4O0JA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[4-(4-chlorophenyl)-6-(3,4-dimethylphenyl)-2,5-dimethylpyridin-3-yl]ethanoic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
molecule keywords Integrase
total genus 49
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0jA00
2NUBA 3LP1A 3HPHA 2Z1JA 4CGDA 3P5JA 3VQ8A 4CIGA 1VSMA 5JS1A 3OYIA 2X6NA 3MEEA 2XRIA 3EYZA 1XHZA 3SV4A 4QOZB 1TKDA 5CYMA 3K5LA 1BI4B 3AVHA 3VN5A 2R7YA 3O4NA 4KI6A 4M3RA 4DFJA 1WSIA 3SI6A 5CY4A 1L3SA 4K8ZA 4PQUA 3QETA 1LWFA 2B6AA 4JRQA 3E01A 2GUIA 4CJUA 4KPYA 2Z1HA 4E7LA 4RW4A 3SQ4A 1RDBA 3HP9A 4OKKA 4DTRA 3SUOA 2GV9A 3QIPA 1TKZA 1U04A 3ZSOA 1WAFA 1RDCA 3B6OA 4PUOA 4Z4FA 1ZBFA 2HHWA 5C42A 2PYLA 4H4MA 4CJ5A 3VQ5A 3D45A 3OYJA 4PY5A 1HQUA 1BGXT 2YNFA 4DF4A 1UA0A 4JS5A 3PX4A 3OYLA 3AVMA 4IFVA 2G8WA 3V1RA 2Q3SA 4CK3A 2LSNA 4QAGA 4CECA 2E6MA 4ZTJA 3NH2A 3L3UA 4W5NA 4CGHA 1G15A 3DLHA 4M3TA 1RT3A 3KIOA 3RMAA 2IOCA 2RN2A 3DI6A 2YNGA 4FW2A 4RW8A 3U3GA 4BDZA 1BHLA 5HROA 3QEPA 4O4GA 1VSKA 3L2UA 4FJ7A 1YT3A 4OVLA 3SPYA 4OGEA 1SUQA 4FLWA 1CXUA 2VWJA 1R0AA 3AVAA 3AVJA 2XY6A 4ELTA 2BDPA 2HNDA 4IBNA 3AVLA 3ZSXA 3ZSZA 1LAVA 3QO9A 1SKRA 3RWUA 4Q5VA 4DMNA 4N5SA 5HBMA 2VG5A 4N56A 1RILA 3V4IA 2HVHA 4MFBA 4FW1A 1RT5A 3HP6A 1ASWA 4FJIA 2ETJA 3WNHA 1TL3A 4JS4A 4CF1A 4HCBA 1KVBA 4ID5A 4KFBA 4JRPA 4J2AA 2FBVA 5HRSA 5SWMA 3AA3A 4OGCA 4YNQA 1CZ9A 2B5JA 4KTZA 4CIFA 1JLAA 1X9MA 4JLHA 1XHXA 4IFYA 4DTSA 3SUNA 3LAMA 1MU2A 4L8RB 3ASMA 3MAQA 4N76A 3KD1E 1FKPA 5KGXA 4O0JA 1TVRA 1TAQA 4FVMA 4CF8A 3M8SA 3I8DA 3V9WA 3MXIA 3MECA 3OS0A 1TGOA 2OPPA 4H8KA 3LZJA 4DS5A 4AHUA 3O3HA 4W5OA 1HMVA 2HHUA 4UQGA 5HLFA 2BE2A 2E4LA 4B8AB 4F2SA 1NJYA 1QSYA 3ZT2A 3PV8A 3QLHA 3DYAA 4IG0A 4CHNA 5HRRA 3NGIA 1SKSA 3AVIA 4FK4A 4TSXA 1S6PA 4CJPA 2AJQA 2G8HA 3DLRA 2KFNA 2HHTA 4AILC 2YHAA 4FLVA 1S1WA 3AA4A 3V1QA 3G0ZA 3TWHA 4B9NA 1L3VA 1S1XA 3IAYA 3OYDA 3VQ7A 4DG1A 1W0HA 1ZBIA 2ITGA 1KTQA 4CF0A 4O0IA 4LY7A 4EZ6A 4HCCA 2QK9A 3ITHA 3NAEA 3M8RA 1BI4A 4CK1A 3IS9A 2JGUA 4FJXA 1KVCA 1JLEA 1X9SA 1IKYA 3RTVA 3RMDA 4CK2A 1JLGA 3HSTB 5C24A 5T7BA 1BISA 3NF9A 5SZTA 3DLKA 4DFKA 3LDSA 3RR8A 2RPIA 1WSFA 4B8CA 3VA0A 4DF8A 3MXMA 3LP2A 5CYQA 3VQ9A 3O3FA 4FJNA 1RTDA 1I3AA 4FJHA 1WSJA 1FKOA 4RW6A 5KI6A 4E89A 4XIUA 1TK0A 4DSFA 1KFSA 1LWEA 4RG8A 3JSMA 1J5OA 4FZYA 4M3XA 3HL8A 1J53A 2FBYA 5FROA 1VSLA 4PWDA 3KTQA 3V9SA 3ZSWA 3NH0A 1T7PA 4CHOA 1D9FA 3SV3A 3TAMA 4CEOA 3QIOA 3AV9A 3TAEA 1NJXA 1SL2A 2HNZA 1RBSA 3F73A 4IKFA 1NOZA 3KK2A 3EY1A 4B9LA 4CGJA 2ZQBA 2D0AA 3VQ4A 3I0SA 1YTUA 1EKEA 4ICLA 1F21A 4DU1A 3HPOA 3O4QA 4DSKA 1NK9A 2BGGA 4FJGA 3MEGA 4M3WA 2RKIA 1VSJA 3NF7A 4AHCA 3WNGA 1HRHA 4FM0A 4LSLA 4BWMA 1KSPA 5I3UA 2OZSA 4EZ9A 2YNIA 4E1NA 4ZTFA 4FLYA 1SL1A 1KFDA 3WNFA 3QNNA 2OYQA 1S1VA 3OY9A 4C8LA 3QINA 3OYAA 4I9LA 1L5UA 1WN7A 4B9TA 4KB0A 4B08A 5KRSA 3DRPA 4OLBA 2Z1GA 4CFBA 3OYCA 1C0TA 1LAWA 2P5GA 3KK3A 4Y1CA 5K14A 4I2PA 4R5PA 3CFRA 2IGIA 3NE6A 3ZSYA 1HJRA 2PY5A 3HPGA 1NKEA 4M45A 3IG1A 4FLZA 1HNVA 5DK5A 1B9DA 4E7IA 1UA1A 2X6SA 4W5QA 3DM2A 4F8RA 5JS2A 4W5RA 4N41A 4CEQA 4KHYA 1EP4A 1S1TA 1J54A 4W5TA 2DY4A 1IKXA 1VSFA 3MEDA 4CJWA 3SJJA 1ASVA 1RT7A 3HYFA 3VQPA 2F8TA 1QE1A 3FFIA 4FZXC 4KB1A 3I0RA 4NCGA 4WE1A 3SQ2A 1FXXA 1XC9A 5HRNA 4LD0A 2D0CA 1KLNA 1W9HA 4CHPA 1NKBA 4B9VA 4J2DA 3V9ZA 3K5MA 1KCFA 2KW4A 1RTJA 1RBTA 1BQNA 4OKJA 4DQRA 3TANA 3AVCA 3L3VA 4CGGA 3KKRA 2DFHA 3SUPA 4FJLA 2KZZA 1CXQA 3JYTA 4DTMA 1U47A 1QSSA 4FK0A 1BIZA 3QEVA 1CZBA 2VWKA 2XY7A 3V6DA 2YKMA 2OA8A 1HPZA 4DTNA 1HYSA 3QEWA 3TR8A 4CJKA 1WSGA 1TL1A 3OYNA 5CZ2A 3ZT3A 4DSEA 3VQDA 2KQ2A 3KKSA 4HTUA 2FBTA 1NK5A 2O4IA 4CCHA 5J2QA 4EP4A 4E7JA 4GW6A 3QEXA 2W42A 4CERA 3F9KA 1SKWA 3PX0A 4DQPA 4E7HA 4IDKA 1D8YA 1ITGA 1C0MA 1NK4A 4FYDA 4CEDA 2F96A 5E41A 3SQ1A 4CFCA 3LZIA 4YFUA 2XHBA 2DFEA 3K59A 4DQQA 4BDPA 4NYNA 3HT3A 5HP1A 1X9WA 3QNOA 1Q9XA 1O1WA 4FJ9A 2IC3A 4B9MA 3NF8A 3U3YA 1S5JA 2IDOA 3H08A 3P1GA 4EP5A 1NJWA 1QQCA 4KTQA 4CFDA 3ZSVA 2YNHA 3AO2A 3OYBA 3KLFA 1GOAA 1RDDA 2HNYA 4I9QA 4FM2A 1LW0A 1SV5A 3DOLA 3LP0A 3PUFA 3OYGA 1UAXA 1DLOA 2YHBA 1KVAA 4RW7A 1T05A 1JLCA 2VG7A 2WOMA 1TKXA 2YV0X 4KAZA 3QERA 2F8SA 3TAGA 1BIUA 3OYMA 4AH9A 3AA5X 4KHWA 4OJRA 1RT2A 4HUEA 2KTQA 2FBXA 2P1JA 1RCHA 3CQ8A 3P83D 3SUQA 3PY8A 3SCXA 4M42A 2IS3A 2QKBA 2P51A 3DOKA 3KLHA 3DMJA 3MXJA 1SL0A 4KI4A 4J2BA 1Y97A 2KFZA 3L8BA 1Q9YA 3LP3A 1EETA 4DFPA 3AVNA 4DSJA 1VSDA 1JLBA 3V9XA 3AVBA 3LWLA 2O4GA 1RDAA 4B9SA 4CJFA 4ELUA 3OYKA 1JLQA 2XO7A 5KRTA 1B92A 4CHZA 4FLTA 3DRRA 4CEEA 1NK6A 3RMBA 3DLBA 4FJJA 1U48A 1QHTA 2EHGA 2IAJA 1QSLA 1RT6A 4Z4HA 2E6LA 3A2FA 3K2PA 4DU3A 4DQSA 5KGWA 3C94A 1VRUA 1YTAA 1EXQA 1WNSA 3VA3A 1C1CA 3BGRA 1LV5A 1A5VA 3M8QA 1J9AA 1S9EA 1VSIA 3TAQA 3IRXA 4LH5A 4HUGA 1L3TA 4F3TA 4BE0A 4FLXA 4LH4A 4B3OA 3NHGA 1IH7A 2G8FA 4Z0UA 4C8OA 4B9UA 4CEAA 3OVNA 4KO0A 4I7FA 3CG7A 1RBRA 3RRGA 4RW9A 1BQMA 1U4BA 1KLMA 4DU4A 4M3ZA 3G10A 1XI1A 4CJVA 3C6TA 3TAPA 3NFAA 4I2QA 1HYVA 1IKVA 4ZHRA 3CFPA 1X1PA 3K58A 4PA1A 4DTPA 3PO5A 3NGZA 4FJMA 4CJSA 3ISNC 5J2NA 1JLFA 3L2QA 3HJFA 4E1MA 3OS1A 4CJTA 4CHQA 4FCYA 4DSIA 4CJEA 1LWCA 1TKTA 3ZT4A 4CHYA 4DFMA 4DLEA 1JKHA 3VQQA 2A1SA 4J2EA 1NJZA 1D9DA 4Z4IA 3LANA 3L2WA 2HVIA 3ZSRA 3NBPA 4KV8A 2ZE2A 2OPSA 4CGFA 4CGIA 4IG3A 4FLUA 2P5OA 4AHVA 3C6UA 3ZT1A 4OLAA 1FK9A 3QEIA 1RBVA 1EX4A 4DTUA 1RT4A 1VSEA 4ELVA 4CE9A 1D5AA 1Q8IA 4BDYA 2Y1IA 2QKKA 3NF6A 4FJ8A 1VRTA 2Y1JA 3U6FA 4FK2A 1NKCA 1C1AA 4FZZA 2FC0A 4G1QA 3OJUA 4BE2A 3LALA 1N5YA 1DTQA 2B4JA 4GVMA 1ZBHA 2DFFA 3DLEA 4DLGA 4E19A 3TAFA 1IO2A 1U49A 3M8PA 2DTUA 4HUFA 3OJSA 3KD5E 1JXBA 1K6YA 4DSLA 1IKWA 4HHTA 3HVTA 1XWLA 3T1AA 1QS4A 3OYFA 1NK8A 1WSHA 1NOYA 4FJ5A 3HO1A 1JL2A 3AVKA 3KLIA 3D0PA 1IG9A 1KRPA 4AHRA 3NDKA 1REVA 1C6VA 1BCOA 2EX3A 3EZ5A 3DLGA 4KREA 1BL3A 4CJLA 4C8KA 2YKNA 2G8KA 2Z1IA 4KHQA 3KK1A 4QCLA 3QESA 5HRPA 3V81A 4CEZA 5I42A 1ZBLA 3KLGA 1NK7A 2X74A 1TV6A 4CIEA 1YVUA 5KTQA 3OS2A 1RT1A 2WONA 2PYJA 2HMIA 1C0UA 2A1RA 3RRHA 1A5WA 3S3OA 4AHSA 2JLEA 3S3NA 1S9GA 1TK8A 3RMCA 4GMJB 2XY5A 1TAUA 3AVFA 1JXEA 1TK5A 1B9FA 3TI0A 4K8XA 4E3SA 4F2RA 4DQIA 2GBZA 1Z25A 3CFOA 3LWMA 1RTHA 3SYZA 3BDPA 1N6QA 1WAJA 2OPQA 4Z4CA 3L2RA 4H4OA 2HHVA 1C1BA 2G8UA 4F4KA 1HNIA 4C8MA 2D0BA 3NGYA 3SQ0A 4CESA 2ATQA 4CEFA 4M3UA 4M41A 2I5JA 3VQCA 3T3FA 4BE1A 4KHUA 4Y1DA 4FXDA 2OPRA 3TARA 1WSEA 3L2VA 3ALYA 5J1EA 3K5OA 4MQ3A 5C25A 1T03A 2PZSA 2HHXA 4O55A 3SPZA 4ID1A 3ZSQA 4DWIA 2ZD1A 3C95A 1CLQA 1RNHA 4KKOA 4CF2A 5DMRA 3HXMA 3THVA 2HHQA 4CJQA 2OZMA 5J2MA 3O3GA 3OYHA 2G8IA 5D3GA 1U45A 4M3YA 4CJ3A 4NYFA 2G8VA 3TABA 4FJKA 4CF9A 1QTMA 3RR7A 4KTWA 2VG6A 4CEBA 1Z26A 4LSNA 4Z4EA 1T8EA 4KHNA 3CM5A 3CYMA 4C8NA 5EU7A 3HVRA 3SNNA 2HB5A 4N47A 3S3MA 4OKEA 2D5RA 4CFAA 1S6QA 4BACA 3V9UA 3AA2A 1HYZA 3ULDA 3LAKA 4DTJA 4CJ4A 3PX6A 3LPTA 2KZMA 1VK0A 1VSHA 4DS4A 3KJVA 1UOCA 3AO4A 4DTXA 5FDLA 3SZ2A 1UWBA 3VQAA 1JL1A 4E0DA 4Z4GA 5FRMA 4E7KA 1ZBUA 4DTOA 3AO1A 3DRSA 1RBUA 3AO5A 4HVJA 3NH1A 4NCAA 1ASUA 1LW2A 1DTTA 5CZ1A 3V1OA 4CJRA 1BCMA 5FRNA 2X78A 3CM6A 3UIQA 4KRFA 4KHSA 3LPUA 4FM1A 1GOBA 1RTIA 3ZCMA 1NK0A 1ZYQA 4F3OA 2HHSA 3NCIA 3HK2A 1A5XA 4O44A 4OPJA 3S9HA 1WLJA 4Q0BA 3B6PA 3ZT0A 3K5NA 3OYEA 5J2PA 1GOCA 3K57A 2BANA 1HQEA 1S1UA 3WNEA 3HM9A 4NCBA 3VQ6A 2QXFA 4OPKA 3T19A 3VQEA 4O5BA 3AVGA 2RF2A 4AHTA 2HW3A 2XY8A 3KLEA 1I39A 1L3UA 3VQBA 3AO3A 4BWJA 3PO4A
chains in the Genus database with same CATH superfamily
3HPHA 4CGDA 3P5JA 3VQ8A 5BRDA 3MEEA 3VTHA 3K5LA 3CJ9A 3AVHA 5AQMA 3CC2N 1N8RO 5AQOA 3QETA 4JRQA 3E01A 3VETA 4RW4A 4OKKA 2CH5A 3QIPA 3B6OA 4H4MA 3VQ5A 1VQNN 3D45A 1BGXT 3OYLA 3L0QA 3SAHA 3I33A 2HBJA 3CQXA 4GV6A 2E6MA 4M63C 4YORA 3GG4A 3UB5A 1KC8O 1E4FT 4W5NA 2QI2A 1K8AO 1EWRA 3RMAA 2IOCA 2RN2A 3DI6A 1N34K 4BDZA 2IVNA 5GINA 3IKMA 5ELZA 1HNXK 4OGEA 1SUQA 1T6CA 4FLWA 4YY3K 3AVAA 3VEYA 2HNDA 4IBNA 2YJFA 3O9RA 3O80A 3MCAB 2ETJA 4Y0WA 3WNHA 4CF1A 4BY9C 1XNRK 1KVBA 4ID5A 4KFBA 4V19S 1CZ9A 2B5JA 4HCCA 4IFYA 3LAMA 1YITN 4BRAA 1YI2N 3KD1E 1TVRA 3HTVA 1HR0K 4FOIA 1XC3A 3UKRB 1TGOA 2OPPA 2HHUA 2H3GX 1HMVA 1NJYA 4FWQA 3ZT2A 3FFKB 3DYAA 4CHNA 5HRRA 2AJQA 4CJPA 2BH1A 2GUPA 2YHAA 3AA4A 4NXNK 1S22A 3L6QA 1S1XA 1VQON 1W0HA 1ZBIA 5C2FA 3ITHA 1SAZA 3RMDA 4CK2A 3G71N 3J7YP 1BISA 5AR0A 3NF9A 3DLKA 4FL9A 3LDSA 4ILJA 3VA0A 4DF8A 4JI5K 3LP2A 3THWB 1YXQA 3O8MA 3VOVA 4LFBK 1XNQK 2VWBA 1WSJA 1FKOA 4XIUA 4DSFA 4BR7A 3G25A 1J5OA 3DXMB 2FBYA 1WBDA 1VSLA 3J7ZO 1OVQA 1W2BM 1W7AA 4AQYK 3Q7BA 3SV3A 4CEOA 3QIOA 3TAEA 4A2AA 5AZJB 4IKFA 1RBSA 3EY1A 1NGBA 1P90A 3DXKB 3Q7CA 5JMVA 3VQ4A 4BRHA 1YTUA 1EKEA 4ILHA 4DU1A 3HPOA 1NK9A 2HF4A 3GL1A 4LF8K 5C0YA 3WNGA 2FSKA 4LSLA 5I3UA 4E1NA 4ZTFA 1SL1A 1KFDA 2OYQA 3OA9A 3VGMA 2GEMA 4O8KA 5KRSA 4BR0A 4JKDA 1C0TA 1Z05A 1K9MO 5BRHA 4IOCL 3NE6A 3U9DA 1QZ5A 1HNVA 1B9DA 1UA1A 4JKCA 3P4IA 4CEQA 2E1ZA 3QFUA 4IXCA 2RE2A 3FE1A 4CBUA 3G4SN 1VSFA 3AGRA 3WXLA 1ASVA 3VQPA 1DT9A 4WE1A 1IBLK 1XC9A 4DV6K 1S72N 