4O0AA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4o0aA00
2NZOA 3FKIG 2H5XA 3IRBA 1KRTA 4YWKA 3KF8B 4GKKQ 4LFBL 5C3EH 4TQUS 4B3TL 2VNUD 2RHSB 2N8NA 3A5UA 2HQLA 3M85A 1HR0W 5M3MH 2KHJA 2VQEQ 3I4OA 2OTLA 4JBMA 3CW2C 1Q12A 3I4NH 1KHIA 3A5ZB 4JI4L 3S1RH 1K3RA 3M4OH 4DV3Q 4OWWB 1LUZA 2EXDA 4JV5Q 4IFDJ 4X62Q 5LMUQ 1NMFA 2EIFA 2CWAA 2KBNA 4HJ5A 2PMZE 1KD1C 2HIVA 4RMFA 5AJ3L 4KHPQ 1RIPA 2K14A 2B63G 2EQSA 1HZAA 1UE1A 3KOJA 1QVCA 4IPDA 5FLXc 4LFCL 4R4QA 5IYCG 5LMNQ 3PUYA 1BVSA 1XMOL 1IBMQ 4JOIA 4GOPA 1PYBA 3CPFA 2F4VL 1E7ZA 4IFDI 3GD7A 4K0KL 1KRSA 3GTPH 4LFBQ 3UDIA 5JJIA 4PG3A 1X65A 4LUZA 4P75A 4DV5L 2Z6KC 3HOXH 1Q1BA 1WCMH 5IYBG 1YBYA 1VQ8A 1EIYB 3BU2A 4OX9Q 3GDEA 2F4VQ 2UXBQ 2VQEL 1V9PA 3RR5A 1EWIA 4QY7A 2Y0SE 2JA5G 3KDFB 5C44H 4JC0A 3RNUA 5GROA 5GAEC 1BKBA 5C0XI 1EQQA 1XNQL 2ASBA 4UP7A 4IPCA 4EX5A 1B8AA 4A3MH 1YHQA 4B3SL 1XTDA 4QGUA 2ZM6L 1SMXA 1CSQA 2JEBI 4GOPB 2VQFL 3S15H 2HT1A 1X6OA 2ZJPA 4HIOA 3PIOA 3DLLA 1FJGQ 2VY3A 1O7IA 2ALYB 3EBEA 1Q86C 1Y1WH 2IX0A 2MNAA 1T9HA 3G4SA 1PH8A 1E24A 1EYGA 4LNQA 4DR4Q 5JJLA 5IYBH 1JB7A 3RLOA 3CPWA 3GTJH 3NBHB 3S1QH 4BXXG 4HIDA 4BA1I 4BY7G 3OTOL 2KCTA 4AYBG 3PF5A 3ULJA 4JI7Q 4A3JG 3HOWG 1N36Q 2D0OA 2I0QA 4B3RQ 1VQHA 1SFOH 4IO9A 1W2BA 3CC4A 4DKAC 4A3IH 1G51A 4DR3Q 1OTCA 4L5QA 2Z0SA 1N34L 4JI6L 2YV5A 1XMOQ 2XTIA 2JEAI 4A3GH 2JE6I 2Q2IA 3AQQA 1J6QA 1N36L 5H1SE 2Q2HA 3G71A 1AE3A 1JJGA 2ZJRA 2ZJQA 4PZ7A 3BJUA 1VQNA 3RLFA 2A19A 3TS0A 4XTCS 2CQOA 3L2PA 3STBD 2DGYA 1GD7A 4NXNQ 4JYAQ 1HNWQ 1VQMA 5J3BA 3UDXA 4DV2Q 2JA7H 2JA6H 1D7QA 2K75A 3NELA 2AMCB 3K81C 3E0EA 5C4XH 4JBJA 1VQOA 1Y1WG 1X9NA 1CUKA 3HKZE 4KHPL 2OQKA 1WCMG 3J80c 3CXCA 3CMEA 2Q2UA 4GLVB 3VDYA 1XNRL 5C0XJ 4JCVE 3OTOQ 1IYJB 1QUQA 4NPSA 1E1TA 2WB1E 4YHHQ 1VQ9A 4BA2I 1KIXA 1N33L 1XPOA 2JA8H 4LF8L 2MFIA 2R93G 3D31A 1FJGL 2I5HA 3I2ZA 2JA5H 1Y14B 3GTLH 4UP8A 3S2HH 1G6PA 2YTVA 4ALPA 4BBSG 4YCWA 4OX9L 2NVQH 1N32Q 2R92H 1I50H 2BH2A 2UXBL 3G48A 4MZ9A 4DR6Q 1V43A 4AQYQ 4LF5Q 4A3CH 2VZAA 4OONA 4LUOA 1L0WA 3UE1A 3S16H 1NJIC 4UY8C 1XNQQ 1N8RC 1B70B 3JC66 3CCEA 3RN2A 2R7DA 2JA7G 3S1MH 4APVA 4A3BG 3U4VA 4DV2L 2GVAA 2F52A 3RZOH 3S14H 4H02A 5IE8A 3H15A 4X62L 5LMUL 4GN3B 4LFAQ 3RZDH 2E2JH 4OWTB 5ELOA 1I94Q 1KAWA 3HKSA 3I55A 3CCJA 3JAMi 2B3GA 1EQRA 1X55A 1VQAA 1LYLA 2VS1A 3AFPA 3PUWA 4P74A 4B3TQ 1TWAH 3KFUA 4A3DG 1HR0Q 4Y52H 4A3IG 1VQJA 1XMQL 1K9MC 2Z6KA 4QIWE 3CCVA 1MJEA 1UWVA 1NBWA 2QGQA 5E7NA 4DR3L 4JI6Q 4NXMQ 3L0OA 5C0XG 1HR0L 5FJ8G 3B6YA 4GNXB 2UU9L 3PF4A 3T1YL 1C0AA 4DR5Q 4X66Q 2AWNA 4BBRH 2E5LQ 2NN6I 1CKMA 4DUYL 5GQOA 3PCOB 2UXCQ 3ULLA 1VQLA 3HKZG 3U50C 3J81i 3PUXA 4R4IA 4UP9A 5IYDG 1VS0A 1I5FA 4DV0L 2K5NA 1HZBA 4OXPA 4A3EG 2R93H 3GO5A 1VQPA 4GNXA 4J15A 1M1KC 1VQGA 1CKOA 2PQAA 4JYAL 1SROA 1X3FA 4BBRG 3S24A 3F1ZA 2PI2A 3EIVA 5M3FG 4JI8L 3CQZH 2LXKA 2N3SA 3SGIA 4DAMA 1IBKL 3H0GH 5JEAJ 1WI5A 4C2MH 4A3BH 2AWOA 1PH3A 4EQ5A 1Q8KA 5IP9H 1WFQA 2V1CC 3PO3G 3CCLA 4LF8Q 3MEFA 1N33Q 2NZHA 4DV7L 1FVIA 2N49A 2VL6A 2ZM6Q 1P16A 3NENA 1EFWA 2UU9Q 2E8GA 1S72A 4AYBE 3CF5A 1AE2A 3UDGA 1NE3A 1ASYA 2UXDQ 1QZHA 2KENA 3M3YH 5M5XH 4A3EH 2PQAB 5M5YH 2LXJA 2HIXA 1JMCA 2YTYA 5C4JH 1Y1VG 4YCUA 4JI2Q 5M5WH 2OQ0A 2CCZA 4L5RC 2I5LX 1VQBA 2IT1A 3FP9A 4GS3A 4DNIA 3HOZH 1LM0A 3W1GA 2B29A 3A74A 4A3KH 2Y0SG 4X6AH 2IX1A 1L1OC 3KJPA 5K36G 1UE5A 4L5TA 3CAMA 1GM5A 3J7A5 1GO3E 1SR3A 1BBUA 4QJFA 3T1HQ 1VQCA 3KJOA 1VQ6A 1OXVA 1TXYA 4IJHA 3UDFA 2IHFA 3J7ZC 1C7YA 1PYSB 1V1QA 1XNRQ 3K7AH 3OW2A 4DR2L 4GLXA 4JI1Q 3T1YQ 3NEMA 4LFAL 1A63A 1K73C 4BXXH 3I4NG 3PO2H 2R7FA 1BBWA 1K83H 4JG2A 4R4CA 3PUZA 3HOWH 1X56A 4IPGA 1OXSC 2HHHQ 3PGZA 2UUCL 2WB1G 4B3RL 4DR2Q 4IJLA 4LUVA 3I4MG 4ME3A 1YHBA 2A1AA 2K5HA 5IY0A 1JJCB 1PH7A 1DGSA 1VQIA 1OXUA 2IY5B 4NB3A 4YCVA 4AQYL 1YI2A 4LF5L 2ATWA 2NVTH 1SN8A 4R4TA 4A3FH 3GTGH 1JE5A 2NVXH 3KYHC 4YWLA 1QVGA 2XGTA 1PFSA 4NXNL 5BR8Q 4GNXC 3CC2A 4LF7Q 4GKJQ 3STBC 1QUQB 3S17H 2KHIA 4IPHA 2IHEA 1A0IA 2QA4A 1OXXK 3TREA 4JI4Q 3CC7A 2JK8A 2K50A 4XIGS 4A3LH 3CCUA 3S2DH 1GVPA 2C35B 3F2BA 3ULPA 3DM3A 3J81c 1HNZL 2L15A 1YVCA 4O2DA 1PH1A 1IBKQ 4LF6Q 4YHHL 5M3FH 4A93H 4GN4B 1X3GA 5C3EG 2E5LL 3L7ZC 1VQEA 3ERSX 4JI7L 3LGJA 1PH9A 4K0KQ 3TS2A 1AH9A 3AEVA 4DR1Q 4JBWA 4A3MG 2E2HH 2AKWB 1A8VA 2F3IA 2AHOB 1UE6A 4QQBX 3F2CA 4MNOA 1Q81C 3CCRA 1VQFA 3HFZB 1S40A 2WFWA 3GTKH 5JEAG 4POFA 4JOIC 2NVYH 4DPGA 4GOPC 4A3FG 5IYDH 4RG1A 4DV4Q 3I7FA 1K8GA 2ES2A 1A62A 1NY4A 4O0AA 2YU9H 1PVOA 2RCNA 3WWVA 4KLKA 5HGQA 3I56A 2JA9A 4HJAA 1K8AC 4A3LG 4DR5L 5IT9c 5FJ8H 1HNXQ 3I4MH 3PIPA 1PH2A 4A3JH 3E9HA 1B7YB 3K7UC 1FL0A 2BA1A 1KC8C 1YIJA 1Y1VH 5IWAL 1X54A 1SE8A 1PH6A 3FHWA 2UUBL 3HOUH 3T1HL 3PSIA 2Q2TA 5IWAQ 3TEHB 4JI1L 1L1OA 1Q7YC 3AFQA 4HIKA 4DV5Q 3W1BA 3KF6B 3ZJYC 4POGA 4DR1L 3H3VI 4JI8Q 1Z9FA 2R6GA 4DV7Q 3BZKA 1IXRA 4LWCA 3K0XA 4HIMA 1PV4A 5DLQE 1I94L 1QZGA 2LSSA 1R9TH 2NN6G 2HHHL 4DV4L 4BY7H 1L1OB 4A93G 5M3MG 4PZ6A 4X64L 3TQYA 2CFMA 1N34Q 1HNZQ 4LF6L 2CKZB 1KL9A 2YYZA 4YWMA 4DV1Q 5GAHC 2GN5A 2VUMH 3CD6A 1FGUA 3H0GG 1I6HH 4LF9L 3RLNA 4BBSH 1N32L 4DK6C 1J5EQ 1X3EA 2ID0A 1K0RA 2ZTCA 3TRZA 3GTMH 2ZTEA 3HOVG 1E1OA 4JI0Q 2JJQA 4B3MQ 3RN5A 3Q8DA 4DV1L 1P8LA 4LF7L 2BH8A 3AYHB 3BZCA 2WP8J 4C3HH 4R1JA 4DAYB 4GN5A 2UUAQ 5IYCH 3M4QA 5C44G 3ICEA 2MO1A 4DR7L 3ER0A 1WYDA 1IBML 5IP9G 1Q82C 3GTQH 3GTOH 3E9IA 1D8LA 2OWOA 1E22A 3G6EA 2I5MX 1SLJA 3H3VH 4LW1A 2K52A 5IP7G 2K4KA 1WJJA 5GAGC 4BY1H 4R4OA 5HY6A 5BR8L 4DV3L 4X65Q 2CWPA 4JI5L 1Q46A 1UE7A 3CP0A 1ASZA 1EOVA 1YJWA 4LFCQ 2JA6G 2ZTDA 1IBLL 2UUCQ 2WAQE 4IOCA 3PO2G 4A76A 3PUVA 3HOYG 2N78A 4QL5A 1PA6A 4X64Q 4GLAC 4C3IH 5LMNL 4JI3Q 1LTLA 3MXNB 4PMWA 3JAMc 3UE0A 4LF4Q 4GKKL 2OTJA 1G291 3F2DA 1TWGH 1U5KA 3A0JA 4JI2L 4DR6L 1MKHA 1J5EL 1N9WA 1RL2A 1L2FA 2PI2E 4JI3L 2DUDA 3J81j 4KI0A 1MIUA 4MTNA 4DV0Q 1NTGA 4HJ8A 3EN2A 4WJ4A 1QVFA 1S3OA 1TWCH 2VW9A 4PZ8A 1VCIA 2FXQA 1HNWL 4TVAB 3HOZG 3W5OA 1M90C 1EUJA 4B3SQ 1HZ9A 1YZ6A 5IP7H 5GADC 3CCQA 1KQSA 1HZCA 4OWXB 2QEXA 1JT8A 3CCSA 1TWHH 1HNXL 3KDFA 3M7NA 1XMQQ 2UUAL 1PH5A 1H95A 4IOAA 1XPRA 1PHJA 3HOYH 1HH2P 1YITA 2UUBQ 1WOCA 1JJ2A 4A3KG 3CMAA 2UXDL 1VQ5A 1HJPA 1SRUA 5JJKA 3KF6A 2OCEA 1U0LA 4X66L 4C3JH 4JBKA 4LF9Q 1CSPA 3KLWA 1IL2A 3K8AA 1E3PA 1VQKA 5ELNA 2VUMG 5FLMH 2MQHA 2R7ZG 2D0PA 1IBLQ 4DV6Q 1VQ7A 3PO3H 1YHAA 4HJ7A 4WJ3M 3HOXG 4A3CG 2A8VA 2R7ZH 4A75A 5FLMG 4BY1G 4A3DH 2VQFQ 2R92G 1KXLA 3J80i 1I3QH 1W3SA 4OO1G 4P72A 2PNHA 2D62A 3K80C 1GKHA 5EAYA 4AIMA 2RHQB 4DR7Q 3M4PA 3PV0A 4P71A 3S1NH 2JA8G 4A3GG 1OXTA 4FDBA 1UEBA 3M9BA 4B3ML 1Z47A 2BA0A 2MO0A 4UPAA 4P73A 4AH6A 4JV5L 4X65L 3D0FA 3U58A 4DUYQ 2UXCL 2E2IH 1YNXA 5AJ3Q 4GKJL 3F8TA 2KCMA 1CKNA 4Y7NH 4LF4L 3U4ZA 1XPUA 1IZ6A 4YY3Q 4DUZL 4NXML 5C4XG 2GVBA 2K5VA 4A4IA 2RF4A 4DR4L 4OO1I 5LMNW 2JQOA 3CCMA 1C9OA 2WAQG 1YEZA 1YJ9A 1MJCA 4DV6L 4HJ9A 1VQDA 4KHZA 4IFDG 3FKIH 1Q1EA 4JI5Q 1TWFH 4L5SA 2B63H 4YY3L 3OYYA 4DUZQ 1VQ4A 1YJNA 1EIFA 1XJVA 1PH4A 1CKNB 4JI0L 3HOVH 1NMGA 3HOUG 2YTXA 4DK3C
chains in the Genus database with same CATH superfamily
3Q0AA 1GOZA 3P7JA 3KF8B 2N8NA 2GA4B 1EZ8A 3JAME 1EWCA 3I4NB 5IGBA 2KHJA 3I4OA 3CW2C 4UAIA 1SNCA 1KHIA 3M4OH 4RAUC 1LUZA 3A56A 1R4PB 2N55A 1NMFA 5KNDA 5KNCA 1EY6A 2HCCA 2EQSA 1WTWA 4JPBW 1UE1A 1NSNS 2KEEA 5IYCG 2R93B 4FYDA 4JOIA 1PYBA 1LABA 2F4VL 1K3BC 2PW7A 3HOVB 2EZVA 4H13C 4LUZA 2Z6KC 1YBYA 3KBGA 1HTPA 2IJ0A 2K5WA 2Y0SE 2CW0D 3RNUA 4JC0A 3IFTA 4UP7A 4IPCA 4HAEA 4B3SL 4MHEA 4QGUA 1SMXA 2JEBI 2VQFL 1X6OA 3SE0A 2QILA 2NUCA 2Z9HA 1EYDA 1FJGQ 2VY3A 3EBEA 2IX0A 1PH8A 5C6AA 5JJLA 3CPWA 3NK9A 3GTJH 1K28A 3PF5A 2I0QA 2IX3A 3D6WA 1JOOA 1OTCA 2Z0SA 1XMOQ 1TS3A 1F77A 1A15A 4IALA 2Z8LA 1K0SA 3P75A 2YU9B 1JJGA 4F88A 2D5DA 3EROA 2ZJQA 3RLFA 2A19A 4C3IG 4A3MB 1J8IA 1GD7A 5J3BA 1D7QA 4ULLA 3PO2B 4LMQD 1M4VA 1IYVA 2OQKA 1I4GA 3CXCA 3KLSA 3VDYA 3K5MA 1IYJB 3ND9A 1KIXA 2ZT9C 1XPOA 2MFIA 4G7HC 2I5HA 2B2TA 3GTLH 3CKIB 1YNND 4BBSG 4MZ9A 4AQYQ 3NTHA 4C1NI 5M5WB 1NR4A 3W2DA 1VF5C 1XNQQ 1N8RC 4I7AA 3RN2A 4A3BG 2B2UC 2QKIC 2GVAA 2F52A 4H02A 2LY7A 4X62L 2RBMA 2E2JH 4KMUC 4OWTB 4X3UA 3CCJA 3JAMi 3PUWA 3AFPA 2X6LA 3KFUA 2OEOA 1GHKA 2XIWA 3TP6A 1UWVA 1NBWA 3FPPA 5C0XG 5FJ8G 3PF4A 2E2DC 1F2YA 4A3KB 4IQZA 3E3XA 2NN6I 4HN7A 3ULLA 3U50C 4R4IA 4UP9A 5LL6S 1VS0A 4DAVA 2R93H 3MFGA 4OXPA 3GO5A 3HGBA 2Z4IA 1M1KC 3RZOB 1VQGA 1CKOA 1SROA 4BBRG 4IUVA 1A3TA 1PRTF 5C5MA 4C2MH 3MZ5A 1MSGA 3ERQA 1PH3A 2V1CC 1EWHA 3IFDA 4OIKA 1FVIA 1P16A 3NENA 2SNMA 2Q8RE 4HCSA 3S9WA 1NE3A 1ASYA 1QZHA 5JAVA 1SDFA 1PZKD 3S1NB 3D8GA 3GTKB 3T4AC 3A8JE 4YCUA 4JI2Q 4L6TB 3VYUA 4L5RC 3RD4A 2IT1A 3J81L 3HOZH 3U9OA 2B29A 5C44B 3A74A 3MXPA 3CHBD 3KJPA 5K36G 1UE5A 4OL7A 1T5XD 2NVYB 1KTKA 1D5ZC 1GO3E 2F0QA 1BBUA 3T1HQ 3QOJA 4FF3A 5ELDA 5IODA 1B3QA 1O7ZA 3J7ZC 3Q23A 2IHFA 1PYSB 1V1QA 4HR7B 4DR2L 4PNYA 4GLXA 1A63A 4XXEA 1K73C 4BXXH 2EJFC 4ZCKA 4TSSA 1D2BA 4A3BB 3PUZA 4K14A 3PGZA 5CORA 3FKIB 3WOFA 2F0UA 1YHBA 2K5HA 5IY0A 1VQIA 1X32A 1PRTD 1TIID 3H91A 2PCFB 3GTGH 1JE5A 3R3OA 3K0YA 4HCEA 2JA6B 2AQ2B 3A8IE 4J1MA 4GNXC 3CC2A 4GKJQ 1QUQB 4IPHA 3CC7A 2JK8A 3H0GB 5EPKA 2K50A 1A2TA 3CCUA 1GVPA 3WDNA 2C35B 4DN4M 3F2BA 4A3GB 4B9WA 4LF6Q 2MJ8A 4A93H 1IBKQ 1LT4D 4GN4B 5C3EG 4ZUJA 3QG1A 1VQEA 4K0KQ 1AH9A 3TS2A 4JBWA 4A3MG 2AKWB 2F3IA 1SYEA 1Q81C 4MTKA 3CCRA 3S2HB 5I6WA 4DPGA 3VA7A 2ES2A 1BUVT 4XQQA 2O2LD 4UDUC 4KLKA 2B8GA 4HJAA 5IGCA 5IT9c 