4O0AA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4o0aA00
2NZOA 3RNUA 1O7IA 4IOAA 1EIFA 1YBYA 4OX9Q 4LFAQ 1S3OA 3CC2A 4XTCS 2OQKA 4JCVE 4GLVB 4OO1I 1V1QA 1WOCA 4B3MQ 4BBSH 3G48A 3E9IA 2HHHQ 1G51A 4X66L 3TS0A 4LF8L 3EBEA 4QIWE 3CCQA 1PH5A 4IFDG 4WJ4A 1JT8A 2Z6KA 3HKSA 1OTCA 1G291 5IY0A 3TEHB 3F1ZA 4PZ8A 4BBRG 1S40A 3GTMH 1KQSA 2F3IA 1FL0A 1VQ8A 2HIXA 1PV4A 1G6PA 1OXXK 1UEBA 5C0XJ 4R4CA 1BBWA 4AIMA 1P8LA 2CQOA 1U0LA 4APVA 3M85A 5IWAQ 4DR1Q 4AQYQ 1KIXA 1Q86C 3S16H 4KHPL 4LNQA 2UXDL 1E1TA 3STBC 1HNZQ 2PI2A 4JYAQ 1Y14B 1WI5A 4HIOA 1SE8A 3MEFA 3PGZA 4JI3L 1KRTA 3SGIA 4C3JH 1L1OA 4UP7A 4HIMA 4GOPC 3HKZG 3PUVA 1VQOA 2CKZB 3ULJA 2CCZA 1VQ6A 2C35B 4DUYL 1VQ7A 3J80i 3K7UC 2NVXH 5LMNW 2Q2HA 2PI2E 5IP9G 3PO3H 4JG2A 3U4VA 1KXLA 4UPAA 4BXXH 1I5FA 1TWGH 4P73A 4PMWA 2UUBL 1VQDA 2PQAA 4DV5L 4GLXA 4GNXC 1FGUA 3J81c 1I3QH 4ALPA 2BA0A 4IPCA 2F4VL 4JOIA 3S17H 2Z0SA 3NENA 3UDFA 3T1YL 2F52A 2IT1A 4QQBX 1N33L 2JE6I 1PH4A 4XIGS 2UUCL 2MQHA 3NBHB 1BBUA 4B3RQ 2VQEQ 1EUJA 2VUMG 4A3BG 1OXUA 2XGTA 3CCRA 2E2JH 1UE7A 3GO5A 3M9BA 1E1OA 3U4ZA 1XNRQ 1N34L 4QJFA 1SFOH 2JEBI 3CP0A 4K0KL 3KF8B 1IBLQ 3UDXA 4DR2L 4GN4B 5M5XH 3PIOA 4BA2I 1VQGA 2MNAA 3G4SA 3OTOQ 4YY3Q 1X54A 1Q82C 2OWOA 3TS2A 2UUAL 2CWAA 1QUQA 4A3KG 1YJWA 2K5HA 4UY8C 4YCWA 1M90C 4O2DA 4NXML 4A76A 2QGQA 4TQUS 2RHQB 2JEAI 1CSQA 4DR4Q 4A3DH 1AE3A 4DR6L 3L2PA 1Z47A 5HY6A 4JI2Q 1AE2A 4NB3A 1K73C 1K0RA 2K50A 3OYYA 3CCVA 1X3GA 1A62A 4LF5L 3Q8DA 4A3EG 5BR8Q 1SMXA 3H0GG 5FJ8G 5JEAJ 3HOVG 3K0XA 5LMUQ 1KAWA 1VCIA 2I5MX 2N49A 4IJHA 4A3LH 1KHIA 1PA6A 4TVAB 4JI5Q 4LF4Q 3FKIG 4B3TL 4PZ7A 4HJ7A 1EYGA 4JI1L 1Y1VH 1CSPA 2I5HA 5M3MH 2GVAA 5IYBH 2IX1A 4A3MH 5LMNL 4A3IH 5C44H 1JB7A 3ERSX 3CCEA 2N3SA 2Z6KC 2ZJPA 2UXCQ 3KF6A 2JA9A 5JJLA 3CPWA 1TWCH 1BKBA 3HKZE 4QL5A 1XJVA 1S72A 2GN5A 3ER0A 2N8NA 2JA8H 4J15A 5ELOA 3RLNA 1TWHH 1XMOQ 4JI4Q 3H15A 4A3GG 4R4QA 2AWNA 1GO3E 4UP8A 5M3FG 4GKKQ 1QZGA 1HNZL 1LM0A 4X62Q 2R93G 4Y52H 5JJIA 2AMCB 3PV0A 2MO1A 3AYHB 4H02A 4DV6Q 3KOJA 3RN2A 1Q1BA 4LFCL 4JI6L 2AKWB 2LSSA 4DPGA 2WFWA 3GD7A 2VL6A 3PUZA 4OONA 2K4KA 3T1HL 3H3VH 1PYSB 1EWIA 4JI0Q 1H95A 1VQ9A 1VQLA 1L1OC 4DV1Q 3MXNB 3HOWG 3CCLA 2YYZA 4JI7L 1NBWA 4X65Q 4BBRH 1FJGL 5C4XG 1IXRA 3GTOH 1JJCB 3K8AA 2YU9H 3GTGH 3BU2A 2VW9A 2JA6H 3HOUH 1VQ4A 3CQZH 2R6GA 1C9OA 4JBJA 3ULPA 2R7ZH 3J7A5 2Y0SG 1XPUA 1I94Q 1J5EQ 4DR5Q 1ASZA 1YNXA 1X55A 1TXYA 4DR7L 4L5QA 3STBD 1IBMQ 4JOIC 2ZJQA 1NE3A 4R4IA 3KFUA 4DV2L 3JC66 1VQKA 4HJ9A 4DV7L 5GAHC 1HNXL 1XNQL 2AHOB 5IYDH 2A1AA 4RG1A 1RIPA 1EOVA 2WB1E 2JA7H 3S2DH 3RLFA 1XNRL 5IYCH 4LUVA 1GVPA 4POFA 1SRUA 5H1SE 2YTVA 3I4NG 3PO2G 1MJCA 2K14A 4AYBG 4EX5A 2D62A 2VZAA 4X64Q 3GTLH 2B3GA 3K81C 4GN5A 4DAMA 2RF4A 3OW2A 5HGQA 3G71A 5M5WH 1XPOA 1A8VA 3HOXH 4DAYB 4JBKA 2K52A 4LFBQ 1EQQA 4LF7Q 1YEZA 4PZ6A 2WP8J 1X65A 1EFWA 3CCUA 3NEMA 2UXBL 4QY7A 3I2ZA 4IPGA 4BY7H 3RR5A 2YTYA 2ZM6Q 3K80C 2LXJA 4NXNQ 4C2MH 4DK3C 2ASBA 2R92G 2NN6I 1TWFH 4JBWA 1K8AC 4PG3A 3CC4A 4B3SQ 1MIUA 4A3CG 1VQ5A 2WAQG 4YHHL 1HZ9A 2JA5H 1HR0Q 1VQJA 2B29A 4LW1A 4DV3Q 4LF6Q 5M5YH 1JJGA 2CFMA 3BJUA 3JAMc 4DUZQ 1WCMH 5FLMH 4A3FH 1B70B 3A0JA 1SLJA 2ZTCA 1Q12A 4DV4L 2UU9L 3GTPH 2IX0A 1N32Q 1MKHA 3KLWA 2KCTA 1E3PA 2EQSA 1L0WA 4GS3A 5GADC 5C4JH 1XMQQ 3F8TA 2A8VA 1SN8A 4A4IA 1HNWQ 2VQFL 4DR3Q 3EIVA 3PUXA 5GROA 1J6QA 5C3EH 2IHEA 1IBKL 2IY5B 1PVOA 5E7NA 4JV5Q 3S24A 1PHJA 1NTGA 1YJ9A 4DV0L 1R9TH 4HIKA 4JI8L 1QVGA 1OXVA 4GKKL 2I5LX 4OWWB 3HFZB 3I4MH 4LF9L 2MFIA 3H0GH 5FJ8H 5K36G 3HOYG 3AFPA 2VS1A 4DK6C 4A3JH 1VQFA 1LYLA 4YWMA 3CMAA 4O0AA 5IP7G 4X66Q 5C0XG 4QGUA 5AJ3L 3IRBA 4LF8Q 1HZCA 2ALYB 3A5ZB 4C3IH 1Y1WH 4DKAC 1QZHA 1N36L 1KL9A 3H3VI 1VQHA 4IFDI 1CKMA 4A93H 3M4QA 3HOZH 3ULLA 2E8GA 1W3SA 4BXXG 2L15A 4OX9L 4LFAL 4OO1G 3W1GA 3S1MH 1K9MC 3A74A 1N9WA 4P72A 4IOCA 3PUWA 4B3ML 1K8GA 4LUZA 4DR5L 2HHHL 4BY1H 4A3GH 3U50C 5M3FH 2K5NA 2BH8A 2R93H 3I56A 3J7ZC 4KHPQ 2UXDQ 2KCMA 2QEXA 2FXQA 2K5VA 1WJJA 3S1QH 3UDGA 1Z9FA 1EQRA 1NMGA 4JI3Q 4GKJQ 3E9HA 3G6EA 1CUKA 2HIVA 3J80c 4DUYQ 1XTDA 3HOWH 2YV5A 4P71A 2CWPA 5IWAL 4DR1L 1OXTA 4IFDJ 4IPDA 4AQYL 3AQQA 1UWVA 1JJ2A 2GVBA 3UE1A 2UUBQ 3EN2A 4LWCA 3ZJYC 4DV5Q 3CCJA 2ID0A 4JYAL 2PMZE 2PQAB 2VY3A 2K75A 2F4VQ 1K3RA 1HZBA 1YHAA 4UP9A 3T1YQ 2BH2A 3ICEA 4A3DG 3CPFA 1N33Q 1LUZA 1RL2A 3CAMA 1PH7A 2UUCQ 3WWVA 1IL2A 2PNHA 3RN5A 1UE5A 1X3FA 1Q1EA 1FVIA 4YWKA 2OCEA 1GKHA 1WFQA 4HJAA 4L5RC 1N34Q 4YCUA 3I4NH 1VQBA 1VS0A 2DGYA 3PSIA 2OTLA 4K0KQ 1HZAA 2KBNA 3I55A 3D0FA 3J81i 4DR2Q 2I0QA 4A3LG 2Q2UA 2YTXA 2ATWA 1A0IA 4OWXB 5GAEC 1N8RC 1E24A 3KJOA 4KHZA 4IJLA 1T9HA 1Y1VG 1VQPA 4A75A 2UUAQ 5M3MG 2QA4A 4HJ5A 4A3MG 2VQEL 1QUQB 2JQOA 4GOPB 4A3IG 4NXMQ 4B3RL 5JJKA 1X6OA 1Q81C 3M7NA 3B6YA 5JEAG 2E2IH 4DR6Q 3GDEA 1A63A 2JJQA 1CKNB 2Q2IA 3FP9A 1VQAA 4R4OA 5IP9H 4NPSA 2JA8G 1IBLL 1E22A 4A3CH 2KENA 3PUYA 4LF5Q 1X3EA 5GAGC 3DLLA 1VQCA 3OTOL 4YY3L 1IZ6A 1KD1C 1M1KC 4GNXB 1PH3A 3UE0A 2EIFA 3D31A 3K7AH 4MNOA 2B63G 3FHWA 4DR4L 4B3TQ 1C0AA 2NVYH 1PH9A 3KDFB 2R7DA 4JI1Q 4JI2L 4X6AH 2LXKA 2VNUD 3F2CA 5LMNQ 5DLQE 2VUMH 3M4PA 4A3BH 2IHFA 1HJPA 1YI2A 4HJ8A 5BR8L 1NJIC 3PF4A 2JA6G 1PH2A 3KF6B 3HOUG 1VQIA 2R7ZG 3UDIA 1B8AA 5LMUL 2XTIA 1BVSA 4BBSG 1V43A 4IPHA 4AH6A 2N78A 4KI0A 1UE6A 3NELA 4JI5L 1JMCA 4LF4L 3HOYH 4A3KH 4L5TA 1E7ZA 1SR3A 1KC8C 4LFCQ 1K83H 2HQLA 1W2BA 5IP7H 4JI6Q 5IYDG 4GKJL 3VDYA 4YWLA 2NVQH 2JA7G 3T1HQ 1JE5A 2UXCL 5IYCG 2RCNA 4HIDA 3KJPA 3CW2C 3RZDH 3GTQH 4JI7Q 1FJGQ 1I6HH 5GQOA 1XMOL 4JI4L 1QVCA 4GN3B 5J3BA 1EIYB 2D0PA 4MTNA 4A3EH 1HR0W 5ELNA 4X62L 3HOXG 1PYBA 1SROA 3J81j 3S14H 1Q46A 4DV6L 5EAYA 2KHJA 3F2BA 3HOVH 1X56A 4P75A 3L0OA 2HT1A 3LGJA 2KHIA 4BY7G 4ME3A 3FKIH 4DR7Q 3BZCA 2Y0SE 1OXSC 1KRSA 1V9PA 1PH1A 4JI0L 4DV2Q 4DV1L 2ES2A 3CD6A 4DV7Q 1U5KA 1HNXQ 1XNQQ 4X65L 3CCMA 1YJNA 3PCOB 3RLOA 4RMFA 3PO3G 1YHQA 1PFSA 3E0EA 3KYHC 2JA5G 3S15H 2NVTH 1XPRA 4A3FG 1WCMG 5FLMG 4POGA 5IT9c 3TRZA 1I94L 1J5EL 1VQNA 1WYDA 3PF5A 3U58A 1NMFA 4GLAC 4AYBE 1DGSA 4R4TA 2WB1G 1IBML 1VQEA 1L2FA 1D8LA 3F2DA 4GOPA 1MJEA 4C3HH 4DNIA 2UXBQ 1HH2P 1CKNA 1YHBA 1YVCA 2V1CC 1YIJA 5C3EG 1L1OB 4JC0A 3M4OH 1GM5A 3CCSA 5C4XH 4X64L 5FLXc 3PIPA 2H5XA 4LUOA 4MZ9A 2E5LQ 2ZTDA 4GNXA 3I4MG 1B7YB 4YHHQ 1PH8A 3M3YH 1TWAH 2R7FA 4LFBL 2D0OA 3CMEA 3W5OA 1VQMA 4LF7L 2NZHA 4DV4Q 1IYJB 4A3JG 2WAQE 2UU9Q 2RHSB 2ZJRA 2OTJA 3KDFA 1P16A 1UE1A 1C7YA 4L5SA 2BA1A 3TQYA 3GTJH 2OQ0A 3CC7A 2ZM6L 1Y1WG 1PH6A 2NN6G 4EQ5A 1GD7A 2Q2TA 3S1NH 4NXNL 1YITA 1YZ6A 3L7ZC 4A93G 3HOZG 4B3SL 2A19A 3AFQA 3CF5A 4BA1I 2VQFQ 3S2HH 2EXDA 3A5UA 1IBKQ 3RZOH 2AWOA 5IE8A 1HR0L 3PO2H 4KLKA 4DV3L 4LF6L 2ZTEA 4DUZL 1Q8KA 2E5LL 4YCVA 3JAMi 4DV0Q 3GTKH 4WJ3M 4BY1G 2MO0A 4JI8Q 1N32L 1ASYA 1NY4A 1X9NA 4LF9Q 4OWTB 1D7QA 3AEVA 3TREA 3I4OA 4Y7NH 3S1RH 1CKOA 3DM3A 1Q7YC 2DUDA 4R1JA 1XMQL 4FDBA 2E2HH 2B63H 3I7FA 3W1BA 5IYBG 4JBMA 5AJ3Q 1HNWL 5C44G 1I50H 1LTLA 3CXCA 4DR3L 1QVFA 4IO9A 5C0XI 1N36Q 4OXPA 1AH9A 4P74A 2JK8A 4JV5L 2R92H 3BZKA
chains in the Genus database with same CATH superfamily
1U9RA 4IOAA 2L4NA 4OX9Q 4LFAQ 2JA6B 3BVMA 1EQTA 3CC2A 4JCVE 4GLVB 1RDPD 4BBSH 4BBSB 1B3AA 2HHHQ 4ME5A 2NWGA 4X66L 3TS0A 4LF8L 2K33A 3D8GA 3TZUA 1OTCA 5BN5A 3T16A 5IY0A 3TEHB 3IFTA 4PZ8A 4B08A 1HA5A 4DK1A 1TR5A 1PV4A 5ELEA 4R4CA 1BBWA 2F0LA 4AIMA 1U0LA 1F9SA 4DR1Q 1KDCA 1MSHA 1E2VA 5M5WB 3STBC 4M8AA 4JYAQ 1Y14B 4FXDA 1SE8A 3MEFA 1KRTA 4FF4A 1VQOA 1YNNC 2C35B 1HQRD 5IP9G 5HGTA 3P75A 1KXLA 2EYJA 4B9XA 1CHPD 3T13A 4PMWA 1JORA 4XYQA 5KNCA 2D2CC 4GNXC 1FGUA 2BA0A 4IPCA 2F4VL 1KDBA 3OIQA 2IT1A 1CM9A 2WB1B 4QQBX 4EQPA 1PH4A 2UUCL 3NBHB 1ENAA 2V4DA 1PZJD 3A8KE 3CCRA 2E2JH 3K5OA 3U4ZA 1BDOA 3K0YA 4HCSA 1SFOH 1R9TB 1IBLQ 1STYA 4DR2L 4BA2I 3DEOA 1Q82C 3AB9A 4CJ2C 1CHQD 2CWAA 1ZXTA 4A3KG 4UY8C 4NXML 1CSQA 1HUMA 1Y1WB 1AE3A 4DR6L 3L2PA 4KKSA 2PZWA 1JICA 3CCVA 1HTLD 4A3EG 5BR8Q 5JEAJ 3K0XA 1L0XB 5LMUQ 2I5MX 2N55A 4JI1L 1Y1VH 1Y1VB 3TN2A 2Z4IA 2ZJPA 4KN7C 3KF6A 2JA9A 5ELBA 1TWCH 1XJVA 2GN5A 3ER0A 2JA8H 4R8IA 4JI4Q 4HN7A 4UP8A 4GKKQ 1HNZL 1LM0A 2R93G 5JJIA 4H02A 4HR7B 3KOJA 1SAPA 4YIJA 2ICIA 1O7YA 1B53A 4HAEA 2NTTA 3H3VH 3ITPA 1EWIA 4JI0Q 2KVMA 1VQ9A 1L1OC 4BBRH 4BBRB 5C4XG 1IXRA 2A69D 3K8AA 2I07B 4PMBA 2RCFA 3GTGH 3GTGB 1B3QA 1VQ4A 1C9OA 1IW7C 5C3WA 4JBJA 5CMDA 5C4HA 2Y0SG 2E74C 1J5EQ 4DR5Q 4C1NI 1WTPA 1X55A 1IBMQ 5IODA 2A1AA 3HKZB 1EOVA 1HRJA 5I9PA 3RLFA 2ZT9C 1B50A 4LUVA 1AN8A 2XN9C 3KF8A 2NZ1D 4DNRB 4POFA 3I4NG 3PO2G 3GTLH 1TU2B 2B3GA 1SNDA 2OF1A 5HGQA 3G71A 1D6EC 3T53B 3HOXH 3K6OA 1WTRA 1SYEA 1EQQA 3PIO3 4LF7Q 2B2WC 4PZ6A 3ERQA 3I2ZA 3RR5A 2EYMA 2VUMB 2NUCA 1PMRA 1K8AC 4B3SQ 3GV6A 1I4QA 5CV4A 4YHHL 2EXZA 1TY2A 2JA5H 1VQJA 2JA5B 4LF6Q 1X3PA 3JAMc 3BJUA 4DV4L 3GTPH 4J8QA 1Q12A 2IX0A 3QR8A 5EBDA 2WACA 1E3PA 3CRLC 3F8TA 5I6WA 1F9RA 4A4IA 1HNWQ 4OIKA 4U68A 5CV8A 4DR3Q 4U673 3PUXA 3MVVA 2IHEA 5E7NA 1NTGA 3CHBD 3VYRA 2K03A 1OXVA 1V1OA 4LF9L 3H0GH 3H0GB 3I4MH 3I4MB 2KEDA 3AFPA 3J7AF 5IP7G 5C0XG 3IRBA 2ALYB 3A5ZB 4DKAC 1QZHA 1N36L 4H0LC 2LS01 3W2DA 4BWGB 2RQXA 4V0BA 2SDFA 3VYSA 5T1IA 4A93H 1SMYC 2Q8IB 4OO1G 3SK6A 3W1GA 5JAVA 3E5SA 1WTXA 2NVTB 4FF2A 4P72A 3C3LA 3DEPA 1JOQA 4B3ML 2H1EA 4LUZA 3M7GA 4B9WA 2KCMA 1BXTA 4K6DA 3A55A 2FFKB 3S1QH 1LTBD 1EQRA 3U9OA 4RKBA 3E9HA 2PCFB 4PQXA 3J80c 3HOWH 3HOWB 2YV5A 4P71A 1NR4A 1EY4A 3I72A 3HS0C 2GVBA 3URYA 3MAQA 3CCJA 2ID0A 1ICWA 1YHAA 