4O0JA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[4-(4-chlorophenyl)-6-(3,4-dimethylphenyl)-2,5-dimethylpyridin-3-yl]ethanoic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
140
Chain Sequence
b'CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 49
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0jA00
3AA4A 4CGGA 3O3GA 3NAEA 4B8CA 4CHPA 3WNGA 3NFAA 3DLKA 1BI4A 4CJPA 3CFOA 1VSJA 3CYMA 2XY6A 2OPPA 1MU2A 1ZBLA 4O0IA 4N5SA 3SQ2A 1KTQA 3M8PA 4KFBA 2VWJA 1LWCA 1A5XA 1RBVA 3P5JA 5CZ1A 3NH1A 2YV0X 4M45A 4FM2A 4DSKA 4HUGA 3OYBA 3ZCMA 3OYJA 2RPIA 3TAMA 1Z25A 2P1JA 2PYLA 3RRGA 3ZSWA 3P83D 4OLBA 4CIFA 5J2PA 3QIPA 5SWMA 3T3FA 3ASMA 3O4QA 4IG0A 4WE1A 4FM0A 2KFNA 3KTQA 1VSHA 2RF2A 3AA5X 5KTQA 1KFSA 1RDBA 3AVHA 4R5PA 2G8VA 2PYJA 1SUQA 2YNGA 3DLRA 1RTJA 4AILC 2GUIA 4DSLA 4DQRA 3AO5A 2O4IA 1TKDA 1ZYQA 3PO5A 2BGGA 4OLAA 4E0DA 1KVAA 3TARA 3PV8A 1VSMA 4KKOA 2YNHA 1TK0A 4FZYA 3TANA 2KTQA 3LPTA 5K14A 2Z1IA 4Q5VA 5CZ2A 1JLGA 1Z26A 3U3GA 4BE2A 4KHNA 4I9LA 4CESA 3ZSZA 1TL3A 4Q0BA 2HB5A 4F3OA 2HHQA 1DLOA 1JL1A 3NF6A 3OS0A 1L3SA 4AH9A 3RWUA 1SKRA 5J2NA 4QOZB 2KW4A 3B6OA 1RT4A 2ZQBA 1QSYA 3DYAA 3QNOA 4J2AA 4KHQA 4DQSA 4FLZA 4FJXA 4DTNA 1J54A 4H4MA 1HNIA 4AHRA 3SCXA 1L3TA 4LD0A 3QO9A 1SKSA 1ZBFA 1B92A 3LP3A 4CIGA 4KHSA 3AVCA 2D0BA 1TV6A 3I0RA 3CFPA 3SQ4A 3P1GA 4OVLA 3I8DA 4FYDA 3AVJA 3AVNA 4JRQA 5T7BA 3K59A 2IC3A 4NCGA 3IRXA 4N56A 4E1NA 2BANA 4RW7A 4EP4A 2OYQA 4FJJA 1W0HA 2D0CA 4CHQA 3LP1A 5HROA 4RW9A 4I2PA 3SJJA 3TABA 5DMRA 4B9MA 3SPZA 4CF1A 1S6QA 2KZMA 3O4NA 3JYTA 1LAWA 1NJWA 4F3TA 3OJUA 3K5MA 1TVRA 3NF8A 4CEBA 4DSEA 1ASWA 3RRHA 4RW6A 3RR7A 4H8KA 4CE9A 4M42A 3QLHA 2A1SA 1U47A 1N5YA 1KLNA 1S1XA 1RDCA 4CHNA 4DTPA 2HW3A 4IKFA 4B9SA 2Y1JA 2G8WA 1CLQA 2BDPA 2HHVA 4M41A 4CHYA 3QIOA 4FK2A 1UAXA 4E89A 5KI6A 1CXUA 1C0MA 2D0AA 1B9DA 2E4LA 2IS3A 4JLHA 1U45A 3KJVA 2QK9A 1UOCA 5HRNA 1YT3A 1LW0A 4FCYA 4PUOA 2HNDA 1JXEA 2NUBA 1NK7A 1U48A 2HMIA 3TAEA 4M3UA 1FXXA 3HPHA 3KD5E 1SL0A 4N47A 1X1PA 1L3VA 2ZD1A 3T1AA 4JRPA 1S9EA 1RBTA 2VG6A 2KZZA 3HYFA 2WONA 1JLBA 4CEFA 3OY9A 4GMJB 5J2MA 4LSNA 4E7IA 3JSMA 4N76A 4M3XA 5D3GA 3MEEA 2B5JA 4F2SA 2HVIA 2Z1GA 4FJKA 1JL2A 1S1TA 1LV5A 3T19A 3ZSQA 2E6LA 3V1OA 1C0UA 4ZTJA 1S1WA 3L2RA 3OYEA 4KO0A 1TKTA 3SYZA 1FKPA 3HSTB 4IFYA 4B8AB 5FDLA 5E41A 1XHXA 4FJGA 1TAUA 3C6UA 3LAKA 4FJNA 3BGRA 4ICLA 4O0JA 2PZSA 4CEEA 1BIUA 4FJ9A 3HO1A 1HQEA 3AO4A 4F4KA 3DOLA 2W42A 2KQ2A 4I7FA 3OYHA 2LSNA 3RMAA 3F9KA 5I42A 1VSKA 1C1CA 3A2FA 1NK4A 3AVKA 4DU4A 4I2QA 3AO1A 3PY8A 1WSJA 3G0ZA 4B08A 3ZT4A 3CFRA 1I39A 4Z4HA 4K8ZA 1QTMA 3QEWA 1UA0A 3NGYA 4CJ3A 4FW1A 4CGIA 1X9SA 1T03A 1D9FA 3HXMA 4BDPA 4ELTA 1WSGA 1NK5A 4M3TA 5JS1A 4FLUA 3ISNC 4CK2A 1VSIA 1RNHA 3K5OA 2G8FA 1D9DA 4BDYA 1Q8IA 2ITGA 1QS4A 1BCMA 3L2QA 1TK8A 1NK6A 1NOYA 2DTUA 1HJRA 2QKBA 1XWLA 2FBVA 4B9VA 1GOBA 3DM2A 3LP0A 3S9HA 3RR8A 2ETJA 3MEDA 3QNNA 1RT1A 2Y1IA 1LWFA 4ID1A 4FJHA 5FRMA 1BI4B 1K6YA 2EX3A 2QKKA 1A5VA 3G10A 2P5GA 4DTJA 2HHXA 4FLXA 1BCOA 3AA2A 4CEOA 3SI6A 1BHLA 3LALA 4IDKA 4PA1A 1GOCA 4FVMA 2A1RA 4NYNA 4FK4A 1KSPA 1W9HA 1Y97A 1SKWA 4RW4A 1F21A 3DLBA 1WAFA 1BGXT 4HCBA 2HNYA 4J2EA 2YHBA 3AV9A 3OYIA 4BE1A 4DLGA 3MAQA 2IGIA 3NE6A 1D8YA 3PX4A 1VRUA 4TSXA 4CGHA 1RT3A 3K2PA 3NGIA 1JLEA 4CJUA 1UA1A 4CJRA 4PQUA 3ZSOA 1T8EA 4CGFA 3NF9A 3AO3A 3AVAA 1IKXA 1HRHA 4FW2A 1U4BA 3QEPA 2XO7A 1YVUA 5J1EA 3WNHA 4JS4A 4KV8A 4HTUA 3SNNA 2OZSA 4RG8A 3VQAA 1SL2A 3V9XA 3VA3A 3LAMA 1RT2A 4Y1CA 4FLTA 2B4JA 3LPUA 3OYAA 1RBUA 1S6PA 1RBSA 4HUEA 3U3YA 2O4GA 1CZ9A 4DU1A 3OYKA 3KK3A 5J2QA 1QSLA 3AVIA 3VQ7A 4CEQA 2I5JA 2OA8A 3RTVA 1N6QA 1RILA 3OYFA 4CEDA 2X74A 3IAYA 3OS1A 1VSDA 4CFDA 2XY8A 1LWEA 2X6NA 2HVHA 4CCHA 4IBNA 1QSSA 1BIZA 1RCHA 3B6PA 4CEZA 2ZE2A 2X6SA 4ELUA 3ITHA 4J2DA 2XRIA 4DF8A 4DTUA 3ZSYA 4KI6A 3V4IA 2F96A 1RTHA 5JS2A 4B9LA 4KB1A 4FJ7A 3WNFA 4KHUA 3ZSVA 4ZTFA 1T05A 2G8KA 4FJIA 2HHTA 4OGCA 4LH4A 4W5OA 2B6AA 4BDZA 4BE0A 3TAFA 4DSIA 3PUFA 2VG5A 1NK0A 1JLCA 3TAPA 3NHGA 4DTSA 2YNFA 3QEIA 3VQBA 3OYDA 1NOZA 1S9GA 3QEXA 2GV9A 1LW2A 3SQ0A 3VA0A 2YKNA 5CYMA 1J5OA 4LY7A 2ATQA 5KGWA 3L2UA 4H4OA 4W5RA 4KHWA 3K57A 1REVA 2G8IA 1JLFA 3VQ6A 4CF8A 3RMDA 3ZT2A 1Q9YA 3V1QA 3AVBA 1A5WA 3V1RA 5HP1A 4DWIA 3KLHA 4C8LA 2FBXA 1RBRA 1NJXA 3V9ZA 1EKEA 1SV5A 1NKBA 1RT6A 4CJLA 4DF4A 3AVFA 4HUFA 3DLGA 4DFKA 3M8QA 4OJRA 3HP6A 1L3UA 3V9WA 1TKXA 5HRRA 1HYZA 4JS5A 3EYZA 2G8HA 1TKZA 3UIQA 2YKMA 1Q9XA 4I9QA 4O5BA 3ULDA 4Z4FA 3PO4A 4O44A 2IDOA 3BDPA 4DSFA 2R7YA 2PY5A 4DQQA 2HHWA 1HPZA 4DTOA 4GW6A 3NGZA 4MFBA 4F8RA 3AVMA 2JGUA 4IG3A 1TGOA 1FKOA 2IAJA 2WOMA 1HYVA 3VQ5A 3VQ8A 4CJ5A 3DRPA 4ZHRA 3OS2A 3NDKA 3SV3A 1RTDA 3MXJA 4CJQA 3OYMA 3L2WA 3SPYA 4DFMA 4EZ6A 3OYNA 1X9WA 4PY5A 4IFVA 4OPKA 4CF0A 3LDSA 4FZZA 4B3OA 3KD1E 1LAVA 3V81A 3S3OA 2VG7A 4FLWA 1EP4A 3FFIA 4W5QA 1ZBHA 1KCFA 1DTQA 3CQ8A 4DS4A 4AHSA 2P5OA 3M8SA 3IG1A 4BACA 1XI1A 1WLJA 2FBYA 4CHOA 4DTXA 5EU7A 2IOCA 1RT7A 3ZSXA 3VQ4A 4HCCA 3CM6A 4YNQA 1S1VA 1ITGA 5HBMA 1B9FA 1EXQA 1U49A 1QHTA 5C42A 2G8UA 4KAZA 2D5RA 4DFJA 3MEGA 1R0AA 1IH7A 3OYLA 4FJ5A 1X9MA 3KLFA 4F2RA 4HVJA 4CJTA 1O1WA 4CFAA 3TI0A 4Z4GA 3QESA 3K5NA 1JXBA 2E6MA 3KKSA 3SUPA 2OPQA 3LZIA 2EHGA 4DLEA 3DI6A 4CEAA 4CF9A 4DFPA 4DSJA 2DFHA 5CY4A 3IS9A 1RDAA 1TAQA 1FK9A 3LWLA 4M3YA 3THVA 3CG7A 2X78A 5KGXA 3PX0A 4LH5A 3SUNA 4CIEA 1XC9A 4M3WA 3EY1A 3PX6A 4E1MA 3SZ2A 4KTZA 5FRNA 1HYSA 2F8SA 1HMVA 3KK2A 3TAQA 4K8XA 3HVRA 1NK9A 1NKEA 4OKKA 2Z1JA 3VQ9A 4KTQA 1WSIA 3L8BA 3HL8A 4C8KA 4FZXC 1KFDA 3NF7A 4E19A 4EZ9A 1IKVA 1J53A 1C1BA 5C24A 4CF2A 4J2BA 4E7KA 3VN5A 2XY7A 4ELVA 4DTRA 5CYQA 1RDDA 4DTMA 1C0TA 2Q3SA 3KLIA 3CM5A 4W5TA 1JKHA 4OKEA 3O3FA 3M8RA 3OYCA 1YTAA 3TWHA 3VQPA 1VSEA 3DOKA 1ASUA 2BE2A 3L3UA 3MXIA 3VQQA 5C25A 4Z0UA 3ALYA 1ASVA 1IKWA 4KTWA 4NYFA 4LSLA 4O4GA 1CXQA 3SV4A 4QCLA 3AVLA 4AHUA 3QERA 4Z4IA 4FK0A 2YNIA 4CFCA 4DG1A 4CHZA 4CECA 3MXMA 2HHUA 4UQGA 4CK3A 4CJWA 4XIUA 1C6VA 4Z4CA 1CZBA 3DMJA 2XY5A 3AO2A 3NCIA 4BWJA 1KVBA 1KVCA 4KREA 1J9AA 4OKJA 4OGEA 3C6TA 2HNZA 2P51A 4FJLA 1DTTA 5KRTA 3S3MA 3C94A 3F73A 3MECA 4FLVA 1VK0A 3HT3A 4E7LA 3C95A 4E3SA 3U6FA 1TK5A 4NCAA 3VQCA 4C8MA 4Z4EA 3DRSA 3OYGA 2FC0A 3K5LA 3QETA 3RMCA 2DY4A 4KPYA 2F8TA 3HJFA 3DLEA 3AA3A 2HHSA 3I0SA 3K58A 4B9NA 1NJZA 4CK1A 2OPRA 1JLQA 4EP5A 1WSHA 1HNVA 3DLHA 3SUOA 4KB0A 1D5AA 2DFFA 1TL1A 1WN7A 1BQMA 1WAJA 3EZ5A 1IKYA 4MQ3A 3HM9A 1HQUA 3RMBA 3SQ1A 1WNSA 1BISA 4E7HA 2OZMA 4Y1DA 3LWMA 3KLGA 4FJMA 4E7JA 4W5NA 4M3RA 3L2VA 4CJSA 4DMNA 4B9UA 1RT5A 3V9SA 4G1QA 4FXDA 4N41A 2KFZA 5SZTA 4B9TA 4CJFA 4M3ZA 4KHYA 4PWDA 3KKRA 1KLMA 2VWKA 2QXFA 1NK8A 3QEVA 5I3UA 4DS5A 5HRSA 5KRSA 1BQNA 4CJVA 3TR8A 4CFBA 1VSLA 3H08A 1L5UA 4DQIA 3D0PA 1UWBA 4KRFA 1C1AA 3V6DA 3VQEA 2JLEA 1IO2A 1I3AA 3ZSRA 3OJSA 4CGDA 1EX4A 1KRPA 3E01A 1VRTA 1U04A 1JLAA 3D45A 5HLFA 4FLYA 2XHBA 1ZBIA 2GBZA 4OPJA 3OVNA 3TAGA 2YHAA 2RKIA 1EETA 1S5JA 3KIOA 3LANA 4YFUA 4DU3A 1SL1A 4CERA 3QINA 3KK1A 4ID5A 3S3NA 4CJEA 1RTIA 1G15A 5FROA 3KLEA 3HPGA 2Z1HA 3ZT0A 1ZBUA 2FBTA 2OPSA 3LP2A 4QAGA 3ZT3A 1GOAA 3DRRA 3NH2A 3LZJA 1XHZA 1QQCA 4FM1A 1NKCA 1IG9A 4C8OA 4FJ8A 3HK2A 4CJKA 4HHTA 1WSEA 4CGJA 4DQPA 4NCBA 4KI4A 3NH0A 3V9UA 3L3VA 4AHCA 3SUQA 4GVMA 4L8RB 4BWMA 3AVGA 4RW8A 1BL3A 3HVTA 5HRPA 4C8NA 3NBPA 1QE1A 4AHVA 1NJYA 3ZT1A 5DK5A 4CJ4A 1VSFA 2RN2A 3VQDA 3O3HA 2DFEA 1YTUA 3HP9A 3HPOA 4O55A 3WNEA 1T7PA 2AJQA 1S1UA 4AHTA 1WSFA
chains in the Genus database with same CATH superfamily
2HSTA 4CGGA 1XNQK 3H1QA 4CJPA 3J7AP 1VSJA 4FWOA 4N5SA 3QFPA 1LWCA 1KAYA 3D2FB 4FM2A 3OYBA 3OYJA 3TAMA 1TUUA 3RRGA 3ZSWA 2AP1A 3ASMA 4FM0A 2KFNA 2O8CA 3E9OA 2RF2A 3A5MC 3ENHA 4BC5A 5E84A 2PYJA 2UUCK 5AQGA 2YNGA 1XC3A 1RTJA 4A57A 2GUIA 4CBUA 4DSLA 3WQTA 2QWPA 4WYBA 1ZYQA 3PO5A 4CZMA 1S72N 4OPHA 4BRPA 1VSMA 2E8AA 1TK0A 4FZYA 4Q5VA 3ZEUB 2VGNA 4Q0BA 2HB5A 1Q7YO 3RWUA 3NF6A 2IVNA 1YXQA 2O8EB 1GLFO 2PAVA 3B6OA 1QSYA 2A5XA 4J2AA 3A0IX 2PBDA 4DKWA 5AQTA 1E3MA 2ZGZA 2DPNA 1NU0A 4RTFD 2F9TA 3LP3A 4KHSA 3AVCA 3M6GA 3SQ4A 4OVLA 5BRDA 3K59A 4N56A 2BANA 4IXCA 2D0CA 3E9PA 1ILYA 3WEEB 2NLXA 4BRMA 4DV7K 4IWVA 4CF1A 1KAZA 2KZMA 4LF4K 1HUXA 4BRCA 3OJUA 3K5MA 3RR7A 5AQKA 4M42A 3QLHA 5JICA 1N5YA 2P9KA 3CC7N 4WFBL 4BC3A 2HHVA 4M41A 4C23A 4WQ5C 1YJNN 1UAXA 3A5NC 1U45A 3ZETB 1UOCA 5HRNA 4FCYA 3FFKB 3ZYYX 4PUOA 4AQYK 5JVGL 4BRHA 2I7NA 2VG6A 3HYFA 4GMJB 4LSNA 5D3GA 2B5JA 2YCHA 3BY5A 3ZSQA 2P9UB 3V1OA 1S1WA 3SYZA 4BQZA 5FDLA 3LAKA 4K25A 3THXB 4O0JA 1GLEG 4FJ9A 3HO1A 3KK7A 4A61A 2BTFA 3DOLA 4B1XB 5AQRA 3A2FA 3FZLA 4IEIA 4BQLA 3AO1A 1WSJA 3G0ZA 5BPNA 3CFRA 2W6KA 3CETA 4CJ3A 4FW1A 3TSUA 4BDPA 1NK5A 4M3TA 1N8RO 4BGBA 1W7AA 4H0TB 4DQ8A 1D9DA 3KZBA 4G9ZA 2VWBA 1QS4A 2KLAA 1XWLA 1ZC6A 3MEDA 3QNNA 1RT1A 2Y1IA 1BI4B 1A5VA 4IFEA 1BCOA 4IDKA 4I6MA 2Q1NA 3O80A 1Y97A 4HCBA 1BGXT 1MA9B 2YHBA 3AV9A 3QICA 4BE1A 4DLGA 3NE6A 3PX4A 4CGHA 3WXKA 1RT3A 1UA1A 1T8EA 4CGFA 5AQSA 1IKXA 4K41A 3UKRB 4YOVA 5CE3A 2XO7A 