3VGLA 3K5MA 1WBBA 1RBTA 2D4WA 3TANA 4DQRA 3L3VA 5LJWA 3SUPA 4FJLA 1NWKA 1U47A 4FK0A 1BIZA 1CZBA 2VWKA 2XY7A 3V6DA 3QEWA 1H1VA 1T44A 4CJKA 4CZFA 4DSEA 3VQDA 3KKSA 4HTUA 1NK5A 5BPMA 2CGLA 5J2QA 4CCHA 2D0PA 3QFPA 1LOTB 3PX0A 3OTOK 4E7HA 4IDKA 1D8YA 4QS9A 2YCHA 1V4TA 2XHBA 4JAXA 4FJ9A 3HT3A 1Q9XA 3NF8A 3H08A 2IDOA 1NJWA 1QQCA 4CFDA 3KLFA 2YNHA 4BC5A 1YF5L 4M7XA 1RDDA 4I9QA 4FM2A 1SV5A 3OYGA 1VQLN 2UU9K 2YHBA 1KVAA 1JLCA 2VG7A 2WOMA 3I8BA 4YDUC 4CZMA 1TKXA 2KLAA 3QICA 4AH9A 3AA5X 1X3MA 4KHWA 2Q31A 3CQ8A 3PY8A 2P9LA 3KLHA 1SL0A 4JV5K 3RSEA 3SMSA 3V9XA 2O4GA 2XO7A 3MN5A 4CHZA 4JI0K 4LF9K 3D2FB 4FJJA 4FWOA 2EHGA 2IAJA 1RT6A 1FW6A 3K2PA 1GLLO 2GWJA 5CHIA 1C1CA 3ZETA 3BGRA 3M5RA 4IOXA 2E5LK 3C65A 4JNEA 4Z0UA 4MLHA 4B9UA 2P9UB 3OVNA 4KO0A 3W3DA 3CG7A 2FSNA 1BQMA 2E8AA 4DU4A 3P39A 3FZMA 5JVGL 2Q0RA 1MA9B 1NGHA 3ISNC 4E1MA 3OS1A 4CJEA 2IVPA 1R59O 1TKTA 4FWRA 1BUPA 4GVEA 2VGMA 3C6HA 4Z4IA 3NBPA 2E88A 4KV8A 4CGFA 2P5OA 4FLUA 3ID6A 1HKBA 3ZT1A 2OTJN 4DTUA 3EZWA 3FR0A 3O1WA 1U2VB 1D5AA 5FPDA 1Q8IA 2QKKA 3NF6A 4IEEA 3CCLN 4FJ8A 3U6FA 4FZZA 4YOXA 3U4LA 4BE2A 4C23A 1HKGA 2B4JA 4IWVA 1N5YA 3OJSA 2IIRA 1N32K 4DSLA 3HVTA 5C15A 5IWAK 4QS7A 1QZ6A 1C6VA 4CJLA 3THYA 3F5TA 3QESA 5I42A 4BC4A 5KTQA 2HMIA 1A5WA 4AHSA 4CD1A 1TAUA 1ATSA 4K8XA 4F2RA 1GLEG 2GBZA 3L2RA 4F4KA 2E2OA 1TYQA 2ZJPL 3NGYA 4M41A 4A5AA 5JICA 4Y1DA 4FXDA 3K5OA 4CZHA 1T03A 3ZSQA 1HUXA 5AZIB 2A5XA 4CJQA 3O3GA 5AQXA 3TABA 3SLCA 3RR7A 4G9ZA 1Z26A 3D6RA 4KHNA 3CM5A 3HVRA 3S3MA 3WQTA 4CFAA 4DTJA 4CJ4A 4BC2A 1NGFA 3KJVA 1KAYA 3EE9A 1UOCA 4RTFD 4KBOA 4JI1K 3O6WA 3SZ2A 5F1XA 1BO5O 4FVUA 4E0DA 4H03B 1ZBUA 4DTOA 3AO1A 4HVJA 4NCAA 5CR4A 3V1OA 1OH8A 1BCMA 3CM6A 3LPUA 4FM1A 1GOBA 2O8EA 1A5XA 3P31A 4DV1K 2HBKA 3B6PA 3OYEA 1SZ2A 1NGAA 4H5TA 2QM1A 3KLEA 4BG8A 4JLHA 3CJ7A 2QWOA 3G6EN 5JS1A 4YOVA 3OYIA 2X6NA 1HNWK 4PKGA 5CYMA 2R7YA 3O4NA 4KI6A 4DFJA 4PQUA 2QEXN 4BRKA 4CJUA 2Z1HA 4E7LA 3SQ4A 3HP9A 4DTRA 1NMDA 1U04A 4JK9A 3ZSOA 1ZBFA 2AP1A 2P9LB 5C42A 1KD1O 3VMFB 3VERA 3B8AX 3L4IA 4JS5A 3KK7A 3PX4A 4IFVA 3ATUA 2ASMA 2LSNA 4CECA 3JXUA 3LM2A 4B3SK 3NH2A 5ADXA 2HBMA 3JS6A 1RT3A 3KIOA 3CJBA 1ZBSA 5HROA 1BHLA 3QEPA 1NJIO 3L2UA 4FJ7A 3CCUN 1DKGD 2PFUA 2BUPA 3AVJA 4ELTA 2BDPA 4IFEA 2O8CA 3ZSXA 3ZSZA 1LAVA 3RWUA 3CF5L 4Q5VA 4DMNA 1OVYA 1RT5A 3HP6A 4JS4A 1N36K 1TL3A 2O8CB 4J2AA 1J5EK 1D4XA 4WYBA 4YNQA 3RVCA 3WQUA 4CIFA 1X9MA 1XHXA 3SUNA 1MU2A 4L8RB 4I6MB 1X3NA 3HRGA 1FKPA 4B1ZA 4FVMA 5IT9O 3I8DA 3MXIA 4YOYA 3OS0A 3VEWA 4UQGA 2E4LA 3GE1A 4BRGA 5FPEA 1SKSA 3QLHA 2ZGYA 4BRFA 3AVIA 4AILC 1S1WA 3G0ZA 4H0VB 3MX2A 1L3VA 1BU6O 3OYDA 3OW2M 2ITGA 4CF0A 4DUYK 3PIOL 4LY7A 1YIJN 3NVKA 1IV0A 3NAEA 5M1QA 4CK1A 4FO0A 3IS9A 2JGUA 4FJXA 1KVCA 3O4WA 3QMLA 3HSTB 5C24A 1IBMK 3CXCM 5SZTA 4DCHA 4BQLA 4B8CA 2RPIA 5BN9A 4U7BA 3O3FA 2KKZA 4B1UB 4IEIA 3HOTA 4FJHA 5KI6A 1KFSA 1LWEA 4M3XA 1J53A 2QWNA 3KTQA 3AV9A 2O8DB 3I0SA 4OO1J 4HWIA 2P9IA 2GTDA 2RKIA 1EO1A 1NGEA 4B3TK 2QWQA 4JYAK 3WNFA 4C8LA 1S1VA 3DWLA 1L5UA 3MK6A 3A5OC 2GELA 3KWGA 1LAWA 2ZWHA 2P5GA 3KK3A 5K14A 4I2PA 2IGIA 3ZSYA 3F9MA 3O08A 4K0KK 4M45A 3IG1A 4FLZA 1CZAN 2X6SA 4LF7K 3DM2A 4KHYA 2NRVA 1J54A 3OBYA 4W5TA 3ZEUA 1IKXA 1RT7A 1QE1A 3FFIA 3I0RA 4NCGA 1BWFO 3SQ2A 5HRNA 1QVGM 2Q36A 1KLNA 4JD2B 4CHPA 1TYQB 2D1KA 2P9KB 1KCFA 2KW4A 1RTJA 4C1NI 2E1YA 3AVCA 3UKRA 4CZIA 2KZZA 2DFHA 5HOOA 4XH5A 3JYTA 2YKMA 1HYSA 1WSGA 3ATVA 5CZ2A 3OYNA 3THXB 4HTLA 3QEXA 2W42A 4PKIA 4DR4K 1ITGA 1C0MA 3ENOA 5E41A 3NVMA 5HP1A 2IC3A 4DB3A 1C0GA 4GY2B 1HLUA 1Z6RA 4M7YA 1GOAA 2HNYA 4BVPA 3A0IX 3SMPA 4DHYA 5AQFA 5LMNK 1DGKN 1VQ8N 2YV0X 3QERA 4YDUA 3K0SA 1BIUA 3OYMA 4OJRA 1RT2A 4HUEA 2P9NA 5AFUA 4BGBA 2QKBA 2P51A 3DMJA 2Q0UA 2ZJQL 4J2BA 4NLCA 1EETA 4DFPA 3R9PA 3M6GA 3QBXA 1VSDA 3AVBA 3LWLA 4CJFA 1ZC6A 3ZETB 5KRTA 2AA4A 4FLTA 1NK6A 3RMBA 4WQ4A 1NGJA 1QQOA 1QHTA 4U67L 2E6LA 4DU3A 4DQSA 5KGWA 3T7ZA 1EXQA 2A40A 3VA3A 3TAQA 1J9AA 4HUGA 4F3TA 5M1KA 3NHGA 5GAEP 3KWIA 4MO4A 2G8FA 1VHXA 4I7FA 1ATRA 1RBRA 3THXA 4RW9A 1XI1A 3VTIA 3NFAA 5M1FA 4I2QA 3DAWA 4DTPA 3HSCA 1X1PA 5CE3A 4PA1A 3K58A 4FJMA 3NGZA 4FWSA 1GLDG 4CJTA 1LWCA 2E20A 3VPZA 2HMPA 4CHYA 4DV7K 3E1YA 3PLAA 2P9PA 3WXKA 3LANA 3L2WA 2A6AA 4DR7K 2ZE2A 2OPSA 3DLLL 2NRHA 1FK9A 2QA4N 5BR9A 4ELVA 3ZEUB 1GLJO 4IOAL 2Y1IA 3S41A 5C10A 3BZCA 1VRTA 3H6EA 4KH4A 1NKCA 2FC0A 4JD2A 2QTDA 4L3QA 3OJUA 2P9SA 1DTQA 4GVMA 3VENA 1QQNA 3PSFA 1JCEA 1NNEA 3PIPL 1IO2A 1VQ7N 1K6YA 1JXBA 1NOYA 5TKWA 2GWKA 1XWLA 4MDBA 3HO1A 2KFNA 4FJ5A 2KFZA 2O8FB 4BC3A 3KLIA 4AHRA 3HZ6A 1MWKA 4LF4K 3EZ5A 3MN9A 2G8KA 4DV0K 4QCLA 3LL3A 4MLEA 5HRPA 4CEZA 4XEIA 3KLGA 2X74A 1TV6A 3ULEA 1YVUA 3OS2A 1RT1A 3UKUB 2V51B 2PYJA 3RRHA 1C0FA 1SQKA 4CBXA 5KQDA 1S9GA 4GMJB 2O8DA 1JXEA 2F7TA 1B9FA 4FPAA 4FWPA 3MX5A 1Z25A 3CFOA 1VQMN 4CW7B 4B3MK 1WAJA 4H4OA 2F4VK 1C1BA 2G8UA 2HHVA 5BRFA 4C8MA 2D0BA 4FWMA 2ITMA 1E3MA 4YHHK 3LDPA 2ASOA 3I56N 4LFCK 3L2VA 4RWTA 2QXLA 3WXJA 5C25A 1KAXA 2NLXA 3J80O 1WOQA 3A5NC 1CLQA 2WUSA 4KKOA 3ZX0A 3T1HK 2G8IA 5J2MA 4M3YA 4NYFA 4FJKA 4CF9A 3O1BA 2VG6A 4KTWA 4CBWA 4EHTA 4LSNA 4C8NA 4MDAA 5EU7A 4N47A 4OKEA 5AQJA 3ZLJA 3AA2A 3ULDA 4H0YB 1HPMA 3R6MA 3K9JA 4BRCA 1X9JA 4A2BA 4B1YB 3VQAA 2UUCK 5FPMA 4F9OA 1RBUA 3AO5A 3NH1A 5AZJA 1LW2A 5FRNA 4DR3K 1RTIA 3ZCMA 4LC9B 2HHSA 3NCIA 5DM6L 4BQZA 3OHRA 3HK2A 3CQYA 3S9HA 4OPJA 1WLJA 3K5NA 5J2PA 1GOCA 1HQEA 1S1UA 5BPNA 3WNEA 3HM9A 4NCBA 1KXPA 2Q2RA 4PL7A 2XY8A 1I39A 1L3UA 3O5BA 5AQUA 2RHKA 2OANA 3H46O 2Z1JA 3LDQA 2P9SB 2XRIA 3SV4A 4WFBL 2Q1NA 1ATNA 1KAZA 1L3SA 5JVHL 3SI6A 4WFNL 4K8ZA 1LWFA 2GUIA 1RDUA 4K25A 1OKJA 2GV9A 4YOTA 1WAFA 4CZEA 3ENBA 1RDCA 4PUOA 2F9TA 2HHWA 4LFAK 3JAMO 2PYLA 4J8FA 5B8HA 2YNFA 3AVMA 4ILGB 2G8WA 3CMAN 3V1RA 2Q3SA 4CK3A 4QAGA 3IFRA 4ZTJA 3L3UA 1MDUB 5TKYA 1G15A 4CGHA 1W97L 4M3TA 4FW2A 1DEJA 3MDQA 1GLAG 1IBKK 4O4GA 1VSKA 1YT3A 3KVGA 1CXUA 2VWJA 1R0AA 3SAGA 2QWMA 1K73O 3AVLA 4Z94A 3FZLA 3E9PA 4N5SA 5HBMA 2VG5A 4N56A 1RILA 3V4IA 2HVHA 4MFBA 4FW1A 4IO9L 1ASWA 2YHYA 4JK8A 4HCBA 1OH6A 3CI5A 1YAGA 3AA3A 1RFQA 3ASMA 4O0JA 4O5FA 1NGCA 1TAQA 4CF8A 3MECA 4BRQA 4H8KA 3FZKA 3O3HA 3HM8A 5HLFA 4CZGA 3PV8A 4TSXA 1S6PA 5C2DA 2G8HA 3DLRA 5A2QO 4FLVA 3V1QA 4B9NA 2KHOA 4JKBA 4DG1A 4FOEA 4O0IA 1KTQA 4IJAA 5ADXH 2QK9A 2VCPA 3M8RA 1JLEA 1X9SA 1IKYA 1JLGA 2NRXA 4R79A 4BROA 4CJ7A 3RR8A 1GLFO 1GLCG 5CYQA 4GV3A 2HBLA 4FJNA 1I3AA 3H1QA 3J81O 4JI4K 4RW6A 1TK0A 3M1FA 4WQ4C 3JSMA 5FROA 2HF3A 1M1KO 3V9SA 2I7PA 3ZSWA 3TAMA 1N33K 1SL2A 2HNZA 3BZKA 4A57A 2ZQBA 3WUHA 4RCHA 3O4QA 4DSKA 2FLOA 5F2RA 4AHCA 4EZ9A 2YNIA 3QDKA 3QNNA 5E84A 3OY9A 3QINA 3OYAA 4I9LA 1WN7A 4B9TA 1QVFM 3DRPA 4OLBA 4CFBA 4EAHD 3EKUA 2UUAK 4Y1CA 2VGNA 2WC9A 4R5PA 4PHTX 3BUZB 2PY5A 1NKEA 4F8RA 4B1XB 1S1TA 2DY4A 5KPTA 2UXCK 3HYFA 2F8TA 4KB1A 1FXXA 3C7NB 3CHWA 4LD0A 3KZBA 4BR4A 4EIAA 4B9VA 3O9UA 2FF3B 4J2DA 4GNIA 1BDGA 3N4PA 2BTFA 4CGGA 4JKGA 1U2VA 1CXQA 1QSSA 3QEVA 1XQSC 3TPQA 3ZX3A 2OA8A 1HPZA 4DR5K 3N4QA 3TR8A 3VEOA 4OPHA 2KQ2A 1GLBG 2FBTA 2O4IA 4EP4A 1RDWX 3AY9A 5BN8A 3F9KA 1SKWA 4CZKA 5AQHA 4H0OA 4FYDA 4CEDA 2F96A 4BDPA 3K59A 2DFEA 3MN6A 4NYNA 1O1WA 3GDQA 4IJNA 5M1OA 4H5VA 1NLVA 4B9MA 1S5JA 3CCRN 3A8YA 4KTQA 2OTLN 3OYBA 5EX5A 4JKHA 3TTDA 4IDHA 3DOLA 4RW7A 1DLOA 3RSEB 2EWSA 3U8XA 3CCQN 2F8SA 1JCFA 4BR5A 2W6LA 2KTQA 2FBXA 2P1JA 1WB9A 2IS3A 1Y97A 4YOWA 1Q9YA 1XMQK 2UXBK 3AVNA 4DSJA 3IUCA 1BA0A 4BRNA 4ELUA 1JLQA 1B92A 2ZF5O 4JKFA 3DLBA 3DJCA 4EFHA 1QSLA 4JI7K 4DR2K 1YTAA 1WNSA 1YUWA 5EOYA 2O8BB 3M8QA 3SBGA 1L3TA 4FLXA 4B3OA 1IH7A 4K41A 3LM9A 4C8OA 4DUZK 3FZHA 4X65K 4QS8A 4B3RK 2ZGZA 4E1JA 1U4BA 3I55N 4M3ZA 3G10A 5KPZA 3CMEN 4CJVA 3BY5A 2V52B 5E26A 3CCMN 1YHQN 3PO5A 4BRIA 5J2NA 3HJFA 3CETA 3L2QA 2HHHK 1VAZA 3H3OB 3ZT4A 4DFMA 4DLEA 3FLCO 2A1SA 2V7ZA 3VGKA 1D9DA 2HVIA 3ZSRA 2W40A 4CGIA 4IG3A 3SAFA 3EN9A 1HX1A 3C6UA 4OLAA 1RBVA 1EX4A 1RT4A 3GBTA 3WXMB 4WF9L 4BDYA 2E2PA 2Y1JA 1C1AA 4G1QA 5AQSA 4LF5K 3LALA 1M90O 2DFFA 5AQPA 1NU0A 3BP8A 1U49A 3FZFA 1IKWA 4HHTA 4ISFA 3T1AA 3MWTA 1NK8A 3OYFA 1JL2A 3AVKA 1IG9A 1KRPA 2UUBK 4A5BA 3TTFA 3NDKA 3T69A 2UYTA 4KREA 2Z1IA 4KHQA 4H0XB 1NK7A 4JI8K 4CIEA 1C0UA 5AQKA 3S3OA 4H0PA 1J6ZA 2JLEA 3S3NA 5GAGP 1TK8A 3RMCA 3DXKA 2XY5A 5FLXO 1QQMA 3TI0A 4E3SA 3LWMA 1RTHA 3ID8A 1N6QA 2OPQA 3C0BA 2WBNA 4Z4CA 3DXMA 3SQ0A 3SK3A 1EWQA 2I5JA 1ILYA 5BR8K 2NZTA 3HBTA 2VQFK 5BPLA 5DM7L 3U9ZA 3A5LC 3K9KA 3ALYA 5J1EA 3MWPA 4MQ3A 1HNZK 3P38A 5FPNA 2PZSA 2HHXA 4DWIA 3MCPA 3C95A 3ULEB 5AZIA 4CF2A 5DMRA 4ISGA 3VF6A 3THVA 2OZMA 4CJ3A 1QTMA 4BREA 4Z4EA 4FWLA 3THWA 1T8EA 3SNNA 3CYMA 4GKJK 3BEXA 1V4SA 4BG9A 3TTCA 2NRZA 2D5RA 2QW9A 4BACA 3UKUA 4XH4A 2DPNA 4OX9K 4B1VA 3PX6A 1VK0A 1VSHA 3AARA 3HOSA 4DS4A 4B9QA 4X66K 3L4QA 3F2KA 5GIPA 2UXDK 2CH6A 5FDLA 1UWBA 4JK7A 3VESA 4Z4GA 5FRMA 1O13A 4E7KA 1YJ9N 5CZ1A 3WEEB 2X78A 5AQLA 4NB4A 4KRFA 4DQ8A 1NK0A 2P9PB 4B1WB 4O44A 4BR9A 4Q0BA 3ZT0A 3K57A 5HL7L 2NRTA 3VQ6A 4JKAA 4OPKA 2QWLA 