4QUCA 3T1YQ 4A3DG 1N33Q 1UUPA 1JWMD 3CAMA 3IKJA 1UE5A 1Q1EA 1FVIA 2L0CA 3VYTA 2PZTA 2F0OA 1GKHA 5EBCA 2F0HA 5NUCA 3PSIA 3DWAA 3GTKB 4ILWA 4CGYB 1IKMA 4CKEA 2ATWA 4OWXB 1E24A 3KJOA 2UUAQ 3MC0B 5M3MG 3OIPA 2MJ8A 3A8JE 4A3MG 2VQEL 1QUQB 2PO4A 4GOPB 1I50B 2AUKA 1PZID 1QNKA 1A63A 2JJQA 4I7ZC 4R4OA 5IP9H 3MZ5A 1E22A 4A3CH 3FVQA 2MUYA 3PUYA 4IURA 2WAQB 5GAGC 4LF5Q 1Y69U 4YY3L 1KD1C 1M1KC 4HSVA 1PH3A 3UE0A 2EIFA 3VYUA 1SYBA 3K7AH 2WKDA 2VNUD 5LMNQ 2K01A 3A56A 2EJFC 3MXGA 4JW0A 3C1EA 4O1NA 1WTOA 2JA6G 1VQIA 2F0NA 4BBSG 3QIAA 4IALA 4JI5L 4LF4L 3HG9A 1JWSD 5CBEE 4A3KH 3QJYA 1LT4D 4C3JB 5FLXL 5IYDG 1TS5A 4OEMB 4YWLA 1X32A 1CA6A 2NVXB 1VMPA 5IYCG 1O78A 4HIDA 5FKAC 1FJGQ 5K5PA 1TWGB 1EIYB 4A3EH 2QDLA 1DD2A 1PRTB 2JP1A 4V190 1I3QB 3I8ZA 2KHJA 4P75A 1H9KA 4H44C 1I4PA 3R8BA 4JK1C 3D4DA 1O7ZA 1UAPA 3ND8A 1PH1A 4DV2Q 4DV1L 4MIUA 1XNQQ 4XDXA 1JB3A 3E0EA 5KYIA 1EZ6A 1XPRA 5IT9c 1I94L 3E6ZX 3JAME 1NMFA 2WB1G 1JE4A 2BOSA 3VR3A 3F2DA 4C3HH 4C3HB 2LKVA 4HSPA 1YHBA 4ZKCB 4FXKC 4JC0A 3M4OH 3M4OB 1GM5A 5CYUA 2K05A 3SK4A 5C4XH 5FLXc 3OW7A 2H5XA 1Q3LA 2ZTDA 4GNXA 1JQYD 4J1MA 1LACA 4TKOB 1TWAH 1TWAB 5A2QL 1XXGA 4LFBL 3CMEA 3W5OA 4OGQC 2A6HD 1PTOD 1D1IA 3F2UA 4OL7A 3TQYA 3GTJH 2OQ0A 4C3IG 2ZM6L 1Y1WG 3GTJB 3S1NH 3S1NB 1YZ6A 1TY0A 5LL6S 1OO9B 4IUQA 5BN3A 2VQFQ 3A5UA 2RSNA 3RZOH 1TS4A 3PO2H 1TWHB 4DUZL 4WJ3M 1HFNA 5LL6X 1ASYA 4OWTB 4K5WA 3I4OA 3S1RH 3SK5A 3DM3A 1ET9A 1CZWA 3W1BA 1A2TA 3MWYW 1CTMA 4IUTA 3HRZC 4IO9A 5C0XI 2RVLA 2JK8A 2JN4A 3BZKA 1E0BA 3BG3A 2SOBA 1SEBD 1YBYA 1BCPF 4K2KA 1S3OA 3K5NA 2OQKA 4OO1I 2R7ZB 1WTWA 3E9IA 1XX8A 4G7ZC 4CKCA 1ESRA 1K28A 4QIWE 4RH6A 2QDBA 3HKSA 1G291 4L6TB 4BBRG 2A69C 4ZRZA 1OXXK 1UEBA 1P8LA 3EJIA 3M85A 5IWAQ 1SNQA 4AQYQ 3S16H 3X3NA 3FDTA 1K0SA 2D9UA 1HXYD 4FVMA 1WI5A 4NW2A 3SGIA 1L1OA 4BY7B 3HKZG 2CKZB 3CKIB 4DUYL 3K7UC 5LMNW 4PNYA 3PO3H 3PO3B 1TWFB 3U4VA 5JVG3 4UPAA 2DJFC 4N8FA 1Y8OB 4I7AA 4DAPA 2UUBL 1ILQA 1TKWB 4DV5L 1WCMB 2E2DC 3S17H 3S17B 3NENA 3NE5B 3J7YW 5DEHA 2ICEC 1QOHA 4QF4A 4XIGS 5EJWA 3I4LA 1EUJA 2Z8LA 2VUMG 5M9OA 3D4RA 4FYDA 1QG7A 4QJFA 3KF8B 5M5XH 1AZQA 1VQGA 2MNAA 3G4SA 3R3OA 5D65A 2B2WA 1QUQA 1SBBB 5D14A 3WDNA 4YCWA 4O2DA 4TQUS 2JEAI 4DR4Q 4A3DH 2TMPA 2XRQD 2G5DA 1U4MA 1TS3A 2FJ2A 2LMCB 2IWHA 1GHJA 1K73C 3HOZB 2EE1A 3OMGA 3OYYA 4OIJA 1EEID 2DY7A 3NTHA 5FO8B 3Q8DA 3H0GG 1FNVA 4KKUA 4XT1B 4FF3A 1KAWA 3I90A 2N49A 5BN4A 2P5ZX 4KN4C 1KHIA 1T5XD 4TVAB 2IX3A 3FKIG 4B3TL 4PZ7A 1CSPA 2I5HA 3P1HA 5M3MH 5M3MB 1R4PB 5LHY1 4A3MH 4A3MB 4G7OC 2B2TC 3TZDA 3CCEA 3I70A 3RMHA 2UXCQ 3H6MA 5JJLA 3CPWA 4QL5A 5FO7B 1S72A 1SYFA 2MP1A 1GO3E 4Y52H 2AMCB 3AYHB 3L9AX 3OHXC 2A68D 5E4WC 2LSSA 4DPGA 2VL6A 3T1HL 2K4KA 1QNUA 1SYDA 2Q8TA 1H9RA 3HOWG 3CCLA 5IGFA 2YYZA 4JI7L 2O2LD 2E75C 2YU9H 2YU9B 3BU2A 5FLXE 2JA6H 2IW3A 2QKIC 3CQZH 3CQZB 2WV6D 1FYCA 2RDGA 1KDAA 3BVZA 4K8IA 1XPUA 1YNXA 1HPCA 1ESFA 1TXYA 4L5QA 3BVGA 4JOIC 3JC66 1STBA 5GAHC 4DV7L 1HNXL 2AHOB 2KQ3A 2NTSA 5IYDH 2E2IB 5IYCH 3R2TA 2JXMB 1SRUA 2AQ1B 3KK7A 5H1SE 1MJCA 2K14A 4EX5A 1KNEA 1T5EA 3OW2A 5M5WH 1XPOA 3AMUA 3V05A 2K52A 1YEZA 2UXBL 4KKTA 3V2TA 4IPGA 2EYHA 3MXPA 3K80C 2A5HA 2KA7A 4C2MH 4DK3C 4C2MB 4KMUC 1IYVA 4PG3A 4A3CG 2AUJD 3QO2A 2WAQG 1HR0Q 2B29A 4DV3Q 5EGTA 2CFMA 2R3ZA 1ASZA 2ZXOA 2ZTCA 1D1KA 2UU9L 1ONLA 1B9NA 1I4XA 4RFBA 1N32Q 1NNXA 3MFYA 2KCTA 2K6AA 2TSSA 1L0WA 4GS3A 5GADC 1XMQQ 2PNRC 1K83B 2JYOA 1BF4A 2A8VA 2NYZD 1H9MA 1SN8A 2FMMA 3I91A 5A2QE 1YNJD 1IBKL 1V1PA 1SJHD 3GTQB 5C6AA 4HMIA 1PHJA 1YJ9A 1R9TH 3EFXD 4MHEA 1QVGA 4GKKL 3BDCA 3HFZB 3OMCA 2MFIA 5FJ8H 4RKLA 2Q8RE 1DXMA 1VQFA 4YWMA 4C3JG 5D3DA 1CA5A 4X66Q 5AJ3L 4QGUA 2QILA 4LF8Q 4C3IH 4C3IB 1Y1WH 3KUPA 1EY7A 4XQNA 3H3VI 2BE5D 1CKMA 5C5MA 1CFMA 2DJGC 1WD1A 3S15B 1K9MC 3PUWA 2EJGC 4BS9A 4ZUIA 4DR5L 1S4ZA 1STHA 2BH8A 4DU9A 3RD4A 3D3RA 2QEXA 2K5VA 1WJJA 1QILA 1B44D 1M4VA 2F0JA 2F0UA 3G6JB 1S5FD 4JPBW 2HIVA 2EY6A 2K32A 1GXDC 5G3LD 4KY7A 1OXTA 2EPBA 5DM73 4IPDA 3AQQA 1MSGA 5DM63 3ZJYC 3I3CA 2RBMA 4F8MA 2VY3A 2EZVA 1BBXC 2F4VQ 4C3HG 1NCVA 3ICEA 4NP5A 3CPFA 4L8JA 2L55A 1LUZA 1RL2A 1PH7A 1BCPD 4RHRA 2UUCQ 3BDOA 3BYYB 2PNHA 1X3FA 1RCVD 2OCEA 1WFQA 3NWTA 4L5RC 3VR4A 1HZAA 3I55A 2A6HC 1PTOC 3G7LA 3J81i 4DR2Q 4KTAA 2PPBC 1NUCA 4A3LG 1G8ZD 2YTXA 2MHVA 2X69A 2J4XA 4WRDA 4KHZA 3BZDB 1VQPA 2E2HB 1BO0A 2QA4A 4HJ5A 4B3RL 4DAVA 4NXMQ 2QEJC 1AP0A 3M7NA 1E2WA 4DR6Q 3FP9A 4RGMA 1RJTA 2DNEA 3DLLA 2XWJB 3OTOL 1S5DD 1VF5C 4RHSA 4GNXB 5EPJA 5FO9B 2K04A 4JI1Q 2R7DA 4JI2L 1GUGA 2LXKA 1BUVT 3F2CA 5DLQE 2VUMH 3GTMB 4M1UB 3SR1A 1NJIC 3PF4A 1PFBA 2FINB 5JJZA 4TSSA 2CVRA 2R7ZG 1LO5D 5K36H 4ZCKA 1JMCA 3HOYH 3HOYB 1E7ZA 1PZKD 2WKCA 3VDYA 1EYCA 2RCNA 1R4QB 1K3BC 3KJPA 1WD0A 1KNAA 1E2ZA 3CW2C 2O5IC 3K57A 1XMOL 1QVCA 1HR0W 4X62L 1SROA 3M4YA 1EIGA 3TP6A 1Q46A 4DV6L 1BNZA 5EAYA 2XNAC 1X56A 2F0MA 3L0OA 3OSOA 3DWQA 4BY7G 2F4IA 3FKIB 3FKIH 1OXSC 2HDLA 1FNUA 4X65L 1YJNA 3PO3G 3RLOA 1TQOA 1PFSA 5CV7A 1EY9A 2NVTH 1WCMG 5FLMG 4POGA 2E76C 1CK1A 4ID6A 1VQNA 1EYDA 1WYDA 3PF5A 3U58A 4LJZC 4GLAC 2N88A 4AYBE 5D3IB 3P20A 1VQEA 1L2FA 4CKBA 4CDDC 1YVCA 2V1CC 4ZK9B 3VR6A 1Q90A 4XQQA 1L1OB 3DWPA 1PRTF 3A7AB 4X64L 1STAA 1F9PA 3FPPA 1B1ZA 4LUOA 4MZ9A 1B7YB 4YHHQ 2M2LA 1PH8A 3VA7A 2R7FA 4PV1C 1PTOB 2F0TA 1LTRD 2NZHA 4DV4Q 3NQIA 1ZEQX 5JPMC 1RKNA 5CORA 1C7YA 3K58A 1PH6A 4NXNL 1YITA 1H9SA 3HOZG 1RODA 3NTIA 3CF5A 1I4HA 2EXDA 1PFNA 5IE8A 2ZTEA 1Q8KA 2E5LL 2KCCA 3GTKH 2MO0A 2B2VC 4LF9Q 1BR9A 3AEVA 1D7QA 4RCNA 4Y7NH 4Y7NB 1CKOA 4R1JA 1D2BA 4FDBA 1F2LA 2B63H 2B63B 1I50H 2F0FA 1QVFA 3U9SA 2L1BA 1N36Q 4OXPA 4P74A 5ISRA 4JV5L 3GTOB 2DN8A 3RNUA 1O7IA 3HOUB 4XTCS 1FD7D 3HP3A 1V1QA 1WOCA 4B3MQ 2A68C 5I6YA 1G51A 2O5JC 2HUGA 1DOKA 3MEHA 1JC7A 2B2TA 1ENCA 2K5DA 3GQBA 4IFDG 4WJ4A 2VB2X 1JT8A 3DUZA 1GUOA 2JA7B 3S2DB 3F1ZA 2IPKD 4X3SA 1KQSA 1FL0A 1VQ8A 3EA6A 5C0XJ 5EKLA 2CQOA 4WJWA 4XQJA 5J22A 2F0WA 2I46A 4KV6A 1KIXA 4KHPL 3HGBA 4ZQ3A 1E1TA 2UXDL 4HIOA 3PGZA 4JI3L 4C3JH 4UP7A 2EDGA 2CCZA 3ULJA 1VQ6A 4K8JA 1VQ7A 2NVXH 2Q2HA 3NUCA 2KECA 4JG2A 1TVXA 1IYUA 2B2YC 1I5FA 1TWGH 5CR3A 1VQDA 5M5YB 4NDXA 3VR2A 4A3FB 1I3QH 5IGCA 1GOZA 4JOIA 2Z0SA 3UDFA 2F52A 2Z9HA 5C4JB 2JE6I 1LT5D 1Z7TA 2VQEQ 4RAUC 4DA2A 1AFPA 1W6KA 3M9BA 5C3EB 3K5MA 1XNRQ 1N34L 1S5ED 4LK1C 3CP0A 4K0KL 4GN4B 2Z6BA 3PIOA 1TT2A 4YY3Q 2K7VA 2OWOA 3TS2A 5F2DA 1SJED 2L9HA 4A3JB 1PDQA 1YJWA 1VDZA 2RHQB 1YNJC 1B9MA 2NN6H 4K14A 5HY6A 3Q22A 2IL8A 4NB3A 2NB0A 1K0RA 2F0VA 2K50A 5JPNC 1X3GA 1A62A 4DXGA 1SNOA 1SMXA 2B2UC 4HEDA 5FJ8G 1WVLA 2BCOA 2OT2A 2HD3A 1HA6A 4BY1B 1Y8NB 3MHBA 4A3LH 1KLGD 4JI5Q 4LF4Q 1K8MA 5IGGA 2BE5C 2GVAA 5IYBH 1EZ8A 3NP8A 5C44H 5C44B 1JB7A 3DM1A 2Z6KC 4HMJA 1BKBA 3HKZE 4N9PA 1V1PB 1X3QA 4J15A 5ELOA 1TWHH 3H15A 4R4QA 4DFAA 2RSOA 1QZGA 4H7BA 3PV0A 1B4OA 2MO1A 2PYKA 5I2XA 1EY6A 1Q1BA 4LFCL 4JI6L 3KLSX 5ELDA 3GD7A 3PUZA 4OONA 1ZKOA 1ZYRC 1VQLA 4DV1Q 1F2YA 3C2PA 1NBWA 2ENBA 2QW7A 4EVOA 1JJCB 1VF7A 3Q23A 2R6GA 2R7ZH 1I94Q 3CU7A 5DAUA 1S5BD 4DR7L 1BCPC 4R4IA 4QCLA 1A3UA 4P2CB 2D5DA 1GVPA 1EFID 1XYIA 2YTVA 3K81C 1D5ZC 4DAMA 2K1BA 4N8X1 4LFBQ 3E0JA 2WP8J 3CCUA 3NEMA 4QY7A 4BY7H 1WTQA 1JWUD 2ZM6Q 2LXJA 1DOMA 1LTAD 2ASBA 4A3BB 2F1MA 3SDZA 3NK9A 1TWFH 4JBWA 3CC4A 2EY5A 2HQEA 3PQIA 4C56C 1WTHA 1HZ9A 4LW1A 1JJGA 4WORA 4DUZQ 5HURA 1WCMH 5FLMH 1B70B 3WOEA 1SLJA 4CDEC 3QOLA 1MKHA 3NPPA 3KLWA 1CI3M 2EQSA 1MD2D 1MI2A 1H9JA 2F3VA 1UNSA 2JSOA 2NVQB 1ICFB 1PLFA 2F0DA 3R93A 1EOTA 4EQOA 3EIVA 4HTHA 4ODGA 1J6QA 1I6HB 3S24A 4KJNA 4DV0L 1A15A 4JI8L 1DONA 5K36G 1SNMA 3S14B 1PXUA 3RUZA 3LWUA 1QCBD 3HOYG 3HOVB 1PRTD 2VS1A 4DK6C 3N52A 3OWEB 4O0AA 2F3WA 1HZCA 1QB5D 2SNSA 2DY8A 4IFDI 2B8GA 3HOZH 2E8GA 4BXXG 4OX9L 1LT6D 4LFAL 5C4ZA 2KJXA 4IOCA 4GZYC 1K8GA 2HHHL 4A3GH 4A3GB 3EQLC 3U50C 5M3FH 5M3FB 2HCIA 2FXQA 3FPUB 1EYAA 2BDNA 3UDGA 1Z9FA 3VR5A 1HCZA 4GKJQ 3G6EA 2EYOA 1CUKA 1NR2A 5CBAE 4DUYQ 3TMEA 4CJ1B 1S5CD 4ZUJA 2CWPA 4DR1L 1B2TA 4RCOA 4RWSC 1JJ2A 5KYLA 4DAYA 4DF7A 4K5XA 2UUBQ 4DV5Q 1BQQT 4JYAL 1CZGA 2PMZE 2PQAB 2K75A 1Z6HA 1HZBA 3ND9A 4CHTB 4RA8A 2G9DA 3Q0AA 2L11A 4IFDH 3K59A 1U4PA 3S2HB 4FNFA 3QOJA 4YWKA 4HJAA 1JR0D 1EU3A 4AYBB 2DGYA 3TDQA 2KBNA 3SXHA 3NXWA 5AFWA 1NAPA 3KLRA 4IUVA 3LNNA 5GAEC 1N8RC 1T9HA 5E4XA 4IN3A 1G2TA 3FMCA 2JQOA 4A3IG 2WINB 2ZXPA 1X6OA 1Q81C 5JEAG 2E2IH 3GDEA 3TP7A 2Q2IA 1SE3A 2R92B 1LT3D 4ZAIA 1IBLL 2XVSA 1O80A 3SVMA 3A8IE 1VQCA 3D6CA 5EPKA 4KD3A 5CV6A 2B63G 1G2SA 5KRUA 4B3TQ 3H3VC 1C0AA 3TP8A 1PH9A 4X6AH 1FNWA 4K2LA 1LV9A 3M4PA 4MTKA 1HJPA 1C8CA 1H9SB 5A35A 4HJ8A 5BR8L 3C1FA 3HOUG 1MBYA 2B2VA 3UDIA 5LMUL 1V43A 1DJRD 4IPHA 4AH6A 4KI0A 2WIIB 1UE6A 3SHLA 2M00A 3SK8A 5L37A 1MHWC 4L5TA 1SR3A 3MA2B 1KC8C 1K83H 2HQLA 2KCNA 2JA7G 3T1HQ 1JE5A 2F0EA 4QMGA 5KGUA 3RZDH 1GUNA 3RZDB 4JI7Q 3GTQH 1FGBD 4JI4L 2D0PA 3OPOA 4MTNA 2EOTA 1PYBA 1GUWA 3V96A 3F2BA 2XIWA 2SEBD 4L63B 2Y0SE 4JI0L 2ES2A 4DV7Q 1U5KA 1HNXQ 1UEAB 3CCMA 3PCOB 2E2JB 5IGEA 1YHQA 4DK0A 3MXUA 5TSSA 1SFOB 4ZLTF 2EVBA 3S15H 4A3FG 3PMFA 5KEEA 3NHHA 3S9WA 3TRZA 1LTID 1J5EL 2BDOA 3FRPB 3WOFA 1IBML 2CHBD 1MJEA 4DNIA 2RDHA 2A6ED 1K8OA 2UXBQ 1J8IA 1CKNA 1GUTA 1ZYRD 2J0TD 5C3EG 4J6HA 4NKLA 2B2YA 2OEOA 1M8AA 5FOBB 3CCSA 1SXTA 2VXWA 2F0IA 1LTGD 1WTVA 3I73A 3M3YH 3M3YB 1G91A 3SE0A 1VQMA 4LF7L 4UDUC 4A3JG 2UU9Q 2ZJRA 3KDFA 1UE1A 2BA1A 1SE4A 3EROA 2Q2TA 2NN6G 4EQ5A 1GD7A 5CV9A 1ET6A 2F0KA 