4LC9B 1JCFA 3IKMA 4BC4A 4X66K 5AZJB 4IEEA 3WNHA 2OZSA 2F7TA 3SNNA 4U7BA 1RT2A 4Y1CA 2VQFK 3D6RA 5AJ3K 3OYAA 3HSCA 2CGJA 5JMVA 1G99A 2WUSA 3VF4A 2O4GA 3U3YA 4DU1A 2E2PA 1N6QA 1TYQB 1RILA 3OYFA 1VSDA 4CFDA 2HVHA 1QSSA 3B6PA 4CEZA 3GG4A 2VQEK 4ELUA 4DR7K 5B8HA 1RTHA 4B9LA 3TSQA 3VETA 2QTDA 2P9IA 2ZJRL 3QEIA 3OYDA 2GEMA 4ISEA 4B1ZA 2UXBK 5CYMA 1J5OA 1IV0A 2RHKA 1M1KO 4DCHA 3CJ7A 1KQSM 3AGRA 4X65K 3K57A 1WOQA 3ZT2A 5AR0A 3MN6A 1A5WA 3VEWA 2QEXN 4B9QA 4FWSA 3JXUA 4C8LA 4M7XA 1NKBA 5JVHL 1RT6A 4XH1A 4CVNE 3HP6A 3HTVA 1VQ8N 5BPLA 2FSNA 3UIQA 4O5BA 3O6WA 2QWQA 3PO4A 4O44A 5C10A 2PY5A 2HHWA 3T69A 2WTUA 4GW6A 3VF2A 4J8FA 3GDQA 1S3XA 3CC4N 1TGOA 2IAJA 4CJ5A 3OS2A 2BDPA 4JI7K 4ZHRA 1VQPN 4F9OA 3MXJA 3Q7CA 4EZ6A 3OYNA 4PY5A 5KPRA 4CF0A 3LDSA 1HKBA 3KD1E 2CH6A 2VG7A 4YOTA 1DKGD 2GX9A 1DTQA 4LF8K 4BREA 2FSKA 4BACA 4CHOA 2FLOA 2IOCA 3VQ4A 2HBLA 1BWFO 3CC2N 1X3MA 3C6HA 3WT0A 2G8UA 4KAZA 2D5RA 1R0AA 1IH7A 3I8BA 3W0LA 3OYLA 4DUZK 3TI0A 4Z4GA 1QVFM 4JEPA 3QESA 4DV6K 3K5NA 2E6MA 3SK3A 3D2FA 4E1JA 1OVYA 4DFPA 1QHAA 2DFHA 5CY4A 4M3YA 3THVA 4BVOA 4M3WA 4FWQA 3EY1A 1HYSA 4KTZA 2F8SA 1HMVA 3HVRA 3TSPA 4JD2B 4OKKA 3SBGA 2FXUA 1WSIA 4FZXC 3NF7A 4CZEA 4C1NI 5C24A 3ZEUA 1C1BA 3KWGA 1YJ9N 5AQOA 1RDDA 2O8EA 3VOVA 3O3FA 1YTAA 1E4FT 3BF1A 2KHOA 3MXIA 3CCLN 4BRIA 5C25A 2E2QA 3ALYA 4NYFA 4PL7A 3QERA 4WQ4C 3WUHA 2YNIA 3CPWM 4CECA 3MXMA 4A59A 1NGAA 4IDHA 4CK3A 1C6VA 2E2NA 1D4XA 2D0OA 3WEEA 1P8ZA 3MN9A 1VHXA 1ESVA 1EQYA 5M1OA 3MECA 3O9TA 2A6AA 3VQCA 3BUZB 4BRDA 3DRSA 2F8TA 3MDQA 3J81O 3SBTA 2NRRA 3DLEA 3CCRN 4FWPA 4CK1A 1V4SA 2BUPA 3HM8A 4FPBA 4BY9C 3ZETA 1XUPO 4MQ3A 1WNSA 4E7JA 2QWNA 4M3RA 1YITN 3JS6A 3V9SA 1N36K 4UY8O 4FXDA 3TTFA 3C0BA 2KFZA 4B9TA 4CJFA 4KHYA 4PWDA 2VWKA 3E9LA 3QEVA 1FW6A 5GINA 5KRSA 3ID6A 3HRGA 2P9UA 3TR8A 1UWBA 4KRFA 5I9EB 5FPNA 2JLEA 3I55N 3ZSRA 3ZLJA 3U9DA 3PIPL 2GBZA 3OVNA 2NRXA 3TAGA 5EVZA 2RKIA 2W41A 3KIOA 4YFUA 3QINA 5HL7L 4ID5A 1RTIA 2Z1HA 1XHZA 3Q7BA 5EX5A 2D4WA 3HI0A 2J4RA 3L3VA 4AHCA 2OCEA 3SLCA 1NJYA 2PZSA 4AHVA 3VENA 4MLEA 4CJ4A 4GV3A 1YTUA 3FLCO 1T6DA 3FZMA 4AHTA 3P39A 3AA4A 5M1FA 1WUAA 3NAEA 3VESA 4CHPA 3WNGA 3NFAA 3DLKA 2FF3B 1BI4A 2P9PB 5AQVA 3CYMA 3SMPA 2XY6A 4O0IA 3QFUA 4KFBA 5BR9A 5IWAK 2VWJA 5CZ1A 5ADXH 4M45A 5F0XA 1JCEA 1Z6RA 4CIFA 3GOIA 3QIPA 5SWMA 3O4QA 4WE1A 5KTQA 1RDBA 4HTLA 3UKRA 1T6CA 2O4IA 1TKDA 5AZJA 1KVAA 1QQNA 4KKOA 3THYB 2Z1IA 5CZ2A 3KHYA 3U3GA 5AZIB 4CESA 2CGLA 4WCEL 1DLOA 3T1YK 3EZWA 1TYQA 3DYAA 4JK9A 3QMLA 4JKAA 3VF6A 4DQSA 3PSFA 4FLZA 2HF3A 4FJXA 4DTNA 1J54A 1HNIA 3SCXA 5AFUH 1L3TA 5BREA 4NO7A 3WQUA 1QZ6A 4CIGA 1TV6A 3I0RA 3I8DA 4B3OA 3VEXA 1KSPA 2OANA 4H5VA 4RW7A 4EP4A 1W0HA 1VQ9N 3LP1A 2GTDA 3CQYA 4I2PA 4B9MA 1S6QA 2NNWA 3O4NA 1VQ7N 1LAWA 1U6ZA 4JYAK 4F3TA 3EE9A 2F9WA 4LFAK 4H8KA 1T44A 2A1SA 1S1XA 4IKFA 4B9SA 3RSEB 1CLQA 2WFBA 3QIOA 4H5WA 4U67L 4KHPK 4E89A 3M5RA 2UXDK 1B9DA 1NGBA 2HNDA 3CF5L 2HMIA 4BR7A 4K43A 1VQ6N 4M3UA 4BR9A 1OH8A 1L3VA 3T1AA 2KZZA 5J2MA 4E7IA 3MEEA 4FJKA 1S1TA 1LV5A 3H1VX 4JV5K 4KH4A 3OYEA 2D1KA 5LJWA 5AQFA 4FJGA 3FZHA 4MDAA 4Z94A 4OPAA 4FJNA 4B1YB 1QVGM 4ICLA 1BIUA 4F4KA 4JN4A 2KQ2A 2CGKA 4I7FA 3RMAA 3F9KA 5I42A 1HJOA 4DV4K 4H0VB 1NK4A 4B08A 3ZT4A 1I39A 3ENBA 1WB9A 3QEWA 4BG8A 4CGIA 1T03A 5JS1A 4FLUA 3ISNC 2ZWHA 4CK2A 1VSIA 4A5BA 1RNHA 3K5OA 3MCAB 1Q8IA 2YJEA 1Q81O 4JAXA 1NK6A 1HJRA 2QKBA 2FBVA 4B9VA 1GOBA 3AAQA 3LP0A 1MWKA 1WBDA 1K6YA 4B3RK 3G10A 4WFNL 4DTJA 4JKGB 4JD2A 3CIPA 3GL1A 4PA1A 1GOCA 4RW4A 2HNYA 4BC2A 3TTDA 3NVMA 2Q0RA 5C2FA 5BN9A 3OYIA 4CZHA 2GWKA 1VRUA 3K2PA 3M3ZA 4ILGB 4CJUA 4CJRA 4PQUA 3CCEN 3AO3A 3J80O 4PKIA 4HTUA 4FO0A 4KV8A 4BRQA 4FOEA 3VGMA 4YDUC 1RBUA 4HUEA 1CZ9A 3OYKA 5J2QA 3FR0A 4JKHA 3VPZA 3UKUB 4JI0K 3IAYA 4CBXA 2XY8A 4IBNA 1BIZA 4WQ5A 1C0FA 1VQMN 5KPZA 2X6SA 1YF5L 4QS9A 3CD6N 3ZSYA 4FPAA 3ZSVA 4FJIA 4DSIA 2B6AA 1JLCA 1NBWA 4DV2K 4DTSA 2GV9A 3SQ0A 5GIPA 5GAEP 1BU6O 2WBNA 1GLAG 2ATQA 5KGWA 4X62K 3H45C 1Q82O 5KPTA 2G8IA 4CF8A 3U4LA 3V1QA 1RGIA 3AVBA 3V1RA 1WBBA 3KLHA 1NJXA 4DB3A 1NNEA 4NXMK 2G8HA 4DV3K 5CR4A 4YOXA 3S41A 1J6ZA 1ZBSA 3BDPA 4FWLA 1HR0K 1HPZA 3E1YA 4IG3A 4CZKA 2QWOA 1RTDA 4CJQA 3BZKA 3L2WA 3O9RA 1QZ5A 3OA9A 2Q0UA 1X9WA 3EKUA 4IFVA 4DR1K 3V81A 3FFIA 3G25A 3O8MA 1KCFA 5LJVA 4DS4A 3M8SA 1XI1A 2FBYA 2W6LA 4HCCA 5AQHA 1S1VA 4GV9A 2P9PA 1EXQA 3I56N 1QHTA 4JI3K 4DFJA 4FJ5A 3SAFA 4F2RA 2NRVA 5GAGP 1SZ2A 4CJTA 4DR5K 4OO1J 3WXMB 2OPQA 4DLEA 3KVGA 4CEAA 4XH5A 4CF9A 4DSJA 3R9PA 1LOTB 3IS9A 1TAQA 1JCGA 3LL3A 4LH5A 3PX6A 4B1VA 5AQLA 3J7YP 1NKEA 4H5RA 3UB5A 2YHWA 2Z1JA 4WFAL 4KTQA 3HL8A 1P90A 4C8KA 3THYA 3LM2A 1NGIA 5AZIA 4CF2A 3GE1A 2QXLA 4X64K 2XY7A 3IMXA 4HWIA 2D0PA 1NG9A 3KLIA 3O1WA 1XMQK 1Z05A 4KH6A 1VSEA 2BE2A 1ASVA 2Q97A 3SV4A 1CXQA 4H0YB 4CFCA 1HLUA 4CHZA 2Q2RA 3CI5A 1NGCA 3DMJA 3AO2A 3NCIA 1J9AA 4OKJA 5FPEA 4OGEA 4IO8A 3P4IA 3S3MA 5LMUK 1VQON 5AQMA 3K5LA 2DY4A 2FC0A 1YUWA 3R6MA 4FWKA 1GLJO 5FLXO 1K8AO 2HHSA 3RSEA 3CPEA 5ELZA 1OKJA 1BOTO 4EP5A 1HNVA 1VQNN 4KB0A 1WAJA 3MX2A 3EZ5A 3HM9A 2E88A 4H0OA 2ZJQL 4YOUA 1BISA 4E7HA 2NRZA 3CCVN 4QS7A 4W5NA 3L2VA 4DMNA 1RT5A 5DM6L 3BP8A 1GLCG 3H6EA 4M3ZA 1W2BM 1KLMA 1SAZA 1L5UA 1BA1A 3CMAN 1C1AA 3VTHA 3J7ZO 1ATRA 3V6DA 1XMOK 4CGDA 2O8FB 1W97L 3E01A 1VRTA 3CERA 4BRGA 1KXPA 3D45A 4YORA 3HZ6A 2YHAA 2IVPA 1SL1A 3W3DA 3LP2A 3NH2A 4FJ8A 1QQCA 1IG9A 4H03B 4CGJA 5GIOA 4KI4A 3NH0A 4BWMA 2FSJA 3AVGA 3HVTA 1QE1A 2A3ZA 3ID8A 3T1HK 1VSFA 4KBOA 3HP9A 1N33K 3HPOA 4O55A 5GAHP 1S1UA 4CFAA 4IJNA 1RFQA 4B8CA 3MN7A 4ILJA 3CFOA 4FWNA 2OPPA 4JKGA 3F5TA 3SAHA 3MWTA 3PLAA 5AQNA 5C0YA 3SQ2A 2VGMA 3M8PA 4FSVA 1A5XA 2YV0X 2A40A 3CQXA 4DSKA 2RPIA 2E5LK 2P1JA 5BRFA 2PYLA 4O5FA 5J2PA 3T3FA 4WQ4A 4IG0A 1VSHA 1YIJN 4BR2A 3AA5X 4BVPA 1KFSA 1YJWN 3DLRA 4LF5K 3AO5A 4OLAA 3WXJA 3AGKA 2KTQA 3LPTA 5K14A 4BE2A 4KHNA 1JLGA 4I9LA 3G71N 3FZFA 2HHHK 4F3OA 2YI1A 1JL1A 5CHIA 1L3SA 4AH9A 1SKRA 1NJIO 2KW4A 4AM7A 1IG8A 3UKUA 3UE5A 4B3SK 1IBLK 2E20A 3VEOA 4LD0A 1SKSA 4H5TA 3CFPA 4CI6A 4Y0WA 3P1GA 4YY3K 3AVJA 3AVNA 3O4WA 5T7BA 2OTLN 3LDQA 4NCGA 3IRXA 4FYDA 4E1NA 2UUAK 4CHQA 2HF4A 4RW9A 4FWRA 1J5EK 5DMRA 3SPZA 4MLHA 4AF1A 4BRKA 1TVRA 4CEBA 4GY2B 4DSEA 1ASWA 3RRHA 4CD3A 4CE9A 1U47A 4FOIA 1RDCA 2HBJA 4IOCL 2G8WA 4CHYA 4OX9K 4FK2A 4BROA 4MO4A 4FL9A 5KI6A 1C0MA 2D0AA 3VGKA 2QK9A 1YT3A 1JXEA 1U48A 2P9SA 4DV1K 1FXXA 3HPHA 1SL0A 4N47A 1VQ4N 1RBTA 3N4QA 1JLBA 1CZAN 4N76A 1ZXOA 3JSMA 1VQ5N 4M3XA 3IUCA 1JL2A 1QQOA 3LDLA 3T19A 3HOTA 3WXIA 3L2RA 4KO0A 1TKTA 1FKPA 2Q31A 3HSTB 1U2VB 4IFYA 4B8AB 1TAUA 1XHXA 3C6UA 5IT9O 3QBWA 4YOYA 2NRTA 4CEEA 1GLDG 2H3GX 2W42A 3OYHA 1VSKA 4GKJK 3AVKA 4DU4A 3GBTA 3MN5A 4AM6A 3L4IA 4Z4HA 4K8ZA 1I94K 4BRAA 3NGYA 1D9FA 1X9SA 4ELTA 3B8AX 4JI2K 2IVOA 3L6QA 2VYPA 4A2AA 1VQKN 2G8FA 2ITGA 3L2QA 1ATSA 1NOYA 2DTUA 3MK6A 5AQZA 3S9HA 3RR8A 2ETJA 1H1VA 5FRMA 2QKKA 4M63C 4JI1K 4FLXA 3VEZA 3AA2A 4JK8A 3RVCA 3SI6A 1NGJA 1BHLA 3LALA 4FK4A 1W9HA 1WAFA 1NMNA 1RDWX 3ATVA 4JKFA 3MAQA 1D8YA 4TSXA 3NGIA 1JLEA 3FE1A 4JKCA 4H0PA 3NF9A 1NGHA 3AVAA 4V19S 1U4BA 3QEPA 1YVUA 1VAZA 4JHDB 4RG8A 1SL2A 1BDGA 3LPUA 1S6PA 1RBSA 1XNRK 3R3LA 3KK3A 1OH6A 2FF6A 3AVIA 4CEQA 2I5JA 2OA8A 3OBWA 3OS1A 5FPMA 1LWEA 4CCHA 1HNXK 4J2DA 3U9ZA 2F96A 4KHUA 4KB1A 4FJ7A 4ZTFA 2G8KA 3CMEN 2HBMA 4JKDA 4BE0A 4W5OA 4BDZA 2HHTA 3MX5A 3TAPA 1X3NA 3O5BA 3VQBA 4BG9A 2E1ZA 1LW2A 3VA0A 2YKNA 3N4PA 1K8KB 5M1PA 1IBKK 4JI8K 4LY7A 4KHWA 1Q9YA 2A41A 1NLVA 2FBXA 3AY9A 1RBRA 1EKEA 1SV5A 3EEQA 4DF4A 4HUFA 2O8FA 4DFKA 4OJRA 1L3UA 3O9UA 5HRRA 1HYZA 3JAMO 5KQDA 1Q9XA 1RDUA 3CHWA 3ULDA 2ASMA 2IDOA 4R79A 2YHXA 1DT9A 1TUYA 4IOXA 4MFBA 4F8RA 2RE2A 1HYVA 3VQ5A 3DRPA 3IDHA 3OYMA 5GADP 3SPYA 4DFMA 1OH5A 1LAVA 3S3OA 1EP4A 4JI4K 4W5QA 2KKZA 4AHSA 3NMUA 1N32K 3IG1A 5AQXA 3OHRA 3ZSXA 5HBMA 2P9NB 1B9FA 2F4VK 5M1NA 3MEGA 1X9MA 4ISFA 1HNWK 1O1WA 4JI5K 4CD1A 2E2OA 1JXBA 4MO5A 3SUPA 2ASPA 3LZIA 5BN8A 4CZIA 3K9JA 3K9KA 2X78A 5KGXA 3PX0A 2QI2A 5AQQA 4E1MA 5FRNA 3KK2A 4K8XA 5A2QO 4YDUA 2Q36A 2I7PA 1QQMA 4DR3K 5MLCQ 3BF3A 3L8BA 2IIRA 3AARA 5LY3A 3H3NO 4EZ9A 5E26A 1KD1O 1JJ2M 1BO5O 4J2BA 4E7KA 3VN5A 5CYQA 4DTMA 4W5TA 3CM5A 4LFBK 1JKHA 3R8EA 1NM1A 3OYCA 3M8RA 3VQPA 4IJAA 1ASUA 3L3UA 4C1NK 4LF7K 4Z0UA 4O4GA 4JKBA 4KTWA 4LSLA 1O13A 4Z4IA 4AHUA 4UQGA 2YHYA 4XIUA 4IOAL 1CZBA 3C65A 1KVBA 4BRFA 3TPQA 1KVCA 4KREA 3C6TA 2ZM6K 1DTTA 3CCJN 3U6FA 1VK0A 3HT3A 4E3SA 3J8AA 4C8MA 3QETA 3OYGA 3OBYA 4KPYA 3CJAA 5M1QA 3EN9A 3HJFA 3WXLA 4ISGA 2YJFA 1HKGA 3I0SA 2ASOA 1S22A 3KWIA 3LDNA 1NJZA 3O1BA 2OPRA 3C7NB 1WSHA 3SUOA 1WN7A 1D5AA 2DFFA 1IKYA 1HQUA 3RMBA 3SQ1A 4Y1DA 3LWMA 3KLGA 1Y64A 2VCPA 4N41A 1YI2N 1R59O 2E1YA 2P9SB 1NK8A 3H46O 3DXKB 3EO3A 2V7ZA 1VSLA 3THWA 1Q18A 4BR4A 3D0PA 4DUYK 3VQEA 1IO2A 1I3AA 1U2VA 2ZGYA 1EX4A 1V4TA 1U04A 5HLFA 1BUPA 4FLYA 2XHBA 1ZBIA 4CW7B 1NMDA 4OPJA 3CCMN 4DU3A 4CERA 3S3NA 1G15A 5FROA 3HPGA 3ZT3A 2AA4A 1GLBG 1GOAA 3P31A 4C8OA 1NKCA 3F2KA 4DQPA 