5AQQA 2O8BA 3AVGA 2RF2A 2HW3A 2A3ZA 1XMOK 3VQBA 1KQSM 3AO3A 3IAYA 5H1SQ 3PO4A 2NUBA 2ASPA 3LP1A 1P8ZA 1MWMA 4CIGA 1VSMA 2JWKA 4DKWA 3EYZA 1XHZA 1BG3A 3LDOA 3OBWA 1TKDA 4QOZB 1BI4B 3VN5A 4M3RA 1WSIA 5CY4A 2B6AA 4KPYA 5KPRA 2A41A 1RDBA 3SBTA 3VEXA 3SUOA 1TKZA 3BF1A 4Z4FA 4FWNA 4CJ5A 4YOUA 4MO5A 3OYJA 4PY5A 1HQUA 1UA0A 4DF4A 1IG8A 1YJNN 2J4RA 3AAPA 3DLHA 3U3GA 4RW8A 2YNGA 4OVLA 3SPYA 2P9NB 4UY8O 4AF1A 2XY6A 3EKSA 2P9UA 1FJGK 3UE5A 4C1NK 3QO9A 1SKRA 1YJWN 4KH6A 1I94K 1U6ZA 2E2QA 4JHDB 1VQPN 1XUPO 2JWLA 3TU5A 4FJIA 4NXMK 4JRPA 2FBVA 5HRSA 5SWMA 4OGCA 2FF6A 4KTZA 1JLAA 4DTSA 3D2FA 4N76A 3MAQA 3J8AA 5KGXA 2YJEA 4KH5A 3M8SA 3V9WA 4JKGB 3LZJA 4DS5A 4AHUA 3MMVA 4W5OA 5AQZA 1K8KA 2BE2A 3LDLA 4B8AB 4F2SA 4AM7A 5I9EB 1QSYA 4PL8A 1NMNA 4CD3A 4IG0A 3AGKA 3O9QA 3NGIA 4FK4A 2GX9A 1T6DA 1Q7YO 3ENHA 2HHTA 3TWHA 3CPEA 3VQ7A 2FSJA 2PAVA 4WQ5C 1HJOA 1NM1A 2ZJRL 4EZ6A 5JLHA 5GIOA 3IDHA 3HI0A 1BI4A 1WUAA 2P9KA 4DR1K 3RTVA 4BRPA 4BRLA 5T7BA 4DV4K 3H3NO 4DFKA 3E9LA 3WEEA 1WSFA 3MXMA 4FWKA 3KHYA 2CGJA 3VQ9A 2OCEA 1SS6A 1RTDA 4DV3K 4E89A 1Q86O 3TSQA 2VYPA 4RG8A 4FZYA 3HL8A 1JJ2M 4PWDA 5AQWA 3NH0A 1T7PA 4CHOA 1D9FA 4BGAA 4A62A 3ZYYX 5BREA 1NJXA 3F73A 2HSTA 1NOZA 5C12A 3KK2A 4B9LA 4CGJA 2D0AA 4IZ9A 3QB0A 5AQIA 4ICLA 1F21A 3FGUA 3CCJN 2NNWA 3CERA 2BGGA 3MEGA 4M3WA 1VSJA 3NF7A 1IJJA 2V7YA 1HRHA 4FM0A 2A42A 4JI6K 4BWMA 1KSPA 2I7NA 2OZSA 2P9IB 5F0XA 4FLYA 5LMUK 3H1VX 4KB0A 2IVOA 1VQ9N 1S3XA 4B08A 3IMXA 2Z1GA 3R1XA 2WTUA 3OYCA 1Q82O 3CFRA 1HJRA 3HPGA 5DK5A 4E7IA 4W5QA 2PBDA 5JS2A 4W5RA 4N41A 1EP4A 1JCGA 3QBWA 3LDNA 3MEDA 4JI2K 4CJWA 3SJJA 4IO8A 4FPBA 4FZXC 1VQ6N 4K42A 3PSIA 2D0CA 3ZX2A 1W9HA 4WFAL 1NKBA 3VF4A 3V9ZA 2QWRA 1BQNA 4OKJA 3EEQA 3KKRA 3T1YK 4DTMA 4NO7A 1LCUA 4DTNA 2NRWA 1TL1A 3O9SA 3ZT3A 4FSVA 4H5RA 5GAHP 1TUYA 1BA1A 3R8EA 5LJVA 4E7JA 4GW6A 4CERA 4DQPA 3EO3A 3BF3A 1NK4A 3WXIA 3SQ1A 4CFCA 3LZIA 4YFUA 4DQQA 4FJGA 1X9WA 3QNOA 3AAQA 4I6MA 3U3YA 3P1GA 4EP5A 4K43A 4OPAA 3ZSVA 3AO2A 1OH7A 2HOEA 4H0TB 1LW0A 3LP0A 3PUFA 1UAXA 1T05A 3C6AA 4GKKK 4KAZA 3TAGA 3CIPA 3D7EO 3GOIA 3SUQA 4M42A 1RCHA 3EE8A 3P83D 3SCXA 3R3LA 4X64K 3DOKA 3MXJA 4NLBA 4KI4A 1NG9A 3W0LA 2D0OA 3LP3A 3L8BA 1G99A 2YHXA 5LL6Z 5MLCQ 4JN4A 1JLBA 4BRMA 1OH5A 1RDAA 4B9SA 3OYKA 5AQYA 4DR6K 3DRRA 4CEEA 1U48A 4H5WA 4Z4HA 4DV5K 3A2FA 3E9OA 3TSPA 3C94A 1VRUA 4A61A 1NGGA 4O8UA 1LV5A 1A5VA 1VSIA 1S9EA 3IRXA 4LH5A 5AQTA 4BE0A 4LH4A 3M3ZA 5M1PA 3CJAA 4CEAA 3SJHA 3CCVN 1EQYA 3RRGA 5EY4A 1KLMA 4AM6A 3VF2A 3CCSN 3CC4N 3C6TA 3TAPA 1HYVA 2ZM6K 5GADP 4XH1A 1IKVA 4ZHRA 3CFPA 2E2NA 4CJSA 4EHUA 1JLFA 4BRDA 4CHQA 4FCYA 4DSIA 4WCEL 3CCEN 3O9TA 4GV9A 1VQ4N 2O8EB 1JKHA 3VQQA 4A59A 1ZXOA 4J2EA 5AQRA 1NJZA 3CD6N 5AQVA 4AHVA 2CGKA 3QEIA 1VSEA 3CJ1A 4DV2K 4CE9A 4BR2A 1NGDA 1Y64A 3CPWM 4FK2A 4KHPK 2FXUA 1QHAA 1ZBHA 3CJCA 3DLEA 1Q81O 4DLGA 4E19A 3TAFA 3M8PA 3CC7N 4HUFA 2DTUA 3KD5E 4CZJA 3D2EA 4LF6K 1QS4A 1WSHA 3D0PA 3VEZA 1REVA 1BCOA 2EX3A 2QWPA 4PKHA 4CI6A 3DLGA 1BL3A 4C8KA 5KQ8A 2YKNA 5JLFA 3VEVA 3KK1A 3V81A 1ZBLA 2WONA 2A1RA 2WFBA 4CZLA 3AVFA 1TK5A 4CVNE 4DQIA 3BDPA 3SYZA 3NMUA 1HKCA 1NBWA 1HNIA 1ESVA 3EL2A 4H5NA 4CESA 2ATQA 4JKEA 1Q18A 4CEFA 3C7NA 5AQNA 5AJ3K 3WT0A 4M3UA 3VQCA 3T3FA 4BE1A 4KHUA 3J7AP 2OPRA 3TARA 1VQKN 1WSEA 5AQGA 2O8FA 2Q97A 5EVZA 1BOTO 2VQEK 4O55A 3SPZA 4ID1A 2ZD1A 1RNHA 5AFUH 3HXMA 1T3VA 2HHQA 2F9WA 3THYB 3OYHA 5D3GA 1U45A 2YI1A 2G8VA 1NGIA 4CEBA 4JI3K 1VQ5N 4WQ5A 2HB5A 2W41A 3V9UA 1S6QA 1HYZA 3LAKA 3H45C 3TSUA 3LPTA 2KZMA 3AO4A 4DTXA 5M1NA 2W6KA 1JL1A 3DRSA 1ASUA 4CJRA 1DTTA 2YX6A 4X62K 3UIQA 1YVNA 1E4GT 4KHSA 1TUUA 1ZYQA 4F3OA 4JEPA 1K8KB 3MN7A 4JHDA 2BANA 2NRRA 5EXWA 2QXFA 4ISEA 3T19A 1RGIA 4O5BA 3VQEA 2YHWA 3E66A 4BVOA 4AHTA 3D2EB 3A5MC 5LY3A 4BWJA
chains in the Genus database with same CATH topology
2NUBA 3LP1A 3HPHA 2Z1JA 4CGDA 3P5JA 3VQ8A 4CIGA 1VSMA 5JS1A 3OYIA 2X6NA 3MEEA 2XRIA 3EYZA 1XHZA 3SV4A 4QOZB 1TKDA 5CYMA 3K5LA 1BI4B 3AVHA 3VN5A 2R7YA 3O4NA 4KI6A 4M3RA 4DFJA 1WSIA 3SI6A 5CY4A 1L3SA 4K8ZA 4PQUA 3QETA 1LWFA 2B6AA 4JRQA 3E01A 2GUIA 4CJUA 4KPYA 2Z1HA 4E7LA 4RW4A 3SQ4A 1RDBA 3HP9A 4OKKA 4DTRA 3SUOA 2GV9A 3QIPA 1TKZA 1U04A 3ZSOA 1WAFA 1RDCA 3B6OA 4PUOA 4Z4FA 1ZBFA 2HHWA 5C42A 2PYLA 4H4MA 4CJ5A 3VQ5A 3D45A 3OYJA 4PY5A 1HQUA 1BGXT 2YNFA 4DF4A 1UA0A 4JS5A 3PX4A 3OYLA 3AVMA 4IFVA 2G8WA 3V1RA 2Q3SA 4CK3A 2LSNA 4QAGA 4CECA 2E6MA 4ZTJA 3NH2A 3L3UA 4W5NA 4CGHA 1G15A 3DLHA 4M3TA 1RT3A 3KIOA 3RMAA 2IOCA 2RN2A 3DI6A 2YNGA 4FW2A 4RW8A 3U3GA 4BDZA 1BHLA 5HROA 3QEPA 4O4GA 1VSKA 3L2UA 4FJ7A 1YT3A 4OVLA 3SPYA 4OGEA 1SUQA 4FLWA 1CXUA 2VWJA 1R0AA 3AVAA 3AVJA 2XY6A 4ELTA 2BDPA 2HNDA 4IBNA 3AVLA 3ZSXA 3ZSZA 1LAVA 3QO9A 1SKRA 3RWUA 4Q5VA 4DMNA 4N5SA 5HBMA 2VG5A 4N56A 1RILA 3V4IA 2HVHA 4MFBA 4FW1A 1RT5A 3HP6A 1ASWA 4FJIA 2ETJA 3WNHA 1TL3A 4JS4A 4CF1A 4HCBA 1KVBA 4ID5A 4KFBA 4JRPA 4J2AA 2FBVA 5HRSA 5SWMA 3AA3A 4OGCA 4YNQA 1CZ9A 2B5JA 4KTZA 4CIFA 1JLAA 1X9MA 4JLHA 1XHXA 4IFYA 4DTSA 3SUNA 3LAMA 1MU2A 4L8RB 3ASMA 3MAQA 4N76A 3KD1E 1FKPA 5KGXA 4O0JA 1TVRA 1TAQA 4FVMA 4CF8A 3M8SA 3I8DA 3V9WA 3MXIA 3MECA 3OS0A 1TGOA 2OPPA 4H8KA 3LZJA 4DS5A 4AHUA 3O3HA 4W5OA 1HMVA 2HHUA 4UQGA 5HLFA 2BE2A 2E4LA 4B8AB 4F2SA 1NJYA 1QSYA 3ZT2A 3PV8A 3QLHA 3DYAA 4IG0A 4CHNA 5HRRA 3NGIA 1SKSA 3AVIA 4FK4A 4TSXA 1S6PA 4CJPA 2AJQA 2G8HA 3DLRA 2KFNA 2HHTA 4AILC 2YHAA 4FLVA 1S1WA 3AA4A 3V1QA 3G0ZA 3TWHA 4B9NA 1L3VA 1S1XA 3IAYA 3OYDA 3VQ7A 4DG1A 1W0HA 1ZBIA 2ITGA 1KTQA 4CF0A 4O0IA 4LY7A 4EZ6A 4HCCA 2QK9A 3ITHA 3NAEA 3M8RA 1BI4A 4CK1A 3IS9A 2JGUA 4FJXA 1KVCA 1JLEA 1X9SA 1IKYA 3RTVA 3RMDA 4CK2A 1JLGA 3HSTB 5C24A 5T7BA 1BISA 3NF9A 5SZTA 3DLKA 4DFKA 3LDSA 3RR8A 2RPIA 1WSFA 4B8CA 3VA0A 4DF8A 3MXMA 3LP2A 5CYQA 3VQ9A 3O3FA 4FJNA 1RTDA 1I3AA 4FJHA 1WSJA 1FKOA 4RW6A 5KI6A 4E89A 4XIUA 1TK0A 4DSFA 1KFSA 1LWEA 4RG8A 3JSMA 1J5OA 4FZYA 4M3XA 3HL8A 1J53A 2FBYA 5FROA 1VSLA 4PWDA 3KTQA 3V9SA 3ZSWA 3NH0A 1T7PA 4CHOA 1D9FA 3SV3A 3TAMA 4CEOA 3QIOA 3AV9A 3TAEA 1NJXA 1SL2A 2HNZA 1RBSA 3F73A 4IKFA 1NOZA 3KK2A 3EY1A 4B9LA 4CGJA 2ZQBA 2D0AA 3VQ4A 3I0SA 1YTUA 1EKEA 4ICLA 1F21A 4DU1A 3HPOA 3O4QA 4DSKA 1NK9A 2BGGA 4FJGA 3MEGA 4M3WA 2RKIA 1VSJA 3NF7A 4AHCA 3WNGA 1HRHA 4FM0A 4LSLA 4BWMA 1KSPA 5I3UA 2OZSA 4EZ9A 2YNIA 4E1NA 4ZTFA 4FLYA 1SL1A 1KFDA 3WNFA 3QNNA 2OYQA 1S1VA 3OY9A 4C8LA 3QINA 3OYAA 4I9LA 1L5UA 1WN7A 4B9TA 4KB0A 4B08A 5KRSA 3DRPA 4OLBA 2Z1GA 4CFBA 3OYCA 1C0TA 1LAWA 2P5GA 3KK3A 4Y1CA 5K14A 4I2PA 4R5PA 3CFRA 2IGIA 3NE6A 3ZSYA 1HJRA 2PY5A 3HPGA 1NKEA 4M45A 3IG1A 4FLZA 1HNVA 5DK5A 1B9DA 4E7IA 1UA1A 2X6SA 4W5QA 3DM2A 4F8RA 5JS2A 4W5RA 4N41A 4CEQA 4KHYA 1EP4A 1S1TA 1J54A 4W5TA 2DY4A 1IKXA 1VSFA 3MEDA 4CJWA 3SJJA 1ASVA 1RT7A 3HYFA 3VQPA 2F8TA 1QE1A 3FFIA 4FZXC 4KB1A 3I0RA 4NCGA 4WE1A 3SQ2A 1FXXA 1XC9A 5HRNA 4LD0A 2D0CA 1KLNA 1W9HA 4CHPA 1NKBA 4B9VA 4J2DA 3V9ZA 3K5MA 1KCFA 2KW4A 1RTJA 1RBTA 1BQNA 4OKJA 4DQRA 3TANA 3AVCA 3L3VA 4CGGA 3KKRA 2DFHA 3SUPA 4FJLA 2KZZA 1CXQA 3JYTA 4DTMA 1U47A 1QSSA 4FK0A 1BIZA 3QEVA 1CZBA 2VWKA 2XY7A 3V6DA 2YKMA 2OA8A 1HPZA 4DTNA 1HYSA 3QEWA 3TR8A 4CJKA 1WSGA 1TL1A 3OYNA 5CZ2A 3ZT3A 4DSEA 3VQDA 2KQ2A 3KKSA 4HTUA 2FBTA 1NK5A 2O4IA 4CCHA 5J2QA 4EP4A 4E7JA 4GW6A 3QEXA 2W42A 4CERA 3F9KA 1SKWA 3PX0A 4DQPA 4E7HA 4IDKA 1D8YA 1ITGA 1C0MA 1NK4A 4FYDA 4CEDA 2F96A 5E41A 3SQ1A 4CFCA 3LZIA 4YFUA 2XHBA 2DFEA 3K59A 4DQQA 4BDPA 4NYNA 3HT3A 5HP1A 1X9WA 3QNOA 1Q9XA 1O1WA 4FJ9A 2IC3A 4B9MA 3NF8A 3U3YA 1S5JA 2IDOA 3H08A 3P1GA 4EP5A 1NJWA 1QQCA 4KTQA 4CFDA 3ZSVA 2YNHA 3AO2A 3OYBA 3KLFA 1GOAA 1RDDA 2HNYA 4I9QA 4FM2A 1LW0A 1SV5A 3DOLA 3LP0A 3PUFA 3OYGA 1UAXA 1DLOA 2YHBA 1KVAA 4RW7A 1T05A 1JLCA 2VG7A 2WOMA 1TKXA 2YV0X 4KAZA 3QERA 2F8SA 3TAGA 1BIUA 3OYMA 4AH9A 3AA5X 4KHWA 4OJRA 1RT2A 4HUEA 2KTQA 2FBXA 2P1JA 1RCHA 3CQ8A 3P83D 3SUQA 3PY8A 3SCXA 4M42A 2IS3A 2QKBA 2P51A 3DOKA 3KLHA 3DMJA 3MXJA 1SL0A 4KI4A 4J2BA 1Y97A 2KFZA 3L8BA 1Q9YA 3LP3A 1EETA 4DFPA 3AVNA 4DSJA 1VSDA 1JLBA 3V9XA 3AVBA 3LWLA 2O4GA 1RDAA 4B9SA 4CJFA 4ELUA 3OYKA 1JLQA 2XO7A 5KRTA 1B92A 4CHZA 4FLTA 3DRRA 4CEEA 1NK6A 3RMBA 3DLBA 4FJJA 1U48A 1QHTA 2EHGA 2IAJA 1QSLA 1RT6A 4Z4HA 2E6LA 3A2FA 3K2PA 4DU3A 4DQSA 5KGWA 3C94A 1VRUA 1YTAA 1EXQA 1WNSA 3VA3A 1C1CA 3BGRA 1LV5A 1A5VA 3M8QA 1J9AA 1S9EA 1VSIA 3TAQA 3IRXA 4LH5A 4HUGA 1L3TA 4F3TA 4BE0A 4FLXA 4LH4A 4B3OA 3NHGA 1IH7A 2G8FA 4Z0UA 4C8OA 4B9UA 4CEAA 3OVNA 4KO0A 4I7FA 3CG7A 1RBRA 3RRGA 4RW9A 1BQMA 1U4BA 1KLMA 4DU4A 4M3ZA 3G10A 1XI1A 4CJVA 3C6TA 3TAPA 3NFAA 4I2QA 1HYVA 1IKVA 4ZHRA 3CFPA 1X1PA 3K58A 4PA1A 4DTPA 3PO5A 3NGZA 4FJMA 4CJSA 3ISNC 5J2NA 1JLFA 3L2QA 3HJFA 4E1MA 3OS1A 4CJTA 4CHQA 4FCYA 4DSIA 4CJEA 1LWCA 1TKTA 3ZT4A 4CHYA 4DFMA 4DLEA 1JKHA 3VQQA 2A1SA 4J2EA 1NJZA 1D9DA 4Z4IA 3LANA 3L2WA 2HVIA 3ZSRA 3NBPA 4KV8A 2ZE2A 2OPSA 4CGFA 4CGIA 4IG3A 4FLUA 2P5OA 4AHVA 3C6UA 3ZT1A 4OLAA 1FK9A 3QEIA 1RBVA 1EX4A 4DTUA 1RT4A 1VSEA 4ELVA 4CE9A 1D5AA 1Q8IA 4BDYA 2Y1IA 2QKKA 3NF6A 