCEA 3VCLB 5C08E 3BDYH 4YAQB 2XKUA 4UUJA 2Y36L 4NNPL 4TSCL 4YHLL 4LHJB 3GGWB 1M6OB 2X4NA 3VWKA 1ACYH 5JPNB 2V7NB 3AREC 3NFSL 3MSPA 1CDUA 1LE9B 4DUWA 4JHAL 1QSED 2AS5M 2X89D 2GJJA 5IMLB 4YNYA 5C9JB 3HFMH 1S7WA 3QNZB 4Q9QH 3BT2L 4MA1C 2HFFA 4OV5B 1A2YB 4G8EB 2DLIA 2VH5H 1LVEA 3C5ZC 3MUY1 2HJLA 4PLNC 3RZCB 5DRNB 1EFXA 1RULL 4JM2F 1UVQB 4EI6A 4ACPA 1KJ2A 1BBDL 1IGIL 5EORH 2HJKB 3MV9A 2XACC 4Z7OF 4YGVB 5HGHB 2XWBA 1KJ3H 2AJZB 2MQ0A 1KCUL 4XNYH 4LVHB 1FLRH 2YD4A 3OXRB 5GS0L 1CVRA 3ZYIA 2J88L 1CLOH 3CSGA 4RIRA 3RWEA 2I07B 2CKBL 4UDUA 1YN7A 3TCXA 5CIPH 4PRIB 4LLWA 4XAWL 2PO6D 1FZJA 4O51A 1A7NL 4AL8H 4MA8H 1A3RL 4KKLC 1E28A 5KS9F 4YXKH 4V2CB 5FHBH 4LLMA 3GRWH 1PY9A 1SY6L 1N0XH 1RFDH 3T77A 1TTGA 3OJDA 3L3DB 3QDMB 3UAJD 1PQZB 2AXGB 2BVPB 2EXYD 3MRRA 2LE9A 5HHNB 1MJJA 4NN5B 4D0BB 3X3FL 3GMPA 1KFAL 4IRZL 4M7KL 4NQEA 4QOKE 5JUEL 5GJSL 1V7NL 4L4VD 4WFED 1JMXA 1EK3A 2WQRA 1S9YA 4Q6IC 3P77A 3KHOA 5AUMB 3D3VE 3D3VA 4JRYE 4JRYA 3UTSE 1RJLB 2CDFA 3KYMB 2X6MA 5SWZD 4D9LL 1RPQA 3KYOB 1DCLA 1U6AL 5CJBA 2JJUA 4O9HH 2X05A 1BVLA 1EMTL 4K3EL 1WISA 3VFTB 1SYSA 3Q3GB 1NKOA 1DE4B 2RJMA 4Z7UB 3MLUH 5L88H 4HV8A 4M8QB 4PJ5B 5CGMA 3RVWC 2C3XA 4NT6A 1A7QL 3OAUH 4X4XA 1VADB 5D5MF 4N1HB 5E1AB 5FA4A 4D9QE 5IT2L 1IQDA 1RUMH 2QHRH 5TE6H 1I3RB 3VDCA 2CKBB 4NNYA 3S34L 2AKRA 5DJAA 5I76B 4JO3L 5GS2H 4KK8C 3U82B 1BWMA 3BPLC 1RJYA 1QPPA 5IW1B 2Q3ZA 5IROA 1AE6H 1QSFA 2XA8H 2P43B 5JNYB 1F02I 4DAGL 2UY7A 4JM2B 4NDMA 3GIVA 5IG7A 2XQYG 4GAFB 1TCMA 3NH7H 5DUPL 2VXQH 4NC1E 3VE0B 3IDMB 4L8DA 5F6IB 2V6HA 2QHLA 1VGEH 4B41A 4MA7H 1PG7H 2H32B 3IFPA 2R56H 1FYTE 1FYTA 4J6RH 3L5IA 2HVKB 5DDHB 2AGJH 1FBIL 5J11B 5CEXB 1RZ8A 4Q6YA 4WI5A 5KS9B 3X11A 3WIIH 3QT2A 4P9HC 1YEHL 2A73B 