4O0JA

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[4-(4-chlorophenyl)-6-(3,4-dimethylphenyl)-2,5-dimethylpyridin-3-yl]ethanoic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
140
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Multimerization Selective Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 49
structure length 140
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0jA00
2OPQA 3SV4A 3QEIA 1SKRA 3CG7A 1D9FA 1NK4A 4CEFA 4DTOA 4RW6A 4LH5A 1KVAA 1X1PA 1ASWA 3K57A 4CGIA 3NFAA 1KVCA 4C8MA 2VG7A 2FBTA 1RT7A 4AILC 4BWMA 1NKCA 4C8LA 5J2MA 1KRPA 1QS4A 4B8CA 2OYQA 4LSLA 3A2FA 4KTZA 4CESA 4H8KA 3KLFA 3U6FA 4EP4A 4OGEA 3VQ7A 1LWCA 3OS2A 4FJ7A 3DLEA 4CFAA 4N76A 3I0RA 4AHRA 4I9LA 2XHBA 1HQUA 1Z25A 3NF7A 3QIPA 3QO9A 3JYTA 3DLBA 4J2DA 4CK1A 4DF8A 4KREA 3NGYA 3LZJA 3V81A 4O44A 4Y1DA 4HUGA 4KAZA 3DOKA 5FRMA 2IOCA 5J1EA 5J2QA 1S1TA 1WSIA 1RTIA 3BGRA 4L8RB 2WOMA 4CFBA 3LPUA 2IS3A 1BISA 1DLOA 3AVHA 4N5SA 4JS5A 1S9GA 5HRSA 3DRSA 3OYIA 2Q3SA 2RKIA 3PUFA 2A1RA 1L5UA 1TKTA 1NK8A 4HUEA 4DQPA 2E6MA 3THVA 4CGGA 4KHYA 3HPGA 1BGXT 1KLMA 4FJKA 1ZBFA 3AO2A 4PY5A 4ZHRA 3OYMA 3AVMA 3ZT4A 1IKYA 4WE1A 4F4KA 2GBZA 2KQ2A 3KKSA 2KTQA 2XY7A 4FK0A 3NAEA 1BI4A 1I3AA 1EX4A 3D0PA 4ICLA 3M8PA 4BWJA 4YNQA 3OYDA 4DTXA 4DTRA 3HJFA 1EXQA 3ZSWA 3SUOA 2G8VA 2OZSA 2FBYA 4G1QA 4HCBA 3LPTA 1Q9YA 1IKWA 3LAMA 4CHZA 3KLHA 3T1AA 1JLCA 4F3TA 4DMNA 3IG1A 4AHVA 3OYHA 4DLEA 1J5OA 3NGIA 3ZT0A 4MQ3A 1BCMA 4E19A 4HCCA 3ZT3A 3QEPA 2OA8A 2VG6A 3IRXA 4CHPA 3LP1A 2P1JA 1VSJA 3KJVA 2B5JA 1D8YA 1FKOA 1D9DA 1C1AA 1QSLA 1JKHA 4Z4GA 1HPZA 2ZD1A 3I8DA 4FJNA 3MAQA 3OYEA 1UWBA 1HMVA 3LALA 2G8UA 4CF0A 3ASMA 3MEEA 2YKNA 3O4QA 4LSNA 3SV3A 3QLHA 4RW8A 3AVJA 1C0MA 1TKZA 4FCYA 3SUNA 1UAXA 3O4NA 1SL0A 4K8ZA 5C42A 3AO5A 4CEEA 4W5OA 3PV8A 3KD1E 2XY6A 3QEXA 1RBRA 1XI1A 3OYGA 1O1WA 3EYZA 4QCLA 2P5OA 1IKVA 3H08A 3RWUA 4KHWA 1FK9A 4DS5A 2XY5A 3RR7A 