4FJ8A 1VRTA 2Y1JA 3U6FA 4FK2A 1NKCA 1C1AA 4FZZA 2FC0A 4G1QA 3OJUA 4BE2A 3LALA 1N5YA 1DTQA 2B4JA 4GVMA 1ZBHA 2DFFA 3DLEA 4DLGA 4E19A 3TAFA 1IO2A 1U49A 3M8PA 2DTUA 4HUFA 3OJSA 3KD5E 1JXBA 1K6YA 4DSLA 1IKWA 4HHTA 3HVTA 1XWLA 3T1AA 1QS4A 3OYFA 1NK8A 1WSHA 1NOYA 4FJ5A 3HO1A 1JL2A 3AVKA 3KLIA 3D0PA 1IG9A 1KRPA 4AHRA 3NDKA 1REVA 1C6VA 1BCOA 2EX3A 3EZ5A 3DLGA 4KREA 1BL3A 4CJLA 4C8KA 2YKNA 2G8KA 2Z1IA 4KHQA 3KK1A 4QCLA 3QESA 5HRPA 3V81A 4CEZA 5I42A 1ZBLA 3KLGA 1NK7A 2X74A 1TV6A 4CIEA 1YVUA 5KTQA 3OS2A 1RT1A 2WONA 2PYJA 2HMIA 1C0UA 2A1RA 3RRHA 1A5WA 3S3OA 4AHSA 2JLEA 3S3NA 1S9GA 1TK8A 3RMCA 4GMJB 2XY5A 1TAUA 3AVFA 1JXEA 1TK5A 1B9FA 3TI0A 4K8XA 4E3SA 4F2RA 4DQIA 2GBZA 1Z25A 3CFOA 3LWMA 1RTHA 3SYZA 3BDPA 1N6QA 1WAJA 2OPQA 4Z4CA 3L2RA 4H4OA 2HHVA 1C1BA 2G8UA 4F4KA 1HNIA 4C8MA 2D0BA 3NGYA 3SQ0A 4CESA 2ATQA 4CEFA 4M3UA 4M41A 2I5JA 3VQCA 3T3FA 4BE1A 4KHUA 4Y1DA 4FXDA 2OPRA 3TARA 1WSEA 3L2VA 3ALYA 5J1EA 3K5OA 4MQ3A 5C25A 1T03A 2PZSA 2HHXA 4O55A 3SPZA 4ID1A 3ZSQA 4DWIA 2ZD1A 3C95A 1CLQA 1RNHA 4KKOA 4CF2A 5DMRA 3HXMA 3THVA 2HHQA 4CJQA 2OZMA 5J2MA 3O3GA 3OYHA 2G8IA 5D3GA 1U45A 4M3YA 4CJ3A 4NYFA 2G8VA 3TABA 4FJKA 4CF9A 1QTMA 3RR7A 4KTWA 2VG6A 4CEBA 1Z26A 4LSNA 4Z4EA 1T8EA 4KHNA 3CM5A 3CYMA 4C8NA 5EU7A 3HVRA 3SNNA 2HB5A 4N47A 3S3MA 4OKEA 2D5RA 4CFAA 1S6QA 4BACA 3V9UA 3AA2A 1HYZA 3ULDA 3LAKA 4DTJA 4CJ4A 3PX6A 3LPTA 2KZMA 1VK0A 1VSHA 4DS4A 3KJVA 1UOCA 3AO4A 4DTXA 5FDLA 3SZ2A 1UWBA 3VQAA 1JL1A 4E0DA 4Z4GA 5FRMA 4E7KA 1ZBUA 4DTOA 3AO1A 3DRSA 1RBUA 3AO5A 4HVJA 3NH1A 4NCAA 1ASUA 1LW2A 1DTTA 5CZ1A 3V1OA 4CJRA 1BCMA 5FRNA 2X78A 3CM6A 3UIQA 4KRFA 4KHSA 3LPUA 4FM1A 1GOBA 1RTIA 3ZCMA 1NK0A 1ZYQA 4F3OA 2HHSA 3NCIA 3HK2A 1A5XA 4O44A 4OPJA 3S9HA 1WLJA 4Q0BA 3B6PA 3ZT0A 3K5NA 3OYEA 5J2PA 1GOCA 3K57A 2BANA 1HQEA 1S1UA 3WNEA 3HM9A 4NCBA 3VQ6A 2QXFA 4OPKA 3T19A 3VQEA 4O5BA 3AVGA 2RF2A 4AHTA 2HW3A 2XY8A 3KLEA 1I39A 1L3UA 3VQBA 3AO3A 4BWJA 3PO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUB A;  3LP1 A;  3HPH A;  2Z1J A;  4CGD A;  3P5J A;  3VQ8 A;  4CIG A;  1VSM A;  5JS1 A;  3OYI A;  2X6N A;  3MEE A;  2XRI A;  3EYZ A;  1XHZ A;  3SV4 A;  4QOZ B;  1TKD A;  5CYM A;  3K5L A;  1BI4 B;  3AVH A;  3VN5 A;  2R7Y A;  3O4N A;  4KI6 A;  4M3R A;  4DFJ A;  1WSI A;  3SI6 A;  5CY4 A;  1L3S A;  4K8Z A;  4PQU A;  3QET A;  1LWF A;  2B6A A;  4JRQ A;  3E01 A;  2GUI A;  4CJU A;  4KPY A;  2Z1H A;  4E7L A;  4RW4 A;  3SQ4 A;  1RDB A;  3HP9 A;  4OKK A;  4DTR A;  3SUO A;  2GV9 A;  3QIP A;  1TKZ A;  1U04 A;  3ZSO A;  1WAF A;  1RDC A;  3B6O A;  4PUO A;  4Z4F A;  1ZBF A;  2HHW A;  5C42 A;  2PYL A;  4H4M A;  4CJ5 A;  3VQ5 A;  3D45 A;  3OYJ A;  4PY5 A;  1HQU A;  1BGX T;  2YNF A;  4DF4 A;  1UA0 A;  4JS5 A;  3PX4 A;  3OYL A;  3AVM A;  4IFV A;  2G8W A;  3V1R A;  2Q3S A;  4CK3 A;  2LSN A;  4QAG A;  4CEC A;  2E6M A;  4ZTJ A;  3NH2 A;  3L3U A;  4W5N A;  4CGH A;  1G15 A;  3DLH A;  4M3T A;  1RT3 A;  3KIO A;  3RMA A;  2IOC A;  2RN2 A;  3DI6 A;  2YNG A;  4FW2 A;  4RW8 A;  3U3G A;  4BDZ A;  1BHL A;  5HRO A;  3QEP A;  4O4G A;  1VSK A;  3L2U A;  4FJ7 A;  1YT3 A;  4OVL A;  3SPY A;  4OGE A;  1SUQ A;  4FLW A;  1CXU A;  2VWJ A;  1R0A A;  3AVA A;  3AVJ A;  2XY6 A;  4ELT A;  2BDP A;  2HND A;  4IBN A;  3AVL A;  3ZSX A;  3ZSZ A;  1LAV A;  3QO9 A;  1SKR A;  3RWU A;  4Q5V A;  4DMN A;  4N5S A;  5HBM A;  2VG5 A;  4N56 A;  1RIL A;  3V4I A;  2HVH A;  4MFB A;  4FW1 A;  1RT5 A;  3HP6 A;  1ASW A;  4FJI A;  2ETJ A;  3WNH A;  1TL3 A;  4JS4 A;  4CF1 A;  4HCB A;  1KVB A;  4ID5 A;  4KFB A;  4JRP A;  4J2A A;  2FBV A;  5HRS A;  5SWM A;  3AA3 A;  4OGC A;  4YNQ A;  1CZ9 A;  2B5J A;  4KTZ A;  4CIF A;  1JLA A;  1X9M A;  4JLH A;  1XHX A;  4IFY A;  4DTS A;  3SUN A;  3LAM A;  1MU2 A;  4L8R B;  3ASM A;  3MAQ A;  4N76 A;  3KD1 E;  1FKP A;  5KGX A;  4O0J A;  1TVR A;  1TAQ A;  4FVM A;  4CF8 A;  3M8S A;  3I8D A;  3V9W A;  3MXI A;  3MEC A;  3OS0 A;  1TGO A;  2OPP A;  4H8K A;  3LZJ A;  4DS5 A;  4AHU A;  3O3H A;  4W5O A;  1HMV A;  2HHU A;  4UQG A;  5HLF A;  2BE2 A;  2E4L A;  4B8A B;  4F2S A;  1NJY A;  1QSY A;  3ZT2 A;  3PV8 A;  3QLH A;  3DYA A;  4IG0 A;  4CHN A;  5HRR A;  3NGI A;  1SKS A;  3AVI A;  4FK4 A;  4TSX A;  1S6P A;  4CJP A;  2AJQ A;  2G8H A;  3DLR A;  2KFN A;  2HHT A;  4AIL C;  2YHA A;  4FLV A;  1S1W A;  3AA4 A;  3V1Q A;  3G0Z A;  3TWH A;  4B9N A;  1L3V A;  1S1X A;  3IAY A;  3OYD A;  3VQ7 A;  4DG1 A;  1W0H A;  1ZBI A;  2ITG A;  1KTQ A;  4CF0 A;  4O0I A;  4LY7 A;  4EZ6 A;  4HCC A;  2QK9 A;  3ITH A;  3NAE A;  3M8R A;  1BI4 A;  4CK1 A;  3IS9 A;  2JGU A;  4FJX A;  1KVC A;  1JLE A;  1X9S A;  1IKY A;  3RTV A;  3RMD A;  4CK2 A;  1JLG A;  3HST B;  5C24 A;  5T7B A;  1BIS A;  3NF9 A;  5SZT A;  3DLK A;  4DFK A;  3LDS A;  3RR8 A;  2RPI A;  1WSF A;  4B8C A;  3VA0 A;  4DF8 A;  3MXM A;  3LP2 A;  5CYQ A;  3VQ9 A;  3O3F A;  4FJN A;  1RTD A;  1I3A A;  4FJH A;  1WSJ A;  1FKO A;  4RW6 A;  5KI6 A;  4E89 A;  4XIU A;  1TK0 A;  4DSF A;  1KFS A;  1LWE A;  4RG8 A;  3JSM A;  1J5O A;  4FZY A;  4M3X A;  3HL8 A;  1J53 A;  2FBY A;  5FRO A;  1VSL A;  4PWD A;  3KTQ A;  3V9S A;  3ZSW A;  3NH0 A;  1T7P A;  4CHO A;  1D9F A;  3SV3 A;  3TAM A;  4CEO A;  3QIO A;  3AV9 A;  3TAE A;  1NJX A;  1SL2 A;  2HNZ A;  1RBS A;  3F73 A;  4IKF A;  1NOZ A;  3KK2 A;  3EY1 A;  4B9L A;  4CGJ A;  2ZQB A;  2D0A A;  3VQ4 A;  3I0S A;  1YTU A;  1EKE A;  4ICL A;  1F21 A;  4DU1 A;  3HPO A;  3O4Q A;  4DSK A;  1NK9 A;  2BGG A;  4FJG A;  3MEG A;  4M3W A;  2RKI A;  1VSJ A;  3NF7 A;  4AHC A;  3WNG A;  1HRH A;  4FM0 A;  4LSL A;  4BWM A;  1KSP A;  5I3U A;  2OZS A;  4EZ9 A;  2YNI A;  4E1N A;  4ZTF A;  4FLY A;  1SL1 A;  1KFD A;  3WNF A;  3QNN A;  2OYQ A;  1S1V A;  3OY9 A;  4C8L A;  3QIN A;  3OYA A;  4I9L A;  1L5U A;  1WN7 A;  4B9T A;  4KB0 A;  4B08 A;  5KRS A;  3DRP A;  4OLB A;  2Z1G A;  4CFB A;  3OYC A;  1C0T A;  1LAW A;  2P5G A;  3KK3 A;  4Y1C A;  5K14 A;  4I2P A;  4R5P A;  3CFR A;  2IGI A;  3NE6 A;  3ZSY A;  1HJR A;  2PY5 A;  3HPG A;  1NKE A;  4M45 A;  3IG1 A;  4FLZ A;  1HNV A;  5DK5 A;  1B9D A;  4E7I A;  1UA1 A;  2X6S A;  4W5Q A;  3DM2 A;  4F8R A;  5JS2 A;  4W5R A;  4N41 A;  4CEQ A;  4KHY A;  1EP4 A;  1S1T A;  1J54 A;  4W5T A;  2DY4 A;  1IKX A;  1VSF A;  3MED A;  4CJW A;  3SJJ A;  1ASV A;  1RT7 A;  3HYF A;  3VQP A;  2F8T A;  1QE1 A;  3FFI A;  4FZX C;  4KB1 A;  3I0R A;  4NCG A;  4WE1 A;  3SQ2 A;  1FXX A;  1XC9 A;  5HRN A;  4LD0 A;  2D0C A;  1KLN A;  1W9H A;  4CHP A;  1NKB A;  4B9V A;  4J2D A;  3V9Z A;  3K5M A;  1KCF A;  2KW4 A;  1RTJ A;  1RBT A;  1BQN A;  4OKJ A;  4DQR A;  3TAN A;  3AVC A;  3L3V A;  4CGG A;  3KKR A;  2DFH A;  3SUP A;  4FJL A;  2KZZ A;  1CXQ A;  3JYT A;  4DTM A;  1U47 A;  1QSS A;  4FK0 A;  1BIZ A;  3QEV A;  1CZB A;  2VWK A;  2XY7 A;  3V6D A;  2YKM A;  2OA8 A;  1HPZ A;  4DTN A;  1HYS A;  3QEW A;  3TR8 A;  4CJK A;  1WSG A;  1TL1 A;  3OYN A;  5CZ2 A;  3ZT3 A;  4DSE A;  3VQD A;  2KQ2 A;  3KKS A;  4HTU A;  2FBT A;  1NK5 A;  2O4I A;  4CCH A;  5J2Q A;  4EP4 A;  4E7J A;  4GW6 A;  3QEX A;  2W42 A;  4CER A;  3F9K A;  1SKW A;  3PX0 A;  4DQP A;  4E7H A;  4IDK A;  1D8Y A;  1ITG A;  1C0M A;  1NK4 A;  4FYD A;  4CED A;  2F96 A;  5E41 A;  3SQ1 A;  4CFC A;  3LZI A;  4YFU A;  2XHB A;  2DFE A;  3K59 A;  4DQQ A;  4BDP A;  4NYN A;  3HT3 A;  5HP1 A;  1X9W A;  3QNO A;  1Q9X A;  1O1W A;  4FJ9 A;  2IC3 A;  4B9M A;  3NF8 A;  3U3Y A;  1S5J A;  2IDO A;  3H08 A;  3P1G A;  4EP5 A;  1NJW A;  1QQC A;  4KTQ A;  4CFD A;  3ZSV A;  2YNH A;  3AO2 A;  3OYB A;  3KLF A;  1GOA A;  1RDD A;  2HNY A;  4I9Q A;  4FM2 A;  1LW0 A;  1SV5 A;  3DOL A;  3LP0 A;  3PUF A;  3OYG A;  1UAX A;  1DLO A;  2YHB A;  1KVA A;  4RW7 A;  1T05 A;  1JLC A;  2VG7 A;  2WOM A;  1TKX A;  2YV0 X;  4KAZ A;  3QER A;  2F8S A;  3TAG A;  1BIU A;  3OYM A;  4AH9 A;  3AA5 X;  4KHW A;  4OJR A;  1RT2 A;  4HUE A;  2KTQ A;  2FBX A;  2P1J A;  1RCH A;  3CQ8 A;  3P83 D;  3SUQ A;  3PY8 A;  3SCX A;  4M42 A;  2IS3 A;  2QKB A;  2P51 A;  3DOK A;  3KLH A;  3DMJ A;  3MXJ A;  1SL0 A;  4KI4 A;  4J2B A;  1Y97 A;  2KFZ A;  3L8B A;  1Q9Y A;  3LP3 A;  1EET A;  4DFP A;  3AVN A;  4DSJ A;  1VSD A;  1JLB A;  3V9X A;  3AVB A;  3LWL A;  2O4G A;  1RDA A;  4B9S A;  4CJF A;  4ELU A;  3OYK A;  1JLQ A;  2XO7 A;  5KRT A;  1B92 A;  4CHZ A;  4FLT A;  3DRR A;  4CEE A;  1NK6 A;  3RMB A;  3DLB A;  4FJJ A;  1U48 A;  1QHT A;  2EHG A;  2IAJ A;  1QSL A;  1RT6 A;  4Z4H A;  2E6L A;  3A2F A;  3K2P A;  4DU3 A;  4DQS A;  5KGW A;  3C94 A;  1VRU A;  1YTA A;  1EXQ A;  1WNS A;  3VA3 A;  1C1C A;  3BGR A;  1LV5 A;  1A5V A;  3M8Q A;  1J9A A;  1S9E A;  1VSI A;  3TAQ A;  3IRX A;  4LH5 A;  4HUG A;  1L3T A;  4F3T A;  4BE0 A;  4FLX A;  4LH4 A;  4B3O A;  3NHG A;  1IH7 A;  2G8F A;  4Z0U A;  4C8O A;  4B9U A;  4CEA A;  3OVN A;  4KO0 A;  4I7F A;  3CG7 A;  1RBR A;  3RRG A;  4RW9 A;  1BQM A;  1U4B A;  1KLM A;  4DU4 A;  4M3Z A;  3G10 