3MQIA 5DFTA 1RJCA 2AI0H 5ETUA 3QR2A 3ZSSA 5ALCH 3QDJB 4HJ0D 4Z95L 1JIBA 2YN5A 3LHPL 1A6UL 1GH7A 1VESA 3WFHA 3FN3A 5BV7C 1T6VN 1BJ8A 3BJ91 4I3RL 4WO4D 4PJHF 4U1SA 2FR4A 4XPBH 2YWZA 1G0YR 1QYGL 1RU9L 3G5XA 3E8UL 4K7PL 4LLYA 1AHWC 3WJJC 4EQ2A 4MVBC 4PJGA 4X6CF 4I0PA 1A3QA 1ZTXL 4ZUUB 1IFHL 2XWTB 3MJGX 5JW4Q 3KPRA 1NSNL 3GSUA 1A4KB 4JRXE 1YEGL 3P9WB 1ZT4B 5DXWA 4JFDD 1J05A 2UZIH 3QI9A 5KSBE 3L3KA 1NAML 3UPRA 1XGYH 1S7XA 3BP4A 5IBTH 3FONA 2NYYC 2BY3A 1CGXA 1MH5B 4XCEA 2GTZA 3GSQA 4NWTH 3TJHC 3DX7B 4KZEL 5D5MB 5L2JA 1UWXK 1F3RB 4MNQE 3NAAH 3EOYG 1KBGL 1QPXA 2P5WD 4FZ8L 5J0BA 4U3CA 1C5BL 3TM6A 1ZMYA 2I9LB 2QQKL 5FYKH 1MNUL 3KS0J 1XF3A 3BWUC 3CSBA 4J8RB 1RZJC 3IAPA 4OZFA 2APFA 4OBRA 5F7DA 5A16A 1EEZB 1N59A 2XNAA 4MLIA 3HE7B 5DF0A 2VYRE 4PBXA 3WNMA 1MOEA 3H42L 2JB5L 5DLMH 1NGQL 1MCKA 1YPZA 3KPSE 5D2LF 3DJ9A 4F58H 4P2OD 3DOSA 5I8CB 5C0AE 1ZEAL 3IXTA 4LLUA 5CJOH 5EUOB 1E27A 1TVHA 3LEXB 1P7KB 5E5MB 3HR5B 5SWQB 2MCG1 4BM7A 3HAEB 4XGZB 2DDQH 4OKVB 5DK0A 1S7SA 3O4OB 1W2KT 3LKNA 1FZMB 1J1PH 5IQ7L 2IQAA 3ZDZE 3M17A 3SGEI 5AZ2H 2HAZA 1NMBL 4NZRH 5IBLC 5K9OA 2Q7YA 1TJIL 2G75B 3HZYB 1U36A 5IMOA 5IB2A 1N6QL 4BFGA 4XBPA 1IQWH 5EIQA 3SDAC 2FEEL 5HBBA 1OL0A 5EZOH 2ZSWB 4YUEH 1CU4L 4PB0H 1JI1A 2E9BA 4O2EB 5J9PB 4KHTH 5D7IF 3SE3C 3U1SH 4WU7A 5CP3A 4XHJD 4NN7B 5E5UB 1LO3L 3FQWA 3HCVA 4PJHB 1GC1L 4NBZB 3ARBD 2HT3D 4P5TD 1JI2A 2Q6WA 5LBSL 3JVGA 5GS1B 4IMLB 1FCGA 1AGFA 1X6LA 2Q8AL 4ZFZB 1AC6A 4DQOL 2VTFA 4X6CB 3TA3C 4Y5YC 5KN5A 1ETZB 1UADC 2ATKB 3KNBA 4LSTL 4L1HA 1G7HA 1DFBH 4N0YH 3B2UD 2VLLA 3QCUL 2FD6L 2DJSA 3QEGL 4PJ8B 1UB6A 2B0SH 2H9GB 4MD4A 1DLFL 2DTSA 2R2CA 1SEBB 3P11H 4JJHA 5A3ID 4XI5C 5JO5A 2YRPA 1SYVB 4D0CB 4WGVB 1JHTA 3O0RL 3DROA 