3I4MH 4K5XA 1B7YB 4A3JB 1D5MC 3VR4A 5IWAL 1X54A 1PH6A 3HOUH 3PSIA 4ZUIA 4Q0FA 5IWAQ 2F1MA 1PFBA 3H09A 4HIKA 3X3MA 2XRSD 4FXGC 2M9VA 4POGA 3X3NA 2V4DA 4KJNA 4JI8Q 3V96A 4C1NK 3EA6A 2K5DA 4LJZC 4X3TA 1HFNA 4LWCA 1PFNA 5DLQE 3ITPA 4S3SA 1I94L 4KK7A 4KTAA 1L1OB 1F2ZA 5FO8B 5EGTA 4PZ6A 1HQRD 3KF8A 2B2YC 4YWMA 2KCCA 1H9MA 3H0GG 3ZYYX 1YNJD 1AZQA 3RLNA 4LF9L 1RDPD 4OIJA 4X3KA 1N32L 2XVSA 2PYKA 2ZTEA 3RN5A 1WTPA 2AQ1B 4EQOA 2BH8A 3AYHB 3BZCA 4R1JA 3T56B 4DR7L 5IP9G 2KOLA 3TP5A 4ZRZA 5D3DA 1LTSD 4H0LC 2I5MX 1SLJA 2NWGA 4LW1A 4R4OA 5HY6A 4DV3L 4X65Q 2CWPA 1Q46A 2F0IA 1YJWA 2AUKA 4ABNA 4IOCA 3PO2G 3PUVA 1IHZA 4DXFA 3JAMc 3UE0A 2O5JC 3F2DA 3DXJC 1U5KA 5CGKA 1RD9D 3FPUB 4DR6L 2PI2E 1TR5A 4JI3L 3VYSA 3DMUA 1B44D 2L55A 1NTGA 4HJ8A 4WJ4A 1J9OA 4ODGA 1M90C 3C1EA 3SEBA 1HZ9A 1D1KA 1I50B 4TKOB 4DU9A 4RCOA 1KQSA 1PLFA 1Y1VB 5LL6X 1TWHH 3KDFA 1SYFA 1VDZA 3M7NA 4IUQA 2I46A 1VQ5A 1HJPA 5JJKA 1LT6D 4C3JH 4LF9Q 5DAUA 2PQEA 4C2MB 1IL2A 4KN7C 1TWAB 4BY1B 1IBLQ 2KQ3A 4ZAIA 4DF7A 3PO3H 5D65A 4HJ7A 3HOXG 4A3CG 2KUMA 4A3DB 4A75A 2K7VA 3IKJA 2H4OA 2R92G 2XSCA 4G7ZC 4P72A 4G7OC 3K80C 1WTVA 4AIMA 2RHQB 1GUNA 4I7ZC 2N88A 2JA8G 5M5YB 1T5EA 1UEBA 3M9BA 3QO2A 3OWEB 3D4RA 1BNZA 4DUYQ 5I4DA 1Y8PB 4LF4L 2RF4A 1LT3D 1X3QA 3GV3A 4DV6L 4HJ9A 1VQDA 4LFBQ 5IGFA 4JI5Q 1Q1EA 4YY3L 4DUZQ 1VQ4A 3EJIA 5IGEA 3I3CA 1EIFA 3HOUG 5COYA 3HOVH 1NMGA 3A5UA 2VZAA 3PIPA 4DK3C 2F0LA 2NZOA 1QCBD 4YWKA 3R93A 5C3EH 2R3ZA 2RHSB 4QUCA 1PTOC 4NKLA 3R8BA 3Q24A 3MXUA 1HR0W 2O4XA 2OTLA 4JBMA 3NE5B 3I4NH 3L9AX 2EYOA 3S1RH 4QCLA 4OWWB 2EPBA 1H9RA 1CTMA 3DWQA 1SMYD 4X62Q 4HJ5A 2CWAA 2KBNA 4BBSB 2PMZE 1YNJC 1RIPA 2K14A 4IPDA 5FLXc 1CZWA 4LFCL 4R4QA 3NTIA 2Q8IB 4KY6A 1ET9A 4K0KL 5FK9C 3GTPH 3UDIA 5JJIA 4DV5L 3BVGA 3HOXH 1Q1BA 2X69A 1D5XC 3BU2A 1EIGA 1GHJA 3OWFA 2JA5G 3KDFB 5C44H 1DOMA 2RQXA 3SK6A 5GAEC 3O13A 1XXGA 1KDAA 1XTDA 1FNVA 1V8QA 1EY5A 1C8CA 4GOPB 3BG3A 2ZJPA 4HIOA 3C1FA 3PIOA 2F3WA 5DNFA 3G4SA 1BCPF 2SNSA 1EYGA 2VB3X 3M4YA 1ILPA 4DK0A 4BXXG 4HIDA 4C3JG 4BY7G 3OTOL 2KCTA 1F2LA 1BCPB 3HOWG 1DM0B 1SNMA 3CC4A 3LWEA 4A3IH 4DR3Q 1XX8A 5DEHA 1N34L 3BZDB 3AQQA 4A3FB 1O78A 3PMFA 2ZJRA 1Y69U 1I4PA 2NVTB 3BJUA 3M7GA 3TS0A 4XTCS 5CV8A 2J4XA 2CQOA 3L2PA 2G9DA 5ISRA 2EJGC 3HOZB 1VQMA 1KLGD 1SYCA 4GZYC 2K75A 2F0TA 2LFNA 4EVOA 4JBJA 1Y1WG 1FYCA 3RZDB 4KHPL 2J0TD 2M2LA 5T1GA 1WCMG 3CMEA 3DHQA 3I70A 3A54A 4ZYSA 5M9OA 4GLVB 5G3LD 1QE6A 3OTOQ 1QUQA 3L3OC 3TZDA 1I4RA 1QILA 3VYTA 4RFBA 2B2WC 5EKIA 2JA8H 1EOTA 2R93G 3D31A 5E3FA 1Y14B 1B50A 1G6PA 1ML0D 3PIO3 2F0OA 4OX9L 1TY2A 2R92H 1I50H 1N32Q 4DR6Q 4H44C 3A55A 2XN9C 5CC4A 4A3CH 1B2TA 3MXGA 3J7AF 4LUOA 3SK5A 3S16H 1NJIC 3MHBA 1JC7A 2L12A 3S1MH 1X3PA 5M3MB 3RZOH 2B63B 5LMUL 2OF1A 1TS2A 2WIIB 5ELOA 1I94Q 3HKSA 3I55A 4CKCA 3IAYA 2R92B 1YNNC 2VS1A 1LV9A 4DK1A 4IUUA 5BN5A 4Y52H 1VQJA 1KNEA 5IT9L 1S5CD 4QIWE 4R8IA 2WAQB 2Y0SB 5E7NA 4NXMQ 4RGMA 4DR3L 1HR0L 4GNXB 3B6YA 3E5SA 4CKEA 2O5IC 1C0AA 1B9NA 1EYCA 4JW0A 5IIFA 2F0FA 2E5LQ 2UXCQ 3PCOB 1VQLA 3HKZG 3J81i 3PUXA 1VMPA 1U4RA 1EQVA 2RSOA 3SHLA 1VQPA 4J15A 5BN4A 4JYAL 2PI2A 4JI8L 2LXKA 1TU2B 4I65A 4UHVA 4EQ5A 1Q8KA 3BDLA 1O7LA 3CCLA 3RMHA 1GUOA 3QB3A 4DV7L 2N49A 2VL6A 4AYBE 1XYIA 3CF5A 2KENA 5LHY1 1AZPA 3HOXB 5BN3A 3K59A 3OOCA 2PQAB 2K5QA 1CM9A 1JMCA 5C4JH 5C4ZA 3NQIA 1Z6HA 5KYIA 1ZEQX 2E2IB 2I5LX 3I4MB 4DNIA 2WB1B 4K5VA 2L1BA 4OGQC 4A3KH 3V05A 1SR3A 3KJOA 1VQ6A 1TXYA 2EYLA 4IJHA 1C7YA 2MP1A 3OW2A 2D9UA 2A73B 4DAPA 4B08A 2L11A 4A93B 2BOSA 2QEJC 4IUPA 1BBWA 1K83H 3I73A 4JG2A 4K2KA 2CHBD 4R4CA 5FO9B 1AEXA 4IPGA 4C56C 3GTOB 3T53B 5I2YA 4IJLA 2NZ1D 3I4MG 4ME3A 2A1AA 3KBXA 1PH7A 2B2VA 2IY5B 4YCVA 5KRUA 4K6DA 1YI2A 4LF5L 2NVTH 5FLXE 2FFKB 1ENFA 1U9RA 3HOYB 3H6MA 4B9XA 1QVGA 1BBXC 3GTLB 2KHIA 3I72A 4K5WA 1OXXK 3MVVA 4JI4Q 2F0EA 2IWHA 1SSOA 3ULPA 3DM3A 4DA2A 1H9SA 1YVCA 2A68D 3A7AB 1JCKB 3L7ZC 1PH9A 5I9OA 2RDFA 3AEVA 5CBEE 1UUPA 2E2HH 1TWGB 3P20A 1STYA 3F2CA 2M00A 1VQFA 3HFZB 1S40A 3GTKH 4POFA 2Z6BA 4RG1A 4DV4Q 2F0HA 1NY4A 4O0AA 4BWGB 2YU9H 1PVOA 1GUWA 3TSSA 5HGQA 4DR5L 5FJ8H 1B9MA 5KNBA 2BA1A 1YIJA 4BY7B 1Y1VH 4RKBA 3AFQA 4DV5Q 1SJED 4PMBA 3ZJYC 4K8IA 3LX0A 5IGDA 1IXRA 1PV4A 3OMGA 4JVZA 3PIP3 2F0NA 1QZGA 2HHHL 4DV4L 2EE1A 1BQQT 5C3WA 4KKSA 5M3MG 3TQYA 2CFMA 5A2QE 1N34Q 4LF6L 2VUMH 1S5ED 4BBSH 2ID0A 1LTGD 1K0RA 2ZTCA 1STEA 4WRDA 4K8JA 1E1OA 1LT5D 2HDLA 2JJQA 4HEDA 4JI0Q 3Q8DA 1P8LA 1A3UA 2BDNA 3ICEA 5IYCH 3M4QA 3ER0A 4NW2A 3GTQH 3HKZB 5NUCA 2E2HB 2WKDA 2KVMA 2K4KA 1WJJA 1TQOA 2A69D 2NTTA 1Y1WB 2ZTDA 1DONA 2WAQE 2PZUA 4A76A 2K1BA 1U4LA 4RHSA 4C3IH 4X64Q 4LF4Q 1G291 1MKHA 2RDHA 3J81E 1N9WA 3J81j 3Q6SA 1A3VA 5J39A 1IKMA 1TWCH 2BCOA 4PZ8A 1VCIA 4TVAB 3W5OA 2DY8A 3VR5A 1HZCA 4M8AA 4OWXB 4TRDA 2QEXA 1JT8A 2A6EC 1XMQQ 2UUAL 4IOAA 1XPRA 4G57A 2JA8B 1YITA 1G8ZD 3IL8A 2EXZA 1JJ2A 4A3KG 3C2PA 2PW5A 4CDCC 1SRUA 4JBKA 1VF7A 1CSPA 3K8AA 1E3PA 1CA6A 1VQKA 1JB3A 2R7ZG 3VR3A 4DV6Q 1S5FD 1LACA 1TS5A 1YHAA 2L0CA 2A6ED 2TSSA 5D14A 5A35A 4WJ3M 1GUTA 4A3DH 5E4WC 1W3SA 5EAYA 1GKHA 3BYYB 3J7YW 2EYFA 3M4PA 3PV0A 1CHQD 4P71A 4A3GG 1OXTA 4FDBA 5JOBA 2BA0A 5FKAC 1YNXA 1BOSA 3LWUA 5AJ3Q 3F8TA 2KCMA 4Y7NH 3T13A 1KDBA 4YY3Q 4DUZL 4A4IA 3FDTA 4EQNA 1NCVA 3CCMA 4CDFC 1QB5D 5IT9E 1C9OA 1YEZA 4CKBA 2A69C 3G6JB 1YJNA 1XJVA 3VYRA 2YTXA 1TVXA 3NXWA 3FKIG 1KRTA 1O7YA 4DXGA 4TQUS 3A8KE 3K7AB 3CU7A 3G7LA 2HQLA 1C48A 3M85A 5M3MH 1Q12A 1ZKOA 3A5ZB 4JI4L 1K3RA 4DAYA 4IFDJ 1Q3LA 5LMUQ 4B3TL 1Z7TA 2HIVA 4KHPQ 5AJ3L 5EKLA 4Q5VA 3VR2A 1QVCA 1EEID 3PUYA 1BVSA 1IBMQ 1MI2A 2H1EA 1BDOA 2EYMA 1AN8A 4CDDC 4RGOS 3DEPA 4IFDI 3GD7A 4FO2A 3D4DA 1MHWC 4R9WA 4PG3A 1WCMH 1ESFA 2F3VA 4OX9Q 1EIYB 1L0XB 3GDEA 4HMIA 3S1MB 1V9PA 3RR5A 1EWIA 5ELCA 4IZ8A 2ASBA 2NN6H 1XNQL 5GROA 5CV9A 4EX5A 1H9SB 1VMCA 5F2DA 2HT1A 1WVLA 3E6ZX 1O7IA 2ALYB 2RA4A 1Q86C 1Y1WH 2MNAA 1E24A 3SVMA 2ICEC 5IYBH 3K5LA 3RLOA 5EQ0A 1JB7A 3S1QH 1TKWB 4AYBG 1II3A 1F9PA 4JI7Q 1RKNA 3HZXA 4A3JG 2SEBD 2FMMA 3BDOA 4X3SA 4B3RQ 1VQHA 2JYOA 2D2CC 4IO9A 2IPKD 4JI6L 1SNPA 3J7AV 1PFMA 2XTIA 4A3GH 2JE6I 2Q2IA 1N36L 1S5DD 1DXMA 4EGVA 1JQYD 1AE3A 3G71A 4PZ7A 1VQNA 5E1FA 1I4HA 4IFDH 2EDGA 4NXNQ 1CQFA 3UDXA 2JA7H 2JA6H 3NUCA 3NELA 3K81C 5C4XH 1VQOA 1X9NA 3HKZE 2Q2UA 5EPLA 4DNTB 3GTMB 1XNRL 5C0XJ 4BA2I 2WB1E 4YHHQ 1VQ9A 1PTOB 4NP5A 1MSHA 1F2MA 4C3HG 2F0DA 4CDEC 1I4XA 4PV1C 1FJGL 2JA5H 4OO1H 1LTBD 3BS1A 2XRQD 4ID6A 4ALPA 4YCWA 2UXBL 2NVQH 5I6YA 3G48A 2EY2A 2DNCA 1PZJD 1U4MA 1HFGA 1L0WA 3UE1A 3CCEA 3JC66 2R7DA 2JA7G 2B39A 3U4VA 4C3HB 2Z4HA 1BF4A 1V1PB 2F0KA 5IE8A 3H15A 3RZDH 4LFAQ 4L63B 2DY7A 2B3GA 1FD7D 1EQRA 1STBA 1X55A 1LYLA 3HOUB 2OT2A 2HUGA 1HR0Q 4Y7NB 4XDXA 1XMQL 1K9MC 2Z6KA 1LO5D 1WTHA 4IUTA 4CGYB 3CCVA 5G3LF 1MJEA 2NVXB 1SNQA 2PO4A 4JI6Q 2P5ZX 4XT3B 4C3IB 2L4NA 2UU9L 4DR5Q 3NQTA 2AWNA 1CKMA 2MGSA 4QUFA 5IYDG 2SDFA 1I5FA 3NHHA 4GNXA 3AB9A 1ICWA 3K5OA 1PZID 1UEAB 1HA6A 1HXYD 1JWSD 3F1ZA 3EIVA 1EU3A 3CQZH 3S17B 2N3SA 3C46A 5JEAJ 2AWOA 4ILWA 5IP9H 3PO3B 1WFQA 2FINB 3PO3G 5CR3A 3MEFA 4LF8Q 1I6HB 3AU7A 1N33Q 2NZHA 3NTKA 2ZM6Q 5EPJA 2UU9Q 2E8GA 1AE2A 2UXDQ 1CFMA 3VA5A 5M5XH 4A3EH 3M3YH 5M5YH 2LXJA 2HIXA 1Y1VG 4PQXA 4LAAA 1EFID 1Y8NB 5J22A 1R4QB 3FP9A 4GS3A 1BO0A 2A68C 1RODA 4CHTB 4L5TA 4FNFA 4WFN3 1GM5A 3S1RB 3J7A5 1IW7C 4QJFA 5ELBA 1F9SA 1G2TA 1OXVA 3K7AH 3C3LA 2K04A 3WOEA 4LFAL 3KLSX 5C3EB 5FLXL 3I4NG 4F8MA 4IURA 3PO2H 2R7FA 1B1ZA 1ZYRD 2K05A 3HOWH 1X56A 1OXSC 3OW7A 4LUVA 1TWFB 2KA7A 1SMYC 1KLUD 1OXUA 4AQYL 2ATWA 2ICIA 4A3FH 1U4PA 2NVXH 3KYHC 5EKKA 1JR0D 2XGTA 1PFSA 1Q90A 5C5LA 4NXNL 5BR8Q 3STBC 2F4IA 2IHEA 1EIHA 2EYPA 2QA4A 3TREA 4RCNA 2PMZB 3QJYA 3K58A 4A3LH 1HUNA 2J7ZA 4FXDA 3J81c 1HNZL 4O2DA 4RA8A 3MXNA 4YHHL 5M3FH 3T51B 4IUNA 1FNUA 1X3GA 5CV7A 3CRLC 3Q22A 4JI7L 3LGJA 4BBRB 4DR1Q 3AMUA 1SYGA 1A8VA 1EY4A 2AHOB 4QQBX 3NPPA 4MNOA 5JPMC 5JEAG 4JOIC 2NVYH 1AFPA 1JE4A 5KEEA 3I7FA 1K8GA 2I07B 3BVZA 2RCNA 1B3AA 4MIUA 3I56A 4A3LG 2JA9A 2K28A 1HNXQ 2L5TA 1PH2A 3FVQA 2JSOA 3HP3A 1FL0A 4KKTA 2UUBL 1SFOB 3FHWA 3T1HL 1CZGA 3JAML 4RWSC 4JI1L 5JPNC 1B53A 2Q8TA 3W1BA 4DR1L 1Z9FA 2HCIA 4DV7Q 3BZKA 3MEHA 2HDMA 3D6CA 2LSSA 1R9TH 5KYLA 4A93G 4X64L 2YYZA 3TBIB 4KD3A 5GAHC 3ND8A 1FGUA 1NAPA 2RCFA 5KGUA 2FJ2A 3VR6A 1X3EA 3OIQA 3HOVG 4XQNA 4DV1L 4XT1B 4LF7L 2WP8J 4DAYB 3QR8A 4GN5A 3T16A 1PXUA 2FHTA 1IBML 1WYDA 1Q82C 2ZXOA 1D8LA 2OWOA 5CBAE 3KLRA 1E22A 3G6EA 3H3VH 2K52A 5I2XA 5IP7G 5BR8L 3S2DB 2A5HA 1UE7A 3CP0A 1ASZA 1B4OA 1IBLL 2UUCQ 1WD0A 2RDGA 1EY9A 2N78A 4QL5A 3HOYG 2XWJB 4GLAC 4JI3Q 1LTLA 3MXNB 4GKKL 2OTJA 3A7LA 1TWGH 4NDXA 3A0JA 3SDZA 4EQPA 1HA5A 4JI2L 1HHVA 4M1UB 1NNXA 1ET6A 1RL2A 1L2FA 1D1IA 5C4JB 4DV0Q 3MAQA 1PYWD 3GTJB 1S3OA 2JA7B 3HS0C 2VW9A 2AUJD 2EOTA 2FXQA 1HNWL 5KIXA 5ELEA 3HOZG 1EUJA 5C4XB 4B3SQ 2B2VC 5IP7H 3D4WA 1LTID 5GADC 3CCQA 2DNEA 5K5PA 3CCSA 3OSOA 4QIWB 1JWMD 1PH5A 3CRKC 1H95A 3HOYH 1PHJA 1ZXTA 1I6HH 1HH2P 2UUBQ 1CI3M 3TMEA 1U0LA 3U9SA 1S5BD 1QNUA 3KLWA 4ZQ3A 3BVMA 5ELNA 4KJOA 5FLMH 1AP0A 2MQHA 2MPMA 5JVG3 1VQ7A 1QJOA 2F0SA 4DGZA 2A8VA 4ME5A 3H94A 5FLMG 2R7ZB 1D6EC 3J80i 2EVBA 1UAPA 1HPCA 2PNHA 1KDCA 4DR7Q 3GP7A 4QF4A 1RCVD 2EY5A 3S1NH 4XQJA 2MHVA 1EY0A 5FOBB 2MO0A 3NBHA 4P73A 3N52A 4JV5L 4X65L 2K01A 2UXCL 3TZUA 2JXMB 2NBFA 1CKNA 4AYBB 1IZ6A 1DJRD 2PZTA 4HSVA 4DR4L 5LMNW 1JORA 2C9OA 1STAA 3EQLC 1YJ9A 1MJCA 3M3YB 4KHZA 1PMRA 1DOKA 