2F0GA 4B3SL 2A19A 4BA1I 1IBKQ 1TWCB 2AWOA 2JA8B 4KLKA 4LF6L 3C46A 4YCVA 3JAMi 4KD4A 4BY1G 2F0SA 1X9NA 4CJ0B 2PW5A 1C48A 2DUDA 2E2HH 5IYBG 2H4OA 5AJ3Q 1HNWL 5C44G 2MGSA 2C5CA 4DR3L 1PTOF 3JAML 3BS1A 3J81L 2B2UA 2NZOA 1EIFA 1HHVA 4F87A 1XWEA 2XRSD 1II3A 2L12A 5EKKA 3G48A 3FEWX 2PQEA 3EBEA 3T51B 3CCQA 1A2UA 1PH5A 2Z6KA 1S40A 3GTMH 2F3IA 3X3MA 2HIXA 1SNCA 1G6PA 1QJOA 3GTLB 4APVA 5ELCA 3L3OC 1Q86C 3HOXB 4LNQA 1HNZQ 1U4LA 2PI2A 1STGA 5EPLA 4HIMA 4GOPC 2X6GA 1IKLA 3PUVA 3TBIB 3J80i 2PI2E 2QF7A 4BXXH 5E3FA 4P73A 4IUNA 4PMCA 1A6XA 5CGKA 2PQAA 4KY5A 4GLXA 3GTPB 1I4RA 3QB3A 3J81c 4ALPA 4QIWB 4HCEA 1F2MA 3T1YL 3J80L 1U4RA 3R2IA 1N33L 1QWYA 4RGTA 2MQHA 1BOSA 1BBUA 3KBGA 3TP5A 4B3RQ 1EU4A 4A3BG 1OXUA 2XGTA 1UE7A 4DNTB 3GO5A 1E1OA 1IHZA 1RD9D 3T4AC 1DYQA 2JEBI 4X3UA 5C3XA 1LTTD 3UDXA 2F0PA 3DMUA 3MFGA 4KJOA 1EEFD 3IFDA 3OTOQ 1CT1D 1X54A 1LLRD 2UUAL 2K5HA 1M90C 1KAAA 4A76A 2QGQA 4X3KA 4RGOS 3A54A 1Z47A 1HUNA 4JI2Q 1SDFA 1AE2A 4A93B 2DNCA 4LF5L 4MN3A 4KK7A 2EYLA 4R8NA 1PRTC 5CV5A 3HOVG 1PTOH 3OWFA 1DM0B 1PYWD 1VCIA 4IJHA 4KY6A 4OELB 1PA6A 1AZPA 4HJ7A 1EYGA 2CW0D 5J1ZA 3S1QB 2IX1A 5LMNL 4A3IH 4A3IB 5KNDA 3ERSX 4I65A 2HDMA 2N3SA 5JEAH 3MTSA 2SNMA 4WFN3 1NSNS 2N8NA 5C5LA 1Y8PB 3RLNA 1XMOQ 4A3GG 3T56B 2AWNA 5M3FG 4X62Q 2EYFA 5KIXA 1PFMA 3CRKC 4DV6Q 3RN2A 4E6IA 1EY8A 2AKWB 2KEEA 2WFWA 3J7AV 4TRDA 1PYSB 1H95A 2L5TA 2GA4B 3MXNB 1V8QA 1SE2A 1FJGL 4X65Q 4FO2A 2HCCA 5JOBA 3DHQA 3GTOH 1DCZA 4XXEA 2VW9A 5IGBA 4DXFA 2K5WA 4XYOA 3HOUH 3ULPA 1FR3A 4EQNA 3J7A5 1IL8A 4CDFC 3IAYA 2FMCA 3NBHA 3KFUA 3STBD 2ZJQA 1NE3A 1KTKA 4DV2L 1SYGA 4FP5D 1LTSD 3H09A 4HJ9A 1VQKA 1XNQL 4DN4M 4RG1A 1RIPA 1STNA 2LY7A 2WB1E 2JA7H 3S2DH 1YNND 2X6LA 4ULLA 4Z9CB 1XNRL 5J39A 4X3TA 4K5VA 4O42A 4AYBG 2D62A 2VZAA 4X64Q 3N6RA 4LAAA 2PMZB 4GN5A 3O13A 5FK9C 2RF4A 1A8VA 4DAYB 4JBKA 4CBVA 5E1FA 3K7AB 4EGVA 1EY0A 1X65A 1EFWA 3QWNA 1HTPA 2YTYA 5T1GA 4NXNQ 2R92G 5IT9L 2NN6I 1KABA 3GV3A 1QE6A 2KHSA 1MIUA 1VQ5A 2B39A 3ONAB 4IQZA 3PIP3 5M5YH 2ZXRA 2E5LQ 3LX0A 4A3FH 3A0JA 4QB4A 3D4WA 2LFNA 1JOKA 4S3SA 5C4JH 4A3KB 3P7JA 4JVZA 2NBFA 3QG1A 4FF1A 5EKIA 2VQFL 5GROA 5C3EH 2IY5B 4FXGC 1PVOA 5KNBA 4JV5Q 2PW7A 4HIKA 4A3EB 2I5LX 4OWWB 1GUSA 4A3JH 1LYLA 3CMAA 1RTOA 2RKSA 1JOOA 1I6VC 1KL9A 1VQHA 4UHVA 3M4QA 1AW7A 3ULLA 1W3SA 2L15A 1LABA 3ZYYX 2A73B 3S1MH 3S1MB 3A74A 1N9WA 2R61A 4IZ8A 4BY1H 2VB3X 4RGNA 1DOLA 1MGSA 2FHTA 2K5NA 2R93B 4R9WA 2R93H 3I56A 3J7ZC 4KHPQ 3J81E 2UXDQ 2K5QA 2QCPX 3UI2A 3BDLA 5I9OA 2RA4A 1EWCA 1NMGA 4JI3Q 1SYCA 2EY2A 3Q24A 2RDFA 1XTDA 3DXJC 1I4GA 5C4XB 2KOLA 2AQ3B 5IWAL 4IFDJ 4AQYL 1UWVA 4F7XA 2MPMA 4XT3B 3UE1A 3EN2A 4LWCA 4CDCC 4DGZA 1ILPA 3NWSA 1IW7D 2Y0SB 2Z4HA 2PZUA 2A6EC 1K3RA 4UP9A 2BH2A 1ML0D 3HEJA 3HZXA 3WWVA 1IL2A 3RN5A 1F77A 5COYA 5CC4A 3RZOB 4G57A 1N34Q 4YCUA 3I4NH 1W6JA 5EQ0A 1VQBA 3I4NB 3PO2B 1VS0A 3KBXA 2OTLA 3IL8A 3NBIA 4K0KQ 3D0FA 3SEBA 1GHKA 2I0QA 2K28A 1L0YB 1EIHA 5G3LF 3Q6SA 4ABNA 2Q2UA 1A0IA 3TSSA 3S1RB 1SNPA 2CH4A 2CH4W 1EWHA 1Y1VG 4IJLA 4A75A 1RF2D 5JJKA 3B6YA 2J7ZA 3E3XA 1CKNB 4F88A 1VQAA 3J80E 1A3VA 1A3TA 4NPSA 2JA8G 1STEA 2KENA 2EYPA 1TS2A 1X3EA 4G4KA 1IZ6A 5I4DA 3LWEA 1CQFA 3D31A 4MNOA 1TIID 3FHWA 1RHPA 4DR4L 3W3AA 4NMZA 2NVYH 2NVYB 3KDFB 2XWBB 4A3BH 2IHFA 1D5MC 1YI2A 2EY1A 4IUPA 1PH2A 3KF6B 4ZKBB 1G6ZA 1B8AA 2XTIA 1BVSA 2G9HD 3NSWA 2N78A 3S16B 3NELA 3A7LA 1EY5A 2IJ0A 4N9TA 4Q5VA 4LFCQ 4G7HC 1C4QA 1W2BA 5IP7H 4JI6Q 4GKJL 5C0XH 2NVQH 1XTCD 2EJMA 2UXCL 1SSOA 1I6HH 5GQOA 4UAIA 4GN3B 5J3BA 1EL0A 1SMYD 4OO1H 5ELNA 3HOXG 3J81j 3S14H 1AEXA 3HOVH 2HT1A 2KUMA 5IIFA 3LGJA 3H94A 2KHIA 3BYTB 1O7LA 2Z1CA 4ME3A 3K5LA 3AU7A 3BZCA 1V9PA 1KRSA 3MXNA 4DR7Q 3CD6A 5IGDA 1CQVA 3OOCA 5I2YA 4RMFA 1F2ZA 3KYHC 1J9OA 2JA5G 5M5XB 3H91A 2CQAA 1DGSA 2A74C 4R4TA 4GOPA 1D8LA 3D6WA 4OHJA 2C9OA 4A3DB 1HH2P 4C1NK 1YIJA 3NQTA 4H13C 3PIPA 1HQMC 2XSCA 3KLSA 4QUFA 1D5XC 3I4MG 5ELFA 1JCKB 1Q8IA 2D0OA 1IYJB 2WAQE 2RHSB 4LMQD 2OTJA 4L5SA 1P16A 1BCPB 2O4XA 3CC7A 2B8FA 3L7ZC 5IOCA 4A93G 2OXPA 1ENFA 3AFQA 3S2HH 1DZ1A 1GJXA 1F9QA 1VMCA 1HR0L 4DV3L 5JVH3 4DV0Q 3NTKA 1EQVA 2F03A 3VA5A 4JI8Q 2M9VA 5DNFA 1N32L 1NY4A 5IT9E 3TREA 2CW0C 1HFGA 1Q7YC 1XMQL 4K6LA 4IUUA 3I7FA 4JBMA 3CXCA 1LTLA 1RTNA 3EVQA 1KLUD 4ZYSA 2AQ2B 1AH9A 4KHVA 2R92H 2F0QA 3GP7A 4Q0FA
chains in the Genus database with same CATH topology
2NZOA 3RNUA 1O7IA 4IOAA 1EIFA 1YBYA 4OX9Q 4LFAQ 1S3OA 3CC2A 4XTCS 2OQKA 4JCVE 4GLVB 4OO1I 1V1QA 1WOCA 4B3MQ 4BBSH 3G48A 3E9IA 2HHHQ 1G51A 4X66L 3TS0A 4LF8L 3EBEA 4QIWE 3CCQA 1PH5A 4IFDG 4WJ4A 1JT8A 2Z6KA 3HKSA 1OTCA 1G291 5IY0A 3TEHB 3F1ZA 4PZ8A 4BBRG 1S40A 3GTMH 1KQSA 2F3IA 1FL0A 1VQ8A 2HIXA 1PV4A 1G6PA 1OXXK 1UEBA 5C0XJ 4R4CA 1BBWA 4AIMA 1P8LA 2CQOA 1U0LA 4APVA 3M85A 5IWAQ 4DR1Q 4AQYQ 1KIXA 1Q86C 3S16H 4KHPL 4LNQA 2UXDL 1E1TA 3STBC 1HNZQ 2PI2A 4JYAQ 1Y14B 1WI5A 4HIOA 1SE8A 3MEFA 3PGZA 4JI3L 1KRTA 3SGIA 4C3JH 1L1OA 4UP7A 4HIMA 4GOPC 3HKZG 3PUVA 1VQOA 2CKZB 3ULJA 2CCZA 1VQ6A 2C35B 4DUYL 1VQ7A 3J80i 3K7UC 2NVXH 5LMNW 2Q2HA 2PI2E 5IP9G 3PO3H 4JG2A 3U4VA 1KXLA 4UPAA 4BXXH 1I5FA 1TWGH 4P73A 4PMWA 2UUBL 1VQDA 2PQAA 4DV5L 4GLXA 4GNXC 1FGUA 3J81c 1I3QH 4ALPA 2BA0A 4IPCA 2F4VL 4JOIA 3S17H 2Z0SA 3NENA 3UDFA 3T1YL 2F52A 2IT1A 4QQBX 1N33L 2JE6I 1PH4A 4XIGS 2UUCL 2MQHA 3NBHB 1BBUA 4B3RQ 2VQEQ 1EUJA 2VUMG 4A3BG 1OXUA 2XGTA 3CCRA 2E2JH 1UE7A 3GO5A 3M9BA 1E1OA 3U4ZA 1XNRQ 1N34L 4QJFA 1SFOH 2JEBI 3CP0A 4K0KL 3KF8B 1IBLQ 3UDXA 4DR2L 4GN4B 5M5XH 3PIOA 4BA2I 1VQGA 2MNAA 3G4SA 3OTOQ 4YY3Q 1X54A 1Q82C 2OWOA 3TS2A 2UUAL 2CWAA 1QUQA 4A3KG 1YJWA 2K5HA 4UY8C 4YCWA 1M90C 4O2DA 4NXML 4A76A 2QGQA 4TQUS 2RHQB 2JEAI 1CSQA 4DR4Q 4A3DH 1AE3A 4DR6L 3L2PA 1Z47A 5HY6A 4JI2Q 1AE2A 4NB3A 1K73C 1K0RA 2K50A 3OYYA 3CCVA 1X3GA 1A62A 4LF5L 3Q8DA 4A3EG 5BR8Q 1SMXA 3H0GG 5FJ8G 5JEAJ 3HOVG 3K0XA 5LMUQ 1KAWA 1VCIA 2I5MX 2N49A 4IJHA 4A3LH 1KHIA 1PA6A 4TVAB 4JI5Q 4LF4Q 3FKIG 4B3TL 4PZ7A 4HJ7A 1EYGA 4JI1L 1Y1VH 1CSPA 2I5HA 5M3MH 2GVAA 5IYBH 2IX1A 4A3MH 5LMNL 4A3IH 5C44H 1JB7A 3ERSX 3CCEA 2N3SA 2Z6KC 2ZJPA 2UXCQ 3KF6A 2JA9A 5JJLA 3CPWA 1TWCH 1BKBA 3HKZE 4QL5A 1XJVA 1S72A 2GN5A 3ER0A 2N8NA 2JA8H 4J15A 5ELOA 3RLNA 1TWHH 1XMOQ 4JI4Q 3H15A 4A3GG 4R4QA 2AWNA 1GO3E 4UP8A 5M3FG 4GKKQ 1QZGA 1HNZL 1LM0A 4X62Q 2R93G 4Y52H 5JJIA 2AMCB 3PV0A 2MO1A 3AYHB 4H02A 4DV6Q 3KOJA 3RN2A 1Q1BA 4LFCL 4JI6L 2AKWB 2LSSA 4DPGA 2WFWA 3GD7A 2VL6A 3PUZA 4OONA 2K4KA 3T1HL 3H3VH 1PYSB 1EWIA 4JI0Q 1H95A 1VQ9A 1VQLA 1L1OC 4DV1Q 3MXNB 3HOWG 3CCLA 2YYZA 4JI7L 1NBWA 4X65Q 4BBRH 1FJGL 5C4XG 1IXRA 3GTOH 1JJCB 3K8AA 2YU9H 3GTGH 3BU2A 2VW9A 2JA6H 3HOUH 1VQ4A 3CQZH 2R6GA 1C9OA 4JBJA 3ULPA 2R7ZH 3J7A5 2Y0SG 1XPUA 1I94Q 1J5EQ 4DR5Q 1ASZA 1YNXA 1X55A 1TXYA 4DR7L 4L5QA 3STBD 1IBMQ 4JOIC 2ZJQA 1NE3A 4R4IA 3KFUA 4DV2L 3JC66 1VQKA 4HJ9A 4DV7L 5GAHC 1HNXL 1XNQL 2AHOB 5IYDH 2A1AA 4RG1A 1RIPA 1EOVA 2WB1E 2JA7H 3S2DH 3RLFA 1XNRL 5IYCH 4LUVA 1GVPA 4POFA 1SRUA 5H1SE 2YTVA 3I4NG 3PO2G 1MJCA 2K14A 4AYBG 4EX5A 2D62A 2VZAA 4X64Q 3GTLH 2B3GA 3K81C 4GN5A 4DAMA 2RF4A 3OW2A 5HGQA 3G71A 5M5WH 1XPOA 1A8VA 3HOXH 4DAYB 4JBKA 2K52A 4LFBQ 1EQQA 4LF7Q 1YEZA 4PZ6A 2WP8J 1X65A 1EFWA 3CCUA 3NEMA 2UXBL 4QY7A 3I2ZA 4IPGA 4BY7H 3RR5A 2YTYA 2ZM6Q 3K80C 2LXJA 4NXNQ 4C2MH 4DK3C 2ASBA 2R92G 2NN6I 1TWFH 4JBWA 1K8AC 4PG3A 3CC4A 4B3SQ 1MIUA 4A3CG 1VQ5A 2WAQG 4YHHL 1HZ9A 2JA5H 1HR0Q 1VQJA 2B29A 4LW1A 4DV3Q 4LF6Q 5M5YH 1JJGA 2CFMA 3BJUA 3JAMc 4DUZQ 1WCMH 5FLMH 4A3FH 1B70B 3A0JA 1SLJA 2ZTCA 1Q12A 4DV4L 2UU9L 3GTPH 2IX0A 1N32Q 1MKHA 3KLWA 2KCTA 1E3PA 2EQSA 1L0WA 4GS3A 5GADC 5C4JH 1XMQQ 3F8TA 2A8VA 1SN8A 4A4IA 1HNWQ 2VQFL 4DR3Q 3EIVA 3PUXA 5GROA 1J6QA 5C3EH 2IHEA 1IBKL 2IY5B 1PVOA 5E7NA 4JV5Q 3S24A 1PHJA 1NTGA 1YJ9A 4DV0L 1R9TH 4HIKA 4JI8L 1QVGA 1OXVA 4GKKL 2I5LX 4OWWB 3HFZB 3I4MH 4LF9L 2MFIA 3H0GH 5FJ8H 5K36G 3HOYG 3AFPA 2VS1A 4DK6C 4A3JH 1VQFA 1LYLA 4YWMA 3CMAA 4O0AA 5IP7G 4X66Q 5C0XG 4QGUA 5AJ3L 3IRBA 4LF8Q 1HZCA 2ALYB 3A5ZB 4C3IH 1Y1WH 4DKAC 1QZHA 1N36L 1KL9A 3H3VI 1VQHA 4IFDI 1CKMA 4A93H 3M4QA 3HOZH 3ULLA 2E8GA 1W3SA 4BXXG 2L15A 4OX9L 4LFAL 4OO1G 3W1GA 3S1MH 1K9MC 3A74A 1N9WA 4P72A 4IOCA 3PUWA 4B3ML 1K8GA 4LUZA 4DR5L 2HHHL 4BY1H 4A3GH 3U50C 5M3FH 2K5NA 2BH8A 2R93H 3I56A 3J7ZC 4KHPQ 2UXDQ 2KCMA 2QEXA 2FXQA 2K5VA 1WJJA 3S1QH 3UDGA 1Z9FA 1EQRA 1NMGA 4JI3Q 4GKJQ 3E9HA 3G6EA 1CUKA 2HIVA 3J80c 4DUYQ 1XTDA 3HOWH 2YV5A 4P71A 2CWPA 5IWAL 4DR1L 1OXTA 4IFDJ 4IPDA 4AQYL 3AQQA 1UWVA 1JJ2A 2GVBA 3UE1A 2UUBQ 3EN2A 4LWCA 3ZJYC 4DV5Q 3CCJA 2ID0A 4JYAL 2PMZE 2PQAB 2VY3A 2K75A 2F4VQ 1K3RA 1HZBA 1YHAA 4UP9A 3T1YQ 2BH2A 3ICEA 4A3DG 3CPFA 1N33Q 1LUZA 1RL2A 3CAMA 1PH7A 2UUCQ 3WWVA 1IL2A 2PNHA 3RN5A 1UE5A 1X3FA 1Q1EA 1FVIA 4YWKA 2OCEA 1GKHA 1WFQA 4HJAA 4L5RC 1N34Q 4YCUA 3I4NH 1VQBA 1VS0A 2DGYA 3PSIA 2OTLA 4K0KQ 1HZAA 2KBNA 3I55A 3D0FA 3J81i 4DR2Q 2I0QA 4A3LG 2Q2UA 2YTXA 2ATWA 1A0IA 4OWXB 5GAEC 1N8RC 1E24A 3KJOA 4KHZA 4IJLA 1T9HA 1Y1VG 1VQPA 4A75A 2UUAQ 5M3MG 2QA4A 4HJ5A 4A3MG 2VQEL 1QUQB 2JQOA 4GOPB 4A3IG 4NXMQ 4B3RL 5JJKA 1X6OA 1Q81C 3M7NA 3B6YA 5JEAG 2E2IH 4DR6Q 3GDEA 1A63A 2JJQA 1CKNB 2Q2IA 3FP9A 1VQAA 4R4OA 5IP9H 4NPSA 2JA8G 1IBLL 1E22A 4A3CH 2KENA 3PUYA 4LF5Q 1X3EA 5GAGC 3DLLA 1VQCA 3OTOL 4YY3L 1IZ6A 1KD1C 1M1KC 4GNXB 1PH3A 3UE0A 2EIFA 3D31A 3K7AH 4MNOA 2B63G 3FHWA 4DR4L 4B3TQ 1C0AA 2NVYH 1PH9A 3KDFB 2R7DA 4JI1Q 4JI2L 4X6AH 2LXKA 2VNUD 3F2CA 5LMNQ 5DLQE 