4FQLH 1PY4A 3EDFA 1XGTA 2C3WA 4PY7B 1UXWB 1QRNA 1M05A 4GW4B 4LSSL 4UNUA 5IM7A 3X12B 4PV8A 1IGML 4NZUH 1N0LA 3QPQD 2VDOH 2WBJB 5ECJE 3T0WA 2K1MA 1JV5A 3SOBL 4Y16C 1YUHA 4KTDL 3IGAA 4XNMA 5F88A 4Y19E 3RI5K 1MVFA 5CJ8A 3STZA 4N0CD 4PG9A 1KCVH 5DMIL 1W0VA 4G42B 2H2SC 1LK3H 3DRQB 4QHLB 5BJTA 5I71B 5FO9A 1ZS8A 4JR9H 2EH8L 4DUXA 1KEMH 2APTA 5FYLH 4P46D 3MLPA 3EO9H 5L0QB 3P0VH 3JWDC 2D0GA 3MLZH 1O7SA 3U83A 2WIIB 3RUGE 4QRRA 4D9RD 1IEAB 4H0HB 1ONQA 1JWSA 1DN2A 1JGUH 2BNUA 1P4LA 2VZVA 3B9DA 3IF1A 2JJTC 3L5JA 5AEAA 3RBGA 3ZT6A 5IVXA 4IM8A 5BW7C 2EYSB 5HI5D 1CF8H 3PDDA 2BVQB 5H2BB 1K8IB 3UCRA 4L4TB 3BN3B 4DGYH 3VXUD 1GHFL 4OCSL 3T2NH 2R1WA 1ZLWK 5D7IB 4CJ0A 4LDEB 3V6OA 5IW6B 1U8MB 2YD7A 5FECB 2AV1B 2WWKO 2NXZC 5HVFB 1QKZH 4GAJH 2X5PA 3IKCA 5I1KL 4FN0A 4KPHL 5I75B 3HI6H 5DWUH 5I2IA 5D1QC 5D1XB 1SY6A 3DX6B 3PDOA 3NA4A 4JGMA 2DQCH 2HLAB 3MJ9L 5HGDB 2HKFH 3V8OA 4MJ5A 1QO3A 2DWDA 4OZHF 4PY8J 1OCWH 5FHAL 4I9WD 2IPTL 3QEQA 5DQDL 1E6JH 2ICCA 3P4MA 4ZD3L 1KIRB 3VI3F 4J4PA 1I9IL 5FOBA 1H5BA 3I84A 1S3KH 5K59F 4KJPC 3OJ2C 5J13B 2VOTA 4WI4A 5ESVB 4YXHH 1XIWB 1QSEB 2CUHA 1F8TH 1MFAL 2VUYA 2DBLL 4KUZL 3JWOH 3BRDA 2F53D 2ICEB 5EBWB 3U6RA 5I8KH 4F2MB 5HD8D 5JMRA 1FG9C 1C08B 4DUVA 4P2QD 3EYQD 1EVTC 4Z77A 5I73B 4JO2H 1DVFA 2FYYA 3BQUA 4P3WA 1OOAA 3ZKXB 4LASH 2VDKH 1C5CL 5CJXC 4JFYB 3UJJH 4YHKL 1ES0B 4HC1H 2GJ6D 4YDVA 4JZJB 4OF7A 3MRIB 3BW9A 4R2GD 5T1MB 1XF5B 3DMMC 3GEWB 4EVNB 5EU4A 2X1OA 3BEVB 3OKMA 3CFEB 4M93C 3ARDD 3UBXA 2Y7QA 4G5ZH 3WLWD 3FT4A 2PO6B 4KC3B 3QIWD 1BIIA 1JGDB 2BCKA 1TJHL 2NY1D 3RVVD 5F1NB 2FATL 1ADQL 4ZS6D 1WZKA 4K9EC 2Q20A 1INEL 3C5SA 4L3AA 5GIRB 4XH2B 5AYUL 3OAYH 1FN4A 1GL4B 4CU8A 5J06A 3UJIH 4ODUA 2X1PA 3S88L 4ERSH 1W72A 2J6EA 