4L5SA 1IKLA 2B63H 3OYYA 2VB2X 3I91A 3OPOA 4BS9A 1PH4A 4V0BA 1W6JA 2H5XA 3IRBA 1FGBD 1SE4A 5CV6A 1L0YB 4LFBL 4GKKQ 4N9PA 2VNUD 2TMPA 4QMGA 2VQEQ 2QDLA 2RVLA 3QOLA 2LMCB 2F0PA 4DV3Q 4YIJA 2EXDA 4JV5Q 1E2VA 1KD1C 2EIFA 1GJXA 4N8X1 4RMFA 2CQAA 1STNA 2B63G 1HZAA 1ZYRC 3KOJA 5LMNQ 5J1ZA 1QNKA 1XMOL 4GOPA 2BDOA 1PTOD 4FF4A 3D3RA 3S1QB 3CPFA 3LNNA 1E7ZA 5C3XA 2HD3A 3OHXC 4V190 1KRSA 1HQMC 1X65A 4P75A 1JOQA 5IYBG 1DOLA 1IW7D 1VQ8A 2UXBQ 1QOHA 2F4VQ 2VQEL 2K6AA 4KV6A 4U68A 4QY7A 3DWAA 1EEFD 2DN8A 1EQQA 5C0XI 1BKBA 2CH4W 2E74C 1HRJA 2ZXPA 3BYTB 1B8AA 4A3MH 1YHQA 4RHRA 2ZM6L 1CSQA 1R9TB 2EYHA 3S15H 4HTHA 2F03A 3DLLA 5EBDA 3QWNA 4WORA 4DR4Q 1T9HA 4LNQA 1C4QA 3I8ZA 3NBHB 2IL8A 3MWYW 4BA1I 4CJ0B 2WV6D 3ULJA 1N36Q 2D0OA 1SFOH 4WJWA 1W2BA 1STGA 1DZ1A 4DKAC 2RSNA 1G51A 4L5QA 1I4QA 2KJXA 4QB4A 2YV5A 4E6IA 2JEAI 1J6QA 1WTXA 5H1SE 2Q2HA 2DJGC 1XTCD 2WINB 4ZKCB 2EJMA 3HG9A 5C0XH 2QDBA 3STBD 2DGYA 1H9KA 4JYAQ 1HNWQ 1TWCB 4DV2Q 3K6OA 4N9TA 4A3IB 1EL0A 2AMCB 3E0EA 1CUKA 3J80c 5TSSA 3SK8A 3OIPA 4JCVE 4NPSA 1E1TA 3S16B 1ENAA 2QCPX 1N33L 5A2QL 2PZWA 3SK4A 5CMDA 4LF8L 1SNDA 1ILQA 3EFXD 3I2ZA 5CV5A 4MN3A 4UP8A 3S2HH 1FR3A 2RKSA 3W3AA 1SE3A 2YTVA 1TT2A 3R2TA 5CYUA 2CH4A 5T1IA 4CJ1B 5DM73 2BH2A 1V43A 4LF5Q 1RTNA 1EZ6A 1RHPA 1TWHB 4OONA 4UY8C 1B70B 4APVA 2LKVA 4DV2L 2HQEA 2KECA 3S14H 2KEDA 1E0BA 2E76C 4GN3B 2K33A 1OO9B 3GTPB 1KAWA 3E0JA 1VQAA 2E75C 2K32A 1RJTA 4P74A 4CBVA 4B3TQ 4ZK9B 1TWAH 5JVH3 4A3DG 1CQVA 4A3IG 2BE5D 1O80A 3TP7A 1V1PA 1LLRD 4KKUA 5IOCA 1BR9A 1EU4A 2QGQA 5D3IB 1QG7A 3L0OA 3T1YL 2LS01 4X66Q 4BBRH 2NVQB 2EY1A 2CVRA 3PQIA 4DUYL 5GQOA 2A74C 5JEAH 2WACA 4G4KA 4DV0L 2K5NA 1HZBA 2A6HD 4KY7A 3RUZA 4A3EG 3J80E 1RF2D 2JP1A 3FMCA 2PQAA 4RKLA 1X3FA 5EBCA 4C3JB 5EJWA 3S24A 1WTOA 4FF1A 5M3FG 3SGIA 1IBKL 4DAMA 3H0GH 1I6VC 1IL8A 4RH6A 1WI5A 4NMZA 4A3BH 1BXTA 2VUMB 2R61A 2F0WA 4H7BA 1M8AA 1EFWA 1S72A 1A6XA 3UDGA 1PTOH 1SXTA 2F0MA 2X6GA 4KN4C 1EYAA 2PNRC 2YTYA 3NP8A 4XYQA 2IW3A 3K57A 4HMJA 5M5WH 2OQ0A 2CCZA 1TY0A 2FMCA 1VQBA 4KY5A 3BDCA 1Q8IA 3DWPA 1EY8A 3P1HA 1LM0A 2C5CA 3W1GA 2CW0C 2F0GA 2Y0SG 1CHPD 4X6AH 2IX1A 1L1OC 5HURA 2B2UA 3CAMA 3M4OB 1VQCA 3K5NA 3NWSA 1E2ZA 4P2CB 5JJZA 3R2IA 3MC0B 1XNRQ 4FXKC 3UDFA 3GQBA 1SJHD 3T1YQ 4JI1Q 3NEMA 3ONAB 4F7XA 2G5DA 1NR2A 1IYUA 5M5XB 4B3RL 2UUCL 2HHHQ 1S4ZA 3GTQB 2WB1G 4DR2Q 1PRTC 2Z1CA 1K8OA 1JJCB 1DGSA 3MFYA 4NB3A 1KABA 2EY6A 1SN8A 4R4TA 3DM1A 2AQ3B 1JWUD 3TP8A 5C4HA 2B2TC 2SOBA 1GUGA 1UNSA 3DEOA 4YWLA 4LF7Q 4F87A 1F9QA 2B8FA 3NSWA 3CQZB 3S17H 1PDQA 1A0IA 5IGGA 2NYZD 4R8NA 1ESRA 1LTRD 4XIGS 1WCMB 2G9HD 5AFWA 4ZLTF 3S2DH 1Y8OB 2L15A 1MD2D 1SE2A 1PH1A 1SAPA 3UI2A 1K8MA 1ONLA 2E5LL 3ERSX 1KNAA 1DD2A 3QIAA 5ELFA 2E2JB 1UE6A 1ICFB 2WFWA 1CA5A 5IYDH 4GOPC 4FF2A 4A3FG 4A3EB 5K36H 3V2TA 1A62A 2KCNA 3WWVA 4U673 1K8AC 5DM63 4A3JH 3E9HA 3KK7A 3K7UC 1PTOF 2MUYA 1KC8C 1EQTA 1HTLD 1SE8A 1GUSA 2Q2TA 1SEBD 5FO7B 3TEHB 1Q7YC 1L1OA 1SBBB 1E2WA 3F2UA 3N6RA 1W6KA 1EY7A 3H3VC 3KF6B 3H3VI 2R6GA 3NBIA 4O1NA 3K0XA 4HIMA 2NN6G 4BY7H 1F9RA 1WTQA 1G6ZA 2JA5B 4OEMB 4HSPA 1KAAA 1HNZQ 2CKZB 1KL9A 5HGTA 4DV1Q 2GN5A 3OMCA 3CD6A 2F0VA 1SYBA 4DK6C 1J5EQ 3TRZA 3GTMH 2KHSA 4L8JA 2QF7A 4B3MQ 3SXHA 3I90A 2QW7A 4PMCA 1STHA 4C3HH 1XWEA 2UUAQ 4KD4A 2XWBB 5C44G 4Z9CB 2MO1A 4DNRB 1LTTD 5I9PA 1FNWA 1HCZA 3GTOH 3E9IA 1ENCA 5L37A 4BY1H 5GAGC 2EYJA 4JI5L 1BCPC 1EOVA 2ZXRA 4LFCQ 1GXDC 2JA6G 1SNOA 1JOKA 3SR1A 1PA6A 1BCPD 1MBYA 5LMNL 4PMWA 4JK1C 1G2SA 4FP5D 1JICA 1J5EL 2JN4A 2DUDA 4KI0A 1MIUA 4LK1C 4DFAA 4MTNA 3EN2A 1CK1A 1QVFA 2DJFC 3I4LA 4O42A 4J6HA 3S14B 2NTSA 3HOWB 3J80L 1YZ6A 2K03A 2ENBA 4OHJA 1TS4A 2VXWA 1HNXL 4K2LA 1MGSA 4N8FA 1CT1D 1G91A 3EVQA 3GTGB 1AW7A 1WOCA 3CMAA 2UXDL 3KF6A 3KUPA 2OCEA 1NUCA 4X66L 3DUZA 1HUMA 4ZKBB 2VUMG 3URYA 2D0PA 1WD1A 2A6HC 1PRTB 4KHVA 1H9JA 4K6LA 2R7ZH 1DCZA 1LTAD 5E4XA 4BY1G 2B2YA 2PPBC 2VQFQ 1KXLA 5M3FB 1I3QH 4OO1G 4XYOA 3MA2B 1WTRA 2D62A 2OXPA 3TDQA 1K83B 3HEJA 2XNAC 2BE5C 4B3ML 1Z47A 3FRPB 3NWTA 4UPAA 4J8QA 4RGNA 1V1OA 4AH6A 2F0JA 3D0FA 3U58A 1DYQA 2E2IH 3FEWX 5CV4A 1I3QB 4GKJL 3TN2A 1RTOA 3U4ZA 1XPUA 3GV6A 5C4XG 3HRZC 4NXML 2GVBA 2K5VA 4FVMA 4OO1I 2WKCA 3MTSA 2JQOA 4RGTA 1A2UA 2WAQG 4OELB 2NB0A 4IFDG 3FKIH 1TWFH 2L9HA 4CJ2C 1SYDA 3S15B 1CKNB 1QWYA 4IN3A 4JI0L 2B2WA
chains in the Genus database with same CATH topology
2NZOA 3FKIG 2H5XA 3IRBA 1KRTA 4YWKA 3KF8B 4GKKQ 4LFBL 5C3EH 4TQUS 4B3TL 2VNUD 2RHSB 2N8NA 3A5UA 2HQLA 3M85A 1HR0W 5M3MH 2KHJA 2VQEQ 3I4OA 2OTLA 4JBMA 3CW2C 1Q12A 3I4NH 1KHIA 3A5ZB 4JI4L 3S1RH 1K3RA 3M4OH 4DV3Q 4OWWB 1LUZA 2EXDA 4JV5Q 4IFDJ 4X62Q 5LMUQ 1NMFA 2EIFA 2CWAA 2KBNA 4HJ5A 2PMZE 1KD1C 2HIVA 4RMFA 5AJ3L 4KHPQ 1RIPA 2K14A 2B63G 2EQSA 1HZAA 1UE1A 3KOJA 1QVCA 4IPDA 5FLXc 4LFCL 4R4QA 5IYCG 5LMNQ 3PUYA 1BVSA 1XMOL 1IBMQ 4JOIA 4GOPA 1PYBA 3CPFA 2F4VL 1E7ZA 4IFDI 3GD7A 4K0KL 1KRSA 3GTPH 4LFBQ 3UDIA 5JJIA 4PG3A 1X65A 4LUZA 4P75A 4DV5L 2Z6KC 3HOXH 1Q1BA 1WCMH 5IYBG 1YBYA 1VQ8A 1EIYB 3BU2A 4OX9Q 3GDEA 2F4VQ 2UXBQ 2VQEL 1V9PA 3RR5A 1EWIA 4QY7A 2Y0SE 2JA5G 3KDFB 5C44H 4JC0A 3RNUA 5GROA 5GAEC 1BKBA 5C0XI 1EQQA 1XNQL 2ASBA 4UP7A 4IPCA 4EX5A 1B8AA 4A3MH 1YHQA 4B3SL 1XTDA 4QGUA 2ZM6L 1SMXA 1CSQA 2JEBI 4GOPB 2VQFL 3S15H 2HT1A 1X6OA 2ZJPA 4HIOA 3PIOA 3DLLA 1FJGQ 2VY3A 1O7IA 2ALYB 3EBEA 1Q86C 1Y1WH 2IX0A 2MNAA 1T9HA 3G4SA 1PH8A 1E24A 1EYGA 4LNQA 4DR4Q 5JJLA 5IYBH 1JB7A 3RLOA 3CPWA 3GTJH 3NBHB 3S1QH 4BXXG 4HIDA 4BA1I 4BY7G 3OTOL 2KCTA 4AYBG 3PF5A 3ULJA 4JI7Q 4A3JG 3HOWG 1N36Q 2D0OA 2I0QA 4B3RQ 1VQHA 1SFOH 4IO9A 1W2BA 3CC4A 4DKAC 4A3IH 1G51A 4DR3Q 1OTCA 4L5QA 2Z0SA 1N34L 4JI6L 2YV5A 1XMOQ 2XTIA 2JEAI 4A3GH 2JE6I 2Q2IA 3AQQA 1J6QA 1N36L 5H1SE 2Q2HA 3G71A 1AE3A 1JJGA 2ZJRA 2ZJQA 4PZ7A 3BJUA 1VQNA 3RLFA 2A19A 3TS0A 4XTCS 2CQOA 3L2PA 3STBD 2DGYA 1GD7A 4NXNQ 4JYAQ 1HNWQ 1VQMA 5J3BA 3UDXA 4DV2Q 2JA7H 2JA6H 1D7QA 2K75A 3NELA 2AMCB 3K81C 3E0EA 5C4XH 4JBJA 1VQOA 1Y1WG 1X9NA 1CUKA 3HKZE 4KHPL 2OQKA 1WCMG 3J80c 3CXCA 3CMEA 2Q2UA 4GLVB 3VDYA 1XNRL 5C0XJ 4JCVE 3OTOQ 1IYJB 1QUQA 4NPSA 1E1TA 2WB1E 4YHHQ 1VQ9A 4BA2I 1KIXA 1N33L 1XPOA 2JA8H 4LF8L 2MFIA 2R93G 3D31A 1FJGL 2I5HA 3I2ZA 2JA5H 1Y14B 3GTLH 4UP8A 3S2HH 1G6PA 2YTVA 4ALPA 4BBSG 4YCWA 4OX9L 2NVQH 1N32Q 2R92H 1I50H 2BH2A 2UXBL 3G48A 4MZ9A 4DR6Q 1V43A 4AQYQ 4LF5Q 4A3CH 2VZAA 4OONA 4LUOA 1L0WA 3UE1A 3S16H 1NJIC 4UY8C 1XNQQ 1N8RC 1B70B 3JC66 3CCEA 3RN2A 2R7DA 2JA7G 3S1MH 4APVA 4A3BG 3U4VA 4DV2L 2GVAA 2F52A 3RZOH 3S14H 4H02A 5IE8A 3H15A 4X62L 5LMUL 4GN3B 4LFAQ 3RZDH 2E2JH 4OWTB 5ELOA 1I94Q 1KAWA 3HKSA 3I55A 3CCJA 3JAMi 2B3GA 1EQRA 1X55A 1VQAA 1LYLA 2VS1A 3AFPA 3PUWA 4P74A 4B3TQ 1TWAH 3KFUA 4A3DG 1HR0Q 4Y52H 4A3IG 1VQJA 1XMQL 1K9MC 2Z6KA 4QIWE 3CCVA 1MJEA 1UWVA 1NBWA 2QGQA 5E7NA 4DR3L 4JI6Q 4NXMQ 3L0OA 5C0XG 1HR0L 5FJ8G 3B6YA 4GNXB 2UU9L 3PF4A 3T1YL 1C0AA 4DR5Q 4X66Q 2AWNA 4BBRH 2E5LQ 2NN6I 1CKMA 4DUYL 5GQOA 3PCOB 2UXCQ 3ULLA 1VQLA 3HKZG 3U50C 3J81i 3PUXA 4R4IA 4UP9A 5IYDG 1VS0A 1I5FA 4DV0L 2K5NA 1HZBA 4OXPA 4A3EG 2R93H 3GO5A 1VQPA 4GNXA 4J15A 1M1KC 1VQGA 1CKOA 2PQAA 4JYAL 1SROA 1X3FA 4BBRG 3S24A 3F1ZA 2PI2A 3EIVA 5M3FG 4JI8L 3CQZH 2LXKA 2N3SA 3SGIA 4DAMA 1IBKL 3H0GH 5JEAJ 1WI5A 4C2MH 4A3BH 2AWOA 1PH3A 4EQ5A 1Q8KA 5IP9H 1WFQA 2V1CC 3PO3G 3CCLA 4LF8Q 3MEFA 1N33Q 2NZHA 4DV7L 1FVIA 2N49A 2VL6A 2ZM6Q 1P16A 3NENA 1EFWA 2UU9Q 2E8GA 1S72A 4AYBE 3CF5A 1AE2A 3UDGA 1NE3A 1ASYA 2UXDQ 1QZHA 2KENA 3M3YH 5M5XH 4A3EH 2PQAB 5M5YH 2LXJA 2HIXA 1JMCA 2YTYA 5C4JH 1Y1VG 4YCUA 4JI2Q 5M5WH 2OQ0A 2CCZA 4L5RC 2I5LX 1VQBA 2IT1A 3FP9A 4GS3A 4DNIA 3HOZH 1LM0A 3W1GA 2B29A 3A74A 4A3KH 2Y0SG 4X6AH 2IX1A 1L1OC 3KJPA 5K36G 1UE5A 4L5TA 3CAMA 1GM5A 3J7A5 1GO3E 1SR3A 1BBUA 4QJFA 3T1HQ 1VQCA 3KJOA 1VQ6A 1OXVA 1TXYA 4IJHA 3UDFA 2IHFA 3J7ZC 1C7YA 1PYSB 1V1QA 1XNRQ 3K7AH 3OW2A 4DR2L 4GLXA 4JI1Q 3T1YQ 3NEMA 4LFAL 1A63A 1K73C 4BXXH 3I4NG 3PO2H 2R7FA 1BBWA 1K83H 4JG2A 4R4CA 3PUZA 3HOWH 1X56A 4IPGA 1OXSC 2HHHQ 3PGZA 2UUCL 2WB1G 4B3RL 4DR2Q 4IJLA 4LUVA 3I4MG 4ME3A 1YHBA 2A1AA 2K5HA 5IY0A 1JJCB 1PH7A 1DGSA 1VQIA 1OXUA 2IY5B 4NB3A 4YCVA 4AQYL 1YI2A 4LF5L 2ATWA 2NVTH 1SN8A 4R4TA 4A3FH 3GTGH 1JE5A 2NVXH 3KYHC 4YWLA 1QVGA 2XGTA 1PFSA 4NXNL 5BR8Q 4GNXC 3CC2A 4LF7Q 4GKJQ 3STBC 1QUQB 3S17H 2KHIA 4IPHA 2IHEA 1A0IA 2QA4A 1OXXK 3TREA 4JI4Q 3CC7A 2JK8A 2K50A 4XIGS 4A3LH 3CCUA 3S2DH 1GVPA 2C35B 3F2BA 3ULPA 3DM3A 3J81c 1HNZL 2L15A 1YVCA 4O2DA 1PH1A 1IBKQ 4LF6Q 4YHHL 5M3FH 4A93H 4GN4B 1X3GA 5C3EG 2E5LL 3L7ZC 1VQEA 3ERSX 4JI7L 3LGJA 1PH9A 4K0KQ 3TS2A 1AH9A 3AEVA 4DR1Q 4JBWA 4A3MG 2E2HH 2AKWB 1A8VA 2F3IA 2AHOB 1UE6A 4QQBX 3F2CA 4MNOA 1Q81C 3CCRA 1VQFA 3HFZB 1S40A 2WFWA 3GTKH 5JEAG 4POFA 4JOIC 2NVYH 4DPGA 4GOPC 4A3FG 5IYDH 4RG1A 4DV4Q 3I7FA 1K8GA 2ES2A 1A62A 1NY4A 4O0AA 2YU9H 1PVOA 2RCNA 3WWVA 4KLKA 5HGQA 3I56A 2JA9A 4HJAA 1K8AC 4A3LG 4DR5L 5IT9c 5FJ8H 1HNXQ 3I4MH 3PIPA 1PH2A 4A3JH 3E9HA 1B7YB 3K7UC 1FL0A 2BA1A 1KC8C 1YIJA 1Y1VH 5IWAL 1X54A 1SE8A 1PH6A 3FHWA 2UUBL 3HOUH 3T1HL 3PSIA 2Q2TA 5IWAQ 3TEHB 4JI1L 1L1OA 1Q7YC 3AFQA 4HIKA 4DV5Q 3W1BA 3KF6B 3ZJYC 4POGA 4DR1L 3H3VI 4JI8Q 1Z9FA 2R6GA 4DV7Q 3BZKA 1IXRA 4LWCA 3K0XA 4HIMA 1PV4A 5DLQE 1I94L 1QZGA 2LSSA 1R9TH 2NN6G 2HHHL 4DV4L 4BY7H 1L1OB 4A93G 5M3MG 4PZ6A 4X64L 3TQYA 2CFMA 1N34Q 1HNZQ 4LF6L 2CKZB 1KL9A 2YYZA 4YWMA 4DV1Q 5GAHC 2GN5A 2VUMH 3CD6A 1FGUA 3H0GG 1I6HH 4LF9L 3RLNA 4BBSH 1N32L 4DK6C 