2VUMH 3M4PA 4A3BH 2IHFA 1HJPA 1YI2A 4HJ8A 5BR8L 1NJIC 3PF4A 2JA6G 1PH2A 3KF6B 3HOUG 1VQIA 2R7ZG 3UDIA 1B8AA 5LMUL 2XTIA 1BVSA 4BBSG 1V43A 4IPHA 4AH6A 2N78A 4KI0A 1UE6A 3NELA 4JI5L 1JMCA 4LF4L 3HOYH 4A3KH 4L5TA 1E7ZA 1SR3A 1KC8C 4LFCQ 1K83H 2HQLA 1W2BA 5IP7H 4JI6Q 5IYDG 4GKJL 3VDYA 4YWLA 2NVQH 2JA7G 3T1HQ 1JE5A 2UXCL 5IYCG 2RCNA 4HIDA 3KJPA 3CW2C 3RZDH 3GTQH 4JI7Q 1FJGQ 1I6HH 5GQOA 1XMOL 4JI4L 1QVCA 4GN3B 5J3BA 1EIYB 2D0PA 4MTNA 4A3EH 1HR0W 5ELNA 4X62L 3HOXG 1PYBA 1SROA 3J81j 3S14H 1Q46A 4DV6L 5EAYA 2KHJA 3F2BA 3HOVH 1X56A 4P75A 3L0OA 2HT1A 3LGJA 2KHIA 4BY7G 4ME3A 3FKIH 4DR7Q 3BZCA 2Y0SE 1OXSC 1KRSA 1V9PA 1PH1A 4JI0L 4DV2Q 4DV1L 2ES2A 3CD6A 4DV7Q 1U5KA 1HNXQ 1XNQQ 4X65L 3CCMA 1YJNA 3PCOB 3RLOA 4RMFA 3PO3G 1YHQA 1PFSA 3E0EA 3KYHC 2JA5G 3S15H 2NVTH 1XPRA 4A3FG 1WCMG 5FLMG 4POGA 5IT9c 3TRZA 1I94L 1J5EL 1VQNA 1WYDA 3PF5A 3U58A 1NMFA 4GLAC 4AYBE 1DGSA 4R4TA 2WB1G 1IBML 1VQEA 1L2FA 1D8LA 3F2DA 4GOPA 1MJEA 4C3HH 4DNIA 2UXBQ 1HH2P 1CKNA 1YHBA 1YVCA 2V1CC 1YIJA 5C3EG 1L1OB 4JC0A 3M4OH 1GM5A 3CCSA 5C4XH 4X64L 5FLXc 3PIPA 2H5XA 4LUOA 4MZ9A 2E5LQ 2ZTDA 4GNXA 3I4MG 1B7YB 4YHHQ 1PH8A 3M3YH 1TWAH 2R7FA 4LFBL 2D0OA 3CMEA 3W5OA 1VQMA 4LF7L 2NZHA 4DV4Q 1IYJB 4A3JG 2WAQE 2UU9Q 2RHSB 2ZJRA 2OTJA 3KDFA 1P16A 1UE1A 1C7YA 4L5SA 2BA1A 3TQYA 3GTJH 2OQ0A 3CC7A 2ZM6L 1Y1WG 1PH6A 2NN6G 4EQ5A 1GD7A 2Q2TA 3S1NH 4NXNL 1YITA 1YZ6A 3L7ZC 4A93G 3HOZG 4B3SL 2A19A 3AFQA 3CF5A 4BA1I 2VQFQ 3S2HH 2EXDA 3A5UA 1IBKQ 3RZOH 2AWOA 5IE8A 1HR0L 3PO2H 4KLKA 4DV3L 4LF6L 2ZTEA 4DUZL 1Q8KA 2E5LL 4YCVA 3JAMi 4DV0Q 3GTKH 4WJ3M 4BY1G 2MO0A 4JI8Q 1N32L 1ASYA 1NY4A 1X9NA 4LF9Q 4OWTB 1D7QA 3AEVA 3TREA 3I4OA 4Y7NH 3S1RH 1CKOA 3DM3A 1Q7YC 2DUDA 4R1JA 1XMQL 4FDBA 2E2HH 2B63H 3I7FA 3W1BA 5IYBG 4JBMA 5AJ3Q 1HNWL 5C44G 1I50H 1LTLA 3CXCA 4DR3L 1QVFA 4IO9A 5C0XI 1N36Q 4OXPA 1AH9A 4P74A 2JK8A 4JV5L 2R92H 3BZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZO A;  3RNU A;  1O7I A;  4IOA A;  1EIF A;  1YBY A;  4OX9 Q;  4LFA Q;  1S3O A;  3CC2 A;  4XTC S;  2OQK A;  4JCV E;  4GLV B;  4OO1 I;  1V1Q A;  1WOC A;  4B3M Q;  4BBS H;  3G48 A;  3E9I A;  2HHH Q;  1G51 A;  4X66 L;  3TS0 A;  4LF8 L;  3EBE A;  4QIW E;  3CCQ A;  1PH5 A;  4IFD G;  4WJ4 A;  1JT8 A;  2Z6K A;  3HKS A;  1OTC A;  1G29 1;  5IY0 A;  3TEH B;  3F1Z A;  4PZ8 A;  4BBR G;  1S40 A;  3GTM H;  1KQS A;  2F3I A;  1FL0 A;  1VQ8 A;  2HIX A;  1PV4 A;  1G6P A;  1OXX K;  1UEB A;  5C0X J;  4R4C A;  1BBW A;  4AIM A;  1P8L A;  2CQO A;  1U0L A;  4APV A;  3M85 A;  5IWA Q;  4DR1 Q;  4AQY Q;  1KIX A;  1Q86 C;  3S16 H;  4KHP L;  4LNQ A;  2UXD L;  1E1T A;  3STB C;  1HNZ Q;  2PI2 A;  4JYA Q;  1Y14 B;  1WI5 A;  4HIO A;  1SE8 A;  3MEF A;  3PGZ A;  4JI3 L;  1KRT A;  3SGI A;  4C3J H;  1L1O A;  4UP7 A;  4HIM A;  4GOP C;  3HKZ G;  3PUV A;  1VQO A;  2CKZ B;  3ULJ A;  2CCZ A;  1VQ6 A;  2C35 B;  4DUY L;  1VQ7 A;  3J80 i;  3K7U C;  2NVX H;  5LMN W;  2Q2H A;  2PI2 E;  5IP9 G;  3PO3 H;  4JG2 A;  3U4V A;  1KXL A;  4UPA A;  4BXX H;  1I5F A;  1TWG H;  4P73 A;  4PMW A;  2UUB L;  1VQD A;  2PQA A;  4DV5 L;  4GLX A;  4GNX C;  1FGU A;  3J81 c;  1I3Q H;  4ALP A;  2BA0 A;  4IPC A;  2F4V L;  4JOI A;  3S17 H;  2Z0S A;  3NEN A;  3UDF A;  3T1Y L;  2F52 A;  2IT1 A;  4QQB X;  1N33 L;  2JE6 I;  1PH4 A;  4XIG S;  2UUC L;  2MQH A;  3NBH B;  1BBU A;  4B3R Q;  2VQE Q;  1EUJ A;  2VUM G;  4A3B G;  1OXU A;  2XGT A;  3CCR A;  2E2J H;  1UE7 A;  3GO5 A;  3M9B A;  1E1O A;  3U4Z A;  1XNR Q;  1N34 L;  4QJF A;  1SFO H;  2JEB I;  3CP0 A;  4K0K L;  3KF8 B;  1IBL Q;  3UDX A;  4DR2 L;  4GN4 B;  5M5X H;  3PIO A;  4BA2 I;  1VQG A;  2MNA A;  3G4S A;  3OTO Q;  4YY3 Q;  1X54 A;  1Q82 C;  2OWO A;  3TS2 A;  2UUA L;  2CWA A;  1QUQ A;  4A3K G;  1YJW A;  2K5H A;  4UY8 C;  4YCW A;  1M90 C;  4O2D A;  4NXM L;  4A76 A;  2QGQ A;  4TQU S;  2RHQ B;  2JEA I;  1CSQ A;  4DR4 Q;  4A3D H;  1AE3 A;  4DR6 L;  3L2P A;  1Z47 A;  5HY6 A;  4JI2 Q;  1AE2 A;  4NB3 A;  1K73 C;  1K0R A;  2K50 A;  3OYY A;  3CCV A;  1X3G A;  1A62 A;  4LF5 L;  3Q8D A;  4A3E G;  5BR8 Q;  1SMX A;  3H0G G;  5FJ8 G;  5JEA J;  3HOV G;  3K0X A;  5LMU Q;  1KAW A;  1VCI A;  2I5M X;  2N49 A;  4IJH A;  4A3L H;  1KHI A;  1PA6 A;  4TVA B;  4JI5 Q;  4LF4 Q;  3FKI G;  4B3T L;  4PZ7 A;  4HJ7 A;  1EYG A;  4JI1 L;  1Y1V H;  1CSP A;  2I5H A;  5M3M H;  2GVA A;  5IYB H;  2IX1 A;  4A3M H;  5LMN L;  4A3I H;  5C44 H;  1JB7 A;  3ERS X;  3CCE A;  2N3S A;  2Z6K C;  2ZJP A;  2UXC Q;  3KF6 A;  2JA9 A;  5JJL A;  3CPW A;  1TWC H;  1BKB A;  3HKZ E;  4QL5 A;  1XJV A;  1S72 A;  2GN5 A;  3ER0 A;  2N8N A;  2JA8 H;  4J15 A;  5ELO A;  3RLN A;  1TWH H;  1XMO Q;  4JI4 Q;  3H15 A;  4A3G G;  4R4Q A;  2AWN A;  1GO3 E;  4UP8 A;  5M3F G;  4GKK Q;  1QZG A;  1HNZ L;  1LM0 A;  4X62 Q;  2R93 G;  4Y52 H;  5JJI A;  2AMC B;  3PV0 A;  2MO1 A;  3AYH B;  4H02 A;  4DV6 Q;  3KOJ A;  3RN2 A;  1Q1B A;  4LFC L;  4JI6 L;  2AKW B;  2LSS A;  4DPG A;  2WFW A;  3GD7 A;  2VL6 A;  3PUZ A;  4OON A;  2K4K A;  3T1H L;  3H3V H;  1PYS B;  1EWI A;  4JI0 Q;  1H95 A;  1VQ9 A;  1VQL A;  1L1O C;  4DV1 Q;  3MXN B;  3HOW G;  3CCL A;  2YYZ A;  4JI7 L;  1NBW A;  4X65 Q;  4BBR H;  1FJG L;  5C4X G;  1IXR A;  3GTO H;  1JJC B;  3K8A A;  2YU9 H;  3GTG H;  3BU2 A;  2VW9 A;  2JA6 H;  3HOU H;  1VQ4 A;  3CQZ H;  2R6G A;  1C9O A;  4JBJ A;  3ULP A;  2R7Z H;  3J7A 5;  2Y0S G;  1XPU A;  1I94 Q;  1J5E Q;  4DR5 Q;  1ASZ A;  1YNX A;  1X55 A;  1TXY A;  4DR7 L;  4L5Q A;  3STB D;  1IBM Q;  4JOI C;  2ZJQ A;  1NE3 A;  4R4I A;  3KFU A;  4DV2 L;  3JC6 6;  1VQK A;  4HJ9 A;  4DV7 L;  5GAH C;  1HNX L;  1XNQ L;  2AHO B;  5IYD H;  2A1A A;  4RG1 A;  1RIP A;  1EOV A;  2WB1 E;  2JA7 H;  3S2D H;  3RLF A;  1XNR L;  5IYC H;  4LUV A;  1GVP A;  4POF A;  1SRU A;  5H1S E;  2YTV A;  3I4N G;  3PO2 G;  1MJC A;  2K14 A;  4AYB G;  4EX5 A;  2D62 A;  2VZA A;  4X64 Q;  3GTL H;  2B3G A;  3K81 C;  4GN5 A;  4DAM A;  2RF4 A;  3OW2 A;  5HGQ A;  3G71 A;  5M5W H;  1XPO A;  1A8V A;  3HOX H;  4DAY B;  4JBK A;  2K52 A;  4LFB Q;  1EQQ A;  4LF7 Q;  1YEZ A;  4PZ6 A;  2WP8 J;  1X65 A;  1EFW A;  3CCU A;  3NEM A;  2UXB L;  4QY7 A;  3I2Z A;  4IPG A;  4BY7 H;  3RR5 A;  2YTY A;  2ZM6 Q;  3K80 C;  2LXJ A;  4NXN Q;  4C2M H;  4DK3 C;  2ASB A;  2R92 G;  2NN6 I;  1TWF H;  4JBW A;  1K8A C;  4PG3 A;  3CC4 A;  4B3S Q;  1MIU A;  4A3C G;  1VQ5 A;  2WAQ G;  4YHH L;  1HZ9 A;  2JA5 H;  1HR0 Q;  1VQJ A;  2B29 A;  4LW1 A;  4DV3 Q;  4LF6 Q;  5M5Y H;  1JJG A;  2CFM A;  3BJU A;  3JAM c;  4DUZ Q;  1WCM H;  5FLM H;  4A3F H;  1B70 B;  3A0J A;  1SLJ A;  2ZTC A;  1Q12 A;  4DV4 L;  2UU9 L;  3GTP H;  2IX0 A;  1N32 Q;  1MKH A;  3KLW A;  2KCT A;  1E3P A;  2EQS A;  1L0W A;  4GS3 A;  5GAD C;  5C4J H;  1XMQ Q;  3F8T A;  2A8V A;  1SN8 A;  4A4I A;  1HNW Q;  2VQF L;  4DR3 Q;  3EIV A;  3PUX A;  5GRO A;  1J6Q A;  5C3E H;  2IHE A;  1IBK L;  2IY5 B;  1PVO A;  5E7N A;  4JV5 Q;  3S24 A;  1PHJ A;  1NTG A;  1YJ9 A;  4DV0 L;  1R9T H;  4HIK A;  4JI8 L;  1QVG A;  1OXV A;  4GKK L;  2I5L X;  4OWW B;  3HFZ B;  3I4M H;  4LF9 L;  2MFI A;  3H0G H;  5FJ8 H;  5K36 G;  3HOY G;  3AFP A;  2VS1 A;  4DK6 C;  4A3J H;  1VQF A;  1LYL A;  4YWM A;  3CMA A;  4O0A A;  5IP7 G;  4X66 Q;  5C0X G;  4QGU A;  5AJ3 L;  3IRB A;  4LF8 Q;  1HZC A;  2ALY B;  3A5Z B;  4C3I H;  1Y1W H;  4DKA C;  1QZH A;  1N36 L;  1KL9 A;  3H3V I;  1VQH A;  4IFD I;  1CKM A;  4A93 H;  3M4Q A;  3HOZ H;  3ULL A;  2E8G A;  1W3S A;  4BXX G;  2L15 A;  4OX9 L;  4LFA L;  4OO1 G;  3W1G A;  3S1M H;  1K9M C;  3A74 A;  1N9W A;  4P72 A;  4IOC A;  3PUW A;  4B3M L;  1K8G A;  4LUZ A;  4DR5 L;  2HHH L;  4BY1 H;  4A3G H;  3U50 C;  5M3F H;  2K5N A;  2BH8 A;  2R93 H;  3I56 A;  3J7Z C;  4KHP Q;  2UXD Q;  2KCM A;  2QEX A;  2FXQ A;  2K5V A;  1WJJ A;  3S1Q H;  3UDG A;  1Z9F A;  1EQR A;  1NMG A;  4JI3 Q;  4GKJ Q;  3E9H A;  3G6E A;  1CUK A;  2HIV A;  3J80 c;  4DUY Q;  1XTD A;  3HOW H;  2YV5 A;  4P71 A;  2CWP A;  5IWA L;  4DR1 L;  1OXT A;  4IFD J;  4IPD A;  4AQY L;  3AQQ A;  1UWV A;  1JJ2 A;  2GVB A;  3UE1 A;  2UUB Q;  3EN2 A;  4LWC A;  3ZJY C;  4DV5 Q;  3CCJ A;  2ID0 A;  4JYA L;  2PMZ E;  2PQA B;  2VY3 A;  2K75 A;  2F4V Q;  1K3R A;  1HZB A;  1YHA A;  4UP9 A;  3T1Y Q;  2BH2 A;  3ICE A;  4A3D G;  3CPF A;  1N33 Q;  1LUZ A;  1RL2 A;  3CAM A;  1PH7 A;  2UUC Q;  3WWV A;  1IL2 A;  2PNH A;  3RN5 A;  1UE5 A;  1X3F A;  1Q1E A;  1FVI A;  4YWK A;  2OCE A;  1GKH A;  1WFQ A;  4HJA A;  4L5R C;  1N34 Q;  4YCU A;  3I4N H;  1VQB A;  1VS0 A;  2DGY A;  3PSI A;  2OTL A;  4K0K Q;  1HZA A;  2KBN A;  3I55 A;  3D0F A;  3J81 i;  4DR2 Q;  2I0Q A;  4A3L G;  2Q2U A;  2YTX A;  2ATW A;  1A0I A;  4OWX B;  5GAE C;  1N8R C;  1E24 A;  3KJO A;  4KHZ A;  4IJL A;  1T9H A;  1Y1V G;  1VQP A;  4A75 A;  2UUA Q;  5M3M G;  2QA4 A;  4HJ5 A;  4A3M G;  2VQE L;  1QUQ B;  2JQO A;  4GOP B;  4A3I G;  4NXM Q;  4B3R L;  5JJK A;  1X6O A;  1Q81 C;  3M7N A;  3B6Y A;  5JEA G;  2E2I H;  4DR6 Q;  3GDE A;  1A63 A;  2JJQ A;  1CKN B;  2Q2I A;  3FP9 A;  1VQA A;  4R4O A;  5IP9 H;  4NPS A;  2JA8 G;  1IBL L;  1E22 A;  4A3C H;  2KEN A;  3PUY A;  4LF5 Q;  1X3E A;  5GAG C;  3DLL A;  1VQC A;  3OTO L;  4YY3 L;  1IZ6 A;  1KD1 C;  1M1K C;  4GNX B;  1PH3 A;  3UE0 A;  2EIF A;  3D31 A;  3K7A H;  4MNO A;  2B63 G;  3FHW A;  4DR4 L;  4B3T Q;  1C0A A;  2NVY H;  1PH9 A;  3KDF