4Z8FH 2N1KA 2IGFH 2NY6C 5DJ0A 5HGBB 4HLZG 1C16A 4E5XB 1Q9WA 3VWJA 4L4VB 2R2EA 5FYJU 1IAIL 3EOTH 2C1PA 2YSSA 3TYFB 3RNKA 2IH1A 4W81A 2HWZH 4S1QH 4OCYL 1OTUD 1XZ0B 2BNRD 5IWLA 5AZEH 5SWZB 4GRLC 1C12B 3DETD 3O2WH 1PZ5A 2X7LB 1VACA 3OXSB 4CMHB 3MZTA 4EUPG 5DYOA 5T33L 4WHYG 1R3KA 1IC5H 3DV4A 1YY8A 2EXWD 3OGCB 1W0WB 3I6KB 3WDIA 5KG9B 3L3JA 5E56A 3T4YB 2NTSP 4GH7B 4HDIA 4BFBD 2OR7A 2HH0L 2OM5A 4LCIL 1BQLH 1U3HD 3GJFH 1T21A 5CIPB 3KS0H 1DQMH 5EUKA 5TE7L 3BI9X 4PLKC 4QHUA 2E27L 2BOCA 1CFSA 3AY4A 1A7PL 5EOTA 2EEBA 3BP6A 3RZCC 3QO1A 2Q3AA 1J8HE 3VI4F 1MCOH 5I30L 3RI5F 1JTPA 2VQTA 5FGSA 3HMWL 5CLWA 2W65B 3D85A 2YC1A 1AXTL 4PTUB 4FQ2L 4MZ3A 2X4TA 3O2DA 2E8ZA 2HJFA 4TNWF 2P42B 2DD8H 4WV1C 2CGRH 3VD5A 3TVMA 1NAMA 4ZUWB 4JFOB 2AP2A 2Z4QB 4J3VA 4KZDL 5C2UB 4MDJB 1I1FB 1CICA 1UGNA 3OKKA 3VXPB 4R3SA 4JFFB 4PJ7F 2JCCE 1A9EB 1CIUA 3MXVL 4MXVF 4OM1H 4G3YL 1KCSH 4K2UH 1P84K 3QEHB 5C7XH 1LO4L 4TUOB 1AGCA 3LY6A 1LE5A 2ITCB 4AEHL 4JO1L 2R23B 5J1AA 5JLZB 1D5ZB 1WFTA 3L1OH 1ZLSH 2VR9A 3IJSA 4JCLA 3LH2L 5GGQL 3VFOA 1JK8A 4LHUG 1CK0H 1XGUB 3REWA 3QHFH 2IQ9H 1TITA 3LQMA 3MMEA 5DFWH 5J56B 3WCYA 4GKNB 4MWFB 3S97C 3TO2A 1SJEA 3DBXB 1T7VA 2X4RA 1UM6H 3QULB 4FXGB 4U0QB 2P5EA 1CGSL 4UOJA 2D7NA 4OM0L 1CCZA 2BRRL 4YDIL 1JHKH 3BD5A 3R06A 2EECA 1FFQA 4M1GH 4NRZA 2FX8L 1MHPL 2FL5B 3SE9L 2NQCA 5IFJA 4QRQA 2FJFB 3LB6C 4JPIB 4X0KA 1JGLH 4ORGB 4Z0XA 1NFDA 5LVEA 3PV6B 1K4DB 2YR3A 2GITB 3DHJA 4U6VH 2CUIA 3MLTA 4DOHE 3DVGA 4JQXA 5I6XB 2EE3A 3AUVA 4XMPH 5BRZD 3MLWL 2R39A 5GS0C 2DQEL 2PYEA 5FF6B 4PGJA 5CGYD 2CLRA 4JFDB 3TNMB 4CADA 2C4XA 4E41E 4E41A 3FT2A 3MZGB 2PXYA 2IADA 3BZFA 3G08B 4I0KA 2AXHA 1UA6H 4FFVC 3BRFA 1AGEA 5IEKA 4LSRL 5IFAH 3NTCH 2X4UA 5TGBA 5HDQL 