1J5EQ 1X3EA 2ID0A 1K0RA 2ZTCA 3TRZA 3GTMH 2ZTEA 3HOVG 1E1OA 4JI0Q 2JJQA 4B3MQ 3RN5A 3Q8DA 4DV1L 1P8LA 4LF7L 2BH8A 3AYHB 3BZCA 2WP8J 4C3HH 4R1JA 4DAYB 4GN5A 2UUAQ 5IYCH 3M4QA 5C44G 3ICEA 2MO1A 4DR7L 3ER0A 1WYDA 1IBML 5IP9G 1Q82C 3GTQH 3GTOH 3E9IA 1D8LA 2OWOA 1E22A 3G6EA 2I5MX 1SLJA 3H3VH 4LW1A 2K52A 5IP7G 2K4KA 1WJJA 5GAGC 4BY1H 4R4OA 5HY6A 5BR8L 4DV3L 4X65Q 2CWPA 4JI5L 1Q46A 1UE7A 3CP0A 1ASZA 1EOVA 1YJWA 4LFCQ 2JA6G 2ZTDA 1IBLL 2UUCQ 2WAQE 4IOCA 3PO2G 4A76A 3PUVA 3HOYG 2N78A 4QL5A 1PA6A 4X64Q 4GLAC 4C3IH 5LMNL 4JI3Q 1LTLA 3MXNB 4PMWA 3JAMc 3UE0A 4LF4Q 4GKKL 2OTJA 1G291 3F2DA 1TWGH 1U5KA 3A0JA 4JI2L 4DR6L 1MKHA 1J5EL 1N9WA 1RL2A 1L2FA 2PI2E 4JI3L 2DUDA 3J81j 4KI0A 1MIUA 4MTNA 4DV0Q 1NTGA 4HJ8A 3EN2A 4WJ4A 1QVFA 1S3OA 1TWCH 2VW9A 4PZ8A 1VCIA 2FXQA 1HNWL 4TVAB 3HOZG 3W5OA 1M90C 1EUJA 4B3SQ 1HZ9A 1YZ6A 5IP7H 5GADC 3CCQA 1KQSA 1HZCA 4OWXB 2QEXA 1JT8A 3CCSA 1TWHH 1HNXL 3KDFA 3M7NA 1XMQQ 2UUAL 1PH5A 1H95A 4IOAA 1XPRA 1PHJA 3HOYH 1HH2P 1YITA 2UUBQ 1WOCA 1JJ2A 4A3KG 3CMAA 2UXDL 1VQ5A 1HJPA 1SRUA 5JJKA 3KF6A 2OCEA 1U0LA 4X66L 4C3JH 4JBKA 4LF9Q 1CSPA 3KLWA 1IL2A 3K8AA 1E3PA 1VQKA 5ELNA 2VUMG 5FLMH 2MQHA 2R7ZG 2D0PA 1IBLQ 4DV6Q 1VQ7A 3PO3H 1YHAA 4HJ7A 4WJ3M 3HOXG 4A3CG 2A8VA 2R7ZH 4A75A 5FLMG 4BY1G 4A3DH 2VQFQ 2R92G 1KXLA 3J80i 1I3QH 1W3SA 4OO1G 4P72A 2PNHA 2D62A 3K80C 1GKHA 5EAYA 4AIMA 2RHQB 4DR7Q 3M4PA 3PV0A 4P71A 3S1NH 2JA8G 4A3GG 1OXTA 4FDBA 1UEBA 3M9BA 4B3ML 1Z47A 2BA0A 2MO0A 4UPAA 4P73A 4AH6A 4JV5L 4X65L 3D0FA 3U58A 4DUYQ 2UXCL 2E2IH 1YNXA 5AJ3Q 4GKJL 3F8TA 2KCMA 1CKNA 4Y7NH 4LF4L 3U4ZA 1XPUA 1IZ6A 4YY3Q 4DUZL 4NXML 5C4XG 2GVBA 2K5VA 4A4IA 2RF4A 4DR4L 4OO1I 5LMNW 2JQOA 3CCMA 1C9OA 2WAQG 1YEZA 1YJ9A 1MJCA 4DV6L 4HJ9A 1VQDA 4KHZA 4IFDG 3FKIH 1Q1EA 4JI5Q 1TWFH 4L5SA 2B63H 4YY3L 3OYYA 4DUZQ 1VQ4A 1YJNA 1EIFA 1XJVA 1PH4A 1CKNB 4JI0L 3HOVH 1NMGA 3HOUG 2YTXA 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZO A;  3FKI G;  2H5X A;  3IRB A;  1KRT A;  4YWK A;  3KF8 B;  4GKK Q;  4LFB L;  5C3E H;  4TQU S;  4B3T L;  2VNU D;  2RHS B;  2N8N A;  3A5U A;  2HQL A;  3M85 A;  1HR0 W;  5M3M H;  2KHJ A;  2VQE Q;  3I4O A;  2OTL A;  4JBM A;  3CW2 C;  1Q12 A;  3I4N H;  1KHI A;  3A5Z B;  4JI4 L;  3S1R H;  1K3R A;  3M4O H;  4DV3 Q;  4OWW B;  1LUZ A;  2EXD A;  4JV5 Q;  4IFD J;  4X62 Q;  5LMU Q;  1NMF A;  2EIF A;  2CWA A;  2KBN A;  4HJ5 A;  2PMZ E;  1KD1 C;  2HIV A;  4RMF A;  5AJ3 L;  4KHP Q;  1RIP A;  2K14 A;  2B63 G;  2EQS A;  1HZA A;  1UE1 A;  3KOJ A;  1QVC A;  4IPD A;  5FLX c;  4LFC L;  4R4Q A;  5IYC G;  5LMN Q;  3PUY A;  1BVS A;  1XMO L;  1IBM Q;  4JOI A;  4GOP A;  1PYB A;  3CPF A;  2F4V L;  1E7Z A;  4IFD I;  3GD7 A;  4K0K L;  1KRS A;  3GTP H;  4LFB Q;  3UDI A;  5JJI A;  4PG3 A;  1X65 A;  4LUZ A;  4P75 A;  4DV5 L;  2Z6K C;  3HOX H;  1Q1B A;  1WCM H;  5IYB G;  1YBY A;  1VQ8 A;  1EIY B;  3BU2 A;  4OX9 Q;  3GDE A;  2F4V Q;  2UXB Q;  2VQE L;  1V9P A;  3RR5 A;  1EWI A;  4QY7 A;  2Y0S E;  2JA5 G;  3KDF B;  5C44 H;  4JC0 A;  3RNU A;  5GRO A;  5GAE C;  1BKB A;  5C0X I;  1EQQ A;  1XNQ L;  2ASB A;  4UP7 A;  4IPC A;  4EX5 A;  1B8A A;  4A3M H;  1YHQ A;  4B3S L;  1XTD A;  4QGU A;  2ZM6 L;  1SMX A;  1CSQ A;  2JEB I;  4GOP B;  2VQF L;  3S15 H;  2HT1 A;  1X6O A;  2ZJP A;  4HIO A;  3PIO A;  3DLL A;  1FJG Q;  2VY3 A;  1O7I A;  2ALY B;  3EBE A;  1Q86 C;  1Y1W H;  2IX0 A;  2MNA A;  1T9H A;  3G4S A;  1PH8 A;  1E24 A;  1EYG A;  4LNQ A;  4DR4 Q;  5JJL A;  5IYB H;  1JB7 A;  3RLO A;  3CPW A;  3GTJ H;  3NBH B;  3S1Q H;  4BXX G;  4HID A;  4BA1 I;  4BY7 G;  3OTO L;  2KCT A;  4AYB G;  3PF5 A;  3ULJ A;  4JI7 Q;  4A3J G;  3HOW G;  1N36 Q;  2D0O A;  2I0Q A;  4B3R Q;  1VQH A;  1SFO H;  4IO9 A;  1W2B A;  3CC4 A;  4DKA C;  4A3I H;  1G51 A;  4DR3 Q;  1OTC A;  4L5Q A;  2Z0S A;  1N34 L;  4JI6 L;  2YV5 A;  1XMO Q;  2XTI A;  2JEA I;  4A3G H;  2JE6 I;  2Q2I A;  3AQQ A;  1J6Q A;  1N36 L;  5H1S E;  2Q2H A;  3G71 A;  1AE3 A;  1JJG A;  2ZJR A;  2ZJQ A;  4PZ7 A;  3BJU A;  1VQN A;  3RLF A;  2A19 A;  3TS0 A;  4XTC S;  2CQO A;  3L2P A;  3STB D;  2DGY A;  1GD7 A;  4NXN Q;  4JYA Q;  1HNW Q;  1VQM A;  5J3B A;  3UDX A;  4DV2 Q;  2JA7 H;  2JA6 H;  1D7Q A;  2K75 A;  3NEL A;  2AMC B;  3K81 C;  3E0E A;  5C4X H;  4JBJ A;  1VQO A;  1Y1W G;  1X9N A;  1CUK A;  3HKZ E;  4KHP L;  2OQK A;  1WCM G;  3J80 c;  3CXC A;  3CME A;  2Q2U A;  4GLV B;  3VDY A;  1XNR L;  5C0X J;  4JCV E;  3OTO Q;  1IYJ B;  1QUQ A;  4NPS A;  1E1T A;  2WB1 E;  4YHH Q;  1VQ9 A;  4BA2 I;  1KIX A;  1N33 L;  1XPO A;  2JA8 H;  4LF8 L;  2MFI A;  2R93 G;  3D31 A;  1FJG L;  2I5H A;  3I2Z A;  2JA5 H;  1Y14 B;  3GTL H;  4UP8 A;  3S2H H;  1G6P A;  2YTV A;  4ALP A;  4BBS G;  4YCW A;  4OX9 L;  2NVQ H;  1N32 Q;  2R92 H;  1I50 H;  2BH2 A;  2UXB L;  3G48 A;  4MZ9 A;  4DR6 Q;  1V43 A;  4AQY Q;  4LF5 Q;  4A3C H;  2VZA A;  4OON A;  4LUO A;  1L0W A;  3UE1 A;  3S16 H;  1NJI C;  4UY8 C;  1XNQ Q;  1N8R C;  1B70 B;  3JC6 6;  3CCE A;  3RN2 A;  2R7D A;  2JA7 G;  3S1M H;  4APV A;  4A3B G;  3U4V A;  4DV2 L;  2GVA A;  2F52 A;  3RZO H;  3S14 H;  4H02 A;  5IE8 A;  3H15 A;  4X62 L;  5LMU L;  4GN3 B;  4LFA Q;  3RZD H;  2E2J H;  4OWT B;  5ELO A;  1I94 Q;  1KAW A;  3HKS A;  3I55 A;  3CCJ A;  3JAM i;  2B3G A;  1EQR A;  1X55 A;  1VQA A;  1LYL A;  2VS1 A;  3AFP A;  3PUW A;  4P74 A;  4B3T Q;  1TWA H;  3KFU A;  4A3D G;  1HR0 Q;  4Y52 H;  4A3I G;  1VQJ A;  1XMQ L;  1K9M C;  2Z6K A;  4QIW E;  3CCV A;  1MJE A;  1UWV A;  1NBW A;  2QGQ A;  5E7N A;  4DR3 L;  4JI6 Q;  4NXM Q;  3L0O A;  5C0X G;  1HR0 L;  5FJ8 G;  3B6Y A;  4GNX B;  2UU9 L;  3PF4 A;  3T1Y L;  1C0A A;  4DR5 Q;  4X66 Q;  2AWN A;  4BBR H;  2E5L Q;  2NN6 I;  1CKM A;  4DUY L;  5GQO A;  3PCO B;  2UXC Q;  3ULL A;  1VQL A;  3HKZ G;  3U50 C;  3J81 i;  3PUX A;  4R4I A;  4UP9 A;  5IYD G;  1VS0 A;  1I5F A;  4DV0 L;  2K5N A;  1HZB A;  4OXP A;  4A3E G;  2R93 H;  3GO5 A;  1VQP A;  4GNX A;  4J15 A;  1M1K C;  1VQG A;  1CKO A;  2PQA A;  4JYA L;  1SRO A;  1X3F A;  4BBR G;  3S24 A;  3F1Z A;  2PI2 A;  3EIV A;  5M3F G;  4JI8 L;  3CQZ H;  2LXK A;  2N3S A;  3SGI A;  4DAM A;  1IBK L;  3H0G H;  5JEA J;  1WI5 A;  4C2M H;  4A3B H;  2AWO A;  1PH3 A;  4EQ5 A;  1Q8K A;  5IP9 H;  1WFQ A;  2V1C C;  3PO3 G;  3CCL A;  4LF8 Q;  3MEF A;  1N33 Q;  2NZH A;  4DV7 L;  1FVI A;  2N49 A;  2VL6 A;  2ZM6 Q;  1P16 A;  3NEN A;  1EFW A;  2UU9 Q;  2E8G A;  1S72 A;  4AYB E;  3CF5 A;  1AE2 A;  3UDG A;  1NE3 A;  1ASY A;  2UXD Q;  1QZH A;  2KEN A;  3M3Y H;  5M5X H;  4A3E H;  2PQA B;  5M5Y H;  2LXJ A;  2HIX A;  1JMC A;  2YTY A;  5C4J H;  1Y1V G;  4YCU A;  4JI2 Q;  5M5W H;  2OQ0 A;  2CCZ A;  4L5R C;  2I5L X;  1VQB A;  2IT1 A;  3FP9 A;  4GS3 A;  4DNI A;  3HOZ H;  1LM0 A;  3W1G A;  2B29 A;  3A74 A;  4A3K H;  2Y0S G;  4X6A H;  2IX1 A;  1L1O C;  3KJP A;  5K36 G;  1UE5 A;  4L5T A;  3CAM A;  1GM5 A;  3J7A 5;  1GO3 E;  1SR3 A;  1BBU A;  4QJF A;  3T1H Q;  1VQC A;  3KJO A;  1VQ6 A;  1OXV A;  1TXY A;  4IJH A;  3UDF A;  2IHF A;  3J7Z C;  1C7Y A;  1PYS B;  1V1Q A;  1XNR Q;  3K7A H;  3OW2 A;  4DR2 L;  4GLX A;  4JI1 Q;  3T1Y Q;  3NEM A;  4LFA L;  1A63 A;  1K73 C;  4BXX H;  3I4N G;  3PO2 H;  2R7F A;  1BBW A;  1K83 H;  4JG2 A;  4R4C A;  3PUZ A;  3HOW H;  1X56 A;  4IPG A;  1OXS C;  2HHH Q;  3PGZ A;  2UUC L;  2WB1 G;  4B3R L;  4DR2 Q;  4IJL A;  4LUV A;  3I4M G;  4ME3 A;  1YHB A;  2A1A A;  2K5H A;  5IY0 A;  1JJC B;  1PH7 A;  1DGS A;  1VQI A;  1OXU A;  2IY5 B;  4NB3 A;  4YCV A;  4AQY L;  1YI2 A;  4LF5 L;  2ATW A;  2NVT H;  1SN8 A;  4R4T A;  4A3F H;  3GTG H;  1JE5 A;  2NVX H;  3KYH C;  4YWL A;  1QVG A;  2XGT A;  1PFS A;  4NXN L;  5BR8 Q;  4GNX C;  3CC2 A;  4LF7 Q;  4GKJ Q;  3STB C;  1QUQ B;  3S17 H;  2KHI A;  4IPH A;  2IHE A;  1A0I A;  2QA4 A;  1OXX K;  3TRE A;  4JI4 Q;  3CC7 A;  2JK8 A;  2K50 A;  4XIG S;  4A3L H;  3CCU A;  3S2D H;  1GVP A;  2C35 B;  3F2B A;  3ULP A;  3DM3 A;  3J81 c;  1HNZ L;  2L15 A;  1YVC A;  4O2D A;  1PH1 A;  1IBK Q;  4LF6 Q;  4YHH L;  5M3F H;  4A93 H;  4GN4 B;  1X3G A;  5C3E G;  2E5L L;  3L7Z C;  1VQE A;  3ERS X;  4JI7 L;  3LGJ A;  1PH9 A;  4K0K Q;  3TS2 A;  1AH9 A;  3AEV A;  4DR1 Q;  4JBW A;  4A3M G;  2E2H H;  2AKW B;  1A8V A;  2F3I A;  2AHO B;  1UE6 A;  4QQB X;  3F2C A;  4MNO A;  1Q81 C;  3CCR A;  1VQF A;  3HFZ B;  1S40 A;  2WFW A;  3GTK H;  5JEA G;  4POF A;  4JOI C;  2NVY H;  4DPG A;  4GOP C;  4A3F G;  5IYD H;  4RG1 A;  4DV4 Q;  3I7F A;  1K8G A;  2ES2 A;  1A62 A;  1NY4 A;  4O0A A;  2YU9 H;  1PVO A;  2RCN A;  3WWV A;  4KLK A;  5HGQ A;  3I56 A;  2JA9 A;  4HJA A;  1K8A C;  4A3L G;  4DR5 L;  5IT9 c;  5FJ8 H;  1HNX Q;  3I4M H;  3PIP A;  1PH2 A;  4A3J H;  3E9H A;  1B7Y B;  3K7U C;  1FL0 A;  2BA1 A;  1KC8 C;  1YIJ A;  1Y1V H;  5IWA L;  1X54 A;  1SE8 A;  1PH6 A;  3FHW A;  2UUB L;  3HOU H;  3T1H L;  3PSI A;  2Q2T A;  5IWA Q;  3TEH B;  4JI1 L;  1L1O A;  1Q7Y C;  3AFQ A;  4HIK A;  4DV5 Q;  3W1B A;  3KF6 B;  3ZJY C;  4POG A;  4DR1 L;  3H3V I;  4JI8 Q;  1Z9F A;  2R6G A;  4DV7 Q;  3BZK A;  1IXR A;  4LWC A;  3K0X A;  4HIM A;  1PV4 A;  5DLQ E;  1I94 L;  1QZG A;  2LSS A;  1R9T H;  2NN6 G;  2HHH L;  4DV4 L;  4BY7 H;  1L1O B;  4A93 G;  5M3M G;  4PZ6 A;  4X64 L;  3TQY A;  2CFM A;  1N34 Q;  1HNZ Q;  4LF6 L;  2CKZ B;  1KL9 A;  2YYZ A;  4YWM A;  4DV1 Q;  5GAH C;  2GN5 A;  2VUM H;  3CD6 