3V9UA 1DEJA 4L8RB 3HOSA 4RW8A 1BL3A 5HRPA 4C8NA 2NRHA 3OTOK 3O3HA 1T7PA 2AJQA 4WF9L 2O8BB 1WSFA 3D7EO 3DJCA 3O3GA 1MDUB 4IZ9A 4NLBA 3I33A 1MU2A 1ZBLA 1IBMK 1KTQA 3T7ZA 1RBVA 3P5JA 3NH1A 4HUGA 2P9LB 3ZCMA 1Z25A 3P83D 4OLBA 5H1SQ 3SJHA 4XEIA 3KTQA 2HMPA 3A8YA 3AVHA 4R5PA 1SUQA 4AILC 4DQRA 2QWMA 4K0KK 5BRHA 2BGGA 3D2EB 3L0QA 3DLLL 4E0DA 4JHDA 3PV8A 3TARA 3QDKA 2YNHA 3TANA 3CXCM 1Z26A 1YHQN 2W40A 3ZSZA 2QWRA 1TL3A 3O9QA 2HHQA 3OS0A 3LDPA 5J2NA 1RT4A 2ZQBA 1EWRA 4B1UB 3QNOA 4KHQA 3SMSA 5F1XA 4AHRA 4H4MA 4ILHA 1HNZK 4O8KA 1NWKA 3QO9A 1ZBFA 1B92A 2D0BA 4JRQA 2G8VA 4JK7A 2IC3A 2OYQA 4H5NA 4FJJA 1OVQA 3HBTA 5HROA 2WC9A 3SJJA 3TABA 3JYTA 3CCUN 1NJWA 5BPMA 3NF8A 1K8KA 4RW6A 3F9MA 1KLNA 4LFCK 4FVUA 4CHNA 4DTPA 4IO9L 2HW3A 3O9SA 2Y1JA 1CXUA 2V52B 2E4LA 2IS3A 4JLHA 1SQKA 2O8DB 3VERA 3KJVA 3DXMB 3A5OC 5AQUA 1LW0A 2NUBA 1NK7A 3TAEA 3KD5E 1X1PA 2ZD1A 4JRPA 1S9EA 2WONA 3OY9A 4CEFA 3ULEB 4F2SA 2HVIA 2Z1GA 2E6LA 5ADXA 1C0UA 4ZTJA 5AQPA 5E41A 1NGFA 3VGLA 3BGRA 2GELA 4JI6K 3G4SN 1HQEA 3AO4A 2HOEA 1BG3A 2LSNA 4B1WB 1C1CA 1HKCA 4A2BA 4I2QA 3PY8A 3A5LC 2P9NA 1QTMA 4CZJA 1UA0A 3QB0A 3HXMA 1WSGA 4EFHA 4BDYA 2GWJA 5AQWA 1BCMA 2OTJN 1TK8A 4PL8A 5AFUA 1C0GA 3SAGA 3DM2A 4BRNA 1LWFA 4ID1A 5KQ8A 4FJHA 2EX3A 3FGUA 3TU5A 2P5GA 2HHXA 3MCPA 4CEOA 3H3OB 5LMNK 3ZX0A 3P38A 4FVMA 2A1RA 4NYNA 1SKWA 3DLBA 1F21A 4A5AA 4J2EA 3K0SA 2NZTA 2IGIA 4YOWA 5LL6Z 3VMFB 2O8CB 3OW2M 3ZX3A 1IJJA 3ZSOA 1HRHA 4FW2A 5J1EA 2ZJPL 2A42A 4JS4A 1NGGA 3VQAA 1YVNA 3V9XA 3VA3A 2UU9K 3LAMA 4FLTA 4KH5A 2B4JA 5HOOA 4QOZB 4FWMA 5M1KA 1QSLA 3VQ7A 3RTVA 3NVKA 4JKEA 1K9MO 3O08A 2X74A 4CEDA 2QM1A 2X6NA 3ATUA 1N34K 1RCHA 2ZE2A 3ITHA 2XRIA 1M90O 3AAPA 4DF8A 4DTUA 4KI6A 3V4IA 5JS2A 5AQYA 3WNFA 3G6EN 1T05A 3QBXA 4OGCA 4LH4A 4EHUA 2PFUA 3TAFA 3PUFA 3C7NA 3LDOA 2VG5A 1NK0A 2BH1A 1NGEA 1HX1A 3NHGA 3U8XA 2YNFA 1NOZA 1S9GA 3QEXA 3L2UA 4H4OA 5C15A 2JWLA 4W5RA 2P9KB 1REVA 4H0XB 1HPMA 1JLFA 3VQ6A 4DR2K 3RMDA 4NB4A 3PIOL 3DXKA 5HP1A 4CZLA 3MWPA 4K42A 4DWIA 3ENOA 3V9ZA 4CJLA 3AVFA 2QW9A 3DLGA 3M8QA 4DV0K 3V9WA 1TKXA 3PSIA 4QS8A 4JS5A 3EYZA 3THWB 1XQSC 1TKZA 2JWKA 2YKMA 4I9QA 4GV6A 4Z4FA 2CH5A 3DAWA 4MDBA 4DSFA 2R7YA 4YHHK 4DQQA 4DTOA 3NGZA 5EXWA 2NRWA 3AVMA 2JGUA 3DWLA 3THXA 1FKOA 2WOMA 3SV3A 3VQ8A 2UXCK 3NDKA 3VTIA 4OPKA 4FZZA 3CJ9A 4GKKK 4FLWA 1ZBHA 2EWSA 5AQJA 3CQ8A 1OH7A 2P5OA 2O8BA 3L4QA 1WLJA 1E4GT 1T3VA 4DTXA 5EU7A 1RT7A 3CM6A 4YNQA 1ITGA 1SS6A 3MMVA 2V7YA 1U49A 3LM9A 5C42A 3C6AA 3KLFA 5TKYA 4HVJA 4EHTA 3TTCA 3IFRA 3KKSA 4M7YA 5EOYA 3R1XA 2EHGA 3DI6A 2V51B 2ITMA 2P9LA 1RDAA 3LWLA 1FK9A 3CG7A 3SUNA 1XC9A 4CIEA 3SZ2A 3VEVA 4GNIA 4O8UA 3TAQA 5C12A 1NK9A 3BEXA 4BGAA 5C2DA 1GLLO 3EL2A 3D2EA 4I6MB 3VQ9A 4BR0A 1KFDA 4E19A 1KAXA 4GVEA 1IKVA 1J53A 2UYTA 4PHTX 2GUPA 4L3QA 4ELVA 4DTRA 4BRLA 1C0TA 2Q3SA 4EIAA 4OKEA 5FPDA 5EY4A 3TWHA 4RWTA 3DOKA 4DV5K 3VQQA 5TKWA 1IKWA 4RCHA 4QCLA 3AVLA 4FK0A 4DG1A 2HHUA 4CBWA 3ZX2A 4CJWA 4Z4CA 2XY5A 5JLHA 2QWLA 4BWJA 4FJLA 2HNZA 2P51A 1KC8O 1DGKN 5KRTA 3C94A 3F73A 3CCSN 4FLVA 4E7LA 1TK5A 3C95A 4PKGA 4XH4A 4NCAA 4Z4EA 4CZFA 1FJGK 3RMCA 4B3TK 4EAHD 4LF6K 3CJBA 5JLFA 3AA3A 4CZGA 3K58A 4B9NA 4LF9K 3M1FA 1ATNA 2HBKA 1JLQA 1BA0A 3DLHA 1TL1A 2O8DA 1BQMA 2ZF5O 1NGDA 1K73O 2P9IB 3DXMA 4B3MK 2OZMA 4FJMA 4CJ7A 4CJSA 1EO1A 4B9UA 5BR8K 4G1QA 4A62A 4JNEA 1YAGA 5SZTA 3BZCA 3ULEA 3KKRA 2QXFA 5I3UA 4DS5A 5HRSA 1BQNA 4CJVA 4CFBA 3CJCA 3H08A 4DQIA 1EWQA 3OJSA 1KRPA 4NLCA 5AQIA 1Q86O 3EE8A 1JLAA 3EKSA 1MWMA 4PKHA 1EETA 1S5JA 3LANA 3FZKA 3CJ1A 3KK1A 4CJEA 1VQLN 4DR4K 3KLEA 3ZT0A 1ZBUA 2FBTA 4QAGA 2OPSA 2YX6A 3DRRA 3HK2A 3LZJA 4FM1A 3CCQN 4CJKA 4HHTA 1LCUA 1WSEA 3VEYA 4NCBA 3E66A 3SUQA 4GVMA 4DR6K 3NBPA 3ZT1A 5DK5A 5DM7L 2RN2A 4BR5A 2QA4N 3VQDA 2DFEA 2UUBK 4NXNK 1X9JA 3WNEA 4DHYA 5F2RA
chains in the Genus database with same CATH topology
3AA4A 4CGGA 3O3GA 3NAEA 4B8CA 4CHPA 3WNGA 3NFAA 3DLKA 1BI4A 4CJPA 3CFOA 1VSJA 3CYMA 2XY6A 2OPPA 1MU2A 1ZBLA 4O0IA 4N5SA 3SQ2A 1KTQA 3M8PA 4KFBA 2VWJA 1LWCA 1A5XA 1RBVA 3P5JA 5CZ1A 3NH1A 2YV0X 4M45A 4FM2A 4DSKA 4HUGA 3OYBA 3ZCMA 3OYJA 2RPIA 3TAMA 1Z25A 2P1JA 2PYLA 3RRGA 3ZSWA 3P83D 4OLBA 4CIFA 5J2PA 3QIPA 5SWMA 3T3FA 3ASMA 3O4QA 4IG0A 4WE1A 4FM0A 2KFNA 3KTQA 1VSHA 2RF2A 3AA5X 5KTQA 1KFSA 1RDBA 3AVHA 4R5PA 2G8VA 2PYJA 1SUQA 2YNGA 3DLRA 1RTJA 4AILC 2GUIA 4DSLA 4DQRA 3AO5A 2O4IA 1TKDA 1ZYQA 3PO5A 2BGGA 4OLAA 4E0DA 1KVAA 3TARA 3PV8A 1VSMA 4KKOA 2YNHA 1TK0A 4FZYA 3TANA 2KTQA 3LPTA 5K14A 2Z1IA 4Q5VA 5CZ2A 1JLGA 1Z26A 3U3GA 4BE2A 4KHNA 4I9LA 4CESA 3ZSZA 1TL3A 4Q0BA 2HB5A 4F3OA 2HHQA 1DLOA 1JL1A 3NF6A 3OS0A 1L3SA 4AH9A 3RWUA 1SKRA 5J2NA 4QOZB 2KW4A 3B6OA 1RT4A 2ZQBA 1QSYA 3DYAA 3QNOA 4J2AA 4KHQA 4DQSA 4FLZA 4FJXA 4DTNA 1J54A 4H4MA 1HNIA 4AHRA 3SCXA 1L3TA 4LD0A 3QO9A 1SKSA 1ZBFA 1B92A 3LP3A 4CIGA 4KHSA 3AVCA 2D0BA 1TV6A 3I0RA 3CFPA 3SQ4A 3P1GA 4OVLA 3I8DA 4FYDA 3AVJA 3AVNA 4JRQA 5T7BA 3K59A 2IC3A 4NCGA 3IRXA 4N56A 4E1NA 2BANA 4RW7A 4EP4A 2OYQA 4FJJA 1W0HA 2D0CA 4CHQA 3LP1A 5HROA 4RW9A 4I2PA 3SJJA 3TABA 5DMRA 4B9MA 3SPZA 4CF1A 1S6QA 2KZMA 3O4NA 3JYTA 1LAWA 1NJWA 4F3TA 3OJUA 3K5MA 1TVRA 3NF8A 4CEBA 4DSEA 1ASWA 3RRHA 4RW6A 3RR7A 4H8KA 4CE9A 4M42A 3QLHA 2A1SA 1U47A 1N5YA 1KLNA 1S1XA 1RDCA 4CHNA 4DTPA 2HW3A 4IKFA 4B9SA 2Y1JA 2G8WA 1CLQA 2BDPA 2HHVA 4M41A 4CHYA 3QIOA 4FK2A 1UAXA 4E89A 5KI6A 1CXUA 1C0MA 2D0AA 1B9DA 2E4LA 2IS3A 4JLHA 1U45A 3KJVA 2QK9A 1UOCA 5HRNA 1YT3A 1LW0A 4FCYA 4PUOA 2HNDA 1JXEA 2NUBA 1NK7A 1U48A 2HMIA 3TAEA 4M3UA 1FXXA 3HPHA 3KD5E 1SL0A 4N47A 1X1PA 1L3VA 2ZD1A 3T1AA 4JRPA 1S9EA 1RBTA 2VG6A 2KZZA 3HYFA 2WONA 1JLBA 4CEFA 3OY9A 4GMJB 5J2MA 4LSNA 4E7IA 3JSMA 4N76A 4M3XA 5D3GA 3MEEA 2B5JA 4F2SA 2HVIA 2Z1GA 4FJKA 1JL2A 1S1TA 1LV5A 3T19A 3ZSQA 2E6LA 3V1OA 1C0UA 4ZTJA 1S1WA 3L2RA 3OYEA 4KO0A 1TKTA 3SYZA 1FKPA 3HSTB 4IFYA 4B8AB 5FDLA 5E41A 1XHXA 4FJGA 1TAUA 3C6UA 3LAKA 4FJNA 3BGRA 4ICLA 4O0JA 2PZSA 4CEEA 1BIUA 4FJ9A 3HO1A 1HQEA 3AO4A 4F4KA 3DOLA 2W42A 2KQ2A 4I7FA 3OYHA 2LSNA 3RMAA 3F9KA 5I42A 1VSKA 1C1CA 3A2FA 1NK4A 3AVKA 4DU4A 4I2QA 3AO1A 3PY8A 1WSJA 3G0ZA 4B08A 3ZT4A 3CFRA 1I39A 4Z4HA 4K8ZA 1QTMA 3QEWA 1UA0A 3NGYA 4CJ3A 4FW1A 4CGIA 1X9SA 1T03A 1D9FA 3HXMA 4BDPA 4ELTA 1WSGA 1NK5A 4M3TA 5JS1A 4FLUA 3ISNC 4CK2A 1VSIA 1RNHA 3K5OA 2G8FA 1D9DA 4BDYA 1Q8IA 2ITGA 1QS4A 1BCMA 3L2QA 1TK8A 1NK6A 1NOYA 2DTUA 1HJRA 2QKBA 1XWLA 2FBVA 4B9VA 1GOBA 3DM2A 3LP0A 3S9HA 3RR8A 2ETJA 3MEDA 3QNNA 1RT1A 2Y1IA 1LWFA 4ID1A 4FJHA 5FRMA 1BI4B 1K6YA 2EX3A 2QKKA 1A5VA 3G10A 2P5GA 4DTJA 2HHXA 4FLXA 1BCOA 3AA2A 4CEOA 3SI6A 1BHLA 3LALA 4IDKA 4PA1A 1GOCA 4FVMA 2A1RA 4NYNA 4FK4A 1KSPA 1W9HA 1Y97A 1SKWA 4RW4A 1F21A 3DLBA 1WAFA 1BGXT 4HCBA 2HNYA 4J2EA 2YHBA 3AV9A 3OYIA 4BE1A 4DLGA 3MAQA 2IGIA 3NE6A 1D8YA 3PX4A 1VRUA 4TSXA 4CGHA 1RT3A 3K2PA 3NGIA 1JLEA 4CJUA 1UA1A 4CJRA 4PQUA 3ZSOA 1T8EA 4CGFA 3NF9A 3AO3A 3AVAA 1IKXA 1HRHA 4FW2A 1U4BA 3QEPA 2XO7A 1YVUA 5J1EA 3WNHA 4JS4A 4KV8A 4HTUA 3SNNA 2OZSA 4RG8A 3VQAA 1SL2A 3V9XA 3VA3A 3LAMA 1RT2A 4Y1CA 4FLTA 2B4JA 3LPUA 3OYAA 1RBUA 1S6PA 1RBSA 4HUEA 3U3YA 2O4GA 1CZ9A 4DU1A 3OYKA 3KK3A 5J2QA 1QSLA 3AVIA 3VQ7A 4CEQA 2I5JA 2OA8A 3RTVA 1N6QA 1RILA 3OYFA 4CEDA 2X74A 3IAYA 3OS1A 1VSDA 4CFDA 2XY8A 1LWEA 2X6NA 2HVHA 4CCHA 4IBNA 1QSSA 1BIZA 1RCHA 3B6PA 4CEZA 2ZE2A 2X6SA 4ELUA 3ITHA 4J2DA 2XRIA 4DF8A 4DTUA 3ZSYA 4KI6A 3V4IA 2F96A 1RTHA 5JS2A 4B9LA 4KB1A 4FJ7A 3WNFA 4KHUA 3ZSVA 4ZTFA 1T05A 2G8KA 4FJIA 2HHTA 4OGCA 4LH4A 4W5OA 2B6AA 4BDZA 4BE0A 3TAFA 4DSIA 3PUFA 2VG5A 1NK0A 1JLCA 3TAPA 3NHGA 4DTSA 2YNFA 3QEIA 3VQBA 3OYDA 1NOZA 1S9GA 3QEXA 2GV9A 1LW2A 3SQ0A 3VA0A 2YKNA 5CYMA 1J5OA 4LY7A 2ATQA 5KGWA 3L2UA 4H4OA 4W5RA 4KHWA 3K57A 1REVA 2G8IA 1JLFA 3VQ6A 4CF8A 3RMDA 3ZT2A 1Q9YA 3V1QA 3AVBA 1A5WA 3V1RA 5HP1A 4DWIA 3KLHA 4C8LA 2FBXA 1RBRA 1NJXA 3V9ZA 1EKEA 1SV5A 1NKBA 1RT6A 4CJLA 4DF4A 3AVFA 4HUFA 3DLGA 4DFKA 3M8QA 4OJRA 3HP6A 1L3UA 3V9WA 1TKXA 5HRRA 1HYZA 4JS5A 3EYZA 2G8HA 1TKZA 3UIQA 2YKMA 1Q9XA 4I9QA 4O5BA 3ULDA 4Z4FA 3PO4A 4O44A 2IDOA 3BDPA 4DSFA 2R7YA 2PY5A 4DQQA 2HHWA 1HPZA 4DTOA 4GW6A 3NGZA 4MFBA 4F8RA 3AVMA 2JGUA 4IG3A 1TGOA 1FKOA 2IAJA 2WOMA 1HYVA 3VQ5A 3VQ8A 4CJ5A 3DRPA 4ZHRA 3OS2A 3NDKA 3SV3A 1RTDA 3MXJA 4CJQA 3OYMA 3L2WA 3SPYA 4DFMA 4EZ6A 3OYNA 1X9WA 4PY5A 4IFVA 4OPKA 4CF0A 3LDSA 4FZZA 4B3OA 3KD1E 1LAVA 3V81A 3S3OA 2VG7A 4FLWA 1EP4A 3FFIA 4W5QA 1ZBHA 1KCFA 1DTQA 3CQ8A 4DS4A 4AHSA 2P5OA 3M8SA 3IG1A 4BACA 1XI1A 1WLJA 2FBYA 4CHOA 4DTXA 5EU7A 2IOCA 1RT7A 3ZSXA 3VQ4A 4HCCA 3CM6A 4YNQA 1S1VA 1ITGA 5HBMA 1B9FA 1EXQA 1U49A 1QHTA 5C42A 2G8UA 4KAZA 2D5RA 4DFJA 3MEGA 1R0AA 1IH7A 3OYLA 4FJ5A 1X9MA 3KLFA 4F2RA 4HVJA 4CJTA 1O1WA 4CFAA 3TI0A 4Z4GA 3QESA 3K5NA 1JXBA 2E6MA 3KKSA 3SUPA 2OPQA 3LZIA 2EHGA 4DLEA 3DI6A 4CEAA 4CF9A 4DFPA 4DSJA 2DFHA 5CY4A 3IS9A 1RDAA 1TAQA 1FK9A 3LWLA 4M3YA 3THVA 3CG7A 2X78A 5KGXA 3PX0A 4LH5A 3SUNA 4CIEA 1XC9A 4M3WA 3EY1A 3PX6A 4E1MA 3SZ2A 4KTZA 5FRNA 1HYSA 2F8SA 1HMVA 3KK2A 3TAQA 