3B9KB 5ISZE 3T0AA 1MHCA 3V4UL 1S7QA 5CCKH 2D4FA 4FABL 5HPMA 4OLWL 2HFGL 4JM2C 1RUQH 2HLFD 3QUMH 4PB9L 4JFXB 3FAXA 3GMQA 1X5XA 5DGRA 4AMKL 5E24E 1YEEL 2BY2A 1TNMA 1JF5A 4X5XB 5GZNC 2VXUL 3TPUA 1QA9B 3CVHH 3KVQA 4HIJB 2LAAA 4F7PB 3BH9B 5DMKA 4FFYL 4W70A 1DN0A 5CZXD 5J3HD 4Y5XB 4P2OB 3CLEH 2AK1H 1I1RA 1T83C 3IFNH 4CW1B 2X41A 3WKNA 4UIMB 5DZOA 1MEXH 3NIGE 3UYPA 4PJ7B 2VQ1A 1AGBB 3L3HB 4XPAH 2D31B 5DC9B 2WSKA 5C09E 2C26A 3O3EA 3I6LD 3LEVL 5E95B 5L2KD 1IMHC 2IANE 1E4KC 1RIUL 2VDPL 4WUUA 5EG6C 3TBTB 2WWMC 3GBNL 3GUTA 3RTQD 3DX9A 3RPIB 5E8PB 3MOQA 4KHXH 1JPST 3P2TA 1R5VB 3A67L 2H6PB 1QHPA 3S5LG 4MJ6A 3WNKA 4F8QA 3SKNA 4Q2ZA 3B9VA 4RMSA 3HNTL 1CGYA 1D5IL 4HJJH 3QXAB 3MCG1 4R9HA 3CDGB 1KGCE 1B2WL 4U2ZA 3ZE1F 3ARBB 4F7EB 4P5TB 4LBEA 4ODSL 1IGFH 4K71C 3MV11 3C6LC 4LCCA 3SGDH 2ZCKH 3KPLA 3QO0A 1MCHA 3Q1SL 1H3UA 1H3GA 3WXVH 3R8BB 1GGCH 2HYMA 4ODVH 4S2SA 5BQ7B 2A6IA 2YPKA 5E6IC 4GLRH 5I15H 1BLNA 3IJYB 3RU8L 5FXCH 1UB5A 2R9HC 1E6OH 3IRZA 4MJIE 1KN2L 2DTML 1G84A 4QXUH 1N8ZA 3QUYA 4MNGE 3MCKB 3V4VH 4P3DB 1L7TH 3VFSA 2D9QB 3MGOA 4WI7A 4AK1A 1UM4L 5DK3A 2Y6SC 2ZKHH 2DLEA 4PRDB 1CGVA 2Q1EA 3OMZA 5LGJB 4PR5B 3BIKA 3I6GB 5IIEB 1PJ9A 3G5VB 5A2FA 3WS6C 3HC4H 4WU5B 4ZOEA 5DK2A 2K7PA 5T1KA 3IU3B 5HGAB 5HHVH 5DSCB 3O6KL 1G7MA 4M61B 4X6DF 4WW1A 3U0PB 1JPGA 4WWKD 4AH2A 5H94A 3O4OC 5ILTH 3D6GA 1KPUA 4EOWH 1OAQH 3LKQB 1OGTA 4EI5C 1N3NB 3DSNA 5DGQA 3GSXB 2F54D 4LPXA 2GT9A 4H8WL 2MCPL 4XP1L 1N26A 1A7OH 3MYJB 4IMKC 5F7EL 3THML 1JPFA 1YMME 4GRWE 4HH9B 4ONGL 1CGWA 4UU9B 3VJ6B 2AJYH 3QNYA 3D39E 2QSCL 3LS5H 5I1DB 5EA0L 4LSQL 2OZ4L 1MFEL 1QBLH 1U8IB 1TETH 2FJGB 4OZIA 3HNVH 1PG7X 2JIXD 4TRPH 4XP6L 1ZSDA 3U4EA 3ARFA 4BZ1L 4HHAA 3P73B 1R5IA 4QOKD 1OAUL 1I8IA 