B;  2R7D A;  4JI1 Q;  4JI2 L;  4X6A H;  2LXK A;  2VNU D;  3F2C A;  5LMN Q;  5DLQ E;  2VUM H;  3M4P A;  4A3B H;  2IHF A;  1HJP A;  1YI2 A;  4HJ8 A;  5BR8 L;  1NJI C;  3PF4 A;  2JA6 G;  1PH2 A;  3KF6 B;  3HOU G;  1VQI A;  2R7Z G;  3UDI A;  1B8A A;  5LMU L;  2XTI A;  1BVS A;  4BBS G;  1V43 A;  4IPH A;  4AH6 A;  2N78 A;  4KI0 A;  1UE6 A;  3NEL A;  4JI5 L;  1JMC A;  4LF4 L;  3HOY H;  4A3K H;  4L5T A;  1E7Z A;  1SR3 A;  1KC8 C;  4LFC Q;  1K83 H;  2HQL A;  1W2B A;  5IP7 H;  4JI6 Q;  5IYD G;  4GKJ L;  3VDY A;  4YWL A;  2NVQ H;  2JA7 G;  3T1H Q;  1JE5 A;  2UXC L;  5IYC G;  2RCN A;  4HID A;  3KJP A;  3CW2 C;  3RZD H;  3GTQ H;  4JI7 Q;  1FJG Q;  1I6H H;  5GQO A;  1XMO L;  4JI4 L;  1QVC A;  4GN3 B;  5J3B A;  1EIY B;  2D0P A;  4MTN A;  4A3E H;  1HR0 W;  5ELN A;  4X62 L;  3HOX G;  1PYB A;  1SRO A;  3J81 j;  3S14 H;  1Q46 A;  4DV6 L;  5EAY A;  2KHJ A;  3F2B A;  3HOV H;  1X56 A;  4P75 A;  3L0O A;  2HT1 A;  3LGJ A;  2KHI A;  4BY7 G;  4ME3 A;  3FKI H;  4DR7 Q;  3BZC A;  2Y0S E;  1OXS C;  1KRS A;  1V9P A;  1PH1 A;  4JI0 L;  4DV2 Q;  4DV1 L;  2ES2 A;  3CD6 A;  4DV7 Q;  1U5K A;  1HNX Q;  1XNQ Q;  4X65 L;  3CCM A;  1YJN A;  3PCO B;  3RLO A;  4RMF A;  3PO3 G;  1YHQ A;  1PFS A;  3E0E A;  3KYH C;  2JA5 G;  3S15 H;  2NVT H;  1XPR A;  4A3F G;  1WCM G;  5FLM G;  4POG A;  5IT9 c;  3TRZ A;  1I94 L;  1J5E L;  1VQN A;  1WYD A;  3PF5 A;  3U58 A;  1NMF A;  4GLA C;  4AYB E;  1DGS A;  4R4T A;  2WB1 G;  1IBM L;  1VQE A;  1L2F A;  1D8L A;  3F2D A;  4GOP A;  1MJE A;  4C3H H;  4DNI A;  2UXB Q;  1HH2 P;  1CKN A;  1YHB A;  1YVC A;  2V1C C;  1YIJ A;  5C3E G;  1L1O B;  4JC0 A;  3M4O H;  1GM5 A;  3CCS A;  5C4X H;  4X64 L;  5FLX c;  3PIP A;  2H5X A;  4LUO A;  4MZ9 A;  2E5L Q;  2ZTD A;  4GNX A;  3I4M G;  1B7Y B;  4YHH Q;  1PH8 A;  3M3Y H;  1TWA H;  2R7F A;  4LFB L;  2D0O A;  3CME A;  3W5O A;  1VQM A;  4LF7 L;  2NZH A;  4DV4 Q;  1IYJ B;  4A3J G;  2WAQ E;  2UU9 Q;  2RHS B;  2ZJR A;  2OTJ A;  3KDF A;  1P16 A;  1UE1 A;  1C7Y A;  4L5S A;  2BA1 A;  3TQY A;  3GTJ H;  2OQ0 A;  3CC7 A;  2ZM6 L;  1Y1W G;  1PH6 A;  2NN6 G;  4EQ5 A;  1GD7 A;  2Q2T A;  3S1N H;  4NXN L;  1YIT A;  1YZ6 A;  3L7Z C;  4A93 G;  3HOZ G;  4B3S L;  2A19 A;  3AFQ A;  3CF5 A;  4BA1 I;  2VQF Q;  3S2H H;  2EXD A;  3A5U A;  1IBK Q;  3RZO H;  2AWO A;  5IE8 A;  1HR0 L;  3PO2 H;  4KLK A;  4DV3 L;  4LF6 L;  2ZTE A;  4DUZ L;  1Q8K A;  2E5L L;  4YCV A;  3JAM i;  4DV0 Q;  3GTK H;  4WJ3 M;  4BY1 G;  2MO0 A;  4JI8 Q;  1N32 L;  1ASY A;  1NY4 A;  1X9N A;  4LF9 Q;  4OWT B;  1D7Q A;  3AEV A;  3TRE A;  3I4O A;  4Y7N H;  3S1R H;  1CKO A;  3DM3 A;  1Q7Y C;  2DUD A;  4R1J A;  1XMQ L;  4FDB A;  2E2H H;  2B63 H;  3I7F A;  3W1B A;  5IYB G;  4JBM A;  5AJ3 Q;  1HNW L;  5C44 G;  1I50 H;  1LTL A;  3CXC A;  4DR3 L;  1QVF A;  4IO9 A;  5C0X I;  1N36 Q;  4OXP A;  1AH9 A;  4P74 A;  2JK8 A;  4JV5 L;  2R92 H;  3BZK A; 
#chains in the Genus database with same CATH topology
 1U9R A;  4IOA A;  2L4N A;  4OX9 Q;  4LFA Q;  2JA6 B;  3BVM A;  1EQT A;  3CC2 A;  4JCV E;  4GLV B;  1RDP D;  4BBS H;  4BBS B;  1B3A A;  2HHH Q;  4ME5 A;  2NWG A;  4X66 L;  3TS0 A;  4LF8 L;  2K33 A;  3D8G A;  3TZU A;  1OTC A;  5BN5 A;  3T16 A;  5IY0 A;  3TEH B;  3IFT A;  4PZ8 A;  4B08 A;  1HA5 A;  4DK1 A;  1TR5 A;  1PV4 A;  5ELE A;  4R4C A;  1BBW A;  2F0L A;  4AIM A;  1U0L A;  1F9S A;  4DR1 Q;  1KDC A;  1MSH A;  1E2V A;  5M5W B;  3STB C;  4M8A A;  4JYA Q;  1Y14 B;  4FXD A;  1SE8 A;  3MEF A;  1KRT A;  4FF4 A;  1VQO A;  1YNN C;  2C35 B;  1HQR D;  5IP9 G;  5HGT A;  3P75 A;  1KXL A;  2EYJ A;  4B9X A;  1CHP D;  3T13 A;  4PMW A;  1JOR A;  4XYQ A;  5KNC A;  2D2C C;  4GNX C;  1FGU A;  2BA0 A;  4IPC A;  2F4V L;  1KDB A;  3OIQ A;  2IT1 A;  1CM9 A;  2WB1 B;  4QQB X;  4EQP A;  1PH4 A;  2UUC L;  3NBH B;  1ENA A;  2V4D A;  1PZJ D;  3A8K E;  3CCR A;  2E2J H;  3K5O A;  3U4Z A;  1BDO A;  3K0Y A;  4HCS A;  1SFO H;  1R9T B;  1IBL Q;  1STY A;  4DR2 L;  4BA2 I;  3DEO A;  1Q82 C;  3AB9 A;  4CJ2 C;  1CHQ D;  2CWA A;  1ZXT A;  4A3K G;  4UY8 C;  4NXM L;  1CSQ A;  1HUM A;  1Y1W B;  1AE3 A;  4DR6 L;  3L2P A;  4KKS A;  2PZW A;  1JIC A;  3CCV A;  1HTL D;  4A3E G;  5BR8 Q;  5JEA J;  3K0X A;  1L0X B;  5LMU Q;  2I5M X;  2N55 A;  4JI1 L;  1Y1V H;  1Y1V B;  3TN2 A;  2Z4I A;  2ZJP A;  4KN7 C;  3KF6 A;  2JA9 A;  5ELB A;  1TWC H;  1XJV A;  2GN5 A;  3ER0 A;  2JA8 H;  4R8I A;  4JI4 Q;  4HN7 A;  4UP8 A;  4GKK Q;  1HNZ L;  1LM0 A;  2R93 G;  5JJI A;  4H02 A;  4HR7 B;  3KOJ A;  1SAP A;  4YIJ A;  2ICI A;  1O7Y A;  1B53 A;  4HAE A;  2NTT A;  3H3V H;  3ITP A;  1EWI A;  4JI0 Q;  2KVM A;  1VQ9 A;  1L1O C;  4BBR H;  4BBR B;  5C4X G;  1IXR A;  2A69 D;  3K8A A;  2I07 B;  4PMB A;  2RCF A;  3GTG H;  3GTG B;  1B3Q A;  1VQ4 A;  1C9O A;  1IW7 C;  5C3W A;  4JBJ A;  5CMD A;  5C4H A;  2Y0S G;  2E74 C;  1J5E Q;  4DR5 Q;  4C1N I;  1WTP A;  1X55 A;  1IBM Q;  5IOD A;  2A1A A;  3HKZ B;  1EOV A;  1HRJ A;  5I9P A;  3RLF A;  2ZT9 C;  1B50 A;  4LUV A;  1AN8 A;  2XN9 C;  3KF8 A;  2NZ1 D;  4DNR B;  4POF A;  3I4N G;  3PO2 G;  3GTL H;  1TU2 B;  2B3G A;  1SND A;  2OF1 A;  5HGQ A;  3G71 A;  1D6E C;  3T53 B;  3HOX H;  3K6O A;  1WTR A;  1SYE A;  1EQQ A;  3PIO 3;  4LF7 Q;  2B2W C;  4PZ6 A;  3ERQ A;  3I2Z A;  3RR5 A;  2EYM A;  2VUM B;  2NUC A;  1PMR A;  1K8A C;  4B3S Q;  3GV6 A;  1I4Q A;  5CV4 A;  4YHH L;  2EXZ A;  1TY2 A;  2JA5 H;  1VQJ A;  2JA5 B;  4LF6 Q;  1X3P A;  3JAM c;  3BJU A;  4DV4 L;  3GTP H;  4J8Q A;  1Q12 A;  2IX0 A;  3QR8 A;  5EBD A;  2WAC A;  1E3P A;  3CRL C;  3F8T A;  5I6W A;  1F9R A;  4A4I A;  1HNW Q;  4OIK A;  4U68 A;  5CV8 A;  4DR3 Q;  4U67 3;  3PUX A;  3MVV A;  2IHE A;  5E7N A;  1NTG A;  3CHB D;  3VYR A;  2K03 A;  1OXV A;  1V1O A;  4LF9 L;  3H0G H;  3H0G B;  3I4M H;  3I4M B;  2KED A;  3AFP A;  3J7A F;  5IP7 G;  5C0X G;  3IRB A;  2ALY B;  3A5Z B;  4DKA C;  1QZH A;  1N36 L;  4H0L C;  2LS0 1;  3W2D A;  4BWG B;  2RQX A;  4V0B A;  2SDF A;  3VYS A;  5T1I A;  4A93 H;  1SMY C;  2Q8I B;  4OO1 G;  3SK6 A;  3W1G A;  5JAV A;  3E5S A;  1WTX A;  2NVT B;  4FF2 A;  4P72 A;  3C3L A;  3DEP A;  1JOQ A;  4B3M L;  2H1E A;  4LUZ A;  3M7G A;  4B9W A;  2KCM A;  1BXT A;  4K6D A;  3A55 A;  2FFK B;  3S1Q H;  1LTB D;  1EQR A;  3U9O A;  4RKB A;  3E9H A;  2PCF B;  4PQX A;  3J80 c;  3HOW H;  3HOW B;  2YV5 A;  4P71 A;  1NR4 A;  1EY4 A;  3I72 A;  3HS0 C;  2GVB A;  3URY A;  3MAQ A;  3CCJ A;  2ID0 A;  1ICW A;  1YHA A;  4QUC A;  3T1Y Q;  4A3D G;  1N33 Q;  1UUP A;  1JWM D;  3CAM A;  3IKJ A;  1UE5 A;  1Q1E A;  1FVI A;  2L0C A;  3VYT A;  2PZT A;  2F0O A;  1GKH A;  5EBC A;  2F0H A;  5NUC A;  3PSI A;  3DWA A;  3GTK B;  4ILW A;  4CGY B;  1IKM A;  4CKE A;  2ATW A;  4OWX B;  1E24 A;  3KJO A;  2UUA Q;  3MC0 B;  5M3M G;  3OIP A;  2MJ8 A;  3A8J E;  4A3M G;  2VQE L;  1QUQ B;  2PO4 A;  4GOP B;  1I50 B;  2AUK A;  1PZI D;  1QNK A;  1A63 A;  2JJQ A;  4I7Z C;  4R4O A;  5IP9 H;  3MZ5 A;  1E22 A;  4A3C H;  3FVQ A;  2MUY A;  3PUY A;  4IUR A;  2WAQ B;  5GAG C;  4LF5 Q;  1Y69 U;  4YY3 L;  1KD1 C;  1M1K C;  4HSV A;  1PH3 A;  3UE0 A;  2EIF A;  3VYU A;  1SYB A;  3K7A H;  2WKD A;  2VNU D;  5LMN Q;  2K01 A;  3A56 A;  2EJF C;  3MXG A;  4JW0 A;  3C1E A;  4O1N A;  1WTO A;  2JA6 G;  1VQI A;  2F0N A;  4BBS G;  3QIA A;  4IAL A;  4JI5 L;  4LF4 L;  3HG9 A;  1JWS D;  5CBE E;  4A3K H;  3QJY A;  1LT4 D;  4C3J B;  5FLX L;  5IYD G;  1TS5 A;  4OEM B;  4YWL A;  1X32 A;  1CA6 A;  2NVX B;  1VMP A;  5IYC G;  1O78 A;  4HID A;  5FKA C;  1FJG Q;  5K5P A;  1TWG B;  1EIY B;  4A3E H;  2QDL A;  1DD2 A;  1PRT B;  2JP1 A;  4V19 0;  1I3Q B;  3I8Z A;  2KHJ A;  4P75 A;  1H9K A;  4H44 C;  1I4P A;  3R8B A;  4JK1 C;  3D4D A;  1O7Z A;  1UAP A;  3ND8 A;  1PH1 A;  4DV2 Q;  4DV1 L;  4MIU A;  1XNQ Q;  4XDX A;  1JB3 A;  3E0E A;  5KYI A;  1EZ6 A;  1XPR A;  5IT9 c;  1I94 L;  3E6Z X;  3JAM E;  1NMF A;  2WB1 G;  1JE4 A;  2BOS A;  3VR3 A;  3F2D A;  4C3H H;  4C3H B;  2LKV A;  4HSP A;  1YHB A;  4ZKC B;  4FXK C;  4JC0 A;  3M4O H;  3M4O B;  1GM5 A;  5CYU A;  2K05 A;  3SK4 A;  5C4X H;  5FLX c;  3OW7 A;  2H5X A;  1Q3L A;  2ZTD A;  4GNX A;  1JQY D;  4J1M A;  1LAC A;  4TKO B;  1TWA H;  1TWA B;  5A2Q L;  1XXG A;  4LFB L;  3CME A;  3W5O A;  4OGQ C;  2A6H D;  1PTO D;  1D1I A;  3F2U A;  4OL7 A;  3TQY A;  3GTJ H;  2OQ0 A;  4C3I G;  2ZM6 L;  1Y1W G;  3GTJ B;  3S1N H;  3S1N B;  1YZ6 A;  1TY0 A;  5LL6 S;  1OO9 B;  4IUQ A;  5BN3 A;  2VQF Q;  3A5U A;  2RSN A;  3RZO H;  1TS4 A;  3PO2 H;  1TWH B;  4DUZ L;  4WJ3 M;  1HFN A;  5LL6 X;  1ASY A;  4OWT B;  4K5W A;  3I4O A;  3S1R H;  3SK5 A;  3DM3 A;  1ET9 A;  1CZW A;  3W1B A;  1A2T A;  3MWY W;  1CTM A;  4IUT A;  3HRZ C;  4IO9 A;  5C0X I;  2RVL A;  2JK8 A;  2JN4 A;  3BZK A;  1E0B A;  3BG3 A;  2SOB A;  1SEB D;  1YBY A;  1BCP F;  4K2K A;  1S3O A;  3K5N A;  2OQK A;  4OO1 I;  2R7Z B;  1WTW A;  3E9I A;  1XX8 A;  4G7Z C;  4CKC A;  1ESR A;  1K28 A;  4QIW E;  4RH6 A;  2QDB A;  3HKS A;  1G29 1;  4L6T B;  4BBR G;  2A69 C;  4ZRZ A;  1OXX K;  1UEB A;  1P8L A;  3EJI A;  3M85 A;  5IWA Q;  1SNQ A;  4AQY Q;  3S16 H;  3X3N A;  3FDT A;  1K0S A;  2D9U A;  1HXY D;  4FVM A;  1WI5 A;  4NW2 A;  3SGI A;  1L1O A;  4BY7 B;  3HKZ G;  2CKZ B;  3CKI B;  4DUY L;  3K7U C;  5LMN W;  4PNY A;  3PO3 H;  3PO3 B;  1TWF B;  3U4V A;  5JVG 3;  