1C1CA 2E4LA 3AO1A 4KTWA 3KLGA 3V9ZA 3L3VA 3OYJA 2X6NA 1NJXA 1L3UA 1TAUA 1A5VA 3DLHA 2XO7A 1TAQA 2I5JA 2G8FA 3MXIA 3LWLA 3VA0A 1XC9A 1HNIA 1UOCA 4CJFA 1VRUA 3TABA 4IG3A 1BCOA 3F73A 2A1SA 3AO3A 3ZSRA 3K5OA 1REVA 1TGOA 1SKWA 3AA2A 3VQ6A 4BACA 4KRFA 3KTQA 1FKPA 2KFZA 4F2SA 1TKDA 3HVTA 5DMRA 1JLQA 3VQDA 3OYAA 4DTPA 2W42A 3ZSYA 2OZMA 1U49A 3NH0A 5CZ1A 1RDCA 4M42A 4Z4EA 2HHXA 4ELVA 1IH7A 4RG8A 2D0AA 2GUIA 4CJ3A 3RMAA 4FJJA 4TSXA 1W0HA 2EHGA 4CK2A 2E6LA 1UA0A 2FC0A 4B9VA 4NCAA 2F8TA 4CECA 3PX0A 1A5WA 3MEDA 2PY5A 2BGGA 5K14A 4E7LA 3LP3A 4FZZA 3CM6A 3O3FA 1JXEA 2EX3A 1K6YA 2YNIA 4I2QA 3WNEA 1B9DA 5SZTA 1SV5A 3KK1A 3NHGA 4DSIA 4FJXA 3HO1A 2VWKA 4ID5A 3SPZA 2QKBA 2KFNA 3VQ4A 1CZBA 1NK6A 2XY8A 4PWDA 4CEQA 1LAVA 2P5GA 4UQGA 2IAJA 3QEWA 3T19A 3AVGA 2HNZA 1RBSA 3HSTB 3V1QA 4B08A 1WSEA 5KGXA 4DS4A 5HRPA 3MECA 1HYVA 1VSIA 3SJJA 3HVRA 2WONA 3QNOA 4DFKA 2IDOA 5EU7A 4DU4A 1KCFA 5D3GA 3F9KA 3NH2A 4JS4A 4W5NA 3SQ2A 3SYZA 3M8QA 2QK9A 1YT3A 1B92A 3V9XA 3V1RA 2X6SA 2HHTA 2HHUA 1JL1A 5DK5A 4BDYA 1S6QA 4GW6A 4DQIA 2ATQA 3V6DA 2DFHA 1S1WA 3WNGA 1RT3A 1NK0A 4CJWA 3NBPA 3SUQA 3S3MA 1U4BA 4CHNA 4DLGA 3DRRA 1S6PA 3SZ2A 2JGUA 4KV8A 1T03A 1NJYA 4CIEA 4OGCA 1LV5A 2QXFA 2RF2A 4W5TA 4KHQA 4OKJA 4CFDA 1KVBA 2BE2A 1NK7A 1CZ9A 4KPYA 4IFVA 4CJRA 1NK5A 4DSEA 2F96A 4JLHA 3PO4A 3LANA 3RTVA 1Q8IA 4CJLA 1ZBLA 1L3VA 4NYFA 3SQ0A 4M3XA 2DTUA 1D5AA 1QE1A 4B8AB 2BDPA 4XIUA 3DYAA 3V9WA 3MEGA 4HUFA 2YNFA 2HHWA 1WLJA 3DLKA 4E7HA 1XHZA 4Z4CA 4JRPA 3TANA 1LW0A 2ITGA 2RPIA 4OKEA 1X9WA 3VQBA 4J2AA 2PZSA 3DI6A 4DG1A 2ZQBA 3AVKA 4E89A 3CFRA 4E1NA 1S1UA 1ZYQA 2KW4A 1RTJA 4CJ5A 1WNSA 2DFEA 4CHQA 4CF8A 3OYFA 3TWHA 4CJPA 4E3SA 4FXDA 3OS1A 3LZIA 1BIUA 3S3NA 4J2EA 5I42A 4I9QA 3G10A 1Z26A 3E01A 4N47A 3OYKA 3VQCA 3PX6A 2HVHA 3NH1A 4OPJA 3B6PA 4FLWA 3OJUA 3PX4A 3HYFA 3NGZA 4FW2A 4CGHA 3HK2A 1HNVA 3MXJA 4KO0A 1F21A 4DTUA 5SWMA 1TL1A 1ZBUA 3V9SA 3QIOA 1S9EA 4NCGA 4DFMA 