A;  1XI1 A;  4CJV A;  3C6T A;  3TAP A;  3NFA A;  4I2Q A;  1HYV A;  1IKV A;  4ZHR A;  3CFP A;  1X1P A;  3K58 A;  4PA1 A;  4DTP A;  3PO5 A;  3NGZ A;  4FJM A;  4CJS A;  3ISN C;  5J2N A;  1JLF A;  3L2Q A;  3HJF A;  4E1M A;  3OS1 A;  4CJT A;  4CHQ A;  4FCY A;  4DSI A;  4CJE A;  1LWC A;  1TKT A;  3ZT4 A;  4CHY A;  4DFM A;  4DLE A;  1JKH A;  3VQQ A;  2A1S A;  4J2E A;  1NJZ A;  1D9D A;  4Z4I A;  3LAN A;  3L2W A;  2HVI A;  3ZSR A;  3NBP A;  4KV8 A;  2ZE2 A;  2OPS A;  4CGF A;  4CGI A;  4IG3 A;  4FLU A;  2P5O A;  4AHV A;  3C6U A;  3ZT1 A;  4OLA A;  1FK9 A;  3QEI A;  1RBV A;  1EX4 A;  4DTU A;  1RT4 A;  1VSE A;  4ELV A;  4CE9 A;  1D5A A;  1Q8I A;  4BDY A;  2Y1I A;  2QKK A;  3NF6 A;  4FJ8 A;  1VRT A;  2Y1J A;  3U6F A;  4FK2 A;  1NKC A;  1C1A A;  4FZZ A;  2FC0 A;  4G1Q A;  3OJU A;  4BE2 A;  3LAL A;  1N5Y A;  1DTQ A;  2B4J A;  4GVM A;  1ZBH A;  2DFF A;  3DLE A;  4DLG A;  4E19 A;  3TAF A;  1IO2 A;  1U49 A;  3M8P A;  2DTU A;  4HUF A;  3OJS A;  3KD5 E;  1JXB A;  1K6Y A;  4DSL A;  1IKW A;  4HHT A;  3HVT A;  1XWL A;  3T1A A;  1QS4 A;  3OYF A;  1NK8 A;  1WSH A;  1NOY A;  4FJ5 A;  3HO1 A;  1JL2 A;  3AVK A;  3KLI A;  3D0P A;  1IG9 A;  1KRP A;  4AHR A;  3NDK A;  1REV A;  1C6V A;  1BCO A;  2EX3 A;  3EZ5 A;  3DLG A;  4KRE A;  1BL3 A;  4CJL A;  4C8K A;  2YKN A;  2G8K A;  2Z1I A;  4KHQ A;  3KK1 A;  4QCL A;  3QES A;  5HRP A;  3V81 A;  4CEZ A;  5I42 A;  1ZBL A;  3KLG A;  1NK7 A;  2X74 A;  1TV6 A;  4CIE A;  1YVU A;  5KTQ A;  3OS2 A;  1RT1 A;  2WON A;  2PYJ A;  2HMI A;  1C0U A;  2A1R A;  3RRH A;  1A5W A;  3S3O A;  4AHS A;  2JLE A;  3S3N A;  1S9G A;  1TK8 A;  3RMC A;  4GMJ B;  2XY5 A;  1TAU A;  3AVF A;  1JXE A;  1TK5 A;  1B9F A;  3TI0 A;  4K8X A;  4E3S A;  4F2R A;  4DQI A;  2GBZ A;  1Z25 A;  3CFO A;  3LWM A;  1RTH A;  3SYZ A;  3BDP A;  1N6Q A;  1WAJ A;  2OPQ A;  4Z4C A;  3L2R A;  4H4O A;  2HHV A;  1C1B A;  2G8U A;  4F4K A;  1HNI A;  4C8M A;  2D0B A;  3NGY A;  3SQ0 A;  4CES A;  2ATQ A;  4CEF A;  4M3U A;  4M41 A;  2I5J A;  3VQC A;  3T3F A;  4BE1 A;  4KHU A;  4Y1D A;  4FXD A;  2OPR A;  3TAR A;  1WSE A;  3L2V A;  3ALY A;  5J1E A;  3K5O A;  4MQ3 A;  5C25 A;  1T03 A;  2PZS A;  2HHX A;  4O55 A;  3SPZ A;  4ID1 A;  3ZSQ A;  4DWI A;  2ZD1 A;  3C95 A;  1CLQ A;  1RNH A;  4KKO A;  4CF2 A;  5DMR A;  3HXM A;  3THV A;  2HHQ A;  4CJQ A;  2OZM A;  5J2M A;  3O3G A;  3OYH A;  2G8I A;  5D3G A;  1U45 A;  4M3Y A;  4CJ3 A;  4NYF A;  2G8V A;  3TAB A;  4FJK A;  4CF9 A;  1QTM A;  3RR7 A;  4KTW A;  2VG6 A;  4CEB A;  1Z26 A;  4LSN A;  4Z4E A;  1T8E A;  4KHN A;  3CM5 A;  3CYM A;  4C8N A;  5EU7 A;  3HVR A;  3SNN A;  2HB5 A;  4N47 A;  3S3M A;  4OKE A;  2D5R A;  4CFA A;  1S6Q A;  4BAC A;  3V9U A;  3AA2 A;  1HYZ A;  3ULD A;  3LAK A;  4DTJ A;  4CJ4 A;  3PX6 A;  3LPT A;  2KZM A;  1VK0 A;  1VSH A;  4DS4 A;  3KJV A;  1UOC A;  3AO4 A;  4DTX A;  5FDL A;  3SZ2 A;  1UWB A;  3VQA A;  1JL1 A;  4E0D A;  4Z4G A;  5FRM A;  4E7K A;  1ZBU A;  4DTO A;  3AO1 A;  3DRS A;  1RBU A;  3AO5 A;  4HVJ A;  3NH1 A;  4NCA A;  1ASU A;  1LW2 A;  1DTT A;  5CZ1 A;  3V1O A;  4CJR A;  1BCM A;  5FRN A;  2X78 A;  3CM6 A;  3UIQ A;  4KRF A;  4KHS A;  3LPU A;  4FM1 A;  1GOB A;  1RTI A;  3ZCM A;  1NK0 A;  1ZYQ A;  4F3O A;  2HHS A;  3NCI A;  3HK2 A;  1A5X A;  4O44 A;  4OPJ A;  3S9H A;  1WLJ A;  4Q0B A;  3B6P A;  3ZT0 A;  3K5N A;  3OYE A;  5J2P A;  1GOC A;  3K57 A;  2BAN A;  1HQE A;  1S1U A;  3WNE A;  3HM9 A;  4NCB A;  3VQ6 A;  2QXF A;  4OPK A;  3T19 A;  3VQE A;  4O5B A;  3AVG A;  2RF2 A;  4AHT A;  2HW3 A;  2XY8 A;  3KLE A;  1I39 A;  1L3U A;  3VQB A;  3AO3 A;  4BWJ A;  3PO4 A; 
#chains in the Genus database with same CATH topology
 3HPH A;  4CGD A;  3P5J A;  3VQ8 A;  5BRD A;  3MEE A;  3VTH A;  3K5L A;  3CJ9 A;  3AVH A;  5AQM A;  3CC2 N;  1N8R O;  5AQO A;  3QET A;  4JRQ A;  3E01 A;  3VET A;  4RW4 A;  4OKK A;  2CH5 A;  3QIP A;  3B6O A;  4H4M A;  3VQ5 A;  1VQN N;  3D45 A;  1BGX T;  3OYL A;  3L0Q A;  3SAH A;  3I33 A;  2HBJ A;  3CQX A;  4GV6 A;  2E6M A;  4M63 C;  4YOR A;  3GG4 A;  3UB5 A;  1KC8 O;  1E4F T;  4W5N A;  2QI2 A;  1K8A O;  1EWR A;  3RMA A;  2IOC A;  2RN2 A;  3DI6 A;  1N34 K;  4BDZ A;  2IVN A;  5GIN A;  3IKM A;  5ELZ A;  1HNX K;  4OGE A;  1SUQ A;  1T6C A;  4FLW A;  4YY3 K;  3AVA A;  3VEY A;  2HND A;  4IBN A;  2YJF A;  3O9R A;  3O80 A;  3MCA B;  2ETJ A;  4Y0W A;  3WNH A;  4CF1 A;  4BY9 C;  1XNR K;  1KVB A;  4ID5 A;  4KFB A;  4V19 S;  1CZ9 A;  2B5J A;  4HCC A;  4IFY A;  3LAM A;  1YIT N;  4BRA A;  1YI2 N;  3KD1 E;  1TVR A;  3HTV A;  1HR0 K;  4FOI A;  1XC3 A;  3UKR B;  1TGO A;  2OPP A;  2HHU A;  2H3G X;  1HMV A;  1NJY A;  4FWQ A;  3ZT2 A;  3FFK B;  3DYA A;  4CHN A;  5HRR A;  2AJQ A;  4CJP A;  2BH1 A;  2GUP A;  2YHA A;  3AA4 A;  4NXN K;  1S22 A;  3L6Q A;  1S1X A;  1VQO N;  1W0H A;  1ZBI A;  5C2F A;  3ITH A;  1SAZ A;  3RMD A;  4CK2 A;  3G71 N;  3J7Y P;  1BIS A;  5AR0 A;  3NF9 A;  3DLK A;  4FL9 A;  3LDS A;  4ILJ A;  3VA0 A;  4DF8 A;  4JI5 K;  3LP2 A;  3THW B;  1YXQ A;  3O8M A;  3VOV A;  4LFB K;  1XNQ K;  2VWB A;  1WSJ A;  1FKO A;  4XIU A;  4DSF A;  4BR7 A;  3G25 A;  1J5O A;  3DXM B;  2FBY A;  1WBD A;  1VSL A;  3J7Z O;  1OVQ A;  1W2B M;  1W7A A;  4AQY K;  3Q7B A;  3SV3 A;  4CEO A;  3QIO A;  3TAE A;  4A2A A;  5AZJ B;  4IKF A;  1RBS A;  3EY1 A;  1NGB A;  1P90 A;  3DXK B;  3Q7C A;  5JMV A;  3VQ4 A;  4BRH A;  1YTU A;  1EKE A;  4ILH A;  4DU1 A;  3HPO A;  1NK9 A;  2HF4 A;  3GL1 A;  4LF8 K;  5C0Y A;  3WNG A;  2FSK A;  4LSL A;  5I3U A;  4E1N A;  4ZTF A;  1SL1 A;  1KFD A;  2OYQ A;  3OA9 A;  3VGM A;  2GEM A;  4O8K A;  5KRS A;  4BR0 A;  4JKD A;  1C0T A;  1Z05 A;  1K9M O;  5BRH A;  4IOC L;  3NE6 A;  3U9D A;  1QZ5 A;  1HNV A;  1B9D A;  1UA1 A;  4JKC A;  3P4I A;  4CEQ A;  2E1Z A;  3QFU A;  4IXC A;  2RE2 A;  3FE1 A;  4CBU A;  3G4S N;  1VSF A;  3AGR A;  3WXL A;  1ASV A;  3VQP A;  1DT9 A;  4WE1 A;  1IBL K;  1XC9 A;  4DV6 K;  1S72 N;  3VGL A;  3K5M A;  1WBB A;  1RBT A;  2D4W A;  3TAN A;  4DQR A;  3L3V A;  5LJW A;  3SUP A;  4FJL A;  1NWK A;  1U47 A;  4FK0 A;  1BIZ A;  1CZB A;  2VWK A;  2XY7 A;  3V6D A;  3QEW A;  1H1V A;  1T44 A;  4CJK A;  4CZF A;  4DSE A;  3VQD A;  3KKS A;  4HTU A;  1NK5 A;  5BPM A;  2CGL A;  5J2Q A;  4CCH A;  2D0P A;  3QFP A;  1LOT B;  3PX0 A;  3OTO K;  4E7H A;  4IDK A;  1D8Y A;  4QS9 A;  2YCH A;  1V4T A;  2XHB A;  4JAX A;  4FJ9 A;  3HT3 A;  1Q9X A;  3NF8 A;  3H08 A;  2IDO A;  1NJW A;  1QQC A;  4CFD A;  3KLF A;  2YNH A;  4BC5 A;  1YF5 L;  4M7X A;  1RDD A;  4I9Q A;  4FM2 A;  1SV5 A;  3OYG A;  1VQL N;  2UU9 K;  2YHB A;  1KVA A;  1JLC A;  2VG7 A;  2WOM A;  3I8B A;  4YDU C;  4CZM A;  1TKX A;  2KLA A;  3QIC A;  4AH9 A;  3AA5 X;  1X3M A;  4KHW A;  2Q31 A;  3CQ8 A;  3PY8 A;  2P9L A;  3KLH A;  1SL0 A;  4JV5 K;  3RSE A;  3SMS A;  3V9X A;  2O4G A;  2XO7 A;  3MN5 A;  4CHZ A;  4JI0 K;  4LF9 K;  3D2F B;  4FJJ A;  4FWO A;  2EHG A;  2IAJ A;  1RT6 A;  1FW6 A;  3K2P A;  1GLL O;  2GWJ A;  5CHI A;  1C1C A;  3ZET A;  3BGR A;  3M5R A;  4IOX A;  2E5L K;  3C65 A;  4JNE A;  4Z0U A;  4MLH A;  4B9U A;  2P9U B;  3OVN A;  4KO0 A;  3W3D A;  3CG7 A;  2FSN A;  1BQM A;  2E8A A;  4DU4 A;  3P39 A;  3FZM A;  5JVG L;  2Q0R A;  1MA9 B;  1NGH A;  3ISN C;  4E1M A;  3OS1 A;  4CJE A;  2IVP A;  1R59 O;  1TKT A;  4FWR A;  1BUP A;  4GVE A;  2VGM A;  3C6H A;  4Z4I A;  3NBP A;  2E88 A;  4KV8 A;  4CGF A;  2P5O A;  4FLU A;  3ID6 A;  1HKB A;  3ZT1 A;  2OTJ N;  4DTU A;  3EZW A;  3FR0 A;  3O1W A;  1U2V B;  1D5A A;  5FPD A;  1Q8I A;  2QKK A;  3NF6 A;  4IEE A;  3CCL N;  4FJ8 A;  3U6F A;  4FZZ A;  4YOX A;  3U4L A;  4BE2 A;  4C23 A;  1HKG A;  2B4J A;  4IWV A;  1N5Y A;  3OJS A;  2IIR A;  1N32 K;  4DSL A;  3HVT A;  5C15 A;  5IWA K;  4QS7 A;  1QZ6 A;  1C6V A;  4CJL A;  3THY A;  3F5T A;  3QES A;  5I42 A;  4BC4 A;  5KTQ A;  2HMI A;  1A5W A;  4AHS A;  4CD1 A;  1TAU A;  1ATS A;  4K8X A;  4F2R A;  1GLE G;  2GBZ A;  3L2R A;  4F4K A;  2E2O A;  1TYQ A;  2ZJP L;  3NGY A;  4M41 A;  4A5A A;  5JIC A;  4Y1D A;  4FXD A;  3K5O A;  4CZH A;  1T03 A;  3ZSQ A;  1HUX A;  5AZI B;  2A5X A;  4CJQ A;  3O3G A;  5AQX A;  3TAB A;  3SLC A;  3RR7 A;  4G9Z A;  1Z26 A;  3D6R A;  4KHN A;  3CM5 A;  3HVR A;  3S3M A;  3WQT A;  4CFA A;  4DTJ A;  4CJ4 A;  4BC2 A;  1NGF A;  3KJV A;  1KAY A;  3EE9 A;  1UOC A;  4RTF D;  4KBO A;  4JI1 K;  3O6W A;  3SZ2 A;  5F1X A;  1BO5 O;  4FVU A;  4E0D A;  4H03 B;  1ZBU A;  4DTO A;  3AO1 A;  4HVJ A;  4NCA A;  5CR4 A;  3V1O A;  1OH8 A;  1BCM A;  3CM6 A;  3LPU A;  4FM1 A;  1GOB A;  2O8E A;  1A5X A;  3P31 A;  4DV1 K;  2HBK A;  3B6P A;  3OYE A;  1SZ2 A;  1NGA A;  4H5T A;  2QM1 A;  3KLE A;  4BG8 A;  4JLH A;  3CJ7 A;  2QWO A;  3G6E N;  5JS1 A;  4YOV A;  3OYI A;  2X6N A;  1HNW K;  4PKG A;  5CYM A;  2R7Y A;  3O4N A;  4KI6 A;  4DFJ A;  4PQU A;  2QEX N;  4BRK A;  4CJU A;  2Z1H A;  4E7L A;  3SQ4 A;  3HP9 A;  4DTR