2PUQT 5HHQB 1TZGL 4QHMA 3MRGB 1I1CA 3FO1A 5F3HA 2DI8A 4NFCA 4PPTA 3UTSD 9CGTA 2MPAL 3QUXA 1XR9B 3GJEB 4PJ9A 3VXUB 5GS1C 1F4WH 4OLVH 1QFUH 3FB8B 3NIFF 4MGXA 3EO1A 1HYRC 4PJCE 1T89C 1MREH 4V1DE 2IPKB 5D6DA 1BEYH 5I1LB 5ANME 2DYPA 4KY1L 4JRWA 2ERJB 1MIML 4GXVH 3AS0A 2EEDA 4R96B 3VRLE 3ZTNL 1AD0A 3BKML 3LQZA 3SBWA 2YBRA 1FNSH 3VXSD 3FB5A 2MOVA 3DYMA 3BZEB 3VXMA 5F7MC 3CH1B 4NOFA 1S7RB 3OB8A 3S5LA 1X5AA 35C8H 4MAYC 3RWCB 3S4SB 1HHHB 3LS4L 3OPZH 4EDWL 4HGMA 5MEQA 1B0RA 4MMZC 2XZAL 1ZA3A 4K7FA 3S6CA 2ZJSH 1LP9A 1RZFH 1MFDL 1O0VA 1BWWA 3GSOB 3H0TA 6CGTA 2YMXL 1QBML 2WBJC 1LEGB 4GS7C 4KK5C 3LPFA 4NUGH 5FYJE 2F53B 3S96A 3NN8B 1CL7L 1IL1B 2ESVA 3L7FB 3DECA 4EDXA 3HB3C 5ID1B 4P2QB 1DBML 3NPSC 4LHQB 1FJ1A 3WHE1 1QSZA 1PG7W 1BQHG 5DQ9B 4GOSA 4LKCA 5EO9B 5E2WH 1D5XA 1DQLH 5FAAA 3LMJL 1GCFA 5FGCE 2GJ6B 1GC1C 4ONFL 5E4EB 2Z8WC 5HHOB 4R2GB 4JVPA 3BOVA 4MQXD 4Y8DC 1FO0L 3LQAH 5L0QC 3QSKB 4JFEA 4PYGA 5F93C 2K3TA 3TH2T 3ARDB 1JNNH 1PGRB 1OGAB 1WZMA 4N8VG 3ZT5A 4C56A 3WMSA 3QIWB 1KCKA 5I1EL 2BX5A 1MQKL 3O6FD 1G6RA 1MHEB 1BD2A 4XT1C 5B39B 2DOCA 4BSVA 4LF3B 1YC7A 3QZWB 5TJWK 2QADC 1JMZA 3TZVC 3SY0A 2ZNWA 1A1MA 5JXAH 5HI3C 4APQA 1P4BH 1HHIA 5CZKA 5D7LE 3TF7C 1NC2A 4I2XA 1EAPA 1GIGH 3KLAA 3PJSA 4BZ2H 3OKOA 1HXMA 1KB9J 4H1LB 2RGSA 5I75C 3FQRB 1H8SA 3MFFB 2BNRB 2EYTB 4NM4L 4P23C 5EBGA 4GBXD 3TLRA 1FAKT 3GI8H 1WITA 1FNHA 1M71A 4OD3H 2OXHA 1KPRA 1TVBA 4XPFL 3H9SA 3DO7B 3IVKB 4NC0B 1TVDA 32C2B 2YPLA 4NKOA 5J13C 1U3HB 4XPTH 1MJ7L 3TO4D 1J0ZA 4KJYA 3QHZL 1L6ZA 4NRYA 5JDJA 3KXFD 5I9QB 2XY1A 1HHJA 2JB6A 1ZVSB 2AJ3B 3G6JB 4U6YB 3IJHA 1CWVA 1NBYB 3OAZK 4AEEA 1FO0B 5EOQL 4KXZH 2Y07H 3D25A 4G6KH 3D2UD 4QXTA 4MXWH 3CPLB 4U1JB 2CDEB 1BZ7B 5E08L 3ZSTA 