A;  1FGU A;  3H0G G;  1I6H H;  4LF9 L;  3RLN A;  4BBS H;  1N32 L;  4DK6 C;  1J5E Q;  1X3E A;  2ID0 A;  1K0R A;  2ZTC A;  3TRZ A;  3GTM H;  2ZTE A;  3HOV G;  1E1O A;  4JI0 Q;  2JJQ A;  4B3M Q;  3RN5 A;  3Q8D A;  4DV1 L;  1P8L A;  4LF7 L;  2BH8 A;  3AYH B;  3BZC A;  2WP8 J;  4C3H H;  4R1J A;  4DAY B;  4GN5 A;  2UUA Q;  5IYC H;  3M4Q A;  5C44 G;  3ICE A;  2MO1 A;  4DR7 L;  3ER0 A;  1WYD A;  1IBM L;  5IP9 G;  1Q82 C;  3GTQ H;  3GTO H;  3E9I A;  1D8L A;  2OWO A;  1E22 A;  3G6E A;  2I5M X;  1SLJ A;  3H3V H;  4LW1 A;  2K52 A;  5IP7 G;  2K4K A;  1WJJ A;  5GAG C;  4BY1 H;  4R4O A;  5HY6 A;  5BR8 L;  4DV3 L;  4X65 Q;  2CWP A;  4JI5 L;  1Q46 A;  1UE7 A;  3CP0 A;  1ASZ A;  1EOV A;  1YJW A;  4LFC Q;  2JA6 G;  2ZTD A;  1IBL L;  2UUC Q;  2WAQ E;  4IOC A;  3PO2 G;  4A76 A;  3PUV A;  3HOY G;  2N78 A;  4QL5 A;  1PA6 A;  4X64 Q;  4GLA C;  4C3I H;  5LMN L;  4JI3 Q;  1LTL A;  3MXN B;  4PMW A;  3JAM c;  3UE0 A;  4LF4 Q;  4GKK L;  2OTJ A;  1G29 1;  3F2D A;  1TWG H;  1U5K A;  3A0J A;  4JI2 L;  4DR6 L;  1MKH A;  1J5E L;  1N9W A;  1RL2 A;  1L2F A;  2PI2 E;  4JI3 L;  2DUD A;  3J81 j;  4KI0 A;  1MIU A;  4MTN A;  4DV0 Q;  1NTG A;  4HJ8 A;  3EN2 A;  4WJ4 A;  1QVF A;  1S3O A;  1TWC H;  2VW9 A;  4PZ8 A;  1VCI A;  2FXQ A;  1HNW L;  4TVA B;  3HOZ G;  3W5O A;  1M90 C;  1EUJ A;  4B3S Q;  1HZ9 A;  1YZ6 A;  5IP7 H;  5GAD C;  3CCQ A;  1KQS A;  1HZC A;  4OWX B;  2QEX A;  1JT8 A;  3CCS A;  1TWH H;  1HNX L;  3KDF A;  3M7N A;  1XMQ Q;  2UUA L;  1PH5 A;  1H95 A;  4IOA A;  1XPR A;  1PHJ A;  3HOY H;  1HH2 P;  1YIT A;  2UUB Q;  1WOC A;  1JJ2 A;  4A3K G;  3CMA A;  2UXD L;  1VQ5 A;  1HJP A;  1SRU A;  5JJK A;  3KF6 A;  2OCE A;  1U0L A;  4X66 L;  4C3J H;  4JBK A;  4LF9 Q;  1CSP A;  3KLW A;  1IL2 A;  3K8A A;  1E3P A;  1VQK A;  5ELN A;  2VUM G;  5FLM H;  2MQH A;  2R7Z G;  2D0P A;  1IBL Q;  4DV6 Q;  1VQ7 A;  3PO3 H;  1YHA A;  4HJ7 A;  4WJ3 M;  3HOX G;  4A3C G;  2A8V A;  2R7Z H;  4A75 A;  5FLM G;  4BY1 G;  4A3D H;  2VQF Q;  2R92 G;  1KXL A;  3J80 i;  1I3Q H;  1W3S A;  4OO1 G;  4P72 A;  2PNH A;  2D62 A;  3K80 C;  1GKH A;  5EAY A;  4AIM A;  2RHQ B;  4DR7 Q;  3M4P A;  3PV0 A;  4P71 A;  3S1N H;  2JA8 G;  4A3G G;  1OXT A;  4FDB A;  1UEB A;  3M9B A;  4B3M L;  1Z47 A;  2BA0 A;  2MO0 A;  4UPA A;  4P73 A;  4AH6 A;  4JV5 L;  4X65 L;  3D0F A;  3U58 A;  4DUY Q;  2UXC L;  2E2I H;  1YNX A;  5AJ3 Q;  4GKJ L;  3F8T A;  2KCM A;  1CKN A;  4Y7N H;  4LF4 L;  3U4Z A;  1XPU A;  1IZ6 A;  4YY3 Q;  4DUZ L;  4NXM L;  5C4X G;  2GVB A;  2K5V A;  4A4I A;  2RF4 A;  4DR4 L;  4OO1 I;  5LMN W;  2JQO A;  3CCM A;  1C9O A;  2WAQ G;  1YEZ A;  1YJ9 A;  1MJC A;  4DV6 L;  4HJ9 A;  1VQD A;  4KHZ A;  4IFD G;  3FKI H;  1Q1E A;  4JI5 Q;  1TWF H;  4L5S A;  2B63 H;  4YY3 L;  3OYY A;  4DUZ Q;  1VQ4 A;  1YJN A;  1EIF A;  1XJV A;  1PH4 A;  1CKN B;  4JI0 L;  3HOV H;  1NMG A;  3HOU G;  2YTX A;  4DK3 C; 
#chains in the Genus database with same CATH topology
 3Q0A A;  1GOZ A;  3P7J A;  3KF8 B;  2N8N A;  2GA4 B;  1EZ8 A;  3JAM E;  1EWC A;  3I4N B;  5IGB A;  2KHJ A;  3I4O A;  3CW2 C;  4UAI A;  1SNC A;  1KHI A;  3M4O H;  4RAU C;  1LUZ A;  3A56 A;  1R4P B;  2N55 A;  1NMF A;  5KND A;  5KNC A;  1EY6 A;  2HCC A;  2EQS A;  1WTW A;  4JPB W;  1UE1 A;  1NSN S;  2KEE A;  5IYC G;  2R93 B;  4FYD A;  4JOI A;  1PYB A;  1LAB A;  2F4V L;  1K3B C;  2PW7 A;  3HOV B;  2EZV A;  4H13 C;  4LUZ A;  2Z6K C;  1YBY A;  3KBG A;  1HTP A;  2IJ0 A;  2K5W A;  2Y0S E;  2CW0 D;  3RNU A;  4JC0 A;  3IFT A;  4UP7 A;  4IPC A;  4HAE A;  4B3S L;  4MHE A;  4QGU A;  1SMX A;  2JEB I;  2VQF L;  1X6O A;  3SE0 A;  2QIL A;  2NUC A;  2Z9H A;  1EYD A;  1FJG Q;  2VY3 A;  3EBE A;  2IX0 A;  1PH8 A;  5C6A A;  5JJL A;  3CPW A;  3NK9 A;  3GTJ H;  1K28 A;  3PF5 A;  2I0Q A;  2IX3 A;  3D6W A;  1JOO A;  1OTC A;  2Z0S A;  1XMO Q;  1TS3 A;  1F77 A;  1A15 A;  4IAL A;  2Z8L A;  1K0S A;  3P75 A;  2YU9 B;  1JJG A;  4F88 A;  2D5D A;  3ERO A;  2ZJQ A;  3RLF A;  2A19 A;  4C3I G;  4A3M B;  1J8I A;  1GD7 A;  5J3B A;  1D7Q A;  4ULL A;  3PO2 B;  4LMQ D;  1M4V A;  1IYV A;  2OQK A;  1I4G A;  3CXC A;  3KLS A;  3VDY A;  3K5M A;  1IYJ B;  3ND9 A;  1KIX A;  2ZT9 C;  1XPO A;  2MFI A;  4G7H C;  2I5H A;  2B2T A;  3GTL H;  3CKI B;  1YNN D;  4BBS G;  4MZ9 A;  4AQY Q;  3NTH A;  4C1N I;  5M5W B;  1NR4 A;  3W2D A;  1VF5 C;  1XNQ Q;  1N8R C;  4I7A A;  3RN2 A;  4A3B G;  2B2U C;  2QKI C;  2GVA A;  2F52 A;  4H02 A;  2LY7 A;  4X62 L;  2RBM A;  2E2J H;  4KMU C;  4OWT B;  4X3U A;  3CCJ A;  3JAM i;  3PUW A;  3AFP A;  2X6L A;  3KFU A;  2OEO A;  1GHK A;  2XIW A;  3TP6 A;  1UWV A;  1NBW A;  3FPP A;  5C0X G;  5FJ8 G;  3PF4 A;  2E2D C;  1F2Y A;  4A3K B;  4IQZ A;  3E3X A;  2NN6 I;  4HN7 A;  3ULL A;  3U50 C;  4R4I A;  4UP9 A;  5LL6 S;  1VS0 A;  4DAV A;  2R93 H;  3MFG A;  4OXP A;  3GO5 A;  3HGB A;  2Z4I A;  1M1K C;  3RZO B;  1VQG A;  1CKO A;  1SRO A;  4BBR G;  4IUV A;  1A3T A;  1PRT F;  5C5M A;  4C2M H;  3MZ5 A;  1MSG A;  3ERQ A;  1PH3 A;  2V1C C;  1EWH A;  3IFD A;  4OIK A;  1FVI A;  1P16 A;  3NEN A;  2SNM A;  2Q8R E;  4HCS A;  3S9W A;  1NE3 A;  1ASY A;  1QZH A;  5JAV A;  1SDF A;  1PZK D;  3S1N B;  3D8G A;  3GTK B;  3T4A C;  3A8J E;  4YCU A;  4JI2 Q;  4L6T B;  3VYU A;  4L5R C;  3RD4 A;  2IT1 A;  3J81 L;  3HOZ H;  3U9O A;  2B29 A;  5C44 B;  3A74 A;  3MXP A;  3CHB D;  3KJP A;  5K36 G;  1UE5 A;  4OL7 A;  1T5X D;  2NVY B;  1KTK A;  1D5Z C;  1GO3 E;  2F0Q A;  1BBU A;  3T1H Q;  3QOJ A;  4FF3 A;  5ELD A;  5IOD A;  1B3Q A;  1O7Z A;  3J7Z C;  3Q23 A;  2IHF A;  1PYS B;  1V1Q A;  4HR7 B;  4DR2 L;  4PNY A;  4GLX A;  1A63 A;  4XXE A;  1K73 C;  4BXX H;  2EJF C;  4ZCK A;  4TSS A;  1D2B A;  4A3B B;  3PUZ A;  4K14 A;  3PGZ A;  5COR A;  3FKI B;  3WOF A;  2F0U A;  1YHB A;  2K5H A;  5IY0 A;  1VQI A;  1X32 A;  1PRT D;  1TII D;  3H91 A;  2PCF B;  3GTG H;  1JE5 A;  3R3O A;  3K0Y A;  4HCE A;  2JA6 B;  2AQ2 B;  3A8I E;  4J1M A;  4GNX C;  3CC2 A;  4GKJ Q;  1QUQ B;  4IPH A;  3CC7 A;  2JK8 A;  3H0G B;  5EPK A;  2K50 A;  1A2T A;  3CCU A;  1GVP A;  3WDN A;  2C35 B;  4DN4 M;  3F2B A;  4A3G B;  4B9W A;  4LF6 Q;  2MJ8 A;  4A93 H;  1IBK Q;  1LT4 D;  4GN4 B;  5C3E G;  4ZUJ A;  3QG1 A;  1VQE A;  4K0K Q;  1AH9 A;  3TS2 A;  4JBW A;  4A3M G;  2AKW B;  2F3I A;  1SYE A;  1Q81 C;  4MTK A;  3CCR A;  3S2H B;  5I6W A;  4DPG A;  3VA7 A;  2ES2 A;  1BUV T;  4XQQ A;  2O2L D;  4UDU C;  4KLK A;  2B8G A;  4HJA A;  5IGC A;  5IT9 c;  3I4M H;  4K5X A;  1B7Y B;  4A3J B;  1D5M C;  3VR4 A;  5IWA L;  1X54 A;  1PH6 A;  3HOU H;  3PSI A;  4ZUI A;  4Q0F A;  5IWA Q;  2F1M A;  1PFB A;  3H09 A;  4HIK A;  3X3M A;  2XRS D;  4FXG C;  2M9V A;  4POG A;  3X3N A;  2V4D A;  4KJN A;  4JI8 Q;  3V96 A;  4C1N K;  3EA6 A;  2K5D A;  4LJZ C;  4X3T A;  1HFN A;  4LWC A;  1PFN A;  5DLQ E;  3ITP A;  4S3S A;  1I94 L;  4KK7 A;  4KTA A;  1L1O B;  1F2Z A;  5FO8 B;  5EGT A;  4PZ6 A;  1HQR D;  3KF8 A;  2B2Y C;  4YWM A;  2KCC A;  1H9M A;  3H0G G;  3ZYY X;  1YNJ D;  1AZQ A;  3RLN A;  4LF9 L;  1RDP D;  4OIJ A;  4X3K A;  1N32 L;  2XVS A;  2PYK A;  2ZTE A;  3RN5 A;  1WTP A;  2AQ1 B;  4EQO A;  2BH8 A;  3AYH B;  3BZC A;  4R1J A;  3T56 B;  4DR7 L;  5IP9 G;  2KOL A;  3TP5 A;  4ZRZ A;  5D3D A;  1LTS D;  4H0L C;  2I5M X;  1SLJ A;  2NWG A;  4LW1 A;  4R4O A;  5HY6 A;  4DV3 L;  4X65 Q;  2CWP A;  1Q46 A;  2F0I A;  1YJW A;  2AUK A;  4ABN A;  4IOC A;  3PO2 G;  3PUV A;  1IHZ A;  4DXF A;  3JAM c;  3UE0 A;  2O5J C;  3F2D A;  3DXJ C;  1U5K A;  5CGK A;  1RD9 D;  3FPU B;  4DR6 L;  2PI2 E;  1TR5 A;  4JI3 L;  3VYS A;  3DMU A;  1B44 D;  2L55 A;  1NTG A;  4HJ8 A;  4WJ4 A;  1J9O A;  4ODG A;  1M90 C;  3C1E A;  3SEB A;  1HZ9 A;  1D1K A;  1I50 B;  4TKO B;  4DU9 A;  4RCO A;  1KQS A;  1PLF A;  1Y1V B;  5LL6 X;  1TWH H;  3KDF A;  1SYF A;  1VDZ A;  3M7N A;  4IUQ A;  2I46 A;  1VQ5 A;  1HJP A;  5JJK A;  1LT6 D;  4C3J H;  4LF9 Q;  5DAU A;  2PQE A;  4C2M B;  1IL2 A;  4KN7 C;  1TWA B;  4BY1 B;  1IBL Q;  2KQ3 A;  4ZAI A;  4DF7 A;  3PO3 H;  5D65 A;  4HJ7 A;  3HOX G;  4A3C G;  2KUM A;  4A3D B;  4A75 A;  2K7V A;  3IKJ A;  2H4O A;  2R92 G;  2XSC A;  4G7Z C;  4P72 A;  4G7O C;  3K80 C;  1WTV A;  4AIM A;  2RHQ B;  1GUN A;  4I7Z C;  2N88 A;  2JA8 G;  5M5Y B;  1T5E A;  1UEB A;  3M9B A;  3QO2 A;  3OWE B;  3D4R A;  1BNZ A;  4DUY Q;  5I4D A;  1Y8P B;  4LF4 L;  2RF4 A;  1LT3 D;  1X3Q A;  3GV3 A;  4DV6 L;  4HJ9 A;  1VQD A;  4LFB Q;  5IGF A;  4JI5 Q;  1Q1E A;  4YY3 L;  4DUZ Q;  1VQ4 A;  3EJI A;  5IGE A;  3I3C A;  1EIF A;  3HOU G;  5COY A;  3HOV H;  1NMG A;  3A5U A;  2VZA A;  3PIP A;  4DK3 C;  2F0L A;  2NZO A;  1QCB D;  4YWK A;  3R93 A;  5C3E H;  2R3Z A;  2RHS B;  4QUC A;  1PTO C;  4NKL A;  3R8B A;  3Q24 A;  3MXU A;  1HR0 W;  2O4X A;  2OTL A;  4JBM A;  3NE5 B;  3I4N H;  3L9A X;  2EYO A;  3S1R H;  4QCL A;  4OWW B;  2EPB A;  1H9R A;  1CTM A;  3DWQ A;  1SMY D;  4X62 Q;  4HJ5 A;  2CWA A;  2KBN A;  4BBS B;  2PMZ E;  1YNJ C;  1RIP A;  2K14 A;  4IPD A;  5FLX c;  1CZW A;  4LFC L;  4R4Q A;  3NTI A;  2Q8I B;  4KY6 A;  1ET9 A;  4K0K L;  5FK9 C;  3GTP H;  3UDI A;  5JJI A;  4DV5 L;  3BVG A;  3HOX H;  1Q1B A;  2X69 A;  1D5X C;  3BU2 A;  1EIG A;  1GHJ A;  3OWF A;  2JA5 G;  3KDF B;  5C44 H;  1DOM A;  2RQX A;  3SK6 A;  5GAE C;  3O13 A;  1XXG A;  1KDA A;  1XTD A;  1FNV A;  1V8Q A;  