A;  1NMD A;  1U04 A;  4JK9 A;  3ZSO A;  1ZBF A;  2AP1 A;  2P9L B;  5C42 A;  1KD1 O;  3VMF B;  3VER A;  3B8A X;  3L4I A;  4JS5 A;  3KK7 A;  3PX4 A;  4IFV A;  3ATU A;  2ASM A;  2LSN A;  4CEC A;  3JXU A;  3LM2 A;  4B3S K;  3NH2 A;  5ADX A;  2HBM A;  3JS6 A;  1RT3 A;  3KIO A;  3CJB A;  1ZBS A;  5HRO A;  1BHL A;  3QEP A;  1NJI O;  3L2U A;  4FJ7 A;  3CCU N;  1DKG D;  2PFU A;  2BUP A;  3AVJ A;  4ELT A;  2BDP A;  4IFE A;  2O8C A;  3ZSX A;  3ZSZ A;  1LAV A;  3RWU A;  3CF5 L;  4Q5V A;  4DMN A;  1OVY A;  1RT5 A;  3HP6 A;  4JS4 A;  1N36 K;  1TL3 A;  2O8C B;  4J2A A;  1J5E K;  1D4X A;  4WYB A;  4YNQ A;  3RVC A;  3WQU A;  4CIF A;  1X9M A;  1XHX A;  3SUN A;  1MU2 A;  4L8R B;  4I6M B;  1X3N A;  3HRG A;  1FKP A;  4B1Z A;  4FVM A;  5IT9 O;  3I8D A;  3MXI A;  4YOY A;  3OS0 A;  3VEW A;  4UQG A;  2E4L A;  3GE1 A;  4BRG A;  5FPE A;  1SKS A;  3QLH A;  2ZGY A;  4BRF A;  3AVI A;  4AIL C;  1S1W A;  3G0Z A;  4H0V B;  3MX2 A;  1L3V A;  1BU6 O;  3OYD A;  3OW2 M;  2ITG A;  4CF0 A;  4DUY K;  3PIO L;  4LY7 A;  1YIJ N;  3NVK A;  1IV0 A;  3NAE A;  5M1Q A;  4CK1 A;  4FO0 A;  3IS9 A;  2JGU A;  4FJX A;  1KVC A;  3O4W A;  3QML A;  3HST B;  5C24 A;  1IBM K;  3CXC M;  5SZT A;  4DCH A;  4BQL A;  4B8C A;  2RPI A;  5BN9 A;  4U7B A;  3O3F A;  2KKZ A;  4B1U B;  4IEI A;  3HOT A;  4FJH A;  5KI6 A;  1KFS A;  1LWE A;  4M3X A;  1J53 A;  2QWN A;  3KTQ A;  3AV9 A;  2O8D B;  3I0S A;  4OO1 J;  4HWI A;  2P9I A;  2GTD A;  2RKI A;  1EO1 A;  1NGE A;  4B3T K;  2QWQ A;  4JYA K;  3WNF A;  4C8L A;  1S1V A;  3DWL A;  1L5U A;  3MK6 A;  3A5O C;  2GEL A;  3KWG A;  1LAW A;  2ZWH A;  2P5G A;  3KK3 A;  5K14 A;  4I2P A;  2IGI A;  3ZSY A;  3F9M A;  3O08 A;  4K0K K;  4M45 A;  3IG1 A;  4FLZ A;  1CZA N;  2X6S A;  4LF7 K;  3DM2 A;  4KHY A;  2NRV A;  1J54 A;  3OBY A;  4W5T A;  3ZEU A;  1IKX A;  1RT7 A;  1QE1 A;  3FFI A;  3I0R A;  4NCG A;  1BWF O;  3SQ2 A;  5HRN A;  1QVG M;  2Q36 A;  1KLN A;  4JD2 B;  4CHP A;  1TYQ B;  2D1K A;  2P9K B;  1KCF A;  2KW4 A;  1RTJ A;  4C1N I;  2E1Y A;  3AVC A;  3UKR A;  4CZI A;  2KZZ A;  2DFH A;  5HOO A;  4XH5 A;  3JYT A;  2YKM A;  1HYS A;  1WSG A;  3ATV A;  5CZ2 A;  3OYN A;  3THX B;  4HTL A;  3QEX A;  2W42 A;  4PKI A;  4DR4 K;  1ITG A;  1C0M A;  3ENO A;  5E41 A;  3NVM A;  5HP1 A;  2IC3 A;  4DB3 A;  1C0G A;  4GY2 B;  1HLU A;  1Z6R A;  4M7Y A;  1GOA A;  2HNY A;  4BVP A;  3A0I X;  3SMP A;  4DHY A;  5AQF A;  5LMN K;  1DGK N;  1VQ8 N;  2YV0 X;  3QER A;  4YDU A;  3K0S A;  1BIU A;  3OYM A;  4OJR A;  1RT2 A;  4HUE A;  2P9N A;  5AFU A;  4BGB A;  2QKB A;  2P51 A;  3DMJ A;  2Q0U A;  2ZJQ L;  4J2B A;  4NLC A;  1EET A;  4DFP A;  3R9P A;  3M6G A;  3QBX A;  1VSD A;  3AVB A;  3LWL A;  4CJF A;  1ZC6 A;  3ZET B;  5KRT A;  2AA4 A;  4FLT A;  1NK6 A;  3RMB A;  4WQ4 A;  1NGJ A;  1QQO A;  1QHT A;  4U67 L;  2E6L A;  4DU3 A;  4DQS A;  5KGW A;  3T7Z A;  1EXQ A;  2A40 A;  3VA3 A;  3TAQ A;  1J9A A;  4HUG A;  4F3T A;  5M1K A;  3NHG A;  5GAE P;  3KWI A;  4MO4 A;  2G8F A;  1VHX A;  4I7F A;  1ATR A;  1RBR A;  3THX A;  4RW9 A;  1XI1 A;  3VTI A;  3NFA A;  5M1F A;  4I2Q A;  3DAW A;  4DTP A;  3HSC A;  1X1P A;  5CE3 A;  4PA1 A;  3K58 A;  4FJM A;  3NGZ A;  4FWS A;  1GLD G;  4CJT A;  1LWC A;  2E20 A;  3VPZ A;  2HMP A;  4CHY A;  4DV7 K;  3E1Y A;  3PLA A;  2P9P A;  3WXK A;  3LAN A;  3L2W A;  2A6A A;  4DR7 K;  2ZE2 A;  2OPS A;  3DLL L;  2NRH A;  1FK9 A;  2QA4 N;  5BR9 A;  4ELV A;  3ZEU B;  1GLJ O;  4IOA L;  2Y1I A;  3S41 A;  5C10 A;  3BZC A;  1VRT A;  3H6E A;  4KH4 A;  1NKC A;  2FC0 A;  4JD2 A;  2QTD A;  4L3Q A;  3OJU A;  2P9S A;  1DTQ A;  4GVM A;  3VEN A;  1QQN A;  3PSF A;  1JCE A;  1NNE A;  3PIP L;  1IO2 A;  1VQ7 N;  1K6Y A;  1JXB A;  1NOY A;  5TKW A;  2GWK A;  1XWL A;  4MDB A;  3HO1 A;  2KFN A;  4FJ5 A;  2KFZ A;  2O8F B;  4BC3 A;  3KLI A;  4AHR A;  3HZ6 A;  1MWK A;  4LF4 K;  3EZ5 A;  3MN9 A;  2G8K A;  4DV0 K;  4QCL A;  3LL3 A;  4MLE A;  5HRP A;  4CEZ A;  4XEI A;  3KLG A;  2X74 A;  1TV6 A;  3ULE A;  1YVU A;  3OS2 A;  1RT1 A;  3UKU B;  2V51 B;  2PYJ A;  3RRH A;  1C0F A;  1SQK A;  4CBX A;  5KQD A;  1S9G A;  4GMJ B;  2O8D A;  1JXE A;  2F7T A;  1B9F A;  4FPA A;  4FWP A;  3MX5 A;  1Z25 A;  3CFO A;  1VQM N;  4CW7 B;  4B3M K;  1WAJ A;  4H4O A;  2F4V K;  1C1B A;  2G8U A;  2HHV A;  5BRF A;  4C8M A;  2D0B A;  4FWM A;  2ITM A;  1E3M A;  4YHH K;  3LDP A;  2ASO A;  3I56 N;  4LFC K;  3L2V A;  4RWT A;  2QXL A;  3WXJ A;  5C25 A;  1KAX A;  2NLX A;  3J80 O;  1WOQ A;  3A5N C;  1CLQ A;  2WUS A;  4KKO A;  3ZX0 A;  3T1H K;  2G8I A;  5J2M A;  4M3Y A;  4NYF A;  4FJK A;  4CF9 A;  3O1B A;  2VG6 A;  4KTW A;  4CBW A;  4EHT A;  4LSN A;  4C8N A;  4MDA A;  5EU7 A;  4N47 A;  4OKE A;  5AQJ A;  3ZLJ A;  3AA2 A;  3ULD A;  4H0Y B;  1HPM A;  3R6M A;  3K9J A;  4BRC A;  1X9J A;  4A2B A;  4B1Y B;  3VQA A;  2UUC K;  5FPM A;  4F9O A;  1RBU A;  3AO5 A;  3NH1 A;  5AZJ A;  1LW2 A;  5FRN A;  4DR3 K;  1RTI A;  3ZCM A;  4LC9 B;  2HHS A;  3NCI A;  5DM6 L;  4BQZ A;  3OHR A;  3HK2 A;  3CQY A;  3S9H A;  4OPJ A;  1WLJ A;  3K5N A;  5J2P A;  1GOC A;  1HQE A;  1S1U A;  5BPN A;  3WNE A;  3HM9 A;  4NCB A;  1KXP A;  2Q2R A;  4PL7 A;  2XY8 A;  1I39 A;  1L3U A;  3O5B A;  5AQU A;  2RHK A;  2OAN A;  3H46 O;  2Z1J A;  3LDQ A;  2P9S B;  2XRI A;  3SV4 A;  4WFB L;  2Q1N A;  1ATN A;  1KAZ A;  1L3S A;  5JVH L;  3SI6 A;  4WFN L;  4K8Z A;  1LWF A;  2GUI A;  1RDU A;  4K25 A;  1OKJ A;  2GV9 A;  4YOT A;  1WAF A;  4CZE A;  3ENB A;  1RDC A;  4PUO A;  2F9T A;  2HHW A;  4LFA K;  3JAM O;  2PYL A;  4J8F A;  5B8H A;  2YNF A;  3AVM A;  4ILG B;  2G8W A;  3CMA N;  3V1R A;  2Q3S A;  4CK3 A;  4QAG A;  3IFR A;  4ZTJ A;  3L3U A;  1MDU B;  5TKY A;  1G15 A;  4CGH A;  1W97 L;  4M3T A;  4FW2 A;  1DEJ A;  3MDQ A;  1GLA G;  1IBK K;  4O4G A;  1VSK A;  1YT3 A;  3KVG A;  1CXU A;  2VWJ A;  1R0A A;  3SAG A;  2QWM A;  1K73 O;  3AVL A;  4Z94 A;  3FZL A;  3E9P A;  4N5S A;  5HBM A;  2VG5 A;  4N56 A;  1RIL A;  3V4I A;  2HVH A;  4MFB A;  4FW1 A;  4IO9 L;  1ASW A;  2YHY A;  4JK8 A;  4HCB A;  1OH6 A;  3CI5 A;  1YAG A;  3AA3 A;  1RFQ A;  3ASM A;  4O0J A;  4O5F A;  1NGC A;  1TAQ A;  4CF8 A;  3MEC A;  4BRQ A;  4H8K A;  3FZK A;  3O3H A;  3HM8 A;  5HLF A;  4CZG A;  3PV8 A;  4TSX A;  1S6P A;  5C2D A;  2G8H A;  3DLR A;  5A2Q O;  4FLV A;  3V1Q A;  4B9N A;  2KHO A;  4JKB A;  4DG1 A;  4FOE A;  4O0I A;  1KTQ A;  4IJA A;  5ADX H;  2QK9 A;  2VCP A;  3M8R A;  1JLE A;  1X9S A;  1IKY A;  1JLG A;  2NRX A;  4R79 A;  4BRO A;  4CJ7 A;  3RR8 A;  1GLF O;  1GLC G;  5CYQ A;  4GV3 A;  2HBL A;  4FJN A;  1I3A A;  3H1Q A;  3J81 O;  4JI4 K;  4RW6 A;  1TK0 A;  3M1F A;  4WQ4 C;  3JSM A;  5FRO A;  2HF3 A;  1M1K O;  3V9S A;  2I7P A;  3ZSW A;  3TAM A;  1N33 K;  1SL2 A;  2HNZ A;  3BZK A;  4A57 A;  2ZQB A;  3WUH A;  4RCH A;  3O4Q A;  4DSK A;  2FLO A;  5F2R A;  4AHC A;  4EZ9 A;  2YNI A;  3QDK A;  3QNN A;  5E84 A;  3OY9 A;  3QIN A;  3OYA A;  4I9L A;  1WN7 A;  4B9T A;  1QVF M;  3DRP A;  4OLB A;  4CFB A;  4EAH D;  3EKU A;  2UUA K;  4Y1C A;  2VGN A;  2WC9 A;  4R5P A;  4PHT X;  3BUZ B;  2PY5 A;  1NKE A;  4F8R A;  4B1X B;  1S1T A;  2DY4 A;  5KPT A;  2UXC K;  3HYF A;  2F8T A;  4KB1 A;  1FXX A;  3C7N B;  3CHW A;  4LD0 A;  3KZB A;  4BR4 A;  4EIA A;  4B9V A;  3O9U A;  2FF3 B;  4J2D A;  4GNI A;  1BDG A;  3N4P A;  2BTF A;  4CGG A;  4JKG A;  1U2V A;  1CXQ A;  1QSS A;  3QEV A;  1XQS C;  3TPQ A;  3ZX3 A;  2OA8 A;  1HPZ A;  4DR5 K;  3N4Q A;  3TR8 A;  3VEO A;  4OPH A;  2KQ2 A;  1GLB G;  2FBT A;  2O4I A;  4EP4 A;  1RDW X;  3AY9 A;  5BN8 A;  3F9K A;  1SKW A;  4CZK A;  5AQH A;  4H0O A;  4FYD A;  4CED A;  2F96 A;  4BDP A;  3K59 A;  2DFE A;  3MN6 A;  4NYN A;  1O1W A;  3GDQ A;  4IJN A;  5M1O A;  4H5V A;  1NLV A;  4B9M A;  1S5J A;  3CCR N;  3A8Y A;  4KTQ A;  2OTL N;  3OYB A;  5EX5 A;  4JKH A;  3TTD A;  4IDH A;  3DOL A;  4RW7 A;  1DLO A;  3RSE B;  2EWS A;  3U8X A;  3CCQ N;  2F8S A;  1JCF A;  4BR5 A;  2W6L A;  2KTQ A;  2FBX A;  2P1J A;  1WB9 A;  2IS3 A;  1Y97 A;  4YOW A;  1Q9Y A;  1XMQ K;  2UXB K;  3AVN A;  4DSJ A;  3IUC A;  1BA0 A;  4BRN A;  4ELU A;  1JLQ A;  1B92 A;  2ZF5 O;  4JKF A;  3DLB A;  3DJC A;  4EFH A;  1QSL A;  4JI7 K;  4DR2 K;  1YTA A;  1WNS A;  1YUW A;  5EOY A;  2O8B B;  3M8Q A;  3SBG A;  1L3T A;  4FLX A;  4B3O A;  1IH7 A;  4K41 A;  3LM9 A;  4C8O A;  4DUZ K;  3FZH A;  4X65 K;  4QS8 A;  4B3R K;  2ZGZ A;  4E1J A;  1U4B A;  3I55 N;  4M3Z A;  3G10 A;  5KPZ A;  3CME N;  4CJV A;  3BY5 A;  2V52 B;  5E26 A;  3CCM N;  1YHQ N;  3PO5 A;  4BRI A;  5J2N A;  3HJF A;  3CET A;  3L2Q A;  2HHH K;  1VAZ A;  3H3O B;  3ZT4 A;  4DFM A;  4DLE A;  3FLC O;  2A1S A;  2V7Z A;  3VGK A;  1D9D A;  2HVI A;  3ZSR A;  2W40 A;  4CGI A;  4IG3 A;  3SAF A;  3EN9 A;  1HX1 A;  3C6U A;  4OLA A;  1RBV A;  1EX4 A;  1RT4 A;  3GBT A;  3WXM B;  4WF9 L;  4BDY A;  2E2P A;  2Y1J A;  1C1A A;  4G1Q A;  5AQS A;  