1X5HA 3ZKXC 1DBAL 2IG2L 4W6YB 5I66B 3P4NB 5CP3H 3LN4A 5CMAB 4ZQKA 4N0UE 3O9WA 1C7TA 2VKWA 1AD9B 1NLDL 3QUZD 1U92B 3D0LA 1D9KD 1F6LL 4CVUA 1S7UA 3OKLA 3EDEA 4WENB 3IDIA 5DD1L 5FUCC 3QAZB 1T0MA 2FGZA 1I3GL 3L3IA 1CYGA 2EIEA 5L7XH 3VRJA 1VB9A 2OK0H 4AEFA 3FN9A 3CSYA 3TFKC 1Y18A 1SEQH 5GSRB 5HY9A 4Z78A 2XZCL 2D7OA 2KUTA 1PKOA 5CINL 1CXEA 4XCCL 2CXKA 4BSWA 4YE4H 3RGHA 3GJFB 3UAJC 2EXYC 2NX5E 1ZHLB 3PDGA 3T0ED 1BQHA 1OAKH 5D93B 2FX9H 3I85A 2A6DB 3OKNB 4QGTA 4PJBE 4PJBA 3CXDH 4RFOL 1QG3A 4HBCH 1IT9L 3QXWA 4YC2C 2W92A 3D0VA 3V4PH 5LXGH 3HPJB 4HJGA 2UYLB 3FCTA 5E9DE 4R4BA 1AR1D 1IEHA 5TF1L 4O2FB 1A6ZB 3WFBL 2QTEA 1U91A 5GGSB 3IRPX 5JZ7C 3ZE2E 2HTLD 1JYNA 4KI5D 4TVPD 1INDL 1I8KA 1DUYB 2V7HA 5BRZB 5A2KH 2Z9TA 4OI7A 4JFQA 3QJHA 3HE6B 3PNWA 4PBVC 3TNNB 2J4WH 1PSKL 2X4SB 3VGBA 1KG0B 4UT9L 2VL5A 4WHTB 3OZ9H 3AGVA 3RIAF 4LARL 2E7LC 1GGUA 1AO7E 5DJCB 4X4MA 3ESUF 5F96L 3BGAA 1XGQA 2GAZA 5I8OH 5SWSA 4Z7VA 1GRWA 1S9WA 3UX9B 2NLJB 3H3KA 1G6VK 5FM4A 1C5DA 3MBED 5EU3A 4YR6B 2A0LD 3ZDXF 4Z5RB 3K4DA 1IGJA 5D96C 3TT1H 3E0GA 5CBAB 4YX2H 3LKSB 3MRDA 5FKAB 3STLA 2R8SH 4GAYB 4YDKL 3Q5YA 5HTSA 1Q0XH 4KTYA 4F9LC 5D7JD 5DFVD 2FWOA 3UDWC 1MWAH 4HWUA 5D70L 2CMRL 3EYVA 4H88H 5IHZA 4CKVX 3EHBD 5KSUB 3LN5A 1HILB 3VXRA 4AYFA 5F9OH 2R1XA 2NY5H 1FH5L 3UO1L 1XR8B 4WW2A 3NIDE 5F7WC 4HUWA 4U7KA 2O5XH 1JWUB 1SJXA 4RMRA 3ARTA 5BVJA 2PETA 3VGHA 3I3BA 3U0WL 3CU7A 2HG5A 2YUWA 2KZWA 1NAKH 5L2KB 4OQTH 4DN4H 3L5WB 3TV3H 2X42A 1I7UA 4JPWL 2VLKA 1UM5H 3DIFB 4JPVL 2DICA 2HRPL 3AXLA 2XN9E 2XN9A 5HHPA 4IRSB 4IDJL 1UZ8A 4G8FB 1ZOXA 4WO4C 2OJZH 3MODL 3X14B 2Y5TB 4B50A 3UTZA 1PEZA 4M6MH 4HKBA 5KAQF 3CFJA 4KRNA 3MRFA 2F19H 2C3VB 1WBYB 2UWEA 4FQHA 5JDSA 4FA8A 4KQ3H 1EJ6A 