1EY5 A;  1C8C A;  4GOP B;  3BG3 A;  2ZJP A;  4HIO A;  3C1F A;  3PIO A;  2F3W A;  5DNF A;  3G4S A;  1BCP F;  2SNS A;  1EYG A;  2VB3 X;  3M4Y A;  1ILP A;  4DK0 A;  4BXX G;  4HID A;  4C3J G;  4BY7 G;  3OTO L;  2KCT A;  1F2L A;  1BCP B;  3HOW G;  1DM0 B;  1SNM A;  3CC4 A;  3LWE A;  4A3I H;  4DR3 Q;  1XX8 A;  5DEH A;  1N34 L;  3BZD B;  3AQQ A;  4A3F B;  1O78 A;  3PMF A;  2ZJR A;  1Y69 U;  1I4P A;  2NVT B;  3BJU A;  3M7G A;  3TS0 A;  4XTC S;  5CV8 A;  2J4X A;  2CQO A;  3L2P A;  2G9D A;  5ISR A;  2EJG C;  3HOZ B;  1VQM A;  1KLG D;  1SYC A;  4GZY C;  2K75 A;  2F0T A;  2LFN A;  4EVO A;  4JBJ A;  1Y1W G;  1FYC A;  3RZD B;  4KHP L;  2J0T D;  2M2L A;  5T1G A;  1WCM G;  3CME A;  3DHQ A;  3I70 A;  3A54 A;  4ZYS A;  5M9O A;  4GLV B;  5G3L D;  1QE6 A;  3OTO Q;  1QUQ A;  3L3O C;  3TZD A;  1I4R A;  1QIL A;  3VYT A;  4RFB A;  2B2W C;  5EKI A;  2JA8 H;  1EOT A;  2R93 G;  3D31 A;  5E3F A;  1Y14 B;  1B50 A;  1G6P A;  1ML0 D;  3PIO 3;  2F0O A;  4OX9 L;  1TY2 A;  2R92 H;  1I50 H;  1N32 Q;  4DR6 Q;  4H44 C;  3A55 A;  2XN9 C;  5CC4 A;  4A3C H;  1B2T A;  3MXG A;  3J7A F;  4LUO A;  3SK5 A;  3S16 H;  1NJI C;  3MHB A;  1JC7 A;  2L12 A;  3S1M H;  1X3P A;  5M3M B;  3RZO H;  2B63 B;  5LMU L;  2OF1 A;  1TS2 A;  2WII B;  5ELO A;  1I94 Q;  3HKS A;  3I55 A;  4CKC A;  3IAY A;  2R92 B;  1YNN C;  2VS1 A;  1LV9 A;  4DK1 A;  4IUU A;  5BN5 A;  4Y52 H;  1VQJ A;  1KNE A;  5IT9 L;  1S5C D;  4QIW E;  4R8I A;  2WAQ B;  2Y0S B;  5E7N A;  4NXM Q;  4RGM A;  4DR3 L;  1HR0 L;  4GNX B;  3B6Y A;  3E5S A;  4CKE A;  2O5I C;  1C0A A;  1B9N A;  1EYC A;  4JW0 A;  5IIF A;  2F0F A;  2E5L Q;  2UXC Q;  3PCO B;  1VQL A;  3HKZ G;  3J81 i;  3PUX A;  1VMP A;  1U4R A;  1EQV A;  2RSO A;  3SHL A;  1VQP A;  4J15 A;  5BN4 A;  4JYA L;  2PI2 A;  4JI8 L;  2LXK A;  1TU2 B;  4I65 A;  4UHV A;  4EQ5 A;  1Q8K A;  3BDL A;  1O7L A;  3CCL A;  3RMH A;  1GUO A;  3QB3 A;  4DV7 L;  2N49 A;  2VL6 A;  4AYB E;  1XYI A;  3CF5 A;  2KEN A;  5LHY 1;  1AZP A;  3HOX B;  5BN3 A;  3K59 A;  3OOC A;  2PQA B;  2K5Q A;  1CM9 A;  1JMC A;  5C4J H;  5C4Z A;  3NQI A;  1Z6H A;  5KYI A;  1ZEQ X;  2E2I B;  2I5L X;  3I4M B;  4DNI A;  2WB1 B;  4K5V A;  2L1B A;  4OGQ C;  4A3K H;  3V05 A;  1SR3 A;  3KJO A;  1VQ6 A;  1TXY A;  2EYL A;  4IJH A;  1C7Y A;  2MP1 A;  3OW2 A;  2D9U A;  2A73 B;  4DAP A;  4B08 A;  2L11 A;  4A93 B;  2BOS A;  2QEJ C;  4IUP A;  1BBW A;  1K83 H;  3I73 A;  4JG2 A;  4K2K A;  2CHB D;  4R4C A;  5FO9 B;  1AEX A;  4IPG A;  4C56 C;  3GTO B;  3T53 B;  5I2Y A;  4IJL A;  2NZ1 D;  3I4M G;  4ME3 A;  2A1A A;  3KBX A;  1PH7 A;  2B2V A;  2IY5 B;  4YCV A;  5KRU A;  4K6D A;  1YI2 A;  4LF5 L;  2NVT H;  5FLX E;  2FFK B;  1ENF A;  1U9R A;  3HOY B;  3H6M A;  4B9X A;  1QVG A;  1BBX C;  3GTL B;  2KHI A;  3I72 A;  4K5W A;  1OXX K;  3MVV A;  4JI4 Q;  2F0E A;  2IWH A;  1SSO A;  3ULP A;  3DM3 A;  4DA2 A;  1H9S A;  1YVC A;  2A68 D;  3A7A B;  1JCK B;  3L7Z C;  1PH9 A;  5I9O A;  2RDF A;  3AEV A;  5CBE E;  1UUP A;  2E2H H;  1TWG B;  3P20 A;  1STY A;  3F2C A;  2M00 A;  1VQF A;  3HFZ B;  1S40 A;  3GTK H;  4POF A;  2Z6B A;  4RG1 A;  4DV4 Q;  2F0H A;  1NY4 A;  4O0A A;  4BWG B;  2YU9 H;  1PVO A;  1GUW A;  3TSS A;  5HGQ A;  4DR5 L;  5FJ8 H;  1B9M A;  5KNB A;  2BA1 A;  1YIJ A;  4BY7 B;  1Y1V H;  4RKB A;  3AFQ A;  4DV5 Q;  1SJE D;  4PMB A;  3ZJY C;  4K8I A;  3LX0 A;  5IGD A;  1IXR A;  1PV4 A;  3OMG A;  4JVZ A;  3PIP 3;  2F0N A;  1QZG A;  2HHH L;  4DV4 L;  2EE1 A;  1BQQ T;  5C3W A;  4KKS A;  5M3M G;  3TQY A;  2CFM A;  5A2Q E;  1N34 Q;  4LF6 L;  2VUM H;  1S5E D;  4BBS H;  2ID0 A;  1LTG D;  1K0R A;  2ZTC A;  1STE A;  4WRD A;  4K8J A;  1E1O A;  1LT5 D;  2HDL A;  2JJQ A;  4HED A;  4JI0 Q;  3Q8D A;  1P8L A;  1A3U A;  2BDN A;  3ICE A;  5IYC H;  3M4Q A;  3ER0 A;  4NW2 A;  3GTQ H;  3HKZ B;  5NUC A;  2E2H B;  2WKD A;  2KVM A;  2K4K A;  1WJJ A;  1TQO A;  2A69 D;  2NTT A;  1Y1W B;  2ZTD A;  1DON A;  2WAQ E;  2PZU A;  4A76 A;  2K1B A;  1U4L A;  4RHS A;  4C3I H;  4X64 Q;  4LF4 Q;  1G29 1;  1MKH A;  2RDH A;  3J81 E;  1N9W A;  3J81 j;  3Q6S A;  1A3V A;  5J39 A;  1IKM A;  1TWC H;  2BCO A;  4PZ8 A;  1VCI A;  4TVA B;  3W5O A;  2DY8 A;  3VR5 A;  1HZC A;  4M8A A;  4OWX B;  4TRD A;  2QEX A;  1JT8 A;  2A6E C;  1XMQ Q;  2UUA L;  4IOA A;  1XPR A;  4G57 A;  2JA8 B;  1YIT A;  1G8Z D;  3IL8 A;  2EXZ A;  1JJ2 A;  4A3K G;  3C2P A;  2PW5 A;  4CDC C;  1SRU A;  4JBK A;  1VF7 A;  1CSP A;  3K8A A;  1E3P A;  1CA6 A;  1VQK A;  1JB3 A;  2R7Z G;  3VR3 A;  4DV6 Q;  1S5F D;  1LAC A;  1TS5 A;  1YHA A;  2L0C A;  2A6E D;  2TSS A;  5D14 A;  5A35 A;  4WJ3 M;  1GUT A;  4A3D H;  5E4W C;  1W3S A;  5EAY A;  1GKH A;  3BYY B;  3J7Y W;  2EYF A;  3M4P A;  3PV0 A;  1CHQ D;  4P71 A;  4A3G G;  1OXT A;  4FDB A;  5JOB A;  2BA0 A;  5FKA C;  1YNX A;  1BOS A;  3LWU A;  5AJ3 Q;  3F8T A;  2KCM A;  4Y7N H;  3T13 A;  1KDB A;  4YY3 Q;  4DUZ L;  4A4I A;  3FDT A;  4EQN A;  1NCV A;  3CCM A;  4CDF C;  1QB5 D;  5IT9 E;  1C9O A;  1YEZ A;  4CKB A;  2A69 C;  3G6J B;  1YJN A;  1XJV A;  3VYR A;  2YTX A;  1TVX A;  3NXW A;  3FKI G;  1KRT A;  1O7Y A;  4DXG A;  4TQU S;  3A8K E;  3K7A B;  3CU7 A;  3G7L A;  2HQL A;  1C48 A;  3M85 A;  5M3M H;  1Q12 A;  1ZKO A;  3A5Z B;  4JI4 L;  1K3R A;  4DAY A;  4IFD J;  1Q3L A;  5LMU Q;  4B3T L;  1Z7T A;  2HIV A;  4KHP Q;  5AJ3 L;  5EKL A;  4Q5V A;  3VR2 A;  1QVC A;  1EEI D;  3PUY A;  1BVS A;  1IBM Q;  1MI2 A;  2H1E A;  1BDO A;  2EYM A;  1AN8 A;  4CDD C;  4RGO S;  3DEP A;  4IFD I;  3GD7 A;  4FO2 A;  3D4D A;  1MHW C;  4R9W A;  4PG3 A;  1WCM H;  1ESF A;  2F3V A;  4OX9 Q;  1EIY B;  1L0X B;  3GDE A;  4HMI A;  3S1M B;  1V9P A;  3RR5 A;  1EWI A;  5ELC A;  4IZ8 A;  2ASB A;  2NN6 H;  1XNQ L;  5GRO A;  5CV9 A;  4EX5 A;  1H9S B;  1VMC A;  5F2D A;  2HT1 A;  1WVL A;  3E6Z X;  1O7I A;  2ALY B;  2RA4 A;  1Q86 C;  1Y1W H;  2MNA A;  1E24 A;  3SVM A;  2ICE C;  5IYB H;  3K5L A;  3RLO A;  5EQ0 A;  1JB7 A;  3S1Q H;  1TKW B;  4AYB G;  1II3 A;  1F9P A;  4JI7 Q;  1RKN A;  3HZX A;  4A3J G;  2SEB D;  2FMM A;  3BDO A;  4X3S A;  4B3R Q;  1VQH A;  2JYO A;  2D2C C;  4IO9 A;  2IPK D;  4JI6 L;  1SNP A;  3J7A V;  1PFM A;  2XTI A;  4A3G H;  2JE6 I;  2Q2I A;  1N36 L;  1S5D D;  1DXM A;  4EGV A;  1JQY D;  1AE3 A;  3G71 A;  4PZ7 A;  1VQN A;  5E1F A;  1I4H A;  4IFD H;  2EDG A;  4NXN Q;  1CQF A;  3UDX A;  2JA7 H;  2JA6 H;  3NUC A;  3NEL A;  3K81 C;  5C4X H;  1VQO A;  1X9N A;  3HKZ E;  2Q2U A;  5EPL A;  4DNT B;  3GTM B;  1XNR L;  5C0X J;  4BA2 I;  2WB1 E;  4YHH Q;  1VQ9 A;  1PTO B;  4NP5 A;  1MSH A;  1F2M A;  4C3H G;  2F0D A;  4CDE C;  1I4X A;  4PV1 C;  1FJG L;  2JA5 H;  4OO1 H;  1LTB D;  3BS1 A;  2XRQ D;  4ID6 A;  4ALP A;  4YCW A;  2UXB L;  2NVQ H;  5I6Y A;  3G48 A;  2EY2 A;  2DNC A;  1PZJ D;  1U4M A;  1HFG A;  1L0W A;  3UE1 A;  3CCE A;  3JC6 6;  2R7D A;  2JA7 G;  2B39 A;  3U4V A;  4C3H B;  2Z4H A;  1BF4 A;  1V1P B;  2F0K A;  5IE8 A;  3H15 A;  3RZD H;  4LFA Q;  4L63 B;  2DY7 A;  2B3G A;  1FD7 D;  1EQR A;  1STB A;  1X55 A;  1LYL A;  3HOU B;  2OT2 A;  2HUG A;  1HR0 Q;  4Y7N B;  4XDX A;  1XMQ L;  1K9M C;  2Z6K A;  1LO5 D;  1WTH A;  4IUT A;  4CGY B;  3CCV A;  5G3L F;  1MJE A;  2NVX B;  1SNQ A;  2PO4 A;  4JI6 Q;  2P5Z X;  4XT3 B;  4C3I B;  2L4N A;  2UU9 L;  4DR5 Q;  3NQT A;  2AWN A;  1CKM A;  2MGS A;  4QUF A;  5IYD G;  2SDF A;  1I5F A;  3NHH A;  4GNX A;  3AB9 A;  1ICW A;  3K5O A;  1PZI D;  1UEA B;  1HA6 A;  1HXY D;  1JWS D;  3F1Z A;  3EIV A;  1EU3 A;  3CQZ H;  3S17 B;  2N3S A;  3C46 A;  5JEA J;  2AWO A;  4ILW A;  5IP9 H;  3PO3 B;  1WFQ A;  2FIN B;  3PO3 G;  5CR3 A;  3MEF A;  4LF8 Q;  1I6H B;  3AU7 A;  1N33 Q;  2NZH A;  3NTK A;  2ZM6 Q;  5EPJ A;  2UU9 Q;  2E8G A;  1AE2 A;  2UXD Q;  1CFM A;  3VA5 A;  5M5X H;  4A3E H;  3M3Y H;  5M5Y H;  2LXJ A;  2HIX A;  1Y1V G;  4PQX A;  4LAA A;  1EFI D;  1Y8N B;  5J22 A;  1R4Q B;  3FP9 A;  4GS3 A;  1BO0 A;  2A68 C;  1ROD A;  4CHT B;  4L5T A;  4FNF A;  4WFN 3;  1GM5 A;  3S1R B;  3J7A 5;  1IW7 C;  4QJF A;  5ELB A;  1F9S A;  1G2T A;  1OXV A;  3K7A H;  3C3L A;  2K04 A;  3WOE A;  4LFA L;  3KLS X;  5C3E B;  5FLX L;  3I4N G;  4F8M A;  4IUR A;  3PO2 H;  2R7F A;  1B1Z A;  1ZYR D;  2K05 A;  3HOW H;  1X56 A;  1OXS C;  3OW7 A;  4LUV A;  1TWF B;  2KA7 A;  1SMY C;  1KLU D;  1OXU A;  4AQY L;  2ATW A;  2ICI A;  4A3F H;  1U4P A;  2NVX H;  3KYH C;  5EKK A;  1JR0 D;  2XGT A;  1PFS A;  1Q90 A;  5C5L A;  4NXN L;  5BR8 Q;  3STB C;  2F4I A;  2IHE A;  1EIH A;  2EYP A;  2QA4 A;  3TRE A;  4RCN A;  2PMZ B;  3QJY A;  3K58 A;  4A3L H;  1HUN A;  2J7Z A;  4FXD A;  3J81 c;  1HNZ L;  4O2D A;  4RA8 A;  3MXN A;  4YHH L;  5M3F H;  3T51 B;  4IUN A;  1FNU A;  1X3G A;  5CV7 A;  3CRL C;  3Q22 A;  4JI7 L;  3LGJ A;  4BBR B;  4DR1 Q;  3AMU A;  1SYG A;  1A8V A;  1EY4 A;  2AHO B;  4QQB X;  3NPP A;  4MNO A;  5JPM C;  5JEA G;  4JOI C;  2NVY H;  1AFP A;  1JE4 A;  5KEE A;  3I7F A;  1K8G A;  2I07 B;  3BVZ A;  2RCN A;  1B3A A;  4MIU A;  3I56 A;  4A3L G;  2JA9 A;  2K28 A;  1HNX Q;  2L5T A;  1PH2 A;  3FVQ A;  2JSO A;  3HP3 A;  1FL0 A;  4KKT A;  2UUB L;  1SFO B;  3FHW A;  3T1H L;  1CZG A;  3JAM L;  4RWS C;  4JI1 L;  5JPN C;  1B53 A;  2Q8T A;  3W1B A;  4DR1 L;  1Z9F A;  2HCI A;  4DV7 Q;  3BZK A;  3MEH A;  2HDM A;  3D6C A;  2LSS A;  1R9T H;  5KYL A;  