4K8XA 3HVRA 1NK9A 1NKEA 4OKKA 2Z1JA 3VQ9A 4KTQA 1WSIA 3L8BA 3HL8A 4C8KA 4FZXC 1KFDA 3NF7A 4E19A 4EZ9A 1IKVA 1J53A 1C1BA 5C24A 4CF2A 4J2BA 4E7KA 3VN5A 2XY7A 4ELVA 4DTRA 5CYQA 1RDDA 4DTMA 1C0TA 2Q3SA 3KLIA 3CM5A 4W5TA 1JKHA 4OKEA 3O3FA 3M8RA 3OYCA 1YTAA 3TWHA 3VQPA 1VSEA 3DOKA 1ASUA 2BE2A 3L3UA 3MXIA 3VQQA 5C25A 4Z0UA 3ALYA 1ASVA 1IKWA 4KTWA 4NYFA 4LSLA 4O4GA 1CXQA 3SV4A 4QCLA 3AVLA 4AHUA 3QERA 4Z4IA 4FK0A 2YNIA 4CFCA 4DG1A 4CHZA 4CECA 3MXMA 2HHUA 4UQGA 4CK3A 4CJWA 4XIUA 1C6VA 4Z4CA 1CZBA 3DMJA 2XY5A 3AO2A 3NCIA 4BWJA 1KVBA 1KVCA 4KREA 1J9AA 4OKJA 4OGEA 3C6TA 2HNZA 2P51A 4FJLA 1DTTA 5KRTA 3S3MA 3C94A 3F73A 3MECA 4FLVA 1VK0A 3HT3A 4E7LA 3C95A 4E3SA 3U6FA 1TK5A 4NCAA 3VQCA 4C8MA 4Z4EA 3DRSA 3OYGA 2FC0A 3K5LA 3QETA 3RMCA 2DY4A 4KPYA 2F8TA 3HJFA 3DLEA 3AA3A 2HHSA 3I0SA 3K58A 4B9NA 1NJZA 4CK1A 2OPRA 1JLQA 4EP5A 1WSHA 1HNVA 3DLHA 3SUOA 4KB0A 1D5AA 2DFFA 1TL1A 1WN7A 1BQMA 1WAJA 3EZ5A 1IKYA 4MQ3A 3HM9A 1HQUA 3RMBA 3SQ1A 1WNSA 1BISA 4E7HA 2OZMA 4Y1DA 3LWMA 3KLGA 4FJMA 4E7JA 4W5NA 4M3RA 3L2VA 4CJSA 4DMNA 4B9UA 1RT5A 3V9SA 4G1QA 4FXDA 4N41A 2KFZA 5SZTA 4B9TA 4CJFA 4M3ZA 4KHYA 4PWDA 3KKRA 1KLMA 2VWKA 2QXFA 1NK8A 3QEVA 5I3UA 4DS5A 5HRSA 5KRSA 1BQNA 4CJVA 3TR8A 4CFBA 1VSLA 3H08A 1L5UA 4DQIA 3D0PA 1UWBA 4KRFA 1C1AA 3V6DA 3VQEA 2JLEA 1IO2A 1I3AA 3ZSRA 3OJSA 4CGDA 1EX4A 1KRPA 3E01A 1VRTA 1U04A 1JLAA 3D45A 5HLFA 4FLYA 2XHBA 1ZBIA 2GBZA 4OPJA 3OVNA 3TAGA 2YHAA 2RKIA 1EETA 1S5JA 3KIOA 3LANA 4YFUA 4DU3A 1SL1A 4CERA 3QINA 3KK1A 4ID5A 3S3NA 4CJEA 1RTIA 1G15A 5FROA 3KLEA 3HPGA 2Z1HA 3ZT0A 1ZBUA 2FBTA 2OPSA 3LP2A 4QAGA 3ZT3A 1GOAA 3DRRA 3NH2A 3LZJA 1XHZA 1QQCA 4FM1A 1NKCA 1IG9A 4C8OA 4FJ8A 3HK2A 4CJKA 4HHTA 1WSEA 4CGJA 4DQPA 4NCBA 4KI4A 3NH0A 3V9UA 3L3VA 4AHCA 3SUQA 4GVMA 4L8RB 4BWMA 3AVGA 4RW8A 1BL3A 3HVTA 5HRPA 4C8NA 3NBPA 1QE1A 4AHVA 1NJYA 3ZT1A 5DK5A 4CJ4A 1VSFA 2RN2A 3VQDA 3O3HA 2DFEA 1YTUA 3HP9A 3HPOA 4O55A 3WNEA 1T7PA 2AJQA 1S1UA 4AHTA 1WSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA4 A;  4CGG A;  3O3G A;  3NAE A;  4B8C A;  4CHP A;  3WNG A;  3NFA A;  3DLK A;  1BI4 A;  4CJP A;  3CFO A;  1VSJ A;  3CYM A;  2XY6 A;  2OPP A;  1MU2 A;  1ZBL A;  4O0I A;  4N5S A;  3SQ2 A;  1KTQ A;  3M8P A;  4KFB A;  2VWJ A;  1LWC A;  1A5X A;  1RBV A;  3P5J A;  5CZ1 A;  3NH1 A;  2YV0 X;  4M45 A;  4FM2 A;  4DSK A;  4HUG A;  3OYB A;  3ZCM A;  3OYJ A;  2RPI A;  3TAM A;  1Z25 A;  2P1J A;  2PYL A;  3RRG A;  3ZSW A;  3P83 D;  4OLB A;  4CIF A;  5J2P A;  3QIP A;  5SWM A;  3T3F A;  3ASM A;  3O4Q A;  4IG0 A;  4WE1 A;  4FM0 A;  2KFN A;  3KTQ A;  1VSH A;  2RF2 A;  3AA5 X;  5KTQ A;  1KFS A;  1RDB A;  3AVH A;  4R5P A;  2G8V A;  2PYJ A;  1SUQ A;  2YNG A;  3DLR A;  1RTJ A;  4AIL C;  2GUI A;  4DSL A;  4DQR A;  3AO5 A;  2O4I A;  1TKD A;  1ZYQ A;  3PO5 A;  2BGG A;  4OLA A;  4E0D A;  1KVA A;  3TAR A;  3PV8 A;  1VSM A;  4KKO A;  2YNH A;  1TK0 A;  4FZY A;  3TAN A;  2KTQ A;  3LPT A;  5K14 A;  2Z1I A;  4Q5V A;  5CZ2 A;  1JLG A;  1Z26 A;  3U3G A;  4BE2 A;  4KHN A;  4I9L A;  4CES A;  3ZSZ A;  1TL3 A;  4Q0B A;  2HB5 A;  4F3O A;  2HHQ A;  1DLO A;  1JL1 A;  3NF6 A;  3OS0 A;  1L3S A;  4AH9 A;  3RWU A;  1SKR A;  5J2N A;  4QOZ B;  2KW4 A;  3B6O A;  1RT4 A;  2ZQB A;  1QSY A;  3DYA A;  3QNO A;  4J2A A;  4KHQ A;  4DQS A;  4FLZ A;  4FJX A;  4DTN A;  1J54 A;  4H4M A;  1HNI A;  4AHR A;  3SCX A;  1L3T A;  4LD0 A;  3QO9 A;  1SKS A;  1ZBF A;  1B92 A;  3LP3 A;  4CIG A;  4KHS A;  3AVC A;  2D0B A;  1TV6 A;  3I0R A;  3CFP A;  3SQ4 A;  3P1G A;  4OVL A;  3I8D A;  4FYD A;  3AVJ A;  3AVN A;  4JRQ A;  5T7B A;  3K59 A;  2IC3 A;  4NCG A;  3IRX A;  4N56 A;  4E1N A;  2BAN A;  4RW7 A;  4EP4 A;  2OYQ A;  4FJJ A;  1W0H A;  2D0C A;  4CHQ A;  3LP1 A;  5HRO A;  4RW9 A;  4I2P A;  3SJJ A;  3TAB A;  5DMR A;  4B9M A;  3SPZ A;  4CF1 A;  1S6Q A;  2KZM A;  3O4N A;  3JYT A;  1LAW A;  1NJW A;  4F3T A;  3OJU A;  3K5M A;  1TVR A;  3NF8 A;  4CEB A;  4DSE A;  1ASW A;  3RRH A;  4RW6 A;  3RR7 A;  4H8K A;  4CE9 A;  4M42 A;  3QLH A;  2A1S A;  1U47 A;  1N5Y A;  1KLN A;  1S1X A;  1RDC A;  4CHN A;  4DTP A;  2HW3 A;  4IKF A;  4B9S A;  2Y1J A;  2G8W A;  1CLQ A;  2BDP A;  2HHV A;  4M41 A;  4CHY A;  3QIO A;  4FK2 A;  1UAX A;  4E89 A;  5KI6 A;  1CXU A;  1C0M A;  2D0A A;  1B9D A;  2E4L A;  2IS3 A;  4JLH A;  1U45 A;  3KJV A;  2QK9 A;  1UOC A;  5HRN A;  1YT3 A;  1LW0 A;  4FCY A;  4PUO A;  2HND A;  1JXE A;  2NUB A;  1NK7 A;  1U48 A;  2HMI A;  3TAE A;  4M3U A;  1FXX A;  3HPH A;  3KD5 E;  1SL0 A;  4N47 A;  1X1P A;  1L3V A;  2ZD1 A;  3T1A A;  4JRP A;  1S9E A;  1RBT A;  2VG6 A;  2KZZ A;  3HYF A;  2WON A;  1JLB A;  4CEF A;  3OY9 A;  4GMJ B;  5J2M A;  4LSN A;  4E7I A;  3JSM A;  4N76 A;  4M3X A;  5D3G A;  3MEE A;  2B5J A;  4F2S A;  2HVI A;  2Z1G A;  4FJK A;  1JL2 A;  1S1T A;  1LV5 A;  3T19 A;  3ZSQ A;  2E6L A;  3V1O A;  1C0U A;  4ZTJ A;  1S1W A;  3L2R A;  3OYE A;  4KO0 A;  1TKT A;  3SYZ A;  1FKP A;  3HST B;  4IFY A;  4B8A B;  5FDL A;  5E41 A;  1XHX A;  4FJG A;  1TAU A;  3C6U A;  3LAK A;  4FJN A;  3BGR A;  4ICL A;  4O0J A;  2PZS A;  4CEE A;  1BIU A;  4FJ9 A;  3HO1 A;  1HQE A;  3AO4 A;  4F4K A;  3DOL A;  2W42 A;  2KQ2 A;  4I7F A;  3OYH A;  2LSN A;  3RMA A;  3F9K A;  5I42 A;  1VSK A;  1C1C A;  3A2F A;  1NK4 A;  3AVK A;  4DU4 A;  4I2Q A;  3AO1 A;  3PY8 A;  1WSJ A;  3G0Z A;  4B08 A;  3ZT4 A;  3CFR A;  1I39 A;  4Z4H A;  4K8Z A;  1QTM A;  3QEW A;  1UA0 A;  3NGY A;  4CJ3 A;  4FW1 A;  4CGI A;  1X9S A;  1T03 A;  1D9F A;  3HXM A;  4BDP A;  4ELT A;  1WSG A;  1NK5 A;  4M3T A;  5JS1 A;  4FLU A;  3ISN C;  4CK2 A;  1VSI A;  1RNH A;  3K5O A;  2G8F A;  1D9D A;  4BDY A;  1Q8I A;  2ITG A;  1QS4 A;  1BCM A;  3L2Q A;  1TK8 A;  1NK6 A;  1NOY A;  2DTU A;  1HJR A;  2QKB A;  1XWL A;  2FBV A;  4B9V A;  1GOB A;  3DM2 A;  3LP0 A;  3S9H A;  3RR8 A;  2ETJ A;  3MED A;  3QNN A;  1RT1 A;  2Y1I A;  1LWF A;  4ID1 A;  4FJH A;  5FRM A;  1BI4 B;  1K6Y A;  2EX3 A;  2QKK A;  1A5V A;  3G10 A;  2P5G A;  4DTJ A;  2HHX A;  4FLX A;  1BCO A;  3AA2 A;  4CEO A;  3SI6 A;  1BHL A;  3LAL A;  4IDK A;  4PA1 A;  1GOC A;  4FVM A;  2A1R A;  4NYN A;  4FK4 A;  1KSP A;  1W9H A;  1Y97 A;  1SKW A;  4RW4 A;  1F21 A;  3DLB A;  1WAF A;  1BGX T;  4HCB A;  2HNY A;  4J2E A;  2YHB A;  3AV9 A;  3OYI A;  4BE1 A;  4DLG A;  3MAQ A;  2IGI A;  3NE6 A;  1D8Y A;  3PX4 A;  1VRU A;  4TSX A;  4CGH A;  1RT3 A;  3K2P A;  3NGI A;  1JLE A;  4CJU A;  1UA1 A;  4CJR A;  4PQU A;  3ZSO A;  1T8E A;  4CGF A;  3NF9 A;  3AO3 A;  3AVA A;  1IKX A;  1HRH A;  4FW2 A;  1U4B A;  3QEP A;  2XO7 A;  1YVU A;  5J1E A;  3WNH A;  4JS4 A;  4KV8 A;  4HTU A;  3SNN A;  2OZS A;  4RG8 A;  3VQA A;  1SL2 A;  3V9X A;  3VA3 A;  3LAM A;  1RT2 A;  4Y1C A;  4FLT A;  2B4J A;  3LPU A;  3OYA A;  1RBU A;  1S6P A;  1RBS A;  4HUE A;  3U3Y A;  2O4G A;  1CZ9 A;  4DU1 A;  3OYK A;  3KK3 A;  5J2Q A;  1QSL A;  3AVI A;  3VQ7 A;  4CEQ A;  2I5J A;  2OA8 A;  3RTV A;  1N6Q A;  1RIL A;  3OYF A;  4CED A;  2X74 A;  3IAY A;  3OS1 A;  1VSD A;  4CFD A;  2XY8 A;  1LWE A;  2X6N A;  2HVH A;  4CCH A;  4IBN A;  1QSS A;  1BIZ A;  1RCH A;  3B6P A;  4CEZ A;  2ZE2 A;  2X6S A;  4ELU A;  3ITH A;  4J2D A;  2XRI A;  4DF8 A;  4DTU A;  3ZSY A;  4KI6 A;  3V4I A;  2F96 A;  1RTH A;  5JS2 A;  4B9L A;  4KB1 A;  4FJ7 A;  3WNF A;  4KHU A;  3ZSV A;  4ZTF A;  1T05 A;  2G8K A;  4FJI A;  2HHT A;  4OGC A;  4LH4 A;  4W5O A;  2B6A A;  4BDZ A;  4BE0 A;  3TAF A;  4DSI A;  3PUF A;  2VG5 A;  1NK0 A;  1JLC A;  3TAP A;  3NHG A;  4DTS A;  2YNF A;  3QEI A;  3VQB A;  3OYD A;  1NOZ A;  1S9G A;  3QEX A;  2GV9 A;  1LW2 A;  3SQ0 A;  3VA0 A;  2YKN A;  5CYM A;  1J5O A;  4LY7 A;  2ATQ A;  5KGW A;  3L2U A;  4H4O A;  4W5R A;  4KHW A;  3K57 A;  1REV A;  2G8I A;  1JLF A;  3VQ6 A;  4CF8 A;  3RMD A;  3ZT2 A;  1Q9Y A;  3V1Q A;  3AVB A;  1A5W A;  3V1R A;  5HP1 A;  4DWI A;  3KLH A;  4C8L A;  2FBX A;  1RBR A;  1NJX A;  3V9Z A;  1EKE A;  1SV5 A;  1NKB A;  1RT6 A;  4CJL A;  4DF4 A;  3AVF A;  4HUF A;  3DLG A;  4DFK A;  3M8Q A;  4OJR A;  3HP6 A;  1L3U A;  3V9W A;  1TKX A;  5HRR A;  1HYZ A;  4JS5 A;  3EYZ A;  2G8H A;  1TKZ A;  3UIQ A;  2YKM A;  1Q9X A;  4I9Q A;  4O5B A;  3ULD A;  4Z4F A;  3PO4 A;  4O44 A;  2IDO A;  3BDP A;  4DSF A;  2R7Y A;  2PY5 A;  4DQQ A;  2HHW A;  1HPZ A;  4DTO A;  4GW6 A;  3NGZ A;  4MFB A;  4F8R A;  3AVM A;  2JGU A;  4IG3 A;  1TGO A;  1FKO A;  2IAJ A;  2WOM A;  1HYV A;  3VQ5 A;  3VQ8 A;  4CJ5 A;  3DRP A;  4ZHR A;  3OS2 A;  3NDK A;  3SV3 A;  1RTD A;  3MXJ A;  4CJQ A;  3OYM A;  3L2W A;  3SPY A;  4DFM A;  4EZ6 A;  3OYN A;  1X9W A;  4PY5 A;  4IFV A;  4OPK A;  4CF0 A;  3LDS A;  4FZZ A;  4B3O A;  3KD1 E;  1LAV A;  3V81 A;  3S3O A;  2VG7 A;  4FLW A;  1EP4 A;  3FFI A;  4W5Q A;  1ZBH A;  1KCF A;  1DTQ A;  3CQ8 A;  4DS4 A;  4AHS A;  2P5O A;  3M8S A;  3IG1 A;  4BAC A;  1XI1 A;  1WLJ A;  2FBY A;  4CHO A;  4DTX A;  5EU7 A;  2IOC A;  1RT7 A;  3ZSX