4JM4H 1TTUA 1FGNH 1T03L 1HHKB 1A5FH 3OKDA 1FAIH 5TDNB 3TYGH 2V2TB 2X4OB 3TN0B 3SGKA 5TQ2L 4OZGF 3FB7A 5IB4B 2NZIA 3MOAH 1XCTB 3ALXA 3AMLA 4I3SH 2B1AH 4LLDA 1FFOA 2GKIA 1A6AB 4JPKH 1I7ZB 4ELKA 3LKRB 1KLGA 4CVWA 3VW3H 3PL6A 1IZJA 1RIHL 2XYCA 3X17A 4JJ5B 5KSAD 1NCBH 5CD3A 1CFNA 3N06B 4PLJC 1R24A 2ZUQB 2IAMD 4NQTA 3K2UL 1CXIA 4D8PA 3O8XA 1MHHA 3BIAX 1E0OB 1MRDL 3EYOB 1RK0A 4M5ZL 1H3VA 1RZKL 2AJVL 5JPMA 1RURL 5EU7C 2OX5A 4NKDA 1GJIA 5J6GA 5FK9A 3ULUL 3E6HB 4Y5XC 3NABL 1R3IH 3VH8A 2Q76B 5BS0E 4EZMA 3IDGA 4EXPX 5I1JL 3V79C 4PJIA 5F9DC 2ED9A 2BSRA 2AVGA 4WWKB 2CIIB 1U0QA 4NCC1 4Y4HD 1FNGB 1WEJL 1FE8H 1T7YA 15C8L 3S37H 2ADGA 4ALAH 5SX4H 3VCLA 3N9GH 1MCSA 4YAQA 4MS8D 4HK3N 1VENA 2XV6B 3CSPA 1J5OL 1U8HB 3GGWA 1EAJA 5ACZB 4HPOL 2WUCL 1LE9A 1LO5B 1BGXH 3SE8H 4HULB 2QQNL 5GGRB 5IMLA 1RVFH 4NO5A 4XVTL 3QNZA 1GGIH 1Q8MA 4OV5A 1A2YA 2GTWB 1P5UA 2VC2L 2B5IB 3P40A 4XHJC 4QOKB 1IM3B 5DRNA 1F90H 3O2VL 3QA3B 3EIFA 4X7FC 5MENA 1UVQA 4N8CL 3ARBC 3MRNB 4Q74A 2HT3C 4P5TC 3UTSB 1KTRL 3PXJA 4KRPD 4HWZB 4NPYA 1T6WA 5HGHA 1IGTB 1OTTD 2BNQD 1NL0H 1N64L 4NQDA 1KYOJ 2BSED 3OXRA 3E6FB 4K23L 3HC3L 3IYLW 1QFWL 3O4LD 3I50L 2DIJA 3P9MB 3TBWB 4MJ4A 3ULVH 2I27N 1J1XL 2ADFL 2RHEA 4R4FL 4RZCB 1FRGL 3AM8A 5GGRY 2VLRD 4PRIE 4L3EA 3WUWA 3VXSB 2XKSA 3OHXB 2EE6A 3MJ8B 2P8MA 2BY1A 4L4JA 2Q86B 5A3IC 4Y4FC 4IOIA 4POYA 2F58H 3NPZB 3CFBB 1XF2B 5E94A 2XTJD 3BAEL 1CG9B 4LVOC 4UB0H 5E8NB 2G2RB 1HINH 5CWSA 3QDME 3L3DA 1PQZA 2AXGA 2BVPA 5JXEA 1OQXA 5HHNA 1BF8A 1HZHH 5DHVB 3ZTJG 1JP5A 1S9VB 3QPQC 4ZFFB 3QH3A 5TDPA 1FNAA 3T2PA 3O3BA 5TFSL 5GRJH 5AUMA 5INDB 1LGVA 4N9GA 4I4WA 4JN2B 3BWAA 3DWTA 1DR9A 2PTUA 2UV3A 1OARL 3P4OB 1YNKH 1ZT7A 3IDXL 4Y2DD 2QQQA 3HI5L 2ADIB 5B8CB 1PX3A