4UPA A;  2DJF C;  4N8F A;  1Y8O B;  4I7A A;  4DAP A;  2UUB L;  1ILQ A;  1TKW B;  4DV5 L;  1WCM B;  2E2D C;  3S17 H;  3S17 B;  3NEN A;  3NE5 B;  3J7Y W;  5DEH A;  2ICE C;  1QOH A;  4QF4 A;  4XIG S;  5EJW A;  3I4L A;  1EUJ A;  2Z8L A;  2VUM G;  5M9O A;  3D4R A;  4FYD A;  1QG7 A;  4QJF A;  3KF8 B;  5M5X H;  1AZQ A;  1VQG A;  2MNA A;  3G4S A;  3R3O A;  5D65 A;  2B2W A;  1QUQ A;  1SBB B;  5D14 A;  3WDN A;  4YCW A;  4O2D A;  4TQU S;  2JEA I;  4DR4 Q;  4A3D H;  2TMP A;  2XRQ D;  2G5D A;  1U4M A;  1TS3 A;  2FJ2 A;  2LMC B;  2IWH A;  1GHJ A;  1K73 C;  3HOZ B;  2EE1 A;  3OMG A;  3OYY A;  4OIJ A;  1EEI D;  2DY7 A;  3NTH A;  5FO8 B;  3Q8D A;  3H0G G;  1FNV A;  4KKU A;  4XT1 B;  4FF3 A;  1KAW A;  3I90 A;  2N49 A;  5BN4 A;  2P5Z X;  4KN4 C;  1KHI A;  1T5X D;  4TVA B;  2IX3 A;  3FKI G;  4B3T L;  4PZ7 A;  1CSP A;  2I5H A;  3P1H A;  5M3M H;  5M3M B;  1R4P B;  5LHY 1;  4A3M H;  4A3M B;  4G7O C;  2B2T C;  3TZD A;  3CCE A;  3I70 A;  3RMH A;  2UXC Q;  3H6M A;  5JJL A;  3CPW A;  4QL5 A;  5FO7 B;  1S72 A;  1SYF A;  2MP1 A;  1GO3 E;  4Y52 H;  2AMC B;  3AYH B;  3L9A X;  3OHX C;  2A68 D;  5E4W C;  2LSS A;  4DPG A;  2VL6 A;  3T1H L;  2K4K A;  1QNU A;  1SYD A;  2Q8T A;  1H9R A;  3HOW G;  3CCL A;  5IGF A;  2YYZ A;  4JI7 L;  2O2L D;  2E75 C;  2YU9 H;  2YU9 B;  3BU2 A;  5FLX E;  2JA6 H;  2IW3 A;  2QKI C;  3CQZ H;  3CQZ B;  2WV6 D;  1FYC A;  2RDG A;  1KDA A;  3BVZ A;  4K8I A;  1XPU A;  1YNX A;  1HPC A;  1ESF A;  1TXY A;  4L5Q A;  3BVG A;  4JOI C;  3JC6 6;  1STB A;  5GAH C;  4DV7 L;  1HNX L;  2AHO B;  2KQ3 A;  2NTS A;  5IYD H;  2E2I B;  5IYC H;  3R2T A;  2JXM B;  1SRU A;  2AQ1 B;  3KK7 A;  5H1S E;  1MJC A;  2K14 A;  4EX5 A;  1KNE A;  1T5E A;  3OW2 A;  5M5W H;  1XPO A;  3AMU A;  3V05 A;  2K52 A;  1YEZ A;  2UXB L;  4KKT A;  3V2T A;  4IPG A;  2EYH A;  3MXP A;  3K80 C;  2A5H A;  2KA7 A;  4C2M H;  4DK3 C;  4C2M B;  4KMU C;  1IYV A;  4PG3 A;  4A3C G;  2AUJ D;  3QO2 A;  2WAQ G;  1HR0 Q;  2B29 A;  4DV3 Q;  5EGT A;  2CFM A;  2R3Z A;  1ASZ A;  2ZXO A;  2ZTC A;  1D1K A;  2UU9 L;  1ONL A;  1B9N A;  1I4X A;  4RFB A;  1N32 Q;  1NNX A;  3MFY A;  2KCT A;  2K6A A;  2TSS A;  1L0W A;  4GS3 A;  5GAD C;  1XMQ Q;  2PNR C;  1K83 B;  2JYO A;  1BF4 A;  2A8V A;  2NYZ D;  1H9M A;  1SN8 A;  2FMM A;  3I91 A;  5A2Q E;  1YNJ D;  1IBK L;  1V1P A;  1SJH D;  3GTQ B;  5C6A A;  4HMI A;  1PHJ A;  1YJ9 A;  1R9T H;  3EFX D;  4MHE A;  1QVG A;  4GKK L;  3BDC A;  3HFZ B;  3OMC A;  2MFI A;  5FJ8 H;  4RKL A;  2Q8R E;  1DXM A;  1VQF A;  4YWM A;  4C3J G;  5D3D A;  1CA5 A;  4X66 Q;  5AJ3 L;  4QGU A;  2QIL A;  4LF8 Q;  4C3I H;  4C3I B;  1Y1W H;  3KUP A;  1EY7 A;  4XQN A;  3H3V I;  2BE5 D;  1CKM A;  5C5M A;  1CFM A;  2DJG C;  1WD1 A;  3S15 B;  1K9M C;  3PUW A;  2EJG C;  4BS9 A;  4ZUI A;  4DR5 L;  1S4Z A;  1STH A;  2BH8 A;  4DU9 A;  3RD4 A;  3D3R A;  2QEX A;  2K5V A;  1WJJ A;  1QIL A;  1B44 D;  1M4V A;  2F0J A;  2F0U A;  3G6J B;  1S5F D;  4JPB W;  2HIV A;  2EY6 A;  2K32 A;  1GXD C;  5G3L D;  4KY7 A;  1OXT A;  2EPB A;  5DM7 3;  4IPD A;  3AQQ A;  1MSG A;  5DM6 3;  3ZJY C;  3I3C A;  2RBM A;  4F8M A;  2VY3 A;  2EZV A;  1BBX C;  2F4V Q;  4C3H G;  1NCV A;  3ICE A;  4NP5 A;  3CPF A;  4L8J A;  2L55 A;  1LUZ A;  1RL2 A;  1PH7 A;  1BCP D;  4RHR A;  2UUC Q;  3BDO A;  3BYY B;  2PNH A;  1X3F A;  1RCV D;  2OCE A;  1WFQ A;  3NWT A;  4L5R C;  3VR4 A;  1HZA A;  3I55 A;  2A6H C;  1PTO C;  3G7L A;  3J81 i;  4DR2 Q;  4KTA A;  2PPB C;  1NUC A;  4A3L G;  1G8Z D;  2YTX A;  2MHV A;  2X69 A;  2J4X A;  4WRD A;  4KHZ A;  3BZD B;  1VQP A;  2E2H B;  1BO0 A;  2QA4 A;  4HJ5 A;  4B3R L;  4DAV A;  4NXM Q;  2QEJ C;  1AP0 A;  3M7N A;  1E2W A;  4DR6 Q;  3FP9 A;  4RGM A;  1RJT A;  2DNE A;  3DLL A;  2XWJ B;  3OTO L;  1S5D D;  1VF5 C;  4RHS A;  4GNX B;  5EPJ A;  5FO9 B;  2K04 A;  4JI1 Q;  2R7D A;  4JI2 L;  1GUG A;  2LXK A;  1BUV T;  3F2C A;  5DLQ E;  2VUM H;  3GTM B;  4M1U B;  3SR1 A;  1NJI C;  3PF4 A;  1PFB A;  2FIN B;  5JJZ A;  4TSS A;  2CVR A;  2R7Z G;  1LO5 D;  5K36 H;  4ZCK A;  1JMC A;  3HOY H;  3HOY B;  1E7Z A;  1PZK D;  2WKC A;  3VDY A;  1EYC A;  2RCN A;  1R4Q B;  1K3B C;  3KJP A;  1WD0 A;  1KNA A;  1E2Z A;  3CW2 C;  2O5I C;  3K57 A;  1XMO L;  1QVC A;  1HR0 W;  4X62 L;  1SRO A;  3M4Y A;  1EIG A;  3TP6 A;  1Q46 A;  4DV6 L;  1BNZ A;  5EAY A;  2XNA C;  1X56 A;  2F0M A;  3L0O A;  3OSO A;  3DWQ A;  4BY7 G;  2F4I A;  3FKI B;  3FKI H;  1OXS C;  2HDL A;  1FNU A;  4X65 L;  1YJN A;  3PO3 G;  3RLO A;  1TQO A;  1PFS A;  5CV7 A;  1EY9 A;  2NVT H;  1WCM G;  5FLM G;  4POG A;  2E76 C;  1CK1 A;  4ID6 A;  1VQN A;  1EYD A;  1WYD A;  3PF5 A;  3U58 A;  4LJZ C;  4GLA C;  2N88 A;  4AYB E;  5D3I B;  3P20 A;  1VQE A;  1L2F A;  4CKB A;  4CDD C;  1YVC A;  2V1C C;  4ZK9 B;  3VR6 A;  1Q90 A;  4XQQ A;  1L1O B;  3DWP A;  1PRT F;  3A7A B;  4X64 L;  1STA A;  1F9P A;  3FPP A;  1B1Z A;  4LUO A;  4MZ9 A;  1B7Y B;  4YHH Q;  2M2L A;  1PH8 A;  3VA7 A;  2R7F A;  4PV1 C;  1PTO B;  2F0T A;  1LTR D;  2NZH A;  4DV4 Q;  3NQI A;  1ZEQ X;  5JPM C;  1RKN A;  5COR A;  1C7Y A;  3K58 A;  1PH6 A;  4NXN L;  1YIT A;  1H9S A;  3HOZ G;  1ROD A;  3NTI A;  3CF5 A;  1I4H A;  2EXD A;  1PFN A;  5IE8 A;  2ZTE A;  1Q8K A;  2E5L L;  2KCC A;  3GTK H;  2MO0 A;  2B2V C;  4LF9 Q;  1BR9 A;  3AEV A;  1D7Q A;  4RCN A;  4Y7N H;  4Y7N B;  1CKO A;  4R1J A;  1D2B A;  4FDB A;  1F2L A;  2B63 H;  2B63 B;  1I50 H;  2F0F A;  1QVF A;  3U9S A;  2L1B A;  1N36 Q;  4OXP A;  4P74 A;  5ISR A;  4JV5 L;  3GTO B;  2DN8 A;  3RNU A;  1O7I A;  3HOU B;  4XTC S;  1FD7 D;  3HP3 A;  1V1Q A;  1WOC A;  4B3M Q;  2A68 C;  5I6Y A;  1G51 A;  2O5J C;  2HUG A;  1DOK A;  3MEH A;  1JC7 A;  2B2T A;  1ENC A;  2K5D A;  3GQB A;  4IFD G;  4WJ4 A;  2VB2 X;  1JT8 A;  3DUZ A;  1GUO A;  2JA7 B;  3S2D B;  3F1Z A;  2IPK D;  4X3S A;  1KQS A;  1FL0 A;  1VQ8 A;  3EA6 A;  5C0X J;  5EKL A;  2CQO A;  4WJW A;  4XQJ A;  5J22 A;  2F0W A;  2I46 A;  4KV6 A;  1KIX A;  4KHP L;  3HGB A;  4ZQ3 A;  1E1T A;  2UXD L;  4HIO A;  3PGZ A;  4JI3 L;  4C3J H;  4UP7 A;  2EDG A;  2CCZ A;  3ULJ A;  1VQ6 A;  4K8J A;  1VQ7 A;  2NVX H;  2Q2H A;  3NUC A;  2KEC A;  4JG2 A;  1TVX A;  1IYU A;  2B2Y C;  1I5F A;  1TWG H;  5CR3 A;  1VQD A;  5M5Y B;  4NDX A;  3VR2 A;  4A3F B;  1I3Q H;  5IGC A;  1GOZ A;  4JOI A;  2Z0S A;  3UDF A;  2F52 A;  2Z9H A;  5C4J B;  2JE6 I;  1LT5 D;  1Z7T A;  2VQE Q;  4RAU C;  4DA2 A;  1AFP A;  1W6K A;  3M9B A;  5C3E B;  3K5M A;  1XNR Q;  1N34 L;  1S5E D;  4LK1 C;  3CP0 A;  4K0K L;  4GN4 B;  2Z6B A;  3PIO A;  1TT2 A;  4YY3 Q;  2K7V A;  2OWO A;  3TS2 A;  5F2D A;  1SJE D;  2L9H A;  4A3J B;  1PDQ A;  1YJW A;  1VDZ A;  2RHQ B;  1YNJ C;  1B9M A;  2NN6 H;  4K14 A;  5HY6 A;  3Q22 A;  2IL8 A;  4NB3 A;  2NB0 A;  1K0R A;  2F0V A;  2K50 A;  5JPN C;  1X3G A;  1A62 A;  4DXG A;  1SNO A;  1SMX A;  2B2U C;  4HED A;  5FJ8 G;  1WVL A;  2BCO A;  2OT2 A;  2HD3 A;  1HA6 A;  4BY1 B;  1Y8N B;  3MHB A;  4A3L H;  1KLG D;  4JI5 Q;  4LF4 Q;  1K8M A;  5IGG A;  2BE5 C;  2GVA A;  5IYB H;  1EZ8 A;  3NP8 A;  5C44 H;  5C44 B;  1JB7 A;  3DM1 A;  2Z6K C;  4HMJ A;  1BKB A;  3HKZ E;  4N9P A;  1V1P B;  1X3Q A;  4J15 A;  5ELO A;  1TWH H;  3H15 A;  4R4Q A;  4DFA A;  2RSO A;  1QZG A;  4H7B A;  3PV0 A;  1B4O A;  2MO1 A;  2PYK A;  5I2X A;  1EY6 A;  1Q1B A;  4LFC L;  4JI6 L;  3KLS X;  5ELD A;  3GD7 A;  3PUZ A;  4OON A;  1ZKO A;  1ZYR C;  1VQL A;  4DV1 Q;  1F2Y A;  3C2P A;  1NBW A;  2ENB A;  2QW7 A;  4EVO A;  1JJC B;  1VF7 A;  3Q23 A;  2R6G A;  2R7Z H;  1I94 Q;  3CU7 A;  5DAU A;  1S5B D;  4DR7 L;  1BCP C;  4R4I A;  4QCL A;  1A3U A;  4P2C B;  2D5D A;  1GVP A;  1EFI D;  1XYI A;  2YTV A;  3K81 C;  1D5Z C;  4DAM A;  2K1B A;  4N8X 1;  4LFB Q;  3E0J A;  2WP8 J;  3CCU A;  3NEM A;  4QY7 A;  4BY7 H;  1WTQ A;  1JWU D;  2ZM6 Q;  2LXJ A;  1DOM A;  1LTA D;  2ASB A;  4A3B B;  2F1M A;  3SDZ A;  3NK9 A;  1TWF H;  4JBW A;  3CC4 A;  2EY5 A;  2HQE A;  3PQI A;  4C56 C;  1WTH A;  1HZ9 A;  4LW1 A;  1JJG A;  4WOR A;  4DUZ Q;  5HUR A;  1WCM H;  5FLM H;  1B70 B;  3WOE A;  1SLJ A;  4CDE C;  3QOL A;  1MKH A;  3NPP A;  3KLW A;  1CI3 M;  2EQS A;  1MD2 D;  1MI2 A;  1H9J A;  2F3V A;  1UNS A;  2JSO A;  2NVQ B;  1ICF B;  1PLF A;  2F0D A;  3R93 A;  1EOT A;  4EQO A;  3EIV A;  4HTH A;  4ODG A;  1J6Q A;  1I6H B;  3S24 A;  4KJN A;  4DV0 L;  1A15 A;  4JI8 L;  1DON A;  5K36 G;  1SNM A;  3S14 B;  1PXU A;  3RUZ A;  3LWU A;  1QCB D;  3HOY G;  3HOV B;  1PRT D;  2VS1 A;  4DK6 C;  3N52 A;  3OWE B;  4O0A A;  2F3W A;  1HZC A;  1QB5 D;  2SNS A;  2DY8 A;  4IFD I;  2B8G A;  3HOZ H;  2E8G A;  4BXX G;  4OX9 L;  1LT6 D;  4LFA L;  5C4Z A;  2KJX A;  4IOC A;  4GZY C;  1K8G A;  2HHH L;  4A3G H;  4A3G B;  3EQL C;  3U50 C;  5M3F H;  5M3F B;  2HCI A;  2FXQ A;  3FPU B;  1EYA A;  2BDN A;  3UDG A;  1Z9F A;  3VR5 A;  1HCZ A;  4GKJ Q;  3G6E A;  2EYO A;  1CUK A;  1NR2 A;  5CBA E;  4DUY Q;  3TME A;  4CJ1 B;  1S5C D;  4ZUJ A;  2CWP A;  4DR1 L;  1B2T A;  4RCO A;  4RWS C;  1JJ2 A;  5KYL A;  4DAY A;  4DF7 A;  4K5X A;  2UUB Q;  4DV5 Q;  1BQQ T;  4JYA L;  1CZG A;  2PMZ E;  2PQA B;  2K75 A;  1Z6H A;  1HZB A;  3ND9 A;  4CHT B;  4RA8 A;  2G9D A;  3Q0A A;  2L11 A;  4IFD H;  3K59 A;  1U4P A;  3S2H B;  4FNF A;  3QOJ A;  4YWK A;  4HJA A;  1JR0 D;  1EU3 A;  4AYB B;  2DGY A;  3TDQ A;  2KBN A;  3SXH A;  3NXW A;  5AFW A;  1NAP A;  3KLR A;  4IUV A;  3LNN A;  5GAE C;  1N8R C;  1T9H A;  5E4X A;  4IN3 A;  1G2T A;  3FMC A;  2JQO A;  4A3I G;  2WIN B;  2ZXP A;  1X6O A;  1Q81 C;  5JEA G;  2E2I H;  3GDE A;  3TP7 A;  2Q2I A;  1SE3 A;  2R92 B;  1LT3 D;  4ZAI A;  1IBL L;  2XVS A;  1O80 A;  3SVM A;  3A8I E;  1VQC A;  3D6C A;  5EPK A;  4KD3 A;  5CV6 A;  2B63 G;  1G2S A;  5KRU A;  4B3T Q;  3H3V C;  1C0A A;  3TP8 A;  1PH9 A;  4X6A H;  1FNW A;  4K2L A;  1LV9 A;  3M4P A;  4MTK A;  1HJP A;  1C8C A;  1H9S B;  5A35 A;  4HJ8 A;  5BR8 L;  3C1F A;  3HOU G;  1MBY A;  2B2V A;  3UDI A;  5LMU L;  1V43 A;  1DJR D;  4IPH A;  4AH6 A;  4KI0 A;  2WII B;  1UE6 A;  3SHL A;  2M00 A;  3SK8 A;  5L37 A;  1MHW C;  4L5T A;  1SR3 A;  3MA2 B;  1KC8 C;  1K83 H;  2HQL A;  2KCN A;  2JA7 G;  3T1H Q;  1JE5 A;  2F0E A;  4QMG A;  5KGU A;  3RZD H;  1GUN A;  3RZD B;  4JI7 Q;  3GTQ H;  1FGB D;  4JI4 L;  2D0P A;  3OPO A;  4MTN A;  2EOT A;  1PYB A;  1GUW A;  3V96 A;  3F2B A;  2XIW A;  2SEB D;  4L63 B;  2Y0S E;  4JI0 L;  2ES2 A;  4DV7 Q;  1U5K A;  1HNX Q;  1UEA B;  3CCM A;  3PCO B;  2E2J B;  5IGE A;  1YHQ A;  4DK0 A;  3MXU A;  5TSS A;  1SFO B;  4ZLT F;  2EVB A;  3S15 H;  4A3F G;  3PMF A;  5KEE A;  3NHH A;  3S9W A;  3TRZ A;  1LTI D;  1J5E L;  2BDO A;  3FRP B;  3WOF A;  1IBM L;  2CHB D;  1MJE A;  4DNI A;  2RDH A;  2A6E D;  1K8O A;  2UXB Q;  1J8I A;  1CKN A;  1GUT A;  1ZYR D;  2J0T D;  5C3E G;  4J6H A;  4NKL A;  2B2Y A;  2OEO A;  1M8A A;  5FOB B;  3CCS A;  1SXT A;  2VXW A;  2F0I A;  1LTG D;  1WTV A;  3I73 A;  3M3Y H;  3M3Y B;  1G91 A;  3SE0 A;  1VQM A;  4LF7 L;  4UDU C;  4A3J G;  2UU9 Q;  2ZJR A;  3KDF A;  1UE1 A;  2BA1 A;  1SE4 A;  3ERO A;  2Q2T A;  2NN6 G;  4EQ5 A;  1GD7 A;  5CV9 A;  1ET6 A;  2F0K A;  2F0G A;  4B3S L;  2A19 A;  4BA1 I;  1IBK Q;  1TWC B;  2AWO A;  2JA8 B;  4KLK A;  4LF6 L;  3C46 A;  4YCV A;  3JAM i;  4KD4 A;  4BY1 G;  2F0S A;  1X9N A;  4CJ0 B;  2PW5 A;  1C48 A;  2DUD A;  2E2H H;  5IYB G;  2H4O A;  5AJ3 Q;  1HNW L;  5C44 G;  2MGS A;  2C5C A;  4DR3 L;  1PTO F;  3JAM L;  3BS1 A;  3J81 L;  2B2U A;  2NZO A;  1EIF A;  1HHV A;  4F87 A;  1XWE A;  2XRS D;  1II3 A;  2L12 A;  5EKK A;  3G48 A;  3FEW X;  2PQE A;  3EBE A;  3T51 B;  3CCQ A;  1A2U A;  1PH5 A;  2Z6K A;  1S40 A;  3GTM H;  2F3I A;  3X3M A;  2HIX A;  1SNC A;  1G6P A;  1QJO A;  3GTL B;  4APV A;  5ELC A;  3L3O C;  1Q86 C;  3HOX B;  4LNQ A;  1HNZ Q;  1U4L A;  2PI2 A;  1STG A;  5EPL A;  4HIM A;  4GOP C;  2X6G A;  1IKL A;  3PUV A;  3TBI B;  3J80 i;  2PI2 E;  2QF7 A;  4BXX H;  5E3F A;  4P73 A;  4IUN A;  4PMC A;  1A6X A;  5CGK A;  2PQA A;  4KY5 A;  4GLX A;  3GTP B;  1I4R A;  3QB3 A;  3J81 c;  4ALP A;  4QIW B;  4HCE A;  1F2M A;  3T1Y L;  3J80 L;  1U4R A;  3R2I A;  1N33 L;  1QWY A;  4RGT A;  2MQH A;  1BOS A;  1BBU A;  3KBG A;  3TP5 A;  4B3R Q;  1EU4 A;  4A3B G;  1OXU A;  2XGT A;  1UE7 A;  4DNT B;  3GO5 A;  1E1O A;  1IHZ A;  1RD9 D;  3T4A C;  1DYQ A;  2JEB I;  4X3U A;  5C3X A;  1LTT D;  3UDX A;  2F0P A;  3DMU A;  3MFG A;  4KJO A;  1EEF D;  3IFD A;  3OTO Q;  1CT1 D;  1X54 A;  1LLR D;  2UUA L;  2K5H A;  1M90 C;  1KAA A;  4A76 A;  2QGQ A;  4X3K A;  4RGO S;  3A54 A;  1Z47 A;  1HUN A;  4JI2 Q;  1SDF A;  1AE2 A;  4A93 B;  2DNC A;  4LF5 L;  4MN3 A;  4KK7 A;  2EYL A;  4R8N A;  1PRT C;  5CV5 A;  3HOV G;  1PTO H;  3OWF A;  1DM0 B;  1PYW D;  1VCI A;  4IJH A;  4KY6 A;  4OEL B;  1PA6 A;  1AZP A;  4HJ7 A;  1EYG A;  2CW0 D;  5J1Z A;  3S1Q B;  2IX1 A;  5LMN L;  4A3I H;  4A3I B;  5KND A;  3ERS X;  4I65 A;  2HDM A;  2N3S A;  5JEA H;  3MTS A;  2SNM A;  4WFN 3;  1NSN S;  2N8N A;  5C5L A;  1Y8P B;  3RLN A;  1XMO Q;  4A3G G;  3T56 B;  2AWN A;  5M3F G;  4X62 Q;  2EYF A;  5KIX A;  1PFM A;  3CRK C;  4DV6 Q;  3RN2 A;  4E6I A;  1EY8 A;  2AKW B;  2KEE A;  2WFW A;  3J7A V;  4TRD A;  1PYS B;  1H95 A;  2L5T A;  2GA4 B;  3MXN B;  1V8Q A;  1SE2 A;  1FJG L;  4X65 Q;  4FO2 A;  2HCC A;  5JOB A;  3DHQ A;  3GTO H;  1DCZ A;  4XXE A;  2VW9 A;  5IGB A;  4DXF A;  2K5W A;  4XYO A;  3HOU H;  3ULP A;  1FR3 A;  4EQN A;  3J7A 5;  1IL8 A;  4CDF C;  3IAY A;  2FMC A;  3NBH A;  3KFU A;  3STB D;  2ZJQ A;  1NE3 A;  1KTK A;  4DV2 L;  1SYG A;  4FP5 D;  1LTS D;  3H09 A;  4HJ9 A;  1VQK A;  1XNQ L;  4DN4 M;  4RG1 A;  1RIP A;  1STN A;  2LY7 A;  2WB1 E;  2JA7 H;  3S2D H;  1YNN D;  2X6L A;  4ULL A;  4Z9C B;  1XNR L;  5J39 A;  4X3T A;  4K5V A;  4O42 A;  4AYB G;  2D62 A;  2VZA A;  4X64 Q;  3N6R A;  4LAA A;  2PMZ B;  4GN5 A;  3O13 A;  5FK9 C;  2RF4 A;  1A8V A;  4DAY B;  4JBK A;  4CBV A;  5E1F A;  3K7A B;  4EGV A;  1EY0 A;  1X65 A;  1EFW A;  3QWN A;  1HTP A;  2YTY A;  5T1G A;  4NXN Q;  2R92 G;  5IT9 L;  2NN6 I;  1KAB A;  3GV3 A;  1QE6 A;  2KHS A;  1MIU A;  1VQ5 A;  2B39 A;  3ONA B;  4IQZ A;  3PIP 3;  5M5Y H;  2ZXR A;  2E5L Q;  3LX0 A;  4A3F H;  3A0J A;  4QB4 A;  3D4W A;  2LFN A;  1JOK A;  4S3S A;  5C4J H;  4A3K B;  3P7J A;  4JVZ A;  2NBF A;  3QG1 A;  4FF1 A;  5EKI A;  2VQF L;  5GRO A;  5C3E H;  2IY5 B;  4FXG C;  1PVO A;  5KNB A;  4JV5 Q;  2PW7 A;  4HIK A;  4A3E B;  2I5L X;  4OWW B;  1GUS A;  4A3J H;  1LYL A;  3CMA A;  1RTO A;  2RKS A;  1JOO A;  1I6V C;  1KL9 A;  1VQH A;  4UHV A;  3M4Q A;  1AW7 A;  3ULL A;  1W3S A;  2L15 A;  1LAB A;  3ZYY X;  2A73 B;  3S1M H;  3S1M B;  3A74 A;  1N9W A;  2R61 A;  4IZ8 A;  4BY1 H;  2VB3 X;  4RGN A;  1DOL A;  1MGS A;  2FHT A;  2K5N A;  2R93 B;  4R9W A;  2R93 H;  3I56 A;  3J7Z C;  4KHP Q;  3J81 E;  2UXD Q;  2K5Q A;  2QCP X;  3UI2 A;  3BDL A;  5I9O A;  2RA4 A;  1EWC A;  1NMG A;  4JI3 Q;  1SYC A;  2EY2 A;  3Q24 A;  2RDF A;  1XTD A;  3DXJ C;  1I4G A;  5C4X B;  2KOL A;  2AQ3 B;  5IWA L;  4IFD J;  4AQY L;  1UWV A;  4F7X A;  2MPM A;  4XT3 B;  3UE1 A;  3EN2 A;  4LWC A;  4CDC C;  4DGZ A;  1ILP A;  3NWS A;  1IW7 D;  2Y0S B;  2Z4H A;  2PZU A;  2A6E C;  1K3R A;  4UP9 A;  2BH2 A;  1ML0 D;  3HEJ A;  3HZX A;  3WWV A;  1IL2 A;  3RN5 A;  1F77 A;  5COY A;  5CC4 A;  3RZO B;  4G57 A;  1N34 Q;  4YCU A;  3I4N H;  1W6J A;  5EQ0 A;  1VQB A;  3I4N B;  3PO2 B;  1VS0 A;  3KBX A;  2OTL A;  3IL8 A;  3NBI A;  4K0K Q;  3D0F A;  3SEB A;  1GHK A;  2I0Q A;  2K28 A;  1L0Y B;  1EIH A;  5G3L F;  3Q6S A;  4ABN A;  2Q2U A;  1A0I A;  3TSS A;  3S1R B;  1SNP A;  2CH4 A;  2CH4 W;  1EWH A;  1Y1V G;  4IJL A;  4A75 A;  1RF2 D;  5JJK A;  3B6Y A;  2J7Z A;  3E3X A;  1CKN B;  4F88 A;  1VQA A;  3J80 E;  1A3V A;  1A3T A;  4NPS A;  2JA8 G;  1STE A;  2KEN A;  2EYP A;  1TS2 A;  1X3E A;  4G4K A;  1IZ6 A;  5I4D A;  3LWE A;  1CQF A;  3D31 A;  4MNO A;  1TII D;  3FHW A;  1RHP A;  4DR4 L;  3W3A A;  4NMZ A;  2NVY H;  2NVY B;  3KDF B;  2XWB B;  4A3B H;  2IHF A;  1D5M C;  1YI2 A;  2EY1 A;  4IUP A;  1PH2 A;  3KF6 B;  4ZKB B;  1G6Z A;  1B8A A;  2XTI A;  1BVS A;  2G9H D;  3NSW A;  2N78 A;  3S16 B;  3NEL A;  3A7L A;  1EY5 A;  2IJ0 A;  4N9T A;  4Q5V A;  4LFC Q;  4G7H C;  1C4Q A;  1W2B A;  5IP7 H;  4JI6 Q;  4GKJ L;  5C0X H;  2NVQ H;  1XTC D;  2EJM A;  2UXC L;  1SSO A;  1I6H H;  5GQO A;  4UAI A;  4GN3 B;  5J3B A;  1EL0 A;  1SMY D;  4OO1 H;  5ELN A;  3HOX G;  3J81 j;  3S14 H;  1AEX A;  3HOV H;  2HT1 A;  2KUM A;  5IIF A;  3LGJ A;  3H94 A;  2KHI A;  3BYT B;  1O7L A;  2Z1C A;  4ME3 A;  3K5L A;  3AU7 A;  3BZC A;  1V9P A;  1KRS A;  3MXN A;  4DR7 Q;  3CD6 A;  5IGD A;  1CQV A;  3OOC A;  5I2Y A;  4RMF A;  1F2Z A;  3KYH C;  1J9O A;  2JA5 G;  5M5X B;  3H91 A;  2CQA A;  1DGS A;  2A74 C;  4R4T A;  4GOP A;  1D8L A;  3D6W A;  4OHJ A;  2C9O A;  4A3D B;  1HH2 P;  4C1N K;  1YIJ A;  3NQT A;  4H13 C;  3PIP A;  1HQM C;  2XSC A;  3KLS A;  4QUF A;  1D5X C;  3I4M G;  5ELF A;  1JCK B;  1Q8I A;  2D0O A;  1IYJ B;  2WAQ E;  2RHS B;  4LMQ D;  2OTJ A;  4L5S A;  1P16 A;  1BCP B;  2O4X A;  3CC7 A;  2B8F A;  3L7Z C;  5IOC A;  4A93 G;  2OXP A;  1ENF A;  3AFQ A;  3S2H H;  1DZ1 A;  1GJX A;  1F9Q A;  1VMC A;  1HR0 L;  4DV3 L;  5JVH 3;  4DV0 Q;  3NTK A;  1EQV A;  2F03 A;  3VA5 A;  4JI8 Q;  2M9V A;  5DNF A;  1N32 L;  1NY4 A;  5IT9 E;  3TRE A;  2CW0 C;  1HFG A;  1Q7Y C;  1XMQ L;  4K6L A;  4IUU A;  3I7F A;  4JBM A;  3CXC A;  1LTL A;  1RTN A;  3EVQ A;  1KLU D;  4ZYS A;  2AQ2 B;  1AH9 A;  4KHV A;  2R92 H;  2F0Q A;  3GP7 A;  4Q0F A; 
#chains in the Genus database with same CATH homology