A;  3VQ4 A;  4HCC A;  3CM6 A;  4YNQ A;  1S1V A;  1ITG A;  5HBM A;  1B9F A;  1EXQ A;  1U49 A;  1QHT A;  5C42 A;  2G8U A;  4KAZ A;  2D5R A;  4DFJ A;  3MEG A;  1R0A A;  1IH7 A;  3OYL A;  4FJ5 A;  1X9M A;  3KLF A;  4F2R A;  4HVJ A;  4CJT A;  1O1W A;  4CFA A;  3TI0 A;  4Z4G A;  3QES A;  3K5N A;  1JXB A;  2E6M A;  3KKS A;  3SUP A;  2OPQ A;  3LZI A;  2EHG A;  4DLE A;  3DI6 A;  4CEA A;  4CF9 A;  4DFP A;  4DSJ A;  2DFH A;  5CY4 A;  3IS9 A;  1RDA A;  1TAQ A;  1FK9 A;  3LWL A;  4M3Y A;  3THV A;  3CG7 A;  2X78 A;  5KGX A;  3PX0 A;  4LH5 A;  3SUN A;  4CIE A;  1XC9 A;  4M3W A;  3EY1 A;  3PX6 A;  4E1M A;  3SZ2 A;  4KTZ A;  5FRN A;  1HYS A;  2F8S A;  1HMV A;  3KK2 A;  3TAQ A;  4K8X A;  3HVR A;  1NK9 A;  1NKE A;  4OKK A;  2Z1J A;  3VQ9 A;  4KTQ A;  1WSI A;  3L8B A;  3HL8 A;  4C8K A;  4FZX C;  1KFD A;  3NF7 A;  4E19 A;  4EZ9 A;  1IKV A;  1J53 A;  1C1B A;  5C24 A;  4CF2 A;  4J2B A;  4E7K A;  3VN5 A;  2XY7 A;  4ELV A;  4DTR A;  5CYQ A;  1RDD A;  4DTM A;  1C0T A;  2Q3S A;  3KLI A;  3CM5 A;  4W5T A;  1JKH A;  4OKE A;  3O3F A;  3M8R A;  3OYC A;  1YTA A;  3TWH A;  3VQP A;  1VSE A;  3DOK A;  1ASU A;  2BE2 A;  3L3U A;  3MXI A;  3VQQ A;  5C25 A;  4Z0U A;  3ALY A;  1ASV A;  1IKW A;  4KTW A;  4NYF A;  4LSL A;  4O4G A;  1CXQ A;  3SV4 A;  4QCL A;  3AVL A;  4AHU A;  3QER A;  4Z4I A;  4FK0 A;  2YNI A;  4CFC A;  4DG1 A;  4CHZ A;  4CEC A;  3MXM A;  2HHU A;  4UQG A;  4CK3 A;  4CJW A;  4XIU A;  1C6V A;  4Z4C A;  1CZB A;  3DMJ A;  2XY5 A;  3AO2 A;  3NCI A;  4BWJ A;  1KVB A;  1KVC A;  4KRE A;  1J9A A;  4OKJ A;  4OGE A;  3C6T A;  2HNZ A;  2P51 A;  4FJL A;  1DTT A;  5KRT A;  3S3M A;  3C94 A;  3F73 A;  3MEC A;  4FLV A;  1VK0 A;  3HT3 A;  4E7L A;  3C95 A;  4E3S A;  3U6F A;  1TK5 A;  4NCA A;  3VQC A;  4C8M A;  4Z4E A;  3DRS A;  3OYG A;  2FC0 A;  3K5L A;  3QET A;  3RMC A;  2DY4 A;  4KPY A;  2F8T A;  3HJF A;  3DLE A;  3AA3 A;  2HHS A;  3I0S A;  3K58 A;  4B9N A;  1NJZ A;  4CK1 A;  2OPR A;  1JLQ A;  4EP5 A;  1WSH A;  1HNV A;  3DLH A;  3SUO A;  4KB0 A;  1D5A A;  2DFF A;  1TL1 A;  1WN7 A;  1BQM A;  1WAJ A;  3EZ5 A;  1IKY A;  4MQ3 A;  3HM9 A;  1HQU A;  3RMB A;  3SQ1 A;  1WNS A;  1BIS A;  4E7H A;  2OZM A;  4Y1D A;  3LWM A;  3KLG A;  4FJM A;  4E7J A;  4W5N A;  4M3R A;  3L2V A;  4CJS A;  4DMN A;  4B9U A;  1RT5 A;  3V9S A;  4G1Q A;  4FXD A;  4N41 A;  2KFZ A;  5SZT A;  4B9T A;  4CJF A;  4M3Z A;  4KHY A;  4PWD A;  3KKR A;  1KLM A;  2VWK A;  2QXF A;  1NK8 A;  3QEV A;  5I3U A;  4DS5 A;  5HRS A;  5KRS A;  1BQN A;  4CJV A;  3TR8 A;  4CFB A;  1VSL A;  3H08 A;  1L5U A;  4DQI A;  3D0P A;  1UWB A;  4KRF A;  1C1A A;  3V6D A;  3VQE A;  2JLE A;  1IO2 A;  1I3A A;  3ZSR A;  3OJS A;  4CGD A;  1EX4 A;  1KRP A;  3E01 A;  1VRT A;  1U04 A;  1JLA A;  3D45 A;  5HLF A;  4FLY A;  2XHB A;  1ZBI A;  2GBZ A;  4OPJ A;  3OVN A;  3TAG A;  2YHA A;  2RKI A;  1EET A;  1S5J A;  3KIO A;  3LAN A;  4YFU A;  4DU3 A;  1SL1 A;  4CER A;  3QIN A;  3KK1 A;  4ID5 A;  3S3N A;  4CJE A;  1RTI A;  1G15 A;  5FRO A;  3KLE A;  3HPG A;  2Z1H A;  3ZT0 A;  1ZBU A;  2FBT A;  2OPS A;  3LP2 A;  4QAG A;  3ZT3 A;  1GOA A;  3DRR A;  3NH2 A;  3LZJ A;  1XHZ A;  1QQC A;  4FM1 A;  1NKC A;  1IG9 A;  4C8O A;  4FJ8 A;  3HK2 A;  4CJK A;  4HHT A;  1WSE A;  4CGJ A;  4DQP A;  4NCB A;  4KI4 A;  3NH0 A;  3V9U A;  3L3V A;  4AHC A;  3SUQ A;  4GVM A;  4L8R B;  4BWM A;  3AVG A;  4RW8 A;  1BL3 A;  3HVT A;  5HRP A;  4C8N A;  3NBP A;  1QE1 A;  4AHV A;  1NJY A;  3ZT1 A;  5DK5 A;  4CJ4 A;  1VSF A;  2RN2 A;  3VQD A;  3O3H A;  2DFE A;  1YTU A;  3HP9 A;  3HPO A;  4O55 A;  3WNE A;  1T7P A;  2AJQ A;  1S1U A;  4AHT A;  1WSF A; 
#chains in the Genus database with same CATH topology
 2HST A;  4CGG A;  1XNQ K;  3H1Q A;  4CJP A;  3J7A P;  1VSJ A;  4FWO A;  4N5S A;  3QFP A;  1LWC A;  1KAY A;  3D2F B;  4FM2 A;  3OYB A;  3OYJ A;  3TAM A;  1TUU A;  3RRG A;  3ZSW A;  2AP1 A;  3ASM A;  4FM0 A;  2KFN A;  2O8C A;  3E9O A;  2RF2 A;  3A5M C;  3ENH A;  4BC5 A;  5E84 A;  2PYJ A;  2UUC K;  5AQG A;  2YNG A;  1XC3 A;  1RTJ A;  4A57 A;  2GUI A;  4CBU A;  4DSL A;  3WQT A;  2QWP A;  4WYB A;  1ZYQ A;  3PO5 A;  4CZM A;  1S72 N;  4OPH A;  4BRP A;  1VSM A;  2E8A A;  1TK0 A;  4FZY A;  4Q5V A;  3ZEU B;  2VGN A;  4Q0B A;  2HB5 A;  1Q7Y O;  3RWU A;  3NF6 A;  2IVN A;  1YXQ A;  2O8E B;  1GLF O;  2PAV A;  3B6O A;  1QSY A;  2A5X A;  4J2A A;  3A0I X;  2PBD A;  4DKW A;  5AQT A;  1E3M A;  2ZGZ A;  2DPN A;  1NU0 A;  4RTF D;  2F9T A;  3LP3 A;  4KHS A;  3AVC A;  3M6G A;  3SQ4 A;  4OVL A;  5BRD A;  3K59 A;  4N56 A;  2BAN A;  4IXC A;  2D0C A;  3E9P A;  1ILY A;  3WEE B;  2NLX A;  4BRM A;  4DV7 K;  4IWV A;  4CF1 A;  1KAZ A;  2KZM A;  4LF4 K;  1HUX A;  4BRC A;  3OJU A;  3K5M A;  3RR7 A;  5AQK A;  4M42 A;  3QLH A;  5JIC A;  1N5Y A;  2P9K A;  3CC7 N;  4WFB L;  4BC3 A;  2HHV A;  4M41 A;  4C23 A;  4WQ5 C;  1YJN N;  1UAX A;  3A5N C;  1U45 A;  3ZET B;  1UOC A;  5HRN A;  4FCY A;  3FFK B;  3ZYY X;  4PUO A;  4AQY K;  5JVG L;  4BRH A;  2I7N A;  2VG6 A;  3HYF A;  4GMJ B;  4LSN A;  5D3G A;  2B5J A;  2YCH A;  3BY5 A;  3ZSQ A;  2P9U B;  3V1O A;  1S1W A;  3SYZ A;  4BQZ A;  5FDL A;  3LAK A;  4K25 A;  3THX B;  4O0J A;  1GLE G;  4FJ9 A;  3HO1 A;  3KK7 A;  4A61 A;  2BTF A;  3DOL A;  4B1X B;  5AQR A;  3A2F A;  3FZL A;  4IEI A;  4BQL A;  3AO1 A;  1WSJ A;  3G0Z A;  5BPN A;  3CFR A;  2W6K A;  3CET A;  4CJ3 A;  4FW1 A;  3TSU A;  4BDP A;  1NK5 A;  4M3T A;  1N8R O;  4BGB A;  1W7A A;  4H0T B;  4DQ8 A;  1D9D A;  3KZB A;  4G9Z A;  2VWB A;  1QS4 A;  2KLA A;  1XWL A;  1ZC6 A;  3MED A;  3QNN A;  1RT1 A;  2Y1I A;  1BI4 B;  1A5V A;  4IFE A;  1BCO A;  4IDK A;  4I6M A;  2Q1N A;  3O80 A;  1Y97 A;  4HCB A;  1BGX T;  1MA9 B;  2YHB A;  3AV9 A;  3QIC A;  4BE1 A;  4DLG A;  3NE6 A;  3PX4 A;  4CGH A;  3WXK A;  1RT3 A;  1UA1 A;  1T8E A;  4CGF A;  5AQS A;  1IKX A;  4K41 A;  3UKR B;  4YOV A;  5CE3 A;  2XO7 A;  4LC9 B;  1JCF A;  3IKM A;  4BC4 A;  4X66 K;  5AZJ B;  4IEE A;  3WNH A;  2OZS A;  2F7T A;  3SNN A;  4U7B A;  1RT2 A;  4Y1C A;  2VQF K;  3D6R A;  5AJ3 K;  3OYA A;  3HSC A;  2CGJ A;  5JMV A;  1G99 A;  2WUS A;  3VF4 A;  2O4G A;  3U3Y A;  4DU1 A;  2E2P A;  1N6Q A;  1TYQ B;  1RIL A;  3OYF A;  1VSD A;  4CFD A;  2HVH A;  1QSS A;  3B6P A;  4CEZ A;  3GG4 A;  2VQE K;  4ELU A;  4DR7 K;  5B8H A;  1RTH A;  4B9L A;  3TSQ A;  3VET A;  2QTD A;  2P9I A;  2ZJR L;  3QEI A;  3OYD A;  2GEM A;  4ISE A;  4B1Z A;  2UXB K;  5CYM A;  1J5O A;  1IV0 A;  2RHK A;  1M1K O;  4DCH A;  3CJ7 A;  1KQS M;  3AGR A;  4X65 K;  3K57 A;  1WOQ A;  3ZT2 A;  5AR0 A;  3MN6 A;  1A5W A;  3VEW A;  2QEX N;  4B9Q A;  4FWS A;  3JXU A;  4C8L A;  4M7X A;  1NKB A;  5JVH L;  1RT6 A;  4XH1 A;  4CVN E;  3HP6 A;  3HTV A;  1VQ8 N;  5BPL A;  2FSN A;  3UIQ A;  4O5B A;  3O6W A;  2QWQ A;  3PO4 A;  4O44 A;  5C10 A;  2PY5 A;  2HHW A;  3T69 A;  2WTU A;  4GW6 A;  3VF2 A;  4J8F A;  3GDQ A;  1S3X A;  3CC4 N;  1TGO A;  2IAJ A;  4CJ5 A;  3OS2 A;  2BDP A;  4JI7 K;  4ZHR A;  1VQP N;  4F9O A;  3MXJ A;  3Q7C A;  4EZ6 A;  3OYN A;  4PY5 A;  5KPR A;  4CF0 A;  3LDS A;  1HKB A;  3KD1 E;  2CH6 A;  2VG7 A;  4YOT A;  1DKG D;  2GX9 A;  1DTQ A;  4LF8 K;  4BRE A;  2FSK A;  4BAC A;  4CHO A;  2FLO A;  2IOC A;  3VQ4 A;  2HBL A;  1BWF O;  3CC2 N;  1X3M A;  3C6H A;  3WT0 A;  2G8U A;  4KAZ A;  2D5R A;  1R0A A;  1IH7 A;  3I8B A;  3W0L A;  3OYL A;  4DUZ K;  3TI0 A;  4Z4G A;  1QVF M;  4JEP A;  3QES A;  4DV6 K;  3K5N A;  2E6M A;  3SK3 A;  3D2F A;  4E1J A;  1OVY A;  4DFP A;  1QHA A;  2DFH A;  5CY4 A;  4M3Y A;  3THV A;  4BVO A;  4M3W A;  4FWQ A;  3EY1 A;  1HYS A;  4KTZ A;  2F8S A;  1HMV A;  3HVR A;  3TSP A;  4JD2 B;  4OKK A;  3SBG A;  2FXU A;  1WSI A;  4FZX C;  3NF7 A;  4CZE A;  4C1N I;  5C24 A;  3ZEU A;  1C1B A;  3KWG A;  1YJ9 N;  5AQO A;  1RDD A;  2O8E A;  3VOV A;  3O3F A;  1YTA A;  1E4F T;  3BF1 A;  2KHO A;  3MXI A;  3CCL N;  4BRI A;  5C25 A;  2E2Q A;  3ALY A;  4NYF A;  4PL7 A;  3QER A;  4WQ4 C;  3WUH A;  2YNI A;  3CPW M;  4CEC A;  3MXM A;  4A59 A;  1NGA A;  4IDH A;  4CK3 A;  1C6V A;  2E2N A;  1D4X A;  2D0O A;  3WEE A;  1P8Z A;  3MN9 A;  1VHX A;  1ESV A;  1EQY A;  5M1O A;  3MEC A;  3O9T A;  2A6A A;  3VQC A;  3BUZ B;  4BRD A;  3DRS A;  2F8T A;  3MDQ A;  3J81 O;  3SBT A;  2NRR A;  3DLE A;  3CCR N;  4FWP A;  4CK1 A;  1V4S A;  2BUP A;  3HM8 A;  4FPB A;  4BY9 C;  3ZET A;  1XUP O;  4MQ3 A;  1WNS A;  4E7J A;  2QWN A;  4M3R A;  1YIT N;  3JS6 A;  3V9S A;  1N36 K;  4UY8 O;  4FXD A;  3TTF A;  3C0B A;  2KFZ A;  4B9T A;  4CJF A;  4KHY A;  4PWD A;  2VWK A;  3E9L A;  3QEV A;  1FW6 A;  5GIN A;  5KRS A;  3ID6 A;  3HRG A;  2P9U A;  3TR8 A;  1UWB A;  4KRF A;  5I9E B;  5FPN A;  2JLE A;  3I55 N;  3ZSR A;  3ZLJ A;  3U9D A;  3PIP L;  2GBZ A;  3OVN A;  2NRX A;  3TAG A;  5EVZ A;  2RKI A;  2W41 A;  3KIO A;  4YFU A;  3QIN A;  5HL7 L;  4ID5 A;  1RTI A;  2Z1H A;  1XHZ A;  3Q7B A;  5EX5 A;  2D4W A;  3HI0 A;  2J4R A;  3L3V A;  4AHC A;  2OCE A;  3SLC A;  1NJY A;  2PZS A;  4AHV A;  3VEN A;  4MLE A;  4CJ4 A;  4GV3 A;  1YTU A;  3FLC O;  1T6D A;  3FZM A;  4AHT A;  3P39 A;  3AA4 A;  5M1F A;  1WUA A;  3NAE A;  3VES A;  4CHP A;  3WNG A;  3NFA A;  3DLK A;  2FF3 B;  1BI4 A;  2P9P B;  5AQV A;  3CYM A;  3SMP A;  2XY6 A;  4O0I A;  3QFU A;  4KFB A;  5BR9 A;  5IWA K;  2VWJ A;  5CZ1 A;  5ADX H;  4M45 A;  5F0X A;  1JCE A;  1Z6R A;  4CIF A;  3GOI A;  3QIP A;  5SWM A;  3O4Q A;  4WE1 A;  5KTQ A;  1RDB A;  4HTL A;  3UKR A;  1T6C A;  2O4I A;  1TKD A;  5AZJ A;  1KVA A;  1QQN A;  4KKO A;  3THY B;  2Z1I A;  5CZ2 A;  3KHY A;  3U3G A;  5AZI B;  4CES A;  2CGL A;  4WCE L;  1DLO A;  3T1Y K;  3EZW A;  1TYQ A;  3DYA A;  4JK9 A;  3QML A;  4JKA A;  3VF6 A;  4DQS A;  3PSF A;  4FLZ A;  2HF3 A;  4FJX A;  4DTN A;  1J54 A;  1HNI A;  3SCX A;  5AFU H;  1L3T A;  5BRE A;  4NO7 A;  3WQU A;  1QZ6 A;  4CIG A;  1TV6 A;  3I0R A;  3I8D A;  4B3O A;  3VEX A;  1KSP A;  2OAN A;  4H5V A;  4RW7 A;  4EP4 A;  1W0H A;  1VQ9 N;  3LP1 A;  2GTD A;  3CQY A;  4I2P A;  4B9M A;  1S6Q A;  2NNW A;  3O4N A;  1VQ7 N;  1LAW A;  1U6Z A;  4JYA K;  4F3T A;  3EE9 A;  2F9W A;  4LFA K;  4H8K A;  1T44 A;  2A1S A;  1S1X A;  4IKF A;  4B9S A;  3RSE B;  1CLQ A;  2WFB A;  3QIO A;  4H5W A;  4U67 L;  4KHP K;  4E89 A;  3M5R A;  2UXD K;  1B9D A;  1NGB A;  2HND A;  3CF5 L;  2HMI A;  4BR7 A;  4K43 A;  1VQ6 N;  4M3U A;  4BR9 A;  1OH8 A;  1L3V A;  3T1A A;  2KZZ A;  5J2M A;  4E7I A;  3MEE A;  4FJK A;  1S1T A;  1LV5 A;  3H1V X;  4JV5 K;  4KH4 A;  3OYE A;  2D1K A;  5LJW A;  5AQF A;  4FJG A;  3FZH A;  4MDA A;  4Z94 A;  4OPA A;  4FJN A;  4B1Y B;  1QVG M;  4ICL A;  1BIU A;  4F4K A;  4JN4 A;  2KQ2 A;  2CGK A;  4I7F A;  3RMA A;  3F9K A;  5I42 A;  1HJO A;  4DV4 K;  4H0V B;  1NK4 A;  4B08 A;  3ZT4 A;  1I39 A;  3ENB A;  1WB9 A;  3QEW A;  4BG8 A;  4CGI A;  1T03 A;  5JS1 A;  4FLU A;  3ISN C;  2ZWH A;  4CK2 A;  1VSI A;  4A5B A;  1RNH A;  3K5O A;  3MCA B;  1Q8I A;  2YJE A;  1Q81 O;  4JAX A;  1NK6 A;  1HJR A;  2QKB A;  2FBV A;  4B9V A;  1GOB A;  3AAQ A;  3LP0 A;  1MWK A;  1WBD A;  1K6Y A;  4B3R K;  3G10 A;  4WFN L;  4DTJ A;  4JKG B;  4JD2 A;  3CIP A;  3GL1 A;  4PA1 A;  1GOC A;  4RW4 A;  2HNY A;  4BC2 A;  3TTD A;  3NVM A;  2Q0R A;  5C2F A;  5BN9 A;  3OYI A;  4CZH A;  2GWK A;  1VRU A;  3K2P A;  3M3Z A;  4ILG B;  4CJU A;  4CJR A;  4PQU A;  3CCE N;  3AO3 A;  3J80 O;  4PKI A;  4HTU A;  4FO0 A;  4KV8 A;  4BRQ A;  4FOE A;  3VGM A;  4YDU C;  1RBU A;  4HUE A;  1CZ9 A;  3OYK A;  5J2Q A;  3FR0 A;  4JKH A;  3VPZ A;  3UKU B;  4JI0 K;  3IAY A;  4CBX A;  2XY8 A;  4IBN A;  1BIZ A;  4WQ5 A;  1C0F A;  1VQM N;  5KPZ A;  2X6S A;  1YF5 L;  4QS9 A;  3CD6 N;  3ZSY A;  4FPA A;  3ZSV A;  4FJI A;  4DSI A;  2B6A A;  1JLC A;  1NBW A;  4DV2 K;  4DTS A;  2GV9 A;  3SQ0 A;  5GIP A;  5GAE P;  1BU6 O;  2WBN A;  1GLA G;  2ATQ A;  5KGW A;  4X62 K;  3H45 C;  1Q82 O;  5KPT A;  2G8I A;  4CF8 A;  3U4L A;  3V1Q A;  1RGI A;  3AVB A;  3V1R A;  1WBB A;  3KLH A;  1NJX A;  4DB3 A;  1NNE A;  4NXM K;  2G8H A;  4DV3 K;  5CR4 A;  4YOX A;  3S41 A;  1J6Z A;  1ZBS A;  3BDP A;  4FWL A;  1HR0 K;  1HPZ A;  3E1Y A;  4IG3 A;  4CZK A;  2QWO A;  1RTD A;  4CJQ A;  3BZK A;  3L2W A;  3O9R A;  1QZ5 A;  3OA9 A;  2Q0U A;  1X9W A;  3EKU A;  4IFV A;  4DR1 K;  3V81 A;  3FFI A;  3G25 A;  3O8M A;  1KCF A;  5LJV A;  4DS4 A;  3M8S A;  1XI1 A;  2FBY A;  2W6L A;  4HCC A;  5AQH A;  1S1V A;  4GV9 A;  2P9P A;  1EXQ A;  3I56 N;  1QHT A;  4JI3 K;  4DFJ A;  4FJ5 A;  3SAF A;  4F2R A;  2NRV A;  5GAG P;  1SZ2 A;  4CJT A;  4DR5 K;  4OO1 J;  3WXM B;  2OPQ A;  4DLE A;  3KVG A;  4CEA A;  4XH5 A;  4CF9 A;  4DSJ A;  3R9P A;  1LOT B;  3IS9 A;  1TAQ A;  1JCG A;  3LL3 A;  4LH5 A;  3PX6 A;  4B1V A;  5AQL A;  3J7Y P;  1NKE A;  4H5R A;  3UB5 A;  2YHW A;  2Z1J A;  4WFA L;  4KTQ A;  3HL8 A;  1P90 A;  4C8K A;  3THY A;  3LM2 A;  1NGI A;  5AZI A;  4CF2 A;  3GE1 A;  2QXL A;  4X64 K;  2XY7 A;  3IMX A;  4HWI A;  2D0P A;  1NG9 A;  3KLI A;  3O1W A;  1XMQ K;  1Z05 A;  4KH6 A;  1VSE A;  2BE2 A;  1ASV A;  2Q97 A;  3SV4 A;  1CXQ A;  4H0Y B;  4CFC A;  1HLU A;  4CHZ A;  2Q2R A;  3CI5 A;  1NGC A;  3DMJ A;  3AO2 A;  3NCI A;  1J9A A;  4OKJ A;  5FPE A;  4OGE A;  4IO8 A;  3P4I A;  3S3M A;  5LMU K;  1VQO N;  5AQM A;  3K5L A;  2DY4 A;  2FC0 A;  1YUW A;  3R6M A;  4FWK A;  1GLJ O;  5FLX O;  1K8A O;  2HHS A;  3RSE A;  3CPE A;  5ELZ A;  1OKJ A;  1BOT O;  4EP5 A;  1HNV A;  1VQN N;  4KB0 A;  1WAJ A;  3MX2 A;  3EZ5 A;  3HM9 A;  2E88 A;  4H0O A;  2ZJQ L;  4YOU A;  1BIS A;  4E7H A;  2NRZ A;  3CCV N;  4QS7 A;  4W5N A;  3L2V A;  4DMN A;  1RT5 A;  5DM6 L;  3BP8 A;  1GLC G;  3H6E A;  4M3Z A;  1W2B M;  1KLM A;  1SAZ A;  1L5U A;  1BA1 A;  3CMA N;  1C1A A;  3VTH A;  3J7Z O;  1ATR A;  3V6D A;  1XMO K;  4CGD A;  2O8F B;  1W97 L;  3E01 A;  1VRT A;  3CER A;  4BRG A;  1KXP A;  3D45 A;  4YOR A;  3HZ6 A;  2YHA A;  2IVP A;  1SL1 A;  3W3D A;  3LP2 A;  3NH2 A;  4FJ8 A;  1QQC A;  1IG9 A;  4H03 B;  4CGJ A;  5GIO A;  4KI4 A;  3NH0 A;  4BWM A;  2FSJ A;  3AVG A;  3HVT A;  1QE1 A;  2A3Z A;  3ID8 A;  3T1H K;  1VSF A;  4KBO A;  3HP9 A;  1N33 K;  3HPO A;  4O55 A;  5GAH P;  1S1U A;  4CFA A;  4IJN A;  1RFQ A;  4B8C A;  3MN7 A;  4ILJ A;  3CFO A;  4FWN A;  2OPP A;  4JKG A;  3F5T A;  3SAH A;  3MWT A;  3PLA A;  5AQN A;  5C0Y A;  3SQ2 A;  2VGM A;  3M8P A;  4FSV A;  1A5X A;  2YV0 X;  2A40 A;  3CQX A;  4DSK A;  2RPI A;  2E5L K;  2P1J A;  5BRF A;  2PYL A;  4O5F A;  5J2P A;  3T3F A;  4WQ4 A;  4IG0 A;  1VSH A;  1YIJ N;  4BR2 A;  3AA5 X;  4BVP A;  1KFS A;  1YJW N;  3DLR A;  4LF5 K;  3AO5 A;  4OLA A;  3WXJ A;  3AGK A;  2KTQ A;  3LPT A;  5K14 A;  4BE2 A;  4KHN A;  1JLG A;  4I9L A;  3G71 N;  3FZF A;  2HHH K;  4F3O A;  2YI1 A;  1JL1 A;  5CHI A;  1L3S A;  4AH9 A;  1SKR A;  1NJI O;  2KW4 A;  4AM7 A;  1IG8 A;  3UKU A;  3UE5 A;  4B3S K;  1IBL K;  2E20 A;  3VEO A;  4LD0 A;  1SKS A;  4H5T A;  3CFP A;  4CI6 A;  4Y0W A;  3P1G A;  4YY3 K;  3AVJ A;  3AVN A;  3O4W A;  5T7B A;  2OTL N;  3LDQ A;  4NCG A;  3IRX A;  4FYD A;  4E1N A;  2UUA K;  4CHQ A;  2HF4 A;  4RW9 A;  4FWR A;  1J5E K;  5DMR A;  3SPZ A;  4MLH A;  4AF1 A;  4BRK A;  1TVR A;  4CEB A;  4GY2 B;  4DSE A;  1ASW A;  3RRH A;  4CD3 A;  4CE9 A;  1U47 A;  4FOI A;  1RDC A;  2HBJ A;  4IOC L;  2G8W A;  4CHY A;  4OX9 K;  4FK2 A;  4BRO A;  4MO4 A;  4FL9 A;  5KI6 A;  1C0M A;  2D0A A;  3VGK A;  2QK9 A;  1YT3 A;  1JXE A;  1U48 A;  2P9S A;  4DV1 K;  1FXX A;  3HPH A;  1SL0 A;  4N47 A;  1VQ4 N;  1RBT A;  3N4Q A;  1JLB A;  1CZA N;  4N76 A;  1ZXO A;  3JSM A;  1VQ5 N;  4M3X A;  3IUC A;  1JL2 A;  1QQO A;  3LDL A;  3T19 A;  3HOT A;  3WXI A;  3L2R A;  4KO0 A;  1TKT A;  1FKP A;  2Q31 A;  3HST B;  1U2V B;  4IFY A;  4B8A B;  1TAU A;  1XHX A;  3C6U A;  5IT9 O;  3QBW A;  4YOY A;  2NRT A;  4CEE A;  1GLD G;  2H3G X;  2W42 A;  3OYH A;  1VSK A;  4GKJ K;  3AVK A;  4DU4 A;  3GBT A;  3MN5 A;  4AM6 A;  3L4I A;  4Z4H A;  4K8Z A;  1I94 K;  4BRA A;  3NGY A;  1D9F A;  1X9S A;  4ELT A;  3B8A X;  4JI2 K;  2IVO A;  3L6Q A;  2VYP A;  4A2A A;  1VQK N;  2G8F A;  2ITG A;  3L2Q A;  1ATS A;  1NOY A;  2DTU A;  3MK6 A;  5AQZ A;  3S9H A;  3RR8 A;  2ETJ A;  1H1V A;  5FRM A;  2QKK A;  4M63 C;  4JI1 K;  4FLX A;  3VEZ A;  3AA2 A;  4JK8 A;  3RVC A;  3SI6 A;  1NGJ A;  1BHL A;  3LAL A;  4FK4 A;  1W9H A;  1WAF A;  1NMN A;  1RDW X;  3ATV A;  4JKF A;  3MAQ A;  1D8Y A;  4TSX A;  3NGI A;  1JLE A;  3FE1 A;  4JKC A;  4H0P A;  3NF9 A;  1NGH A;  3AVA A;  4V19 S;  1U4B A;  3QEP A;  1YVU A;  1VAZ A;  4JHD B;  4RG8 A;  1SL2 A;  1BDG A;  3LPU A;  1S6P A;  1RBS A;  1XNR K;  3R3L A;  3KK3 A;  1OH6 A;  2FF6 A;  3AVI A;  4CEQ A;  2I5J A;  2OA8 A;  3OBW A;  3OS1 A;  5FPM A;  1LWE A;  4CCH A;  1HNX K;  4J2D A;  3U9Z A;  2F96 A;  4KHU A;  4KB1 A;  4FJ7 A;  4ZTF A;  2G8K A;  3CME N;  2HBM A;  4JKD A;  4BE0 A;  4W5O A;  4BDZ A;  2HHT A;  3MX5 A;  3TAP A;  1X3N A;  3O5B A;  3VQB A;  4BG9 A;  2E1Z A;  1LW2 A;  3VA0 A;  2YKN A;  3N4P A;  1K8K B;  5M1P A;  1IBK K;  4JI8 K;  4LY7 A;  4KHW A;  1Q9Y A;  2A41 A;  1NLV A;  2FBX A;  3AY9 A;  1RBR A;  1EKE A;  1SV5 A;  3EEQ A;  4DF4 A;  4HUF A;  2O8F A;  4DFK A;  4OJR A;  1L3U A;  3O9U A;  5HRR A;  1HYZ A;  3JAM O;  5KQD A;  1Q9X A;  1RDU A;  3CHW A;  3ULD A;  2ASM A;  2IDO A;  4R79 A;  2YHX A;  1DT9 A;  1TUY A;  4IOX A;  4MFB A;  4F8R A;  2RE2 A;  1HYV A;  3VQ5 A;  3DRP A;  3IDH A;  3OYM A;  5GAD P;  3SPY A;  4DFM A;  1OH5 A;  1LAV A;  3S3O A;  1EP4 A;  4JI4 K;  4W5Q A;  2KKZ A;  4AHS A;  3NMU A;  1N32 K;  3IG1 A;  5AQX A;  3OHR A;  3ZSX A;  5HBM A;  2P9N B;  1B9F A;  2F4V K;  5M1N A;  3MEG A;  1X9M A;  4ISF A;  1HNW K;  1O1W A;  4JI5 K;  4CD1 A;  2E2O A;  1JXB A;  4MO5 A;  3SUP A;  2ASP A;  3LZI A;  5BN8 A;  4CZI A;  3K9J A;  3K9K A;  2X78 A;  5KGX A;  3PX0 A;  2QI2 A;  