4LF5 K;  3LAL A;  1M90 O;  2DFF A;  5AQP A;  1NU0 A;  3BP8 A;  1U49 A;  3FZF A;  1IKW A;  4HHT A;  4ISF A;  3T1A A;  3MWT A;  1NK8 A;  3OYF A;  1JL2 A;  3AVK A;  1IG9 A;  1KRP A;  2UUB K;  4A5B A;  3TTF A;  3NDK A;  3T69 A;  2UYT A;  4KRE A;  2Z1I A;  4KHQ A;  4H0X B;  1NK7 A;  4JI8 K;  4CIE A;  1C0U A;  5AQK A;  3S3O A;  4H0P A;  1J6Z A;  2JLE A;  3S3N A;  5GAG P;  1TK8 A;  3RMC A;  3DXK A;  2XY5 A;  5FLX O;  1QQM A;  3TI0 A;  4E3S A;  3LWM A;  1RTH A;  3ID8 A;  1N6Q A;  2OPQ A;  3C0B A;  2WBN A;  4Z4C A;  3DXM A;  3SQ0 A;  3SK3 A;  1EWQ A;  2I5J A;  1ILY A;  5BR8 K;  2NZT A;  3HBT A;  2VQF K;  5BPL A;  5DM7 L;  3U9Z A;  3A5L C;  3K9K A;  3ALY A;  5J1E A;  3MWP A;  4MQ3 A;  1HNZ K;  3P38 A;  5FPN A;  2PZS A;  2HHX A;  4DWI A;  3MCP A;  3C95 A;  3ULE B;  5AZI A;  4CF2 A;  5DMR A;  4ISG A;  3VF6 A;  3THV A;  2OZM A;  4CJ3 A;  1QTM A;  4BRE A;  4Z4E A;  4FWL A;  3THW A;  1T8E A;  3SNN A;  3CYM A;  4GKJ K;  3BEX A;  1V4S A;  4BG9 A;  3TTC A;  2NRZ A;  2D5R A;  2QW9 A;  4BAC A;  3UKU A;  4XH4 A;  2DPN A;  4OX9 K;  4B1V A;  3PX6 A;  1VK0 A;  1VSH A;  3AAR A;  3HOS A;  4DS4 A;  4B9Q A;  4X66 K;  3L4Q A;  3F2K A;  5GIP A;  2UXD K;  2CH6 A;  5FDL A;  1UWB A;  4JK7 A;  3VES A;  4Z4G A;  5FRM A;  1O13 A;  4E7K A;  1YJ9 N;  5CZ1 A;  3WEE B;  2X78 A;  5AQL A;  4NB4 A;  4KRF A;  4DQ8 A;  1NK0 A;  2P9P B;  4B1W B;  4O44 A;  4BR9 A;  4Q0B A;  3ZT0 A;  3K57 A;  5HL7 L;  2NRT A;  3VQ6 A;  4JKA A;  4OPK A;  2QWL A;  5AQQ A;  2O8B A;  3AVG A;  2RF2 A;  2HW3 A;  2A3Z A;  1XMO K;  3VQB A;  1KQS M;  3AO3 A;  3IAY A;  5H1S Q;  3PO4 A;  2NUB A;  2ASP A;  3LP1 A;  1P8Z A;  1MWM A;  4CIG A;  1VSM A;  2JWK A;  4DKW A;  3EYZ A;  1XHZ A;  1BG3 A;  3LDO A;  3OBW A;  1TKD A;  4QOZ B;  1BI4 B;  3VN5 A;  4M3R A;  1WSI A;  5CY4 A;  2B6A A;  4KPY A;  5KPR A;  2A41 A;  1RDB A;  3SBT A;  3VEX A;  3SUO A;  1TKZ A;  3BF1 A;  4Z4F A;  4FWN A;  4CJ5 A;  4YOU A;  4MO5 A;  3OYJ A;  4PY5 A;  1HQU A;  1UA0 A;  4DF4 A;  1IG8 A;  1YJN N;  2J4R A;  3AAP A;  3DLH A;  3U3G A;  4RW8 A;  2YNG A;  4OVL A;  3SPY A;  2P9N B;  4UY8 O;  4AF1 A;  2XY6 A;  3EKS A;  2P9U A;  1FJG K;  3UE5 A;  4C1N K;  3QO9 A;  1SKR A;  1YJW N;  4KH6 A;  1I94 K;  1U6Z A;  2E2Q A;  4JHD B;  1VQP N;  1XUP O;  2JWL A;  3TU5 A;  4FJI A;  4NXM K;  4JRP A;  2FBV A;  5HRS A;  5SWM A;  4OGC A;  2FF6 A;  4KTZ A;  1JLA A;  4DTS A;  3D2F A;  4N76 A;  3MAQ A;  3J8A A;  5KGX A;  2YJE A;  4KH5 A;  3M8S A;  3V9W A;  4JKG B;  3LZJ A;  4DS5 A;  4AHU A;  3MMV A;  4W5O A;  5AQZ A;  1K8K A;  2BE2 A;  3LDL A;  4B8A B;  4F2S A;  4AM7 A;  5I9E B;  1QSY A;  4PL8 A;  1NMN A;  4CD3 A;  4IG0 A;  3AGK A;  3O9Q A;  3NGI A;  4FK4 A;  2GX9 A;  1T6D A;  1Q7Y O;  3ENH A;  2HHT A;  3TWH A;  3CPE A;  3VQ7 A;  2FSJ A;  2PAV A;  4WQ5 C;  1HJO A;  1NM1 A;  2ZJR L;  4EZ6 A;  5JLH A;  5GIO A;  3IDH A;  3HI0 A;  1BI4 A;  1WUA A;  2P9K A;  4DR1 K;  3RTV A;  4BRP A;  4BRL A;  5T7B A;  4DV4 K;  3H3N O;  4DFK A;  3E9L A;  3WEE A;  1WSF A;  3MXM A;  4FWK A;  3KHY A;  2CGJ A;  3VQ9 A;  2OCE A;  1SS6 A;  1RTD A;  4DV3 K;  4E89 A;  1Q86 O;  3TSQ A;  2VYP A;  4RG8 A;  4FZY A;  3HL8 A;  1JJ2 M;  4PWD A;  5AQW A;  3NH0 A;  1T7P A;  4CHO A;  1D9F A;  4BGA A;  4A62 A;  3ZYY X;  5BRE A;  1NJX A;  3F73 A;  2HST A;  1NOZ A;  5C12 A;  3KK2 A;  4B9L A;  4CGJ A;  2D0A A;  4IZ9 A;  3QB0 A;  5AQI A;  4ICL A;  1F21 A;  3FGU A;  3CCJ N;  2NNW A;  3CER A;  2BGG A;  3MEG A;  4M3W A;  1VSJ A;  3NF7 A;  1IJJ A;  2V7Y A;  1HRH A;  4FM0 A;  2A42 A;  4JI6 K;  4BWM A;  1KSP A;  2I7N A;  2OZS A;  2P9I B;  5F0X A;  4FLY A;  5LMU K;  3H1V X;  4KB0 A;  2IVO A;  1VQ9 N;  1S3X A;  4B08 A;  3IMX A;  2Z1G A;  3R1X A;  2WTU A;  3OYC A;  1Q82 O;  3CFR A;  1HJR A;  3HPG A;  5DK5 A;  4E7I A;  4W5Q A;  2PBD A;  5JS2 A;  4W5R A;  4N41 A;  1EP4 A;  1JCG A;  3QBW A;  3LDN A;  3MED A;  4JI2 K;  4CJW A;  3SJJ A;  4IO8 A;  4FPB A;  4FZX C;  1VQ6 N;  4K42 A;  3PSI A;  2D0C A;  3ZX2 A;  1W9H A;  4WFA L;  1NKB A;  3VF4 A;  3V9Z A;  2QWR A;  1BQN A;  4OKJ A;  3EEQ A;  3KKR A;  3T1Y K;  4DTM A;  4NO7 A;  1LCU A;  4DTN A;  2NRW A;  1TL1 A;  3O9S A;  3ZT3 A;  4FSV A;  4H5R A;  5GAH P;  1TUY A;  1BA1 A;  3R8E A;  5LJV A;  4E7J A;  4GW6 A;  4CER A;  4DQP A;  3EO3 A;  3BF3 A;  1NK4 A;  3WXI A;  3SQ1 A;  4CFC A;  3LZI A;  4YFU A;  4DQQ A;  4FJG A;  1X9W A;  3QNO A;  3AAQ A;  4I6M A;  3U3Y A;  3P1G A;  4EP5 A;  4K43 A;  4OPA A;  3ZSV A;  3AO2 A;  1OH7 A;  2HOE A;  4H0T B;  1LW0 A;  3LP0 A;  3PUF A;  1UAX A;  1T05 A;  3C6A A;  4GKK K;  4KAZ A;  3TAG A;  3CIP A;  3D7E O;  3GOI A;  3SUQ A;  4M42 A;  1RCH A;  3EE8 A;  3P83 D;  3SCX A;  3R3L A;  4X64 K;  3DOK A;  3MXJ A;  4NLB A;  4KI4 A;  1NG9 A;  3W0L A;  2D0O A;  3LP3 A;  3L8B A;  1G99 A;  2YHX A;  5LL6 Z;  5MLC Q;  4JN4 A;  1JLB A;  4BRM A;  1OH5 A;  1RDA A;  4B9S A;  3OYK A;  5AQY A;  4DR6 K;  3DRR A;  4CEE A;  1U48 A;  4H5W A;  4Z4H A;  4DV5 K;  3A2F A;  3E9O A;  3TSP A;  3C94 A;  1VRU A;  4A61 A;  1NGG A;  4O8U A;  1LV5 A;  1A5V A;  1VSI A;  1S9E A;  3IRX A;  4LH5 A;  5AQT A;  4BE0 A;  4LH4 A;  3M3Z A;  5M1P A;  3CJA A;  4CEA A;  3SJH A;  3CCV N;  1EQY A;  3RRG A;  5EY4 A;  1KLM A;  4AM6 A;  3VF2 A;  3CCS N;  3CC4 N;  3C6T A;  3TAP A;  1HYV A;  2ZM6 K;  5GAD P;  4XH1 A;  1IKV A;  4ZHR A;  3CFP A;  2E2N A;  4CJS A;  4EHU A;  1JLF A;  4BRD A;  4CHQ A;  4FCY A;  4DSI A;  4WCE L;  3CCE N;  3O9T A;  4GV9 A;  1VQ4 N;  2O8E B;  1JKH A;  3VQQ A;  4A59 A;  1ZXO A;  4J2E A;  5AQR A;  1NJZ A;  3CD6 N;  5AQV A;  4AHV A;  2CGK A;  3QEI A;  1VSE A;  3CJ1 A;  4DV2 K;  4CE9 A;  4BR2 A;  1NGD A;  1Y64 A;  3CPW M;  4FK2 A;  4KHP K;  2FXU A;  1QHA A;  1ZBH A;  3CJC A;  3DLE A;  1Q81 O;  4DLG A;  4E19 A;  3TAF A;  3M8P A;  3CC7 N;  4HUF A;  2DTU A;  3KD5 E;  4CZJ A;  3D2E A;  4LF6 K;  1QS4 A;  1WSH A;  3D0P A;  3VEZ A;  1REV A;  1BCO A;  2EX3 A;  2QWP A;  4PKH A;  4CI6 A;  3DLG A;  1BL3 A;  4C8K A;  5KQ8 A;  2YKN A;  5JLF A;  3VEV A;  3KK1 A;  3V81 A;  1ZBL A;  2WON A;  2A1R A;  2WFB A;  4CZL A;  3AVF A;  1TK5 A;  4CVN E;  4DQI A;  3BDP A;  3SYZ A;  3NMU A;  1HKC A;  1NBW A;  1HNI A;  1ESV A;  3EL2 A;  4H5N A;  4CES A;  2ATQ A;  4JKE A;  1Q18 A;  4CEF A;  3C7N A;  5AQN A;  5AJ3 K;  3WT0 A;  4M3U A;  3VQC A;  3T3F A;  4BE1 A;  4KHU A;  3J7A P;  2OPR A;  3TAR A;  1VQK N;  1WSE A;  5AQG A;  2O8F A;  2Q97 A;  5EVZ A;  1BOT O;  2VQE K;  4O55 A;  3SPZ A;  4ID1 A;  2ZD1 A;  1RNH A;  5AFU H;  3HXM A;  1T3V A;  2HHQ A;  2F9W A;  3THY B;  3OYH A;  5D3G A;  1U45 A;  2YI1 A;  2G8V A;  1NGI A;  4CEB A;  4JI3 K;  1VQ5 N;  4WQ5 A;  2HB5 A;  2W41 A;  3V9U A;  1S6Q A;  1HYZ A;  3LAK A;  3H45 C;  3TSU A;  3LPT A;  2KZM A;  3AO4 A;  4DTX A;  5M1N A;  2W6K A;  1JL1 A;  3DRS A;  1ASU A;  4CJR A;  1DTT A;  2YX6 A;  4X62 K;  3UIQ A;  1YVN A;  1E4G T;  4KHS A;  1TUU A;  1ZYQ A;  4F3O A;  4JEP A;  1K8K B;  3MN7 A;  4JHD A;  2BAN A;  2NRR A;  5EXW A;  2QXF A;  4ISE A;  3T19 A;  1RGI A;  4O5B A;  3VQE A;  2YHW A;  3E66 A;  4BVO A;  4AHT A;  3D2E B;  3A5M C;  5LY3 A;  4BWJ A; 
#chains in the Genus database with same CATH homology
 2NUB A;  3LP1 A;  3HPH A;  2Z1J A;  4CGD A;  3P5J A;  3VQ8 A;  4CIG A;  1VSM A;  5JS1 A;  3OYI A;  2X6N A;  3MEE A;  2XRI A;  3EYZ A;  1XHZ A;  3SV4 A;  4QOZ B;  1TKD A;  5CYM A;  3K5L A;  1BI4 B;  3AVH A;  3VN5 A;  2R7Y A;  3O4N A;  4KI6 A;  4M3R A;  4DFJ A;  1WSI A;  3SI6 A;  5CY4 A;  1L3S A;  4K8Z A;  4PQU A;  3QET A;  1LWF A;  2B6A A;  4JRQ A;  3E01 A;  2GUI A;  4CJU A;  4KPY A;  2Z1H A;  4E7L A;  4RW4 A;  3SQ4 A;  1RDB A;  3HP9 A;  4OKK A;  4DTR A;  3SUO A;  2GV9 A;  3QIP A;  1TKZ A;  1U04 A;  3ZSO A;  1WAF A;  1RDC A;  3B6O A;  4PUO A;  4Z4F A;  1ZBF A;  2HHW A;  5C42 A;  2PYL A;  4H4M A;  4CJ5 A;  3VQ5 A;  3D45 A;  3OYJ A;  4PY5 A;  1HQU A;  1BGX T;  2YNF A;  4DF4 A;  1UA0 A;  4JS5 A;  3PX4 A;  3OYL A;  3AVM A;  4IFV A;  2G8W A;  3V1R A;  2Q3S A;  4CK3 A;  2LSN A;  4QAG A;  4CEC A;  2E6M A;  4ZTJ A;  3NH2 A;  3L3U A;  4W5N A;  4CGH A;  1G15 A;  3DLH A;  4M3T A;  1RT3 A;  3KIO A;  3RMA A;  2IOC A;  2RN2 A;  3DI6 A;  2YNG A;  4FW2 A;  4RW8 A;  3U3G A;  4BDZ A;  1BHL A;  5HRO A;  3QEP A;  4O4G A;  1VSK A;  3L2U A;  4FJ7 A;  1YT3 A;  4OVL A;  3SPY A;  4OGE A;  1SUQ A;  4FLW A;  1CXU A;  2VWJ A;  1R0A A;  3AVA A;  3AVJ A;  2XY6 A;  4ELT A;  2BDP A;  2HND A;  4IBN A;  3AVL A;  3ZSX A;  3ZSZ A;  1LAV A;  3QO9 A;  1SKR A;  3RWU A;  4Q5V A;  4DMN A;  4N5S A;  5HBM A;  2VG5 A;  4N56 A;  1RIL A;  3V4I A;  2HVH A;  4MFB A;  4FW1 A;  1RT5 A;  3HP6 A;  1ASW A;  4FJI A;  2ETJ A;  3WNH A;  1TL3 A;  4JS4 A;  4CF1 A;  4HCB A;  1KVB A;  4ID5 A;  4KFB A;  4JRP A;  4J2A A;  2FBV A;  5HRS A;  5SWM A;  3AA3 A;  4OGC A;  4YNQ A;  1CZ9 A;  2B5J A;  4KTZ A;  4CIF A;  1JLA A;  1X9M A;  4JLH A;  