4A93 G;  4X64 L;  2YYZ A;  3TBI B;  4KD3 A;  5GAH C;  3ND8 A;  1FGU A;  1NAP A;  2RCF A;  5KGU A;  2FJ2 A;  3VR6 A;  1X3E A;  3OIQ A;  3HOV G;  4XQN A;  4DV1 L;  4XT1 B;  4LF7 L;  2WP8 J;  4DAY B;  3QR8 A;  4GN5 A;  3T16 A;  1PXU A;  2FHT A;  1IBM L;  1WYD A;  1Q82 C;  2ZXO A;  1D8L A;  2OWO A;  5CBA E;  3KLR A;  1E22 A;  3G6E A;  3H3V H;  2K52 A;  5I2X A;  5IP7 G;  5BR8 L;  3S2D B;  2A5H A;  1UE7 A;  3CP0 A;  1ASZ A;  1B4O A;  1IBL L;  2UUC Q;  1WD0 A;  2RDG A;  1EY9 A;  2N78 A;  4QL5 A;  3HOY G;  2XWJ B;  4GLA C;  4JI3 Q;  1LTL A;  3MXN B;  4GKK L;  2OTJ A;  3A7L A;  1TWG H;  4NDX A;  3A0J A;  3SDZ A;  4EQP A;  1HA5 A;  4JI2 L;  1HHV A;  4M1U B;  1NNX A;  1ET6 A;  1RL2 A;  1L2F A;  1D1I A;  5C4J B;  4DV0 Q;  3MAQ A;  1PYW D;  3GTJ B;  1S3O A;  2JA7 B;  3HS0 C;  2VW9 A;  2AUJ D;  2EOT A;  2FXQ A;  1HNW L;  5KIX A;  5ELE A;  3HOZ G;  1EUJ A;  5C4X B;  4B3S Q;  2B2V C;  5IP7 H;  3D4W A;  1LTI D;  5GAD C;  3CCQ A;  2DNE A;  5K5P A;  3CCS A;  3OSO A;  4QIW B;  1JWM D;  1PH5 A;  3CRK C;  1H95 A;  3HOY H;  1PHJ A;  1ZXT A;  1I6H H;  1HH2 P;  2UUB Q;  1CI3 M;  3TME A;  1U0L A;  3U9S A;  1S5B D;  1QNU A;  3KLW A;  4ZQ3 A;  3BVM A;  5ELN A;  4KJO A;  5FLM H;  1AP0 A;  2MQH A;  2MPM A;  5JVG 3;  1VQ7 A;  1QJO A;  2F0S A;  4DGZ A;  2A8V A;  4ME5 A;  3H94 A;  5FLM G;  2R7Z B;  1D6E C;  3J80 i;  2EVB A;  1UAP A;  1HPC A;  2PNH A;  1KDC A;  4DR7 Q;  3GP7 A;  4QF4 A;  1RCV D;  2EY5 A;  3S1N H;  4XQJ A;  2MHV A;  1EY0 A;  5FOB B;  2MO0 A;  3NBH A;  4P73 A;  3N52 A;  4JV5 L;  4X65 L;  2K01 A;  2UXC L;  3TZU A;  2JXM B;  2NBF A;  1CKN A;  4AYB B;  1IZ6 A;  1DJR D;  2PZT A;  4HSV A;  4DR4 L;  5LMN W;  1JOR A;  2C9O A;  1STA A;  3EQL C;  1YJ9 A;  1MJC A;  3M3Y B;  4KHZ A;  1PMR A;  1DOK A;  4L5S A;  1IKL A;  2B63 H;  3OYY A;  2VB2 X;  3I91 A;  3OPO A;  4BS9 A;  1PH4 A;  4V0B A;  1W6J A;  2H5X A;  3IRB A;  1FGB D;  1SE4 A;  5CV6 A;  1L0Y B;  4LFB L;  4GKK Q;  4N9P A;  2VNU D;  2TMP A;  4QMG A;  2VQE Q;  2QDL A;  2RVL A;  3QOL A;  2LMC B;  2F0P A;  4DV3 Q;  4YIJ A;  2EXD A;  4JV5 Q;  1E2V A;  1KD1 C;  2EIF A;  1GJX A;  4N8X 1;  4RMF A;  2CQA A;  1STN A;  2B63 G;  1HZA A;  1ZYR C;  3KOJ A;  5LMN Q;  5J1Z A;  1QNK A;  1XMO L;  4GOP A;  2BDO A;  1PTO D;  4FF4 A;  3D3R A;  3S1Q B;  3CPF A;  3LNN A;  1E7Z A;  5C3X A;  2HD3 A;  3OHX C;  4V19 0;  1KRS A;  1HQM C;  1X65 A;  4P75 A;  1JOQ A;  5IYB G;  1DOL A;  1IW7 D;  1VQ8 A;  2UXB Q;  1QOH A;  2F4V Q;  2VQE L;  2K6A A;  4KV6 A;  4U68 A;  4QY7 A;  3DWA A;  1EEF D;  2DN8 A;  1EQQ A;  5C0X I;  1BKB A;  2CH4 W;  2E74 C;  1HRJ A;  2ZXP A;  3BYT B;  1B8A A;  4A3M H;  1YHQ A;  4RHR A;  2ZM6 L;  1CSQ A;  1R9T B;  2EYH A;  3S15 H;  4HTH A;  2F03 A;  3DLL A;  5EBD A;  3QWN A;  4WOR A;  4DR4 Q;  1T9H A;  4LNQ A;  1C4Q A;  3I8Z A;  3NBH B;  2IL8 A;  3MWY W;  4BA1 I;  4CJ0 B;  2WV6 D;  3ULJ A;  1N36 Q;  2D0O A;  1SFO H;  4WJW A;  1W2B A;  1STG A;  1DZ1 A;  4DKA C;  2RSN A;  1G51 A;  4L5Q A;  1I4Q A;  2KJX A;  4QB4 A;  2YV5 A;  4E6I A;  2JEA I;  1J6Q A;  1WTX A;  5H1S E;  2Q2H A;  2DJG C;  1XTC D;  2WIN B;  4ZKC B;  2EJM A;  3HG9 A;  5C0X H;  2QDB A;  3STB D;  2DGY A;  1H9K A;  4JYA Q;  1HNW Q;  1TWC B;  4DV2 Q;  3K6O A;  4N9T A;  4A3I B;  1EL0 A;  2AMC B;  3E0E A;  1CUK A;  3J80 c;  5TSS A;  3SK8 A;  3OIP A;  4JCV E;  4NPS A;  1E1T A;  3S16 B;  1ENA A;  2QCP X;  1N33 L;  5A2Q L;  2PZW A;  3SK4 A;  5CMD A;  4LF8 L;  1SND A;  1ILQ A;  3EFX D;  3I2Z A;  5CV5 A;  4MN3 A;  4UP8 A;  3S2H H;  1FR3 A;  2RKS A;  3W3A A;  1SE3 A;  2YTV A;  1TT2 A;  3R2T A;  5CYU A;  2CH4 A;  5T1I A;  4CJ1 B;  5DM7 3;  2BH2 A;  1V43 A;  4LF5 Q;  1RTN A;  1EZ6 A;  1RHP A;  1TWH B;  4OON A;  4UY8 C;  1B70 B;  4APV A;  2LKV A;  4DV2 L;  2HQE A;  2KEC A;  3S14 H;  2KED A;  1E0B A;  2E76 C;  4GN3 B;  2K33 A;  1OO9 B;  3GTP B;  1KAW A;  3E0J A;  1VQA A;  2E75 C;  2K32 A;  1RJT A;  4P74 A;  4CBV A;  4B3T Q;  4ZK9 B;  1TWA H;  5JVH 3;  4A3D G;  1CQV A;  4A3I G;  2BE5 D;  1O80 A;  3TP7 A;  1V1P A;  1LLR D;  4KKU A;  5IOC A;  1BR9 A;  1EU4 A;  2QGQ A;  5D3I B;  1QG7 A;  3L0O A;  3T1Y L;  2LS0 1;  4X66 Q;  4BBR H;  2NVQ B;  2EY1 A;  2CVR A;  3PQI A;  4DUY L;  5GQO A;  2A74 C;  5JEA H;  2WAC A;  4G4K A;  4DV0 L;  2K5N A;  1HZB A;  2A6H D;  4KY7 A;  3RUZ A;  4A3E G;  3J80 E;  1RF2 D;  2JP1 A;  3FMC A;  2PQA A;  4RKL A;  1X3F A;  5EBC A;  4C3J B;  5EJW A;  3S24 A;  1WTO A;  4FF1 A;  5M3F G;  3SGI A;  1IBK L;  4DAM A;  3H0G H;  1I6V C;  1IL8 A;  4RH6 A;  1WI5 A;  4NMZ A;  4A3B H;  1BXT A;  2VUM B;  2R61 A;  2F0W A;  4H7B A;  1M8A A;  1EFW A;  1S72 A;  1A6X A;  3UDG A;  1PTO H;  1SXT A;  2F0M A;  2X6G A;  4KN4 C;  1EYA A;  2PNR C;  2YTY A;  3NP8 A;  4XYQ A;  2IW3 A;  3K57 A;  4HMJ A;  5M5W H;  2OQ0 A;  2CCZ A;  1TY0 A;  2FMC A;  1VQB A;  4KY5 A;  3BDC A;  1Q8I A;  3DWP A;  1EY8 A;  3P1H A;  1LM0 A;  2C5C A;  3W1G A;  2CW0 C;  2F0G A;  2Y0S G;  1CHP D;  4X6A H;  2IX1 A;  1L1O C;  5HUR A;  2B2U A;  3CAM A;  3M4O B;  1VQC A;  3K5N A;  3NWS A;  1E2Z A;  4P2C B;  5JJZ A;  3R2I A;  3MC0 B;  1XNR Q;  4FXK C;  3UDF A;  3GQB A;  1SJH D;  3T1Y Q;  4JI1 Q;  3NEM A;  3ONA B;  4F7X A;  2G5D A;  1NR2 A;  1IYU A;  5M5X B;  4B3R L;  2UUC L;  2HHH Q;  1S4Z A;  3GTQ B;  2WB1 G;  4DR2 Q;  1PRT C;  2Z1C A;  1K8O A;  1JJC B;  1DGS A;  3MFY A;  4NB3 A;  1KAB A;  2EY6 A;  1SN8 A;  4R4T A;  3DM1 A;  2AQ3 B;  1JWU D;  3TP8 A;  5C4H A;  2B2T C;  2SOB A;  1GUG A;  1UNS A;  3DEO A;  4YWL A;  4LF7 Q;  4F87 A;  1F9Q A;  2B8F A;  3NSW A;  3CQZ B;  3S17 H;  1PDQ A;  1A0I A;  5IGG A;  2NYZ D;  4R8N A;  1ESR A;  1LTR D;  4XIG S;  1WCM B;  2G9H D;  5AFW A;  4ZLT F;  3S2D H;  1Y8O B;  2L15 A;  1MD2 D;  1SE2 A;  1PH1 A;  1SAP A;  3UI2 A;  1K8M A;  1ONL A;  2E5L L;  3ERS X;  1KNA A;  1DD2 A;  3QIA A;  5ELF A;  2E2J B;  1UE6 A;  1ICF B;  2WFW A;  1CA5 A;  5IYD H;  4GOP C;  4FF2 A;  4A3F G;  4A3E B;  5K36 H;  3V2T A;  1A62 A;  2KCN A;  3WWV A;  4U67 3;  1K8A C;  5DM6 3;  4A3J H;  3E9H A;  3KK7 A;  3K7U C;  1PTO F;  2MUY A;  1KC8 C;  1EQT A;  1HTL D;  1SE8 A;  1GUS A;  2Q2T A;  1SEB D;  5FO7 B;  3TEH B;  1Q7Y C;  1L1O A;  1SBB B;  1E2W A;  3F2U A;  3N6R A;  1W6K A;  1EY7 A;  3H3V C;  3KF6 B;  3H3V I;  2R6G A;  3NBI A;  4O1N A;  3K0X A;  4HIM A;  2NN6 G;  4BY7 H;  1F9R A;  1WTQ A;  1G6Z A;  2JA5 B;  4OEM B;  4HSP A;  1KAA A;  1HNZ Q;  2CKZ B;  1KL9 A;  5HGT A;  4DV1 Q;  2GN5 A;  3OMC A;  3CD6 A;  2F0V A;  1SYB A;  4DK6 C;  1J5E Q;  3TRZ A;  3GTM H;  2KHS A;  4L8J A;  2QF7 A;  4B3M Q;  3SXH A;  3I90 A;  2QW7 A;  4PMC A;  1STH A;  4C3H H;  1XWE A;  2UUA Q;  4KD4 A;  2XWB B;  5C44 G;  4Z9C B;  2MO1 A;  4DNR B;  1LTT D;  5I9P A;  1FNW A;  1HCZ A;  3GTO H;  3E9I A;  1ENC A;  5L37 A;  4BY1 H;  5GAG C;  2EYJ A;  4JI5 L;  1BCP C;  1EOV A;  2ZXR A;  4LFC Q;  1GXD C;  2JA6 G;  1SNO A;  1JOK A;  3SR1 A;  1PA6 A;  1BCP D;  1MBY A;  5LMN L;  4PMW A;  4JK1 C;  1G2S A;  4FP5 D;  1JIC A;  1J5E L;  2JN4 A;  2DUD A;  4KI0 A;  1MIU A;  4LK1 C;  4DFA A;  4MTN A;  3EN2 A;  1CK1 A;  1QVF A;  2DJF C;  3I4L A;  4O42 A;  4J6H A;  3S14 B;  2NTS A;  3HOW B;  3J80 L;  1YZ6 A;  2K03 A;  2ENB A;  4OHJ A;  1TS4 A;  2VXW A;  1HNX L;  4K2L A;  1MGS A;  4N8F A;  1CT1 D;  1G91 A;  3EVQ A;  3GTG B;  1AW7 A;  1WOC A;  3CMA A;  2UXD L;  3KF6 A;  3KUP A;  2OCE A;  1NUC A;  4X66 L;  3DUZ A;  1HUM A;  4ZKB B;  2VUM G;  3URY A;  2D0P A;  1WD1 A;  2A6H C;  1PRT B;  4KHV A;  1H9J A;  4K6L A;  2R7Z H;  1DCZ A;  1LTA D;  5E4X A;  4BY1 G;  2B2Y A;  2PPB C;  2VQF Q;  1KXL A;  5M3F B;  1I3Q H;  4OO1 G;  4XYO A;  3MA2 B;  1WTR A;  2D62 A;  2OXP A;  3TDQ A;  1K83 B;  3HEJ A;  2XNA C;  2BE5 C;  4B3M L;  1Z47 A;  3FRP B;  3NWT A;  4UPA A;  4J8Q A;  4RGN A;  1V1O A;  4AH6 A;  2F0J A;  3D0F A;  3U58 A;  1DYQ A;  2E2I H;  3FEW X;  5CV4 A;  1I3Q B;  4GKJ L;  3TN2 A;  1RTO A;  3U4Z A;  1XPU A;  3GV6 A;  5C4X G;  3HRZ C;  4NXM L;  2GVB A;  2K5V A;  4FVM A;  4OO1 I;  2WKC A;  3MTS A;  2JQO A;  4RGT A;  1A2U A;  2WAQ G;  4OEL B;  2NB0 A;  4IFD G;  3FKI H;  1TWF H;  2L9H A;  4CJ2 C;  1SYD A;  3S15 B;  1CKN B;  1QWY A;  4IN3 A;  4JI0 L;  2B2W A; 
#chains in the Genus database with same CATH homology