5AQQ A;  4E1M A;  5FRN A;  3KK2 A;  4K8X A;  5A2Q O;  4YDU A;  2Q36 A;  2I7P A;  1QQM A;  4DR3 K;  5MLC Q;  3BF3 A;  3L8B A;  2IIR A;  3AAR A;  5LY3 A;  3H3N O;  4EZ9 A;  5E26 A;  1KD1 O;  1JJ2 M;  1BO5 O;  4J2B A;  4E7K A;  3VN5 A;  5CYQ A;  4DTM A;  4W5T A;  3CM5 A;  4LFB K;  1JKH A;  3R8E A;  1NM1 A;  3OYC A;  3M8R A;  3VQP A;  4IJA A;  1ASU A;  3L3U A;  4C1N K;  4LF7 K;  4Z0U A;  4O4G A;  4JKB A;  4KTW A;  4LSL A;  1O13 A;  4Z4I A;  4AHU A;  4UQG A;  2YHY A;  4XIU A;  4IOA L;  1CZB A;  3C65 A;  1KVB A;  4BRF A;  3TPQ A;  1KVC A;  4KRE A;  3C6T A;  2ZM6 K;  1DTT A;  3CCJ N;  3U6F A;  1VK0 A;  3HT3 A;  4E3S A;  3J8A A;  4C8M A;  3QET A;  3OYG A;  3OBY A;  4KPY A;  3CJA A;  5M1Q A;  3EN9 A;  3HJF A;  3WXL A;  4ISG A;  2YJF A;  1HKG A;  3I0S A;  2ASO A;  1S22 A;  3KWI A;  3LDN A;  1NJZ A;  3O1B A;  2OPR A;  3C7N B;  1WSH A;  3SUO A;  1WN7 A;  1D5A A;  2DFF A;  1IKY A;  1HQU A;  3RMB A;  3SQ1 A;  4Y1D A;  3LWM A;  3KLG A;  1Y64 A;  2VCP A;  4N41 A;  1YI2 N;  1R59 O;  2E1Y A;  2P9S B;  1NK8 A;  3H46 O;  3DXK B;  3EO3 A;  2V7Z A;  1VSL A;  3THW A;  1Q18 A;  4BR4 A;  3D0P A;  4DUY K;  3VQE A;  1IO2 A;  1I3A A;  1U2V A;  2ZGY A;  1EX4 A;  1V4T A;  1U04 A;  5HLF A;  1BUP A;  4FLY A;  2XHB A;  1ZBI A;  4CW7 B;  1NMD A;  4OPJ A;  3CCM N;  4DU3 A;  4CER A;  3S3N A;  1G15 A;  5FRO A;  3HPG A;  3ZT3 A;  2AA4 A;  1GLB G;  1GOA A;  3P31 A;  4C8O A;  1NKC A;  3F2K A;  4DQP A;  3V9U A;  1DEJ A;  4L8R B;  3HOS A;  4RW8 A;  1BL3 A;  5HRP A;  4C8N A;  2NRH A;  3OTO K;  3O3H A;  1T7P A;  2AJQ A;  4WF9 L;  2O8B B;  1WSF A;  3D7E O;  3DJC A;  3O3G A;  1MDU B;  4IZ9 A;  4NLB A;  3I33 A;  1MU2 A;  1ZBL A;  1IBM K;  1KTQ A;  3T7Z A;  1RBV A;  3P5J A;  3NH1 A;  4HUG A;  2P9L B;  3ZCM A;  1Z25 A;  3P83 D;  4OLB A;  5H1S Q;  3SJH A;  4XEI A;  3KTQ A;  2HMP A;  3A8Y A;  3AVH A;  4R5P A;  1SUQ A;  4AIL C;  4DQR A;  2QWM A;  4K0K K;  5BRH A;  2BGG A;  3D2E B;  3L0Q A;  3DLL L;  4E0D A;  4JHD A;  3PV8 A;  3TAR A;  3QDK A;  2YNH A;  3TAN A;  3CXC M;  1Z26 A;  1YHQ N;  2W40 A;  3ZSZ A;  2QWR A;  1TL3 A;  3O9Q A;  2HHQ A;  3OS0 A;  3LDP A;  5J2N A;  1RT4 A;  2ZQB A;  1EWR A;  4B1U B;  3QNO A;  4KHQ A;  3SMS A;  5F1X A;  4AHR A;  4H4M A;  4ILH A;  1HNZ K;  4O8K A;  1NWK A;  3QO9 A;  1ZBF A;  1B92 A;  2D0B A;  4JRQ A;  2G8V A;  4JK7 A;  2IC3 A;  2OYQ A;  4H5N A;  4FJJ A;  1OVQ A;  3HBT A;  5HRO A;  2WC9 A;  3SJJ A;  3TAB A;  3JYT A;  3CCU N;  1NJW A;  5BPM A;  3NF8 A;  1K8K A;  4RW6 A;  3F9M A;  1KLN A;  4LFC K;  4FVU A;  4CHN A;  4DTP A;  4IO9 L;  2HW3 A;  3O9S A;  2Y1J A;  1CXU A;  2V52 B;  2E4L A;  2IS3 A;  4JLH A;  1SQK A;  2O8D B;  3VER A;  3KJV A;  3DXM B;  3A5O C;  5AQU A;  1LW0 A;  2NUB A;  1NK7 A;  3TAE A;  3KD5 E;  1X1P A;  2ZD1 A;  4JRP A;  1S9E A;  2WON A;  3OY9 A;  4CEF A;  3ULE B;  4F2S A;  2HVI A;  2Z1G A;  2E6L A;  5ADX A;  1C0U A;  4ZTJ A;  5AQP A;  5E41 A;  1NGF A;  3VGL A;  3BGR A;  2GEL A;  4JI6 K;  3G4S N;  1HQE A;  3AO4 A;  2HOE A;  1BG3 A;  2LSN A;  4B1W B;  1C1C A;  1HKC A;  4A2B A;  4I2Q A;  3PY8 A;  3A5L C;  2P9N A;  1QTM A;  4CZJ A;  1UA0 A;  3QB0 A;  3HXM A;  1WSG A;  4EFH A;  4BDY A;  2GWJ A;  5AQW A;  1BCM A;  2OTJ N;  1TK8 A;  4PL8 A;  5AFU A;  1C0G A;  3SAG A;  3DM2 A;  4BRN A;  1LWF A;  4ID1 A;  5KQ8 A;  4FJH A;  2EX3 A;  3FGU A;  3TU5 A;  2P5G A;  2HHX A;  3MCP A;  4CEO A;  3H3O B;  5LMN K;  3ZX0 A;  3P38 A;  4FVM A;  2A1R A;  4NYN A;  1SKW A;  3DLB A;  1F21 A;  4A5A A;  4J2E A;  3K0S A;  2NZT A;  2IGI A;  4YOW A;  5LL6 Z;  3VMF B;  2O8C B;  3OW2 M;  3ZX3 A;  1IJJ A;  3ZSO A;  1HRH A;  4FW2 A;  5J1E A;  2ZJP L;  2A42 A;  4JS4 A;  1NGG A;  3VQA A;  1YVN A;  3V9X A;  3VA3 A;  2UU9 K;  3LAM A;  4FLT A;  4KH5 A;  2B4J A;  5HOO A;  4QOZ B;  4FWM A;  5M1K A;  1QSL A;  3VQ7 A;  3RTV A;  3NVK A;  4JKE A;  1K9M O;  3O08 A;  2X74 A;  4CED A;  2QM1 A;  2X6N A;  3ATU A;  1N34 K;  1RCH A;  2ZE2 A;  3ITH A;  2XRI A;  1M90 O;  3AAP A;  4DF8 A;  4DTU A;  4KI6 A;  3V4I A;  5JS2 A;  5AQY A;  3WNF A;  3G6E N;  1T05 A;  3QBX A;  4OGC A;  4LH4 A;  4EHU A;  2PFU A;  3TAF A;  3PUF A;  3C7N A;  3LDO A;  2VG5 A;  1NK0 A;  2BH1 A;  1NGE A;  1HX1 A;  3NHG A;  3U8X A;  2YNF A;  1NOZ A;  1S9G A;  3QEX A;  3L2U A;  4H4O A;  5C15 A;  2JWL A;  4W5R A;  2P9K B;  1REV A;  4H0X B;  1HPM A;  1JLF A;  3VQ6 A;  4DR2 K;  3RMD A;  4NB4 A;  3PIO L;  3DXK A;  5HP1 A;  4CZL A;  3MWP A;  4K42 A;  4DWI A;  3ENO A;  3V9Z A;  4CJL A;  3AVF A;  2QW9 A;  3DLG A;  3M8Q A;  4DV0 K;  3V9W A;  1TKX A;  3PSI A;  4QS8 A;  4JS5 A;  3EYZ A;  3THW B;  1XQS C;  1TKZ A;  2JWK A;  2YKM A;  4I9Q A;  4GV6 A;  4Z4F A;  2CH5 A;  3DAW A;  4MDB A;  4DSF A;  2R7Y A;  4YHH K;  4DQQ A;  4DTO A;  3NGZ A;  5EXW A;  2NRW A;  3AVM A;  2JGU A;  3DWL A;  3THX A;  1FKO A;  2WOM A;  3SV3 A;  3VQ8 A;  2UXC K;  3NDK A;  3VTI A;  4OPK A;  4FZZ A;  3CJ9 A;  4GKK K;  4FLW A;  1ZBH A;  2EWS A;  5AQJ A;  3CQ8 A;  1OH7 A;  2P5O A;  2O8B A;  3L4Q A;  1WLJ A;  1E4G T;  1T3V A;  4DTX A;  5EU7 A;  1RT7 A;  3CM6 A;  4YNQ A;  1ITG A;  1SS6 A;  3MMV A;  2V7Y A;  1U49 A;  3LM9 A;  5C42 A;  3C6A A;  3KLF A;  5TKY A;  4HVJ A;  4EHT A;  3TTC A;  3IFR A;  3KKS A;  4M7Y A;  5EOY A;  3R1X A;  2EHG A;  3DI6 A;  2V51 B;  2ITM A;  2P9L A;  1RDA A;  3LWL A;  1FK9 A;  3CG7 A;  3SUN A;  1XC9 A;  4CIE A;  3SZ2 A;  3VEV A;  4GNI A;  4O8U A;  3TAQ A;  5C12 A;  1NK9 A;  3BEX A;  4BGA A;  5C2D A;  1GLL O;  3EL2 A;  3D2E A;  4I6M B;  3VQ9 A;  4BR0 A;  1KFD A;  4E19 A;  1KAX A;  4GVE A;  1IKV A;  1J53 A;  2UYT A;  4PHT X;  2GUP A;  4L3Q A;  4ELV A;  4DTR A;  4BRL A;  1C0T A;  2Q3S A;  4EIA A;  4OKE A;  5FPD A;  5EY4 A;  3TWH A;  4RWT A;  3DOK A;  4DV5 K;  3VQQ A;  5TKW A;  1IKW A;  4RCH A;  4QCL A;  3AVL A;  4FK0 A;  4DG1 A;  2HHU A;  4CBW A;  3ZX2 A;  4CJW A;  4Z4C A;  2XY5 A;  5JLH A;  2QWL A;  4BWJ A;  4FJL A;  2HNZ A;  2P51 A;  1KC8 O;  1DGK N;  5KRT A;  3C94 A;  3F73 A;  3CCS N;  4FLV A;  4E7L A;  1TK5 A;  3C95 A;  4PKG A;  4XH4 A;  4NCA A;  4Z4E A;  4CZF A;  1FJG K;  3RMC A;  4B3T K;  4EAH D;  4LF6 K;  3CJB A;  5JLF A;  3AA3 A;  4CZG A;  3K58 A;  4B9N A;  4LF9 K;  3M1F A;  1ATN A;  2HBK A;  1JLQ A;  1BA0 A;  3DLH A;  1TL1 A;  2O8D A;  1BQM A;  2ZF5 O;  1NGD A;  1K73 O;  2P9I B;  3DXM A;  4B3M K;  2OZM A;  4FJM A;  4CJ7 A;  4CJS A;  1EO1 A;  4B9U A;  5BR8 K;  4G1Q A;  4A62 A;  4JNE A;  1YAG A;  5SZT A;  3BZC A;  3ULE A;  3KKR A;  2QXF A;  5I3U A;  4DS5 A;  5HRS A;  1BQN A;  4CJV A;  4CFB A;  3CJC A;  3H08 A;  4DQI A;  1EWQ A;  3OJS A;  1KRP A;  4NLC A;  5AQI A;  1Q86 O;  3EE8 A;  1JLA A;  3EKS A;  1MWM A;  4PKH A;  1EET A;  1S5J A;  3LAN A;  3FZK A;  3CJ1 A;  3KK1 A;  4CJE A;  1VQL N;  4DR4 K;  3KLE A;  3ZT0 A;  1ZBU A;  2FBT A;  4QAG A;  2OPS A;  2YX6 A;  3DRR A;  3HK2 A;  3LZJ A;  4FM1 A;  3CCQ N;  4CJK A;  4HHT A;  1LCU A;  1WSE A;  3VEY A;  4NCB A;  3E66 A;  3SUQ A;  4GVM A;  4DR6 K;  3NBP A;  3ZT1 A;  5DK5 A;  5DM7 L;  2RN2 A;  4BR5 A;  2QA4 N;  3VQD A;  2DFE A;  2UUB K;  4NXN K;  1X9J A;  3WNE A;  4DHY A;  5F2R A; 
#chains in the Genus database with same CATH homology
 3AA4 A;  4CGG A;  3O3G A;  3NAE A;  4B8C A;  4CHP A;  3WNG A;  3NFA A;  3DLK A;  1BI4 A;  4CJP A;  3CFO A;  1VSJ A;  3CYM A;  2XY6 A;  2OPP A;  1MU2 A;  1ZBL A;  4O0I A;  4N5S A;  3SQ2 A;  1KTQ A;  3M8P A;  4KFB A;  2VWJ A;  1LWC A;  1A5X A;  1RBV A;  3P5J A;  5CZ1 A;  3NH1 A;  2YV0 X;  4M45 A;  4FM2 A;  4DSK A;  4HUG A;  3OYB A;  3ZCM A;  3OYJ A;  2RPI A;  3TAM A;  1Z25 A;  2P1J A;  2PYL A;  3RRG A;  3ZSW A;  3P83 D;  4OLB A;  4CIF A;  5J2P A;  3QIP A;  5SWM A;  3T3F A;  3ASM A;  3O4Q A;  4IG0 A;  4WE1 A;  4FM0 A;  2KFN A;  3KTQ A;  1VSH A;  2RF2 A;  3AA5 X;  5KTQ A;  1KFS A;  1RDB A;  3AVH A;  4R5P A;  2G8V A;  2PYJ A;  1SUQ A;  2YNG A;  3DLR A;  1RTJ A;  4AIL C;  2GUI A;  4DSL A;  4DQR A;  3AO5 A;  2O4I A;  1TKD A;  1ZYQ A;  3PO5 A;  2BGG A;  4OLA A;  4E0D A;  1KVA A;  3TAR A;  3PV8 A;  1VSM A;  4KKO A;  2YNH A;  1TK0 A;  4FZY A;  3TAN A;  2KTQ A;  3LPT A;  5K14 A;  2Z1I A;  4Q5V A;  5CZ2 A;  1JLG A;  1Z26 A;  3U3G A;  4BE2 A;  4KHN A;  4I9L A;  4CES A;  3ZSZ A;  1TL3 A;  4Q0B A;  2HB5 A;  4F3O A;  2HHQ A;  1DLO A;  1JL1 A;  3NF6 A;  3OS0 A;  1L3S A;  4AH9 A;  3RWU A;  1SKR A;  5J2N A;  4QOZ B;  2KW4 A;  3B6O A;  1RT4 A;  2ZQB A;  1QSY A;  3DYA A;  3QNO A;  4J2A A;  4KHQ A;  4DQS A;  4FLZ A;  4FJX A;  4DTN A;  1J54 A;  4H4M A;  1HNI A;  4AHR A;  3SCX A;  1L3T A;  4LD0 A;  3QO9 A;  1SKS A;  1ZBF A;  1B92 A;  3LP3 A;  4CIG A;  4KHS A;  3AVC A;  2D0B A;  1TV6 A;  3I0R A;  3CFP A;  3SQ4 A;  3P1G A;  4OVL A;  3I8D A;  4FYD A;  3AVJ A;  3AVN A;  4JRQ A;  5T7B A;  3K59 A;  2IC3 A;  4NCG A;  3IRX A;  4N56 A;  4E1N A;  2BAN A;  4RW7 A;  4EP4 A;  2OYQ A;  4FJJ A;  1W0H A;  2D0C