1XHX A;  4IFY A;  4DTS A;  3SUN A;  3LAM A;  1MU2 A;  4L8R B;  3ASM A;  3MAQ A;  4N76 A;  3KD1 E;  1FKP A;  5KGX A;  4O0J A;  1TVR A;  1TAQ A;  4FVM A;  4CF8 A;  3M8S A;  3I8D A;  3V9W A;  3MXI A;  3MEC A;  3OS0 A;  1TGO A;  2OPP A;  4H8K A;  3LZJ A;  4DS5 A;  4AHU A;  3O3H A;  4W5O A;  1HMV A;  2HHU A;  4UQG A;  5HLF A;  2BE2 A;  2E4L A;  4B8A B;  4F2S A;  1NJY A;  1QSY A;  3ZT2 A;  3PV8 A;  3QLH A;  3DYA A;  4IG0 A;  4CHN A;  5HRR A;  3NGI A;  1SKS A;  3AVI A;  4FK4 A;  4TSX A;  1S6P A;  4CJP A;  2AJQ A;  2G8H A;  3DLR A;  2KFN A;  2HHT A;  4AIL C;  2YHA A;  4FLV A;  1S1W A;  3AA4 A;  3V1Q A;  3G0Z A;  3TWH A;  4B9N A;  1L3V A;  1S1X A;  3IAY A;  3OYD A;  3VQ7 A;  4DG1 A;  1W0H A;  1ZBI A;  2ITG A;  1KTQ A;  4CF0 A;  4O0I A;  4LY7 A;  4EZ6 A;  4HCC A;  2QK9 A;  3ITH A;  3NAE A;  3M8R A;  1BI4 A;  4CK1 A;  3IS9 A;  2JGU A;  4FJX A;  1KVC A;  1JLE A;  1X9S A;  1IKY A;  3RTV A;  3RMD A;  4CK2 A;  1JLG A;  3HST B;  5C24 A;  5T7B A;  1BIS A;  3NF9 A;  5SZT A;  3DLK A;  4DFK A;  3LDS A;  3RR8 A;  2RPI A;  1WSF A;  4B8C A;  3VA0 A;  4DF8 A;  3MXM A;  3LP2 A;  5CYQ A;  3VQ9 A;  3O3F A;  4FJN A;  1RTD A;  1I3A A;  4FJH A;  1WSJ A;  1FKO A;  4RW6 A;  5KI6 A;  4E89 A;  4XIU A;  1TK0 A;  4DSF A;  1KFS A;  1LWE A;  4RG8 A;  3JSM A;  1J5O A;  4FZY A;  4M3X A;  3HL8 A;  1J53 A;  2FBY A;  5FRO A;  1VSL A;  4PWD A;  3KTQ A;  3V9S A;  3ZSW A;  3NH0 A;  1T7P A;  4CHO A;  1D9F A;  3SV3 A;  3TAM A;  4CEO A;  3QIO A;  3AV9 A;  3TAE A;  1NJX A;  1SL2 A;  2HNZ A;  1RBS A;  3F73 A;  4IKF A;  1NOZ A;  3KK2 A;  3EY1 A;  4B9L A;  4CGJ A;  2ZQB A;  2D0A A;  3VQ4 A;  3I0S A;  1YTU A;  1EKE A;  4ICL A;  1F21 A;  4DU1 A;  3HPO A;  3O4Q A;  4DSK A;  1NK9 A;  2BGG A;  4FJG A;  3MEG A;  4M3W A;  2RKI A;  1VSJ A;  3NF7 A;  4AHC A;  3WNG A;  1HRH A;  4FM0 A;  4LSL A;  4BWM A;  1KSP A;  5I3U A;  2OZS A;  4EZ9 A;  2YNI A;  4E1N A;  4ZTF A;  4FLY A;  1SL1 A;  1KFD A;  3WNF A;  3QNN A;  2OYQ A;  1S1V A;  3OY9 A;  4C8L A;  3QIN A;  3OYA A;  4I9L A;  1L5U A;  1WN7 A;  4B9T A;  4KB0 A;  4B08 A;  5KRS A;  3DRP A;  4OLB A;  2Z1G A;  4CFB A;  3OYC A;  1C0T A;  1LAW A;  2P5G A;  3KK3 A;  4Y1C A;  5K14 A;  4I2P A;  4R5P A;  3CFR A;  2IGI A;  3NE6 A;  3ZSY A;  1HJR A;  2PY5 A;  3HPG A;  1NKE A;  4M45 A;  3IG1 A;  4FLZ A;  1HNV A;  5DK5 A;  1B9D A;  4E7I A;  1UA1 A;  2X6S A;  4W5Q A;  3DM2 A;  4F8R A;  5JS2 A;  4W5R A;  4N41 A;  4CEQ A;  4KHY A;  1EP4 A;  1S1T A;  1J54 A;  4W5T A;  2DY4 A;  1IKX A;  1VSF A;  3MED A;  4CJW A;  3SJJ A;  1ASV A;  1RT7 A;  3HYF A;  3VQP A;  2F8T A;  1QE1 A;  3FFI A;  4FZX C;  4KB1 A;  3I0R A;  4NCG A;  4WE1 A;  3SQ2 A;  1FXX A;  1XC9 A;  5HRN A;  4LD0 A;  2D0C A;  1KLN A;  1W9H A;  4CHP A;  1NKB A;  4B9V A;  4J2D A;  3V9Z A;  3K5M A;  1KCF A;  2KW4 A;  1RTJ A;  1RBT A;  1BQN A;  4OKJ A;  4DQR A;  3TAN A;  3AVC A;  3L3V A;  4CGG A;  3KKR A;  2DFH A;  3SUP A;  4FJL A;  2KZZ A;  1CXQ A;  3JYT A;  4DTM A;  1U47 A;  1QSS A;  4FK0 A;  1BIZ A;  3QEV A;  1CZB A;  2VWK A;  2XY7 A;  3V6D A;  2YKM A;  2OA8 A;  1HPZ A;  4DTN A;  1HYS A;  3QEW A;  3TR8 A;  4CJK A;  1WSG A;  1TL1 A;  3OYN A;  5CZ2 A;  3ZT3 A;  4DSE A;  3VQD A;  2KQ2 A;  3KKS A;  4HTU A;  2FBT A;  1NK5 A;  2O4I A;  4CCH A;  5J2Q A;  4EP4 A;  4E7J A;  4GW6 A;  3QEX A;  2W42 A;  4CER A;  3F9K A;  1SKW A;  3PX0 A;  4DQP A;  4E7H A;  4IDK A;  1D8Y A;  1ITG A;  1C0M A;  1NK4 A;  4FYD A;  4CED A;  2F96 A;  5E41 A;  3SQ1 A;  4CFC A;  3LZI A;  4YFU A;  2XHB A;  2DFE A;  3K59 A;  4DQQ A;  4BDP A;  4NYN A;  3HT3 A;  5HP1 A;  1X9W A;  3QNO A;  1Q9X A;  1O1W A;  4FJ9 A;  2IC3 A;  4B9M A;  3NF8 A;  3U3Y A;  1S5J A;  2IDO A;  3H08 A;  3P1G A;  4EP5 A;  1NJW A;  1QQC A;  4KTQ A;  4CFD A;  3ZSV A;  2YNH A;  3AO2 A;  3OYB A;  3KLF A;  1GOA A;  1RDD A;  2HNY A;  4I9Q A;  4FM2 A;  1LW0 A;  1SV5 A;  3DOL A;  3LP0 A;  3PUF A;  3OYG A;  1UAX A;  1DLO A;  2YHB A;  1KVA A;  4RW7 A;  1T05 A;  1JLC A;  2VG7 A;  2WOM A;  1TKX A;  2YV0 X;  4KAZ A;  3QER A;  2F8S A;  3TAG A;  1BIU A;  3OYM A;  4AH9 A;  3AA5 X;  4KHW A;  4OJR A;  1RT2 A;  4HUE A;  2KTQ A;  2FBX A;  2P1J A;  1RCH A;  3CQ8 A;  3P83 D;  3SUQ A;  3PY8 A;  3SCX A;  4M42 A;  2IS3 A;  2QKB A;  2P51 A;  3DOK A;  3KLH A;  3DMJ A;  3MXJ A;  1SL0 A;  4KI4 A;  4J2B A;  1Y97 A;  2KFZ A;  3L8B A;  1Q9Y A;  3LP3 A;  1EET A;  4DFP A;  3AVN A;  4DSJ A;  1VSD A;  1JLB A;  3V9X A;  3AVB A;  3LWL A;  2O4G A;  1RDA A;  4B9S A;  4CJF A;  4ELU A;  3OYK A;  1JLQ A;  2XO7 A;  5KRT A;  1B92 A;  4CHZ A;  4FLT A;  3DRR A;  4CEE A;  1NK6 A;  3RMB A;  3DLB A;  4FJJ A;  1U48 A;  1QHT A;  2EHG A;  2IAJ A;  1QSL A;  1RT6 A;  4Z4H A;  2E6L A;  3A2F A;  3K2P A;  4DU3 A;  4DQS A;  5KGW A;  3C94 A;  1VRU A;  1YTA A;  1EXQ A;  1WNS A;  3VA3 A;  1C1C A;  3BGR A;  1LV5 A;  1A5V A;  3M8Q A;  1J9A A;  1S9E A;  1VSI A;  3TAQ A;  3IRX A;  4LH5 A;  4HUG A;  1L3T A;  4F3T A;  4BE0 A;  4FLX A;  4LH4 A;  4B3O A;  3NHG A;  1IH7 A;  2G8F A;  4Z0U A;  4C8O A;  4B9U A;  4CEA A;  3OVN A;  4KO0 A;  4I7F A;  3CG7 A;  1RBR A;  3RRG A;  4RW9 A;  1BQM A;  1U4B A;  1KLM A;  4DU4 A;  4M3Z A;  3G10 A;  1XI1 A;  4CJV A;  3C6T A;  3TAP A;  3NFA A;  4I2Q A;  1HYV A;  1IKV A;  4ZHR A;  3CFP A;  1X1P A;  3K58 A;  4PA1 A;  4DTP A;  3PO5 A;  3NGZ A;  4FJM A;  4CJS A;  3ISN C;  5J2N A;  1JLF A;  3L2Q A;  3HJF A;  4E1M A;  3OS1 A;  4CJT A;  4CHQ A;  4FCY A;  4DSI A;  4CJE A;  1LWC A;  1TKT A;  3ZT4 A;  4CHY A;  4DFM A;  4DLE A;  1JKH A;  3VQQ A;  2A1S A;  4J2E A;  1NJZ A;  1D9D A;  4Z4I A;  3LAN A;  3L2W A;  2HVI A;  3ZSR A;  3NBP A;  4KV8 A;  2ZE2 A;  2OPS A;  4CGF A;  4CGI A;  4IG3 A;  4FLU A;  2P5O A;  4AHV A;  3C6U A;  3ZT1 A;  4OLA A;  1FK9 A;  3QEI A;  1RBV A;  1EX4 A;  4DTU A;  1RT4 A;  1VSE A;  4ELV A;  4CE9 A;  1D5A A;  1Q8I A;  4BDY A;  2Y1I A;  2QKK A;  3NF6 A;  4FJ8 A;  1VRT A;  2Y1J A;  3U6F A;  4FK2 A;  1NKC A;  1C1A A;  4FZZ A;  2FC0 A;  4G1Q A;  3OJU A;  4BE2 A;  3LAL A;  1N5Y A;  1DTQ A;  2B4J A;  4GVM A;  1ZBH A;  2DFF A;  3DLE A;  4DLG A;  4E19 A;  3TAF A;  1IO2 A;  1U49 A;  3M8P A;  2DTU A;  4HUF A;  3OJS A;  3KD5 E;  1JXB A;  1K6Y A;  4DSL A;  1IKW A;  4HHT A;  3HVT A;  1XWL A;  3T1A A;  1QS4 A;  3OYF A;  1NK8 A;  1WSH A;  1NOY A;  4FJ5 A;  3HO1 A;  1JL2 A;  3AVK A;  3KLI A;  3D0P A;  1IG9 A;  1KRP A;  4AHR A;  3NDK A;  1REV A;  1C6V A;  1BCO A;  2EX3 A;  3EZ5 A;  3DLG A;  4KRE A;  1BL3 A;  4CJL A;  4C8K A;  2YKN A;  2G8K A;  2Z1I A;  4KHQ A;  3KK1 A;  4QCL A;  3QES A;  5HRP A;  3V81 A;  4CEZ A;  5I42 A;  1ZBL A;  3KLG A;  1NK7 A;  2X74 A;  1TV6 A;  4CIE A;  1YVU A;  5KTQ A;  3OS2 A;  1RT1 A;  2WON A;  2PYJ A;  2HMI A;  1C0U A;  2A1R A;  3RRH A;  1A5W A;  3S3O A;  4AHS A;  2JLE A;  3S3N A;  1S9G A;  1TK8 A;  3RMC A;  4GMJ B;  2XY5 A;  1TAU A;  3AVF A;  1JXE A;  1TK5 A;  1B9F A;  3TI0 A;  4K8X A;  4E3S A;  4F2R A;  4DQI A;  2GBZ A;  1Z25 A;  3CFO A;  3LWM A;  1RTH A;  3SYZ A;  3BDP A;  1N6Q A;  1WAJ A;  2OPQ A;  4Z4C A;  3L2R A;  4H4O A;  2HHV A;  1C1B A;  2G8U A;  4F4K A;  1HNI A;  4C8M A;  2D0B A;  3NGY A;  3SQ0 A;  4CES A;  2ATQ A;  4CEF A;  4M3U A;  4M41 A;  2I5J A;  3VQC A;  3T3F A;  4BE1 A;  4KHU A;  4Y1D A;  4FXD A;  2OPR A;  3TAR A;  1WSE A;  3L2V A;  3ALY A;  5J1E A;  3K5O A;  4MQ3 A;  5C25 A;  1T03 A;  2PZS A;  2HHX A;  4O55 A;  3SPZ A;  4ID1 A;  3ZSQ A;  4DWI A;  2ZD1 A;  3C95 A;  1CLQ A;  1RNH A;  4KKO A;  4CF2 A;  5DMR A;  3HXM A;  3THV A;  2HHQ A;  4CJQ A;  2OZM A;  5J2M A;  3O3G A;  3OYH A;  2G8I A;  5D3G A;  1U45 A;  4M3Y A;  4CJ3 A;  4NYF A;  2G8V A;  3TAB A;  4FJK A;  4CF9 A;  1QTM A;  3RR7 A;  4KTW A;  2VG6 A;  4CEB A;  1Z26 A;  4LSN A;  4Z4E A;  1T8E A;  4KHN A;  3CM5 A;  3CYM A;  4C8N A;  5EU7 A;  3HVR A;  3SNN A;  2HB5 A;  4N47 A;  3S3M A;  4OKE A;  2D5R A;  4CFA A;  1S6Q A;  4BAC A;  3V9U A;  3AA2 A;  1HYZ A;  3ULD A;  3LAK A;  4DTJ A;  4CJ4 A;  3PX6 A;  3LPT A;  2KZM A;  1VK0 A;  1VSH A;  4DS4 A;  3KJV A;  1UOC A;  3AO4 A;  4DTX A;  5FDL A;  3SZ2 A;  1UWB A;  3VQA A;  1JL1 A;  4E0D A;  4Z4G A;  5FRM A;  4E7K A;  1ZBU A;  4DTO A;  3AO1 A;  3DRS A;  1RBU A;  3AO5 A;  4HVJ A;  3NH1 A;  4NCA A;  1ASU A;  1LW2 A;  1DTT A;  5CZ1 A;  3V1O A;  4CJR A;  1BCM A;  5FRN A;  2X78 A;  3CM6 A;  3UIQ A;  4KRF A;  4KHS A;  3LPU A;  4FM1 A;  1GOB A;  1RTI A;  3ZCM A;  1NK0 A;  1ZYQ A;  4F3O A;  2HHS A;  3NCI A;  3HK2 A;  1A5X A;  4O44 A;  4OPJ A;  3S9H A;  1WLJ A;  4Q0B A;  3B6P A;  3ZT0 A;  3K5N A;  3OYE A;  5J2P A;  1GOC A;  3K57 A;  2BAN A;  1HQE A;  1S1U A;  3WNE A;  3HM9 A;  4NCB A;  3VQ6 A;  2QXF A;  4OPK A;  3T19 A;  3VQE A;  4O5B A;  3AVG A;  2RF2 A;  4AHT A;  2HW3 A;  2XY8 A;  3KLE A;  1I39 A;  1L3U A;  3VQB A;  3AO3 A;  4BWJ A;  3PO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...