 2NZO A;  3FKI G;  2H5X A;  3IRB A;  1KRT A;  4YWK A;  3KF8 B;  4GKK Q;  4LFB L;  5C3E H;  4TQU S;  4B3T L;  2VNU D;  2RHS B;  2N8N A;  3A5U A;  2HQL A;  3M85 A;  1HR0 W;  5M3M H;  2KHJ A;  2VQE Q;  3I4O A;  2OTL A;  4JBM A;  3CW2 C;  1Q12 A;  3I4N H;  1KHI A;  3A5Z B;  4JI4 L;  3S1R H;  1K3R A;  3M4O H;  4DV3 Q;  4OWW B;  1LUZ A;  2EXD A;  4JV5 Q;  4IFD J;  4X62 Q;  5LMU Q;  1NMF A;  2EIF A;  2CWA A;  2KBN A;  4HJ5 A;  2PMZ E;  1KD1 C;  2HIV A;  4RMF A;  5AJ3 L;  4KHP Q;  1RIP A;  2K14 A;  2B63 G;  2EQS A;  1HZA A;  1UE1 A;  3KOJ A;  1QVC A;  4IPD A;  5FLX c;  4LFC L;  4R4Q A;  5IYC G;  5LMN Q;  3PUY A;  1BVS A;  1XMO L;  1IBM Q;  4JOI A;  4GOP A;  1PYB A;  3CPF A;  2F4V L;  1E7Z A;  4IFD I;  3GD7 A;  4K0K L;  1KRS A;  3GTP H;  4LFB Q;  3UDI A;  5JJI A;  4PG3 A;  1X65 A;  4LUZ A;  4P75 A;  4DV5 L;  2Z6K C;  3HOX H;  1Q1B A;  1WCM H;  5IYB G;  1YBY A;  1VQ8 A;  1EIY B;  3BU2 A;  4OX9 Q;  3GDE A;  2F4V Q;  2UXB Q;  2VQE L;  1V9P A;  3RR5 A;  1EWI A;  4QY7 A;  2Y0S E;  2JA5 G;  3KDF B;  5C44 H;  4JC0 A;  3RNU A;  5GRO A;  5GAE C;  1BKB A;  5C0X I;  1EQQ A;  1XNQ L;  2ASB A;  4UP7 A;  4IPC A;  4EX5 A;  1B8A A;  4A3M H;  1YHQ A;  4B3S L;  1XTD A;  4QGU A;  2ZM6 L;  1SMX A;  1CSQ A;  2JEB I;  4GOP B;  2VQF L;  3S15 H;  2HT1 A;  1X6O A;  2ZJP A;  4HIO A;  3PIO A;  3DLL A;  1FJG Q;  2VY3 A;  1O7I A;  2ALY B;  3EBE A;  1Q86 C;  1Y1W H;  2IX0 A;  2MNA A;  1T9H A;  3G4S A;  1PH8 A;  1E24 A;  1EYG A;  4LNQ A;  4DR4 Q;  5JJL A;  5IYB H;  1JB7 A;  3RLO A;  3CPW A;  3GTJ H;  3NBH B;  3S1Q H;  4BXX G;  4HID A;  4BA1 I;  4BY7 G;  3OTO L;  2KCT A;  4AYB G;  3PF5 A;  3ULJ A;  4JI7 Q;  4A3J G;  3HOW G;  1N36 Q;  2D0O A;  2I0Q A;  4B3R Q;  1VQH A;  1SFO H;  4IO9 A;  1W2B A;  3CC4 A;  4DKA C;  4A3I H;  1G51 A;  4DR3 Q;  1OTC A;  4L5Q A;  2Z0S A;  1N34 L;  4JI6 L;  2YV5 A;  1XMO Q;  2XTI A;  2JEA I;  4A3G H;  2JE6 I;  2Q2I A;  3AQQ A;  1J6Q A;  1N36 L;  5H1S E;  2Q2H A;  3G71 A;  1AE3 A;  1JJG A;  2ZJR A;  2ZJQ A;  4PZ7 A;  3BJU A;  1VQN A;  3RLF A;  2A19 A;  3TS0 A;  4XTC S;  2CQO A;  3L2P A;  3STB D;  2DGY A;  1GD7 A;  4NXN Q;  4JYA Q;  1HNW Q;  1VQM A;  5J3B A;  3UDX A;  4DV2 Q;  2JA7 H;  2JA6 H;  1D7Q A;  2K75 A;  3NEL A;  2AMC B;  3K81 C;  3E0E A;  5C4X H;  4JBJ A;  1VQO A;  1Y1W G;  1X9N A;  1CUK A;  3HKZ E;  4KHP L;  2OQK A;  1WCM G;  3J80 c;  3CXC A;  3CME A;  2Q2U A;  4GLV B;  3VDY A;  1XNR L;  5C0X J;  4JCV E;  3OTO Q;  1IYJ B;  1QUQ A;  4NPS A;  1E1T A;  2WB1 E;  4YHH Q;  1VQ9 A;  4BA2 I;  1KIX A;  1N33 L;  1XPO A;  2JA8 H;  4LF8 L;  2MFI A;  2R93 G;  3D31 A;  1FJG L;  2I5H A;  3I2Z A;  2JA5 H;  1Y14 B;  3GTL H;  4UP8 A;  3S2H H;  1G6P A;  2YTV A;  4ALP A;  4BBS G;  4YCW A;  4OX9 L;  2NVQ H;  1N32 Q;  2R92 H;  1I50 H;  2BH2 A;  2UXB L;  3G48 A;  4MZ9 A;  4DR6 Q;  1V43 A;  4AQY Q;  4LF5 Q;  4A3C H;  2VZA A;  4OON A;  4LUO A;  1L0W A;  3UE1 A;  3S16 H;  1NJI C;  4UY8 C;  1XNQ Q;  1N8R C;  1B70 B;  3JC6 6;  3CCE A;  3RN2 A;  2R7D A;  2JA7 G;  3S1M H;  4APV A;  4A3B G;  3U4V A;  4DV2 L;  2GVA A;  2F52 A;  3RZO H;  3S14 H;  4H02 A;  5IE8 A;  3H15 A;  4X62 L;  5LMU L;  4GN3 B;  4LFA Q;  3RZD H;  2E2J H;  4OWT B;  5ELO A;  1I94 Q;  1KAW A;  3HKS A;  3I55 A;  3CCJ A;  3JAM i;  2B3G A;  1EQR A;  1X55 A;  1VQA A;  1LYL A;  2VS1 A;  3AFP A;  3PUW A;  4P74 A;  4B3T Q;  1TWA H;  3KFU A;  4A3D G;  1HR0 Q;  4Y52 H;  4A3I G;  1VQJ A;  1XMQ L;  1K9M C;  2Z6K A;  4QIW E;  3CCV A;  1MJE A;  1UWV A;  1NBW A;  2QGQ A;  5E7N A;  4DR3 L;  4JI6 Q;  4NXM Q;  3L0O A;  5C0X G;  1HR0 L;  5FJ8 G;  3B6Y A;  4GNX B;  2UU9 L;  3PF4 A;  3T1Y L;  1C0A A;  4DR5 Q;  4X66 Q;  2AWN A;  4BBR H;  2E5L Q;  2NN6 I;  1CKM A;  4DUY L;  5GQO A;  3PCO B;  2UXC Q;  3ULL A;  1VQL A;  3HKZ G;  3U50 C;  3J81 i;  3PUX A;  4R4I A;  4UP9 A;  5IYD G;  1VS0 A;  1I5F A;  4DV0 L;  2K5N A;  1HZB A;  4OXP A;  4A3E G;  2R93 H;  3GO5 A;  1VQP A;  4GNX A;  4J15 A;  1M1K C;  1VQG A;  1CKO A;  2PQA A;  4JYA L;  1SRO A;  1X3F A;  4BBR G;  3S24 A;  3F1Z A;  2PI2 A;  3EIV A;  5M3F G;  4JI8 L;  3CQZ H;  2LXK A;  2N3S A;  3SGI A;  4DAM A;  1IBK L;  3H0G H;  5JEA J;  1WI5 A;  4C2M H;  4A3B H;  2AWO A;  1PH3 A;  4EQ5 A;  1Q8K A;  5IP9 H;  1WFQ A;  2V1C C;  3PO3 G;  3CCL A;  4LF8 Q;  3MEF A;  1N33 Q;  2NZH A;  4DV7 L;  1FVI A;  2N49 A;  2VL6 A;  2ZM6 Q;  1P16 A;  3NEN A;  1EFW A;  2UU9 Q;  2E8G A;  1S72 A;  4AYB E;  3CF5 A;  1AE2 A;  3UDG A;  1NE3 A;  1ASY A;  2UXD Q;  1QZH A;  2KEN A;  3M3Y H;  5M5X H;  4A3E H;  2PQA B;  5M5Y H;  2LXJ A;  2HIX A;  1JMC A;  2YTY A;  5C4J H;  1Y1V G;  4YCU A;  4JI2 Q;  5M5W H;  2OQ0 A;  2CCZ A;  4L5R C;  2I5L X;  1VQB A;  2IT1 A;  3FP9 A;  4GS3 A;  4DNI A;  3HOZ H;  1LM0 A;  3W1G A;  2B29 A;  3A74 A;  4A3K H;  2Y0S G;  4X6A H;  2IX1 A;  1L1O C;  3KJP A;  5K36 G;  1UE5 A;  4L5T A;  3CAM A;  1GM5 A;  3J7A 5;  1GO3 E;  1SR3 A;  1BBU A;  4QJF A;  3T1H Q;  1VQC A;  3KJO A;  1VQ6 A;  1OXV A;  1TXY A;  4IJH A;  3UDF A;  2IHF A;  3J7Z C;  1C7Y A;  1PYS B;  1V1Q A;  1XNR Q;  3K7A H;  3OW2 A;  4DR2 L;  4GLX A;  4JI1 Q;  3T1Y Q;  3NEM A;  4LFA L;  1A63 A;  1K73 C;  4BXX H;  3I4N G;  3PO2 H;  2R7F A;  1BBW A;  1K83 H;  4JG2 A;  4R4C A;  3PUZ A;  3HOW H;  1X56 A;  4IPG A;  1OXS C;  2HHH Q;  3PGZ A;  2UUC L;  2WB1 G;  4B3R L;  4DR2 Q;  4IJL A;  4LUV A;  3I4M G;  4ME3 A;  1YHB A;  2A1A A;  2K5H A;  5IY0 A;  1JJC B;  1PH7 A;  1DGS A;  1VQI A;  1OXU A;  2IY5 B;  4NB3 A;  4YCV A;  4AQY L;  1YI2 A;  4LF5 L;  2ATW A;  2NVT H;  1SN8 A;  4R4T A;  4A3F H;  3GTG H;  1JE5 A;  2NVX H;  3KYH C;  4YWL A;  1QVG A;  2XGT A;  1PFS A;  4NXN L;  5BR8 Q;  4GNX C;  3CC2 A;  4LF7 Q;  4GKJ Q;  3STB C;  1QUQ B;  3S17 H;  2KHI A;  4IPH A;  2IHE A;  1A0I A;  2QA4 A;  1OXX K;  3TRE A;  4JI4 Q;  3CC7 A;  2JK8 A;  2K50 A;  4XIG S;  4A3L H;  3CCU A;  3S2D H;  1GVP A;  2C35 B;  3F2B A;  3ULP A;  3DM3 A;  3J81 c;  1HNZ L;  2L15 A;  1YVC A;  4O2D A;  1PH1 A;  1IBK Q;  4LF6 Q;  4YHH L;  5M3F H;  4A93 H;  4GN4 B;  1X3G A;  5C3E G;  2E5L L;  3L7Z C;  1VQE A;  3ERS X;  4JI7 L;  3LGJ A;  1PH9 A;  4K0K Q;  3TS2 A;  1AH9 A;  3AEV A;  4DR1 Q;  4JBW A;  4A3M G;  2E2H H;  2AKW B;  1A8V A;  2F3I A;  2AHO B;  1UE6 A;  4QQB X;  3F2C A;  4MNO A;  1Q81 C;  3CCR A;  1VQF A;  3HFZ B;  1S40 A;  2WFW A;  3GTK H;  5JEA G;  4POF A;  4JOI C;  2NVY H;  4DPG A;  4GOP C;  4A3F G;  5IYD H;  4RG1 A;  4DV4 Q;  3I7F A;  1K8G A;  2ES2 A;  1A62 A;  1NY4 A;  4O0A A;  2YU9 H;  1PVO A;  2RCN A;  3WWV A;  4KLK A;  5HGQ A;  3I56 A;  2JA9 A;  4HJA A;  1K8A C;  4A3L G;  4DR5 L;  5IT9 c;  5FJ8 H;  1HNX Q;  3I4M H;  3PIP A;  1PH2 A;  4A3J H;  3E9H A;  1B7Y B;  3K7U C;  1FL0 A;  2BA1 A;  1KC8 C;  1YIJ A;  1Y1V H;  5IWA L;  1X54 A;  1SE8 A;  1PH6 A;  3FHW A;  2UUB L;  3HOU H;  3T1H L;  3PSI A;  2Q2T A;  5IWA Q;  3TEH B;  4JI1 L;  1L1O A;  1Q7Y C;  3AFQ A;  4HIK A;  4DV5 Q;  3W1B A;  3KF6 B;  3ZJY C;  4POG A;  4DR1 L;  3H3V I;  4JI8 Q;  1Z9F A;  2R6G A;  4DV7 Q;  3BZK A;  1IXR A;  4LWC A;  3K0X A;  4HIM A;  1PV4 A;  5DLQ E;  1I94 L;  1QZG A;  2LSS A;  1R9T H;  2NN6 G;  2HHH L;  4DV4 L;  4BY7 H;  1L1O B;  4A93 G;  5M3M G;  4PZ6 A;  4X64 L;  3TQY A;  2CFM A;  1N34 Q;  1HNZ Q;  4LF6 L;  2CKZ B;  1KL9 A;  2YYZ A;  4YWM A;  4DV1 Q;  5GAH C;  2GN5 A;  2VUM H;  3CD6 A;  1FGU A;  3H0G G;  1I6H H;  4LF9 L;  3RLN A;  4BBS H;  1N32 L;  4DK6 C;  1J5E Q;  1X3E A;  2ID0 A;  1K0R A;  2ZTC A;  3TRZ A;  3GTM H;  2ZTE A;  3HOV G;  1E1O A;  4JI0 Q;  2JJQ A;  4B3M Q;  3RN5 A;  3Q8D A;  4DV1 L;  1P8L A;  4LF7 L;  2BH8 A;  3AYH B;  3BZC A;  2WP8 J;  4C3H H;  4R1J A;  4DAY B;  4GN5 A;  2UUA Q;  5IYC H;  3M4Q A;  5C44 G;  3ICE A;  2MO1 A;  4DR7 L;  3ER0 A;  1WYD A;  1IBM L;  5IP9 G;  1Q82 C;  3GTQ H;  3GTO H;  3E9I A;  1D8L A;  2OWO A;  1E22 A;  3G6E A;  2I5M X;  1SLJ A;  3H3V H;  4LW1 A;  2K52 A;  5IP7 G;  2K4K A;  1WJJ A;  5GAG C;  4BY1 H;  4R4O A;  5HY6 A;  5BR8 L;  4DV3 L;  4X65 Q;  2CWP A;  4JI5 L;  1Q46 A;  1UE7 A;  3CP0 A;  1ASZ A;  1EOV A;  1YJW A;  4LFC Q;  2JA6 G;  2ZTD A;  1IBL L;  2UUC Q;  2WAQ E;  4IOC A;  3PO2 G;  4A76 A;  3PUV A;  3HOY G;  2N78 A;  4QL5 A;  1PA6 A;  4X64 Q;  4GLA C;  4C3I H;  5LMN L;  4JI3 Q;  1LTL A;  3MXN B;  4PMW A;  3JAM c;  3UE0 A;  4LF4 Q;  4GKK L;  2OTJ A;  1G29 1;  3F2D A;  1TWG H;  1U5K A;  3A0J A;  4JI2 L;  4DR6 L;  1MKH A;  1J5E L;  1N9W A;  1RL2 A;  1L2F A;  2PI2 E;  4JI3 L;  2DUD A;  3J81 j;  4KI0 A;  1MIU A;  4MTN A;  4DV0 Q;  1NTG A;  4HJ8 A;  3EN2 A;  4WJ4 A;  1QVF A;  1S3O A;  1TWC H;  2VW9 A;  4PZ8 A;  1VCI A;  2FXQ A;  1HNW L;  4TVA B;  3HOZ G;  3W5O A;  1M90 C;  1EUJ A;  4B3S Q;  1HZ9 A;  1YZ6 A;  5IP7 H;  5GAD C;  3CCQ A;  1KQS A;  1HZC A;  4OWX B;  2QEX A;  1JT8 A;  3CCS A;  1TWH H;  1HNX L;  3KDF A;  3M7N A;  1XMQ Q;  2UUA L;  1PH5 A;  1H95 A;  4IOA A;  1XPR A;  1PHJ A;  3HOY H;  1HH2 P;  1YIT A;  2UUB Q;  1WOC A;  1JJ2 A;  4A3K G;  3CMA A;  2UXD L;  1VQ5 A;  1HJP A;  1SRU A;  5JJK A;  3KF6 A;  2OCE A;  1U0L A;  4X66 L;  4C3J H;  4JBK A;  4LF9 Q;  1CSP A;  3KLW A;  1IL2 A;  3K8A A;  1E3P A;  1VQK A;  5ELN A;  2VUM G;  5FLM H;  2MQH A;  2R7Z G;  2D0P A;  1IBL Q;  4DV6 Q;  1VQ7 A;  3PO3 H;  1YHA A;  4HJ7 A;  4WJ3 M;  3HOX G;  4A3C G;  2A8V A;  2R7Z H;  4A75 A;  5FLM G;  4BY1 G;  4A3D H;  2VQF Q;  2R92 G;  1KXL A;  3J80 i;  1I3Q H;  1W3S A;  4OO1 G;  4P72 A;  2PNH A;  2D62 A;  3K80 C;  1GKH A;  5EAY A;  4AIM A;  2RHQ B;  4DR7 Q;  3M4P A;  3PV0 A;  4P71 A;  3S1N H;  2JA8 G;  4A3G G;  1OXT A;  4FDB A;  1UEB A;  3M9B A;  4B3M L;  1Z47 A;  2BA0 A;  2MO0 A;  4UPA A;  4P73 A;  4AH6 A;  4JV5 L;  4X65 L;  3D0F A;  3U58 A;  4DUY Q;  2UXC L;  2E2I H;  1YNX A;  5AJ3 Q;  4GKJ L;  3F8T A;  2KCM A;  1CKN A;  4Y7N H;  4LF4 L;  3U4Z A;  1XPU A;  1IZ6 A;  4YY3 Q;  4DUZ L;  4NXM L;  5C4X G;  2GVB A;  2K5V A;  4A4I A;  2RF4 A;  4DR4 L;  4OO1 I;  5LMN W;  2JQO A;  3CCM A;  1C9O A;  2WAQ G;  1YEZ A;  1YJ9 A;  1MJC A;  4DV6 L;  4HJ9 A;  1VQD A;  4KHZ A;  4IFD G;  3FKI H;  1Q1E A;  4JI5 Q;  1TWF H;  4L5S A;  2B63 H;  4YY3 L;  3OYY A;  4DUZ Q;  1VQ4 A;  1YJN A;  1EIF A;  1XJV A;  1PH4 A;  1CKN B;  4JI0 L;  3HOV H;  1NMG A;  3HOU G;  2YTX A;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...