A;  4CHQ A;  3LP1 A;  5HRO A;  4RW9 A;  4I2P A;  3SJJ A;  3TAB A;  5DMR A;  4B9M A;  3SPZ A;  4CF1 A;  1S6Q A;  2KZM A;  3O4N A;  3JYT A;  1LAW A;  1NJW A;  4F3T A;  3OJU A;  3K5M A;  1TVR A;  3NF8 A;  4CEB A;  4DSE A;  1ASW A;  3RRH A;  4RW6 A;  3RR7 A;  4H8K A;  4CE9 A;  4M42 A;  3QLH A;  2A1S A;  1U47 A;  1N5Y A;  1KLN A;  1S1X A;  1RDC A;  4CHN A;  4DTP A;  2HW3 A;  4IKF A;  4B9S A;  2Y1J A;  2G8W A;  1CLQ A;  2BDP A;  2HHV A;  4M41 A;  4CHY A;  3QIO A;  4FK2 A;  1UAX A;  4E89 A;  5KI6 A;  1CXU A;  1C0M A;  2D0A A;  1B9D A;  2E4L A;  2IS3 A;  4JLH A;  1U45 A;  3KJV A;  2QK9 A;  1UOC A;  5HRN A;  1YT3 A;  1LW0 A;  4FCY A;  4PUO A;  2HND A;  1JXE A;  2NUB A;  1NK7 A;  1U48 A;  2HMI A;  3TAE A;  4M3U A;  1FXX A;  3HPH A;  3KD5 E;  1SL0 A;  4N47 A;  1X1P A;  1L3V A;  2ZD1 A;  3T1A A;  4JRP A;  1S9E A;  1RBT A;  2VG6 A;  2KZZ A;  3HYF A;  2WON A;  1JLB A;  4CEF A;  3OY9 A;  4GMJ B;  5J2M A;  4LSN A;  4E7I A;  3JSM A;  4N76 A;  4M3X A;  5D3G A;  3MEE A;  2B5J A;  4F2S A;  2HVI A;  2Z1G A;  4FJK A;  1JL2 A;  1S1T A;  1LV5 A;  3T19 A;  3ZSQ A;  2E6L A;  3V1O A;  1C0U A;  4ZTJ A;  1S1W A;  3L2R A;  3OYE A;  4KO0 A;  1TKT A;  3SYZ A;  1FKP A;  3HST B;  4IFY A;  4B8A B;  5FDL A;  5E41 A;  1XHX A;  4FJG A;  1TAU A;  3C6U A;  3LAK A;  4FJN A;  3BGR A;  4ICL A;  4O0J A;  2PZS A;  4CEE A;  1BIU A;  4FJ9 A;  3HO1 A;  1HQE A;  3AO4 A;  4F4K A;  3DOL A;  2W42 A;  2KQ2 A;  4I7F A;  3OYH A;  2LSN A;  3RMA A;  3F9K A;  5I42 A;  1VSK A;  1C1C A;  3A2F A;  1NK4 A;  3AVK A;  4DU4 A;  4I2Q A;  3AO1 A;  3PY8 A;  1WSJ A;  3G0Z A;  4B08 A;  3ZT4 A;  3CFR A;  1I39 A;  4Z4H A;  4K8Z A;  1QTM A;  3QEW A;  1UA0 A;  3NGY A;  4CJ3 A;  4FW1 A;  4CGI A;  1X9S A;  1T03 A;  1D9F A;  3HXM A;  4BDP A;  4ELT A;  1WSG A;  1NK5 A;  4M3T A;  5JS1 A;  4FLU A;  3ISN C;  4CK2 A;  1VSI A;  1RNH A;  3K5O A;  2G8F A;  1D9D A;  4BDY A;  1Q8I A;  2ITG A;  1QS4 A;  1BCM A;  3L2Q A;  1TK8 A;  1NK6 A;  1NOY A;  2DTU A;  1HJR A;  2QKB A;  1XWL A;  2FBV A;  4B9V A;  1GOB A;  3DM2 A;  3LP0 A;  3S9H A;  3RR8 A;  2ETJ A;  3MED A;  3QNN A;  1RT1 A;  2Y1I A;  1LWF A;  4ID1 A;  4FJH A;  5FRM A;  1BI4 B;  1K6Y A;  2EX3 A;  2QKK A;  1A5V A;  3G10 A;  2P5G A;  4DTJ A;  2HHX A;  4FLX A;  1BCO A;  3AA2 A;  4CEO A;  3SI6 A;  1BHL A;  3LAL A;  4IDK A;  4PA1 A;  1GOC A;  4FVM A;  2A1R A;  4NYN A;  4FK4 A;  1KSP A;  1W9H A;  1Y97 A;  1SKW A;  4RW4 A;  1F21 A;  3DLB A;  1WAF A;  1BGX T;  4HCB A;  2HNY A;  4J2E A;  2YHB A;  3AV9 A;  3OYI A;  4BE1 A;  4DLG A;  3MAQ A;  2IGI A;  3NE6 A;  1D8Y A;  3PX4 A;  1VRU A;  4TSX A;  4CGH A;  1RT3 A;  3K2P A;  3NGI A;  1JLE A;  4CJU A;  1UA1 A;  4CJR A;  4PQU A;  3ZSO A;  1T8E A;  4CGF A;  3NF9 A;  3AO3 A;  3AVA A;  1IKX A;  1HRH A;  4FW2 A;  1U4B A;  3QEP A;  2XO7 A;  1YVU A;  5J1E A;  3WNH A;  4JS4 A;  4KV8 A;  4HTU A;  3SNN A;  2OZS A;  4RG8 A;  3VQA A;  1SL2 A;  3V9X A;  3VA3 A;  3LAM A;  1RT2 A;  4Y1C A;  4FLT A;  2B4J A;  3LPU A;  3OYA A;  1RBU A;  1S6P A;  1RBS A;  4HUE A;  3U3Y A;  2O4G A;  1CZ9 A;  4DU1 A;  3OYK A;  3KK3 A;  5J2Q A;  1QSL A;  3AVI A;  3VQ7 A;  4CEQ A;  2I5J A;  2OA8 A;  3RTV A;  1N6Q A;  1RIL A;  3OYF A;  4CED A;  2X74 A;  3IAY A;  3OS1 A;  1VSD A;  4CFD A;  2XY8 A;  1LWE A;  2X6N A;  2HVH A;  4CCH A;  4IBN A;  1QSS A;  1BIZ A;  1RCH A;  3B6P A;  4CEZ A;  2ZE2 A;  2X6S A;  4ELU A;  3ITH A;  4J2D A;  2XRI A;  4DF8 A;  4DTU A;  3ZSY A;  4KI6 A;  3V4I A;  2F96 A;  1RTH A;  5JS2 A;  4B9L A;  4KB1 A;  4FJ7 A;  3WNF A;  4KHU A;  3ZSV A;  4ZTF A;  1T05 A;  2G8K A;  4FJI A;  2HHT A;  4OGC A;  4LH4 A;  4W5O A;  2B6A A;  4BDZ A;  4BE0 A;  3TAF A;  4DSI A;  3PUF A;  2VG5 A;  1NK0 A;  1JLC A;  3TAP A;  3NHG A;  4DTS A;  2YNF A;  3QEI A;  3VQB A;  3OYD A;  1NOZ A;  1S9G A;  3QEX A;  2GV9 A;  1LW2 A;  3SQ0 A;  3VA0 A;  2YKN A;  5CYM A;  1J5O A;  4LY7 A;  2ATQ A;  5KGW A;  3L2U A;  4H4O A;  4W5R A;  4KHW A;  3K57 A;  1REV A;  2G8I A;  1JLF A;  3VQ6 A;  4CF8 A;  3RMD A;  3ZT2 A;  1Q9Y A;  3V1Q A;  3AVB A;  1A5W A;  3V1R A;  5HP1 A;  4DWI A;  3KLH A;  4C8L A;  2FBX A;  1RBR A;  1NJX A;  3V9Z A;  1EKE A;  1SV5 A;  1NKB A;  1RT6 A;  4CJL A;  4DF4 A;  3AVF A;  4HUF A;  3DLG A;  4DFK A;  3M8Q A;  4OJR A;  3HP6 A;  1L3U A;  3V9W A;  1TKX A;  5HRR A;  1HYZ A;  4JS5 A;  3EYZ A;  2G8H A;  1TKZ A;  3UIQ A;  2YKM A;  1Q9X A;  4I9Q A;  4O5B A;  3ULD A;  4Z4F A;  3PO4 A;  4O44 A;  2IDO A;  3BDP A;  4DSF A;  2R7Y A;  2PY5 A;  4DQQ A;  2HHW A;  1HPZ A;  4DTO A;  4GW6 A;  3NGZ A;  4MFB A;  4F8R A;  3AVM A;  2JGU A;  4IG3 A;  1TGO A;  1FKO A;  2IAJ A;  2WOM A;  1HYV A;  3VQ5 A;  3VQ8 A;  4CJ5 A;  3DRP A;  4ZHR A;  3OS2 A;  3NDK A;  3SV3 A;  1RTD A;  3MXJ A;  4CJQ A;  3OYM A;  3L2W A;  3SPY A;  4DFM A;  4EZ6 A;  3OYN A;  1X9W A;  4PY5 A;  4IFV A;  4OPK A;  4CF0 A;  3LDS A;  4FZZ A;  4B3O A;  3KD1 E;  1LAV A;  3V81 A;  3S3O A;  2VG7 A;  4FLW A;  1EP4 A;  3FFI A;  4W5Q A;  1ZBH A;  1KCF A;  1DTQ A;  3CQ8 A;  4DS4 A;  4AHS A;  2P5O A;  3M8S A;  3IG1 A;  4BAC A;  1XI1 A;  1WLJ A;  2FBY A;  4CHO A;  4DTX A;  5EU7 A;  2IOC A;  1RT7 A;  3ZSX A;  3VQ4 A;  4HCC A;  3CM6 A;  4YNQ A;  1S1V A;  1ITG A;  5HBM A;  1B9F A;  1EXQ A;  1U49 A;  1QHT A;  5C42 A;  2G8U A;  4KAZ A;  2D5R A;  4DFJ A;  3MEG A;  1R0A A;  1IH7 A;  3OYL A;  4FJ5 A;  1X9M A;  3KLF A;  4F2R A;  4HVJ A;  4CJT A;  1O1W A;  4CFA A;  3TI0 A;  4Z4G A;  3QES A;  3K5N A;  1JXB A;  2E6M A;  3KKS A;  3SUP A;  2OPQ A;  3LZI A;  2EHG A;  4DLE A;  3DI6 A;  4CEA A;  4CF9 A;  4DFP A;  4DSJ A;  2DFH A;  5CY4 A;  3IS9 A;  1RDA A;  1TAQ A;  1FK9 A;  3LWL A;  4M3Y A;  3THV A;  3CG7 A;  2X78 A;  5KGX A;  3PX0 A;  4LH5 A;  3SUN A;  4CIE A;  1XC9 A;  4M3W A;  3EY1 A;  3PX6 A;  4E1M A;  3SZ2 A;  4KTZ A;  5FRN A;  1HYS A;  2F8S A;  1HMV A;  3KK2 A;  3TAQ A;  4K8X A;  3HVR A;  1NK9 A;  1NKE A;  4OKK A;  2Z1J A;  3VQ9 A;  4KTQ A;  1WSI A;  3L8B A;  3HL8 A;  4C8K A;  4FZX C;  1KFD A;  3NF7 A;  4E19 A;  4EZ9 A;  1IKV A;  1J53 A;  1C1B A;  5C24 A;  4CF2 A;  4J2B A;  4E7K A;  3VN5 A;  2XY7 A;  4ELV A;  4DTR A;  5CYQ A;  1RDD A;  4DTM A;  1C0T A;  2Q3S A;  3KLI A;  3CM5 A;  4W5T A;  1JKH A;  4OKE A;  3O3F A;  3M8R A;  3OYC A;  1YTA A;  3TWH A;  3VQP A;  1VSE A;  3DOK A;  1ASU A;  2BE2 A;  3L3U A;  3MXI A;  3VQQ A;  5C25 A;  4Z0U A;  3ALY A;  1ASV A;  1IKW A;  4KTW A;  4NYF A;  4LSL A;  4O4G A;  1CXQ A;  3SV4 A;  4QCL A;  3AVL A;  4AHU A;  3QER A;  4Z4I A;  4FK0 A;  2YNI A;  4CFC A;  4DG1 A;  4CHZ A;  4CEC A;  3MXM A;  2HHU A;  4UQG A;  4CK3 A;  4CJW A;  4XIU A;  1C6V A;  4Z4C A;  1CZB A;  3DMJ A;  2XY5 A;  3AO2 A;  3NCI A;  4BWJ A;  1KVB A;  1KVC A;  4KRE A;  1J9A A;  4OKJ A;  4OGE A;  3C6T A;  2HNZ A;  2P51 A;  4FJL A;  1DTT A;  5KRT A;  3S3M A;  3C94 A;  3F73 A;  3MEC A;  4FLV A;  1VK0 A;  3HT3 A;  4E7L A;  3C95 A;  4E3S A;  3U6F A;  1TK5 A;  4NCA A;  3VQC A;  4C8M A;  4Z4E A;  3DRS A;  3OYG A;  2FC0 A;  3K5L A;  3QET A;  3RMC A;  2DY4 A;  4KPY A;  2F8T A;  3HJF A;  3DLE A;  3AA3 A;  2HHS A;  3I0S A;  3K58 A;  4B9N A;  1NJZ A;  4CK1 A;  2OPR A;  1JLQ A;  4EP5 A;  1WSH A;  1HNV A;  3DLH A;  3SUO A;  4KB0 A;  1D5A A;  2DFF A;  1TL1 A;  1WN7 A;  1BQM A;  1WAJ A;  3EZ5 A;  1IKY A;  4MQ3 A;  3HM9 A;  1HQU A;  3RMB A;  3SQ1 A;  1WNS A;  1BIS A;  4E7H A;  2OZM A;  4Y1D A;  3LWM A;  3KLG A;  4FJM A;  4E7J A;  4W5N A;  4M3R A;  3L2V A;  4CJS A;  4DMN A;  4B9U A;  1RT5 A;  3V9S A;  4G1Q A;  4FXD A;  4N41 A;  2KFZ A;  5SZT A;  4B9T A;  4CJF A;  4M3Z A;  4KHY A;  4PWD A;  3KKR A;  1KLM A;  2VWK A;  2QXF A;  1NK8 A;  3QEV A;  5I3U A;  4DS5 A;  5HRS A;  5KRS A;  1BQN A;  4CJV A;  3TR8 A;  4CFB A;  1VSL A;  3H08 A;  1L5U A;  4DQI A;  3D0P A;  1UWB A;  4KRF A;  1C1A A;  3V6D A;  3VQE A;  2JLE A;  1IO2 A;  1I3A A;  3ZSR A;  3OJS A;  4CGD A;  1EX4 A;  1KRP A;  3E01 A;  1VRT A;  1U04 A;  1JLA A;  3D45 A;  5HLF A;  4FLY A;  2XHB A;  1ZBI A;  2GBZ A;  4OPJ A;  3OVN A;  3TAG A;  2YHA A;  2RKI A;  1EET A;  1S5J A;  3KIO A;  3LAN A;  4YFU A;  4DU3 A;  1SL1 A;  4CER A;  3QIN A;  3KK1 A;  4ID5 A;  3S3N A;  4CJE A;  1RTI A;  1G15 A;  5FRO A;  3KLE A;  3HPG A;  2Z1H A;  3ZT0 A;  1ZBU A;  2FBT A;  2OPS A;  3LP2 A;  4QAG A;  3ZT3 A;  1GOA A;  3DRR A;  3NH2 A;  3LZJ A;  1XHZ A;  1QQC A;  4FM1 A;  1NKC A;  1IG9 A;  4C8O A;  4FJ8 A;  3HK2 A;  4CJK A;  4HHT A;  1WSE A;  4CGJ A;  4DQP A;  4NCB A;  4KI4 A;  3NH0 A;  3V9U A;  3L3V A;  4AHC A;  3SUQ A;  4GVM A;  4L8R B;  4BWM A;  3AVG A;  4RW8 A;  1BL3 A;  3HVT A;  5HRP A;  4C8N A;  3NBP A;  1QE1 A;  4AHV A;  1NJY A;  3ZT1 A;  5DK5 A;  4CJ4 A;  1VSF A;  2RN2 A;  3VQD A;  3O3H A;  2DFE A;  1YTU A;  3HP9 A;  3HPO A;  4O55 A;  3WNE A;  1T7P A;  2AJQ A;  1S1U A;  4AHT A;  1WSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...