 2NZO A;  3RNU A;  1O7I A;  4IOA A;  1EIF A;  1YBY A;  4OX9 Q;  4LFA Q;  1S3O A;  3CC2 A;  4XTC S;  2OQK A;  4JCV E;  4GLV B;  4OO1 I;  1V1Q A;  1WOC A;  4B3M Q;  4BBS H;  3G48 A;  3E9I A;  2HHH Q;  1G51 A;  4X66 L;  3TS0 A;  4LF8 L;  3EBE A;  4QIW E;  3CCQ A;  1PH5 A;  4IFD G;  4WJ4 A;  1JT8 A;  2Z6K A;  3HKS A;  1OTC A;  1G29 1;  5IY0 A;  3TEH B;  3F1Z A;  4PZ8 A;  4BBR G;  1S40 A;  3GTM H;  1KQS A;  2F3I A;  1FL0 A;  1VQ8 A;  2HIX A;  1PV4 A;  1G6P A;  1OXX K;  1UEB A;  5C0X J;  4R4C A;  1BBW A;  4AIM A;  1P8L A;  2CQO A;  1U0L A;  4APV A;  3M85 A;  5IWA Q;  4DR1 Q;  4AQY Q;  1KIX A;  1Q86 C;  3S16 H;  4KHP L;  4LNQ A;  2UXD L;  1E1T A;  3STB C;  1HNZ Q;  2PI2 A;  4JYA Q;  1Y14 B;  1WI5 A;  4HIO A;  1SE8 A;  3MEF A;  3PGZ A;  4JI3 L;  1KRT A;  3SGI A;  4C3J H;  1L1O A;  4UP7 A;  4HIM A;  4GOP C;  3HKZ G;  3PUV A;  1VQO A;  2CKZ B;  3ULJ A;  2CCZ A;  1VQ6 A;  2C35 B;  4DUY L;  1VQ7 A;  3J80 i;  3K7U C;  2NVX H;  5LMN W;  2Q2H A;  2PI2 E;  5IP9 G;  3PO3 H;  4JG2 A;  3U4V A;  1KXL A;  4UPA A;  4BXX H;  1I5F A;  1TWG H;  4P73 A;  4PMW A;  2UUB L;  1VQD A;  2PQA A;  4DV5 L;  4GLX A;  4GNX C;  1FGU A;  3J81 c;  1I3Q H;  4ALP A;  2BA0 A;  4IPC A;  2F4V L;  4JOI A;  3S17 H;  2Z0S A;  3NEN A;  3UDF A;  3T1Y L;  2F52 A;  2IT1 A;  4QQB X;  1N33 L;  2JE6 I;  1PH4 A;  4XIG S;  2UUC L;  2MQH A;  3NBH B;  1BBU A;  4B3R Q;  2VQE Q;  1EUJ A;  2VUM G;  4A3B G;  1OXU A;  2XGT A;  3CCR A;  2E2J H;  1UE7 A;  3GO5 A;  3M9B A;  1E1O A;  3U4Z A;  1XNR Q;  1N34 L;  4QJF A;  1SFO H;  2JEB I;  3CP0 A;  4K0K L;  3KF8 B;  1IBL Q;  3UDX A;  4DR2 L;  4GN4 B;  5M5X H;  3PIO A;  4BA2 I;  1VQG A;  2MNA A;  3G4S A;  3OTO Q;  4YY3 Q;  1X54 A;  1Q82 C;  2OWO A;  3TS2 A;  2UUA L;  2CWA A;  1QUQ A;  4A3K G;  1YJW A;  2K5H A;  4UY8 C;  4YCW A;  1M90 C;  4O2D A;  4NXM L;  4A76 A;  2QGQ A;  4TQU S;  2RHQ B;  2JEA I;  1CSQ A;  4DR4 Q;  4A3D H;  1AE3 A;  4DR6 L;  3L2P A;  1Z47 A;  5HY6 A;  4JI2 Q;  1AE2 A;  4NB3 A;  1K73 C;  1K0R A;  2K50 A;  3OYY A;  3CCV A;  1X3G A;  1A62 A;  4LF5 L;  3Q8D A;  4A3E G;  5BR8 Q;  1SMX A;  3H0G G;  5FJ8 G;  5JEA J;  3HOV G;  3K0X A;  5LMU Q;  1KAW A;  1VCI A;  2I5M X;  2N49 A;  4IJH A;  4A3L H;  1KHI A;  1PA6 A;  4TVA B;  4JI5 Q;  4LF4 Q;  3FKI G;  4B3T L;  4PZ7 A;  4HJ7 A;  1EYG A;  4JI1 L;  1Y1V H;  1CSP A;  2I5H A;  5M3M H;  2GVA A;  5IYB H;  2IX1 A;  4A3M H;  5LMN L;  4A3I H;  5C44 H;  1JB7 A;  3ERS X;  3CCE A;  2N3S A;  2Z6K C;  2ZJP A;  2UXC Q;  3KF6 A;  2JA9 A;  5JJL A;  3CPW A;  1TWC H;  1BKB A;  3HKZ E;  4QL5 A;  1XJV A;  1S72 A;  2GN5 A;  3ER0 A;  2N8N A;  2JA8 H;  4J15 A;  5ELO A;  3RLN A;  1TWH H;  1XMO Q;  4JI4 Q;  3H15 A;  4A3G G;  4R4Q A;  2AWN A;  1GO3 E;  4UP8 A;  5M3F G;  4GKK Q;  1QZG A;  1HNZ L;  1LM0 A;  4X62 Q;  2R93 G;  4Y52 H;  5JJI A;  2AMC B;  3PV0 A;  2MO1 A;  3AYH B;  4H02 A;  4DV6 Q;  3KOJ A;  3RN2 A;  1Q1B A;  4LFC L;  4JI6 L;  2AKW B;  2LSS A;  4DPG A;  2WFW A;  3GD7 A;  2VL6 A;  3PUZ A;  4OON A;  2K4K A;  3T1H L;  3H3V H;  1PYS B;  1EWI A;  4JI0 Q;  1H95 A;  1VQ9 A;  1VQL A;  1L1O C;  4DV1 Q;  3MXN B;  3HOW G;  3CCL A;  2YYZ A;  4JI7 L;  1NBW A;  4X65 Q;  4BBR H;  1FJG L;  5C4X G;  1IXR A;  3GTO H;  1JJC B;  3K8A A;  2YU9 H;  3GTG H;  3BU2 A;  2VW9 A;  2JA6 H;  3HOU H;  1VQ4 A;  3CQZ H;  2R6G A;  1C9O A;  4JBJ A;  3ULP A;  2R7Z H;  3J7A 5;  2Y0S G;  1XPU A;  1I94 Q;  1J5E Q;  4DR5 Q;  1ASZ A;  1YNX A;  1X55 A;  1TXY A;  4DR7 L;  4L5Q A;  3STB D;  1IBM Q;  4JOI C;  2ZJQ A;  1NE3 A;  4R4I A;  3KFU A;  4DV2 L;  3JC6 6;  1VQK A;  4HJ9 A;  4DV7 L;  5GAH C;  1HNX L;  1XNQ L;  2AHO B;  5IYD H;  2A1A A;  4RG1 A;  1RIP A;  1EOV A;  2WB1 E;  2JA7 H;  3S2D H;  3RLF A;  1XNR L;  5IYC H;  4LUV A;  1GVP A;  4POF A;  1SRU A;  5H1S E;  2YTV A;  3I4N G;  3PO2 G;  1MJC A;  2K14 A;  4AYB G;  4EX5 A;  2D62 A;  2VZA A;  4X64 Q;  3GTL H;  2B3G A;  3K81 C;  4GN5 A;  4DAM A;  2RF4 A;  3OW2 A;  5HGQ A;  3G71 A;  5M5W H;  1XPO A;  1A8V A;  3HOX H;  4DAY B;  4JBK A;  2K52 A;  4LFB Q;  1EQQ A;  4LF7 Q;  1YEZ A;  4PZ6 A;  2WP8 J;  1X65 A;  1EFW A;  3CCU A;  3NEM A;  2UXB L;  4QY7 A;  3I2Z A;  4IPG A;  4BY7 H;  3RR5 A;  2YTY A;  2ZM6 Q;  3K80 C;  2LXJ A;  4NXN Q;  4C2M H;  4DK3 C;  2ASB A;  2R92 G;  2NN6 I;  1TWF H;  4JBW A;  1K8A C;  4PG3 A;  3CC4 A;  4B3S Q;  1MIU A;  4A3C G;  1VQ5 A;  2WAQ G;  4YHH L;  1HZ9 A;  2JA5 H;  1HR0 Q;  1VQJ A;  2B29 A;  4LW1 A;  4DV3 Q;  4LF6 Q;  5M5Y H;  1JJG A;  2CFM A;  3BJU A;  3JAM c;  4DUZ Q;  1WCM H;  5FLM H;  4A3F H;  1B70 B;  3A0J A;  1SLJ A;  2ZTC A;  1Q12 A;  4DV4 L;  2UU9 L;  3GTP H;  2IX0 A;  1N32 Q;  1MKH A;  3KLW A;  2KCT A;  1E3P A;  2EQS A;  1L0W A;  4GS3 A;  5GAD C;  5C4J H;  1XMQ Q;  3F8T A;  2A8V A;  1SN8 A;  4A4I A;  1HNW Q;  2VQF L;  4DR3 Q;  3EIV A;  3PUX A;  5GRO A;  1J6Q A;  5C3E H;  2IHE A;  1IBK L;  2IY5 B;  1PVO A;  5E7N A;  4JV5 Q;  3S24 A;  1PHJ A;  1NTG A;  1YJ9 A;  4DV0 L;  1R9T H;  4HIK A;  4JI8 L;  1QVG A;  1OXV A;  4GKK L;  2I5L X;  4OWW B;  3HFZ B;  3I4M H;  4LF9 L;  2MFI A;  3H0G H;  5FJ8 H;  5K36 G;  3HOY G;  3AFP A;  2VS1 A;  4DK6 C;  4A3J H;  1VQF A;  1LYL A;  4YWM A;  3CMA A;  4O0A A;  5IP7 G;  4X66 Q;  5C0X G;  4QGU A;  5AJ3 L;  3IRB A;  4LF8 Q;  1HZC A;  2ALY B;  3A5Z B;  4C3I H;  1Y1W H;  4DKA C;  1QZH A;  1N36 L;  1KL9 A;  3H3V I;  1VQH A;  4IFD I;  1CKM A;  4A93 H;  3M4Q A;  3HOZ H;  3ULL A;  2E8G A;  1W3S A;  4BXX G;  2L15 A;  4OX9 L;  4LFA L;  4OO1 G;  3W1G A;  3S1M H;  1K9M C;  3A74 A;  1N9W A;  4P72 A;  4IOC A;  3PUW A;  4B3M L;  1K8G A;  4LUZ A;  4DR5 L;  2HHH L;  4BY1 H;  4A3G H;  3U50 C;  5M3F H;  2K5N A;  2BH8 A;  2R93 H;  3I56 A;  3J7Z C;  4KHP Q;  2UXD Q;  2KCM A;  2QEX A;  2FXQ A;  2K5V A;  1WJJ A;  3S1Q H;  3UDG A;  1Z9F A;  1EQR A;  1NMG A;  4JI3 Q;  4GKJ Q;  3E9H A;  3G6E A;  1CUK A;  2HIV A;  3J80 c;  4DUY Q;  1XTD A;  3HOW H;  2YV5 A;  4P71 A;  2CWP A;  5IWA L;  4DR1 L;  1OXT A;  4IFD J;  4IPD A;  4AQY L;  3AQQ A;  1UWV A;  1JJ2 A;  2GVB A;  3UE1 A;  2UUB Q;  3EN2 A;  4LWC A;  3ZJY C;  4DV5 Q;  3CCJ A;  2ID0 A;  4JYA L;  2PMZ E;  2PQA B;  2VY3 A;  2K75 A;  2F4V Q;  1K3R A;  1HZB A;  1YHA A;  4UP9 A;  3T1Y Q;  2BH2 A;  3ICE A;  4A3D G;  3CPF A;  1N33 Q;  1LUZ A;  1RL2 A;  3CAM A;  1PH7 A;  2UUC Q;  3WWV A;  1IL2 A;  2PNH A;  3RN5 A;  1UE5 A;  1X3F A;  1Q1E A;  1FVI A;  4YWK A;  2OCE A;  1GKH A;  1WFQ A;  4HJA A;  4L5R C;  1N34 Q;  4YCU A;  3I4N H;  1VQB A;  1VS0 A;  2DGY A;  3PSI A;  2OTL A;  4K0K Q;  1HZA A;  2KBN A;  3I55 A;  3D0F A;  3J81 i;  4DR2 Q;  2I0Q A;  4A3L G;  2Q2U A;  2YTX A;  2ATW A;  1A0I A;  4OWX B;  5GAE C;  1N8R C;  1E24 A;  3KJO A;  4KHZ A;  4IJL A;  1T9H A;  1Y1V G;  1VQP A;  4A75 A;  2UUA Q;  5M3M G;  2QA4 A;  4HJ5 A;  4A3M G;  2VQE L;  1QUQ B;  2JQO A;  4GOP B;  4A3I G;  4NXM Q;  4B3R L;  5JJK A;  1X6O A;  1Q81 C;  3M7N A;  3B6Y A;  5JEA G;  2E2I H;  4DR6 Q;  3GDE A;  1A63 A;  2JJQ A;  1CKN B;  2Q2I A;  3FP9 A;  1VQA A;  4R4O A;  5IP9 H;  4NPS A;  2JA8 G;  1IBL L;  1E22 A;  4A3C H;  2KEN A;  3PUY A;  4LF5 Q;  1X3E A;  5GAG C;  3DLL A;  1VQC A;  3OTO L;  4YY3 L;  1IZ6 A;  1KD1 C;  1M1K C;  4GNX B;  1PH3 A;  3UE0 A;  2EIF A;  3D31 A;  3K7A H;  4MNO A;  2B63 G;  3FHW A;  4DR4 L;  4B3T Q;  1C0A A;  2NVY H;  1PH9 A;  3KDF B;  2R7D A;  4JI1 Q;  4JI2 L;  4X6A H;  2LXK A;  2VNU D;  3F2C A;  5LMN Q;  5DLQ E;  2VUM H;  3M4P A;  4A3B H;  2IHF A;  1HJP A;  1YI2 A;  4HJ8 A;  5BR8 L;  1NJI C;  3PF4 A;  2JA6 G;  1PH2 A;  3KF6 B;  3HOU G;  1VQI A;  2R7Z G;  3UDI A;  1B8A A;  5LMU L;  2XTI A;  1BVS A;  4BBS G;  1V43 A;  4IPH A;  4AH6 A;  2N78 A;  4KI0 A;  1UE6 A;  3NEL A;  4JI5 L;  1JMC A;  4LF4 L;  3HOY H;  4A3K H;  4L5T A;  1E7Z A;  1SR3 A;  1KC8 C;  4LFC Q;  1K83 H;  2HQL A;  1W2B A;  5IP7 H;  4JI6 Q;  5IYD G;  4GKJ L;  3VDY A;  4YWL A;  2NVQ H;  2JA7 G;  3T1H Q;  1JE5 A;  2UXC L;  5IYC G;  2RCN A;  4HID A;  3KJP A;  3CW2 C;  3RZD H;  3GTQ H;  4JI7 Q;  1FJG Q;  1I6H H;  5GQO A;  1XMO L;  4JI4 L;  1QVC A;  4GN3 B;  5J3B A;  1EIY B;  2D0P A;  4MTN A;  4A3E H;  1HR0 W;  5ELN A;  4X62 L;  3HOX G;  1PYB A;  1SRO A;  3J81 j;  3S14 H;  1Q46 A;  4DV6 L;  5EAY A;  2KHJ A;  3F2B A;  3HOV H;  1X56 A;  4P75 A;  3L0O A;  2HT1 A;  3LGJ A;  2KHI A;  4BY7 G;  4ME3 A;  3FKI H;  4DR7 Q;  3BZC A;  2Y0S E;  1OXS C;  1KRS A;  1V9P A;  1PH1 A;  4JI0 L;  4DV2 Q;  4DV1 L;  2ES2 A;  3CD6 A;  4DV7 Q;  1U5K A;  1HNX Q;  1XNQ Q;  4X65 L;  3CCM A;  1YJN A;  3PCO B;  3RLO A;  4RMF A;  3PO3 G;  1YHQ A;  1PFS A;  3E0E A;  3KYH C;  2JA5 G;  3S15 H;  2NVT H;  1XPR A;  4A3F G;  1WCM G;  5FLM G;  4POG A;  5IT9 c;  3TRZ A;  1I94 L;  1J5E L;  1VQN A;  1WYD A;  3PF5 A;  3U58 A;  1NMF A;  4GLA C;  4AYB E;  1DGS A;  4R4T A;  2WB1 G;  1IBM L;  1VQE A;  1L2F A;  1D8L A;  3F2D A;  4GOP A;  1MJE A;  4C3H H;  4DNI A;  2UXB Q;  1HH2 P;  1CKN A;  1YHB A;  1YVC A;  2V1C C;  1YIJ A;  5C3E G;  1L1O B;  4JC0 A;  3M4O H;  1GM5 A;  3CCS A;  5C4X H;  4X64 L;  5FLX c;  3PIP A;  2H5X A;  4LUO A;  4MZ9 A;  2E5L Q;  2ZTD A;  4GNX A;  3I4M G;  1B7Y B;  4YHH Q;  1PH8 A;  3M3Y H;  1TWA H;  2R7F A;  4LFB L;  2D0O A;  3CME A;  3W5O A;  1VQM A;  4LF7 L;  2NZH A;  4DV4 Q;  1IYJ B;  4A3J G;  2WAQ E;  2UU9 Q;  2RHS B;  2ZJR A;  2OTJ A;  3KDF A;  1P16 A;  1UE1 A;  1C7Y A;  4L5S A;  2BA1 A;  3TQY A;  3GTJ H;  2OQ0 A;  3CC7 A;  2ZM6 L;  1Y1W G;  1PH6 A;  2NN6 G;  4EQ5 A;  1GD7 A;  2Q2T A;  3S1N H;  4NXN L;  1YIT A;  1YZ6 A;  3L7Z C;  4A93 G;  3HOZ G;  4B3S L;  2A19 A;  3AFQ A;  3CF5 A;  4BA1 I;  2VQF Q;  3S2H H;  2EXD A;  3A5U A;  1IBK Q;  3RZO H;  2AWO A;  5IE8 A;  1HR0 L;  3PO2 H;  4KLK A;  4DV3 L;  4LF6 L;  2ZTE A;  4DUZ L;  1Q8K A;  2E5L L;  4YCV A;  3JAM i;  4DV0 Q;  3GTK H;  4WJ3 M;  4BY1 G;  2MO0 A;  4JI8 Q;  1N32 L;  1ASY A;  1NY4 A;  1X9N A;  4LF9 Q;  4OWT B;  1D7Q A;  3AEV A;  3TRE A;  3I4O A;  4Y7N H;  3S1R H;  1CKO A;  3DM3 A;  1Q7Y C;  2DUD A;  4R1J A;  1XMQ L;  4FDB A;  2E2H H;  2B63 H;  3I7F A;  3W1B A;  5IYB G;  4JBM A;  5AJ3 Q;  1HNW L;  5C44 G;  1I50 H;  1LTL A;  3CXC A;  4DR3 L;  1QVF A;  4IO9 A;  5C0X I;  1N36 Q;  4OXP A;  1AH9 A;  4P74 A;  2JK8 A;  4JV5 L;  2R92 H;  3BZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...