4Z4IA 2HB5A 4AHSA 4IG0A 3VQQA 4CJTA 3M8RA 4KHNA 2NUBA 3EY1A 4C8KA 4EZ9A 4DU1A 2IGIA 3HP6A 1C0UA 1GOCA 3CFOA 4I7FA 5KI6A 3HT3A 1NJWA 1L3TA 3LWMA 2B6AA 4KI4A 1VSKA 4M3ZA 2HMIA 4IBNA 3TARA 4M3TA 4FJHA 1TK8A 4DTJA 1NOYA 4CF1A 2Z1IA 4O5BA 5T7BA 2G8IA 4DFJA 1U47A 4Y1CA 3L2QA 4R5PA 4J2BA 1RCHA 3ALYA 1EKEA 4DF4A 4Z4FA 2DY4A 1C6VA 2G8WA 5JS1A 4B9MA 4CEBA 4OPKA 3K59A 3L2VA 4IFYA 4OKKA 5FDLA 4F3OA 2BANA 3ZCMA 4CHYA 4BDZA 3AA4A 1KLNA 5C25A 4I2PA 5J2NA 4M3WA 3KK2A 2VWJA 4FJIA 1BHLA 3ZT1A 4AHUA 4E7JA 3OY9A 1U48A 2FBXA 1RBUA 4B3OA 4JRQA 1TVRA 4CEOA 4Q0BA 4HVJA 2Z1HA 3AV9A 3AVNA 3QEVA 1N6QA 4BDPA 4KHSA 1DTTA 3AVBA 3KLIA 4FM1A 4C8NA 1KTQA 4CJKA 1Q9XA 1C0TA 3ZT2A 3HM9A 3ZSOA 1JL2A 4B9TA 1RT4A 1U04A 1RNHA 2YNGA 3U3GA 1JLGA 4CE9A 4EZ6A 1RDBA 3ITHA 4CGDA 1JLBA 1N5YA 3VQAA 2YHAA 2R7YA 1X9SA 4K8XA 5HBMA 4CIGA 3NF6A 1T05A 1RTHA 3DLRA 3QNNA 3L2WA 1HQEA 4GMJB 1VSLA 1JLFA 4E1MA 5I3UA 3DOLA 1ZBHA 1RT1A 3OJSA 4O0IA 1RBVA 4KB1A 2HW3A 2Z1JA 3ZSQA 3HP9A 3P1GA 4DTNA 1CXUA 1LWFA 4FZXC 3DM2A 3VN5A 3WNHA 2Y1IA 4F8RA 3RR8A 3AVLA 4DSJA 5JS2A 4FJ8A 4FYDA 4DFPA 4FJLA 3QERA 1RT2A 1GOAA 4Z0UA 1CLQA 2O4IA 3OVNA 4IDKA 4RW7A 3AO4A 2PYLA 3TAQA 2KZZA 4PA1A 3C94A 3MXMA 1HYZA 1VSEA 1NKBA 3O3HA 3DLGA 1ZBIA 3AA3A 4FLXA 1TV6A 1TL3A 1MU2A 1WN7A 4FLZA 4O4GA 3B6OA 4MFBA 3L2UA 3TAEA 3SUPA 3V1OA 1B9FA 3OYLA 5HLFA 1X9MA 5KTQA 5CY4A 4FW1A 3ULDA 3C95A 3ZSXA 1IO2A 1LAWA 4RW9A 4DSLA 1SL1A 1JLEA 3IS9A 4GVMA 3JSMA 1L3SA 1QSSA 4NCBA 4Q5VA 4HTUA 4ZTFA 4EP5A 3TAGA 3M8SA 1RDDA 4KHUA 2X74A 1RT5A 1EP4A 4HHTA 1SL2A 1S5JA 3TR8A 4N41A 4KKOA 4DU3A 3TAMA 1RILA 1YTUA 3KD5E 2ETJA 3VQ5A 3O3GA 1VRTA 3C6TA 3KLEA 1VSFA 1WSJA 1WSHA 3FFIA 3VQ8A 4CEZA 3OYNA 3V4IA 4FJ9A 3ZSVA 1R0AA 4M3YA 2G8HA 2RN2A 3LP0A 1RT6A 1VSMA 1BL3A 3AA5X 4CJ4A 3RMCA 2QKKA 4FM2A 1VSDA 4KTQA 2D0BA 4CJUA 1JLAA 4CK3A 3T3FA 4AHCA 4FJGA 4M3RA 4QOZB 1U45A 1RTDA 3ISNC 3WNFA 1S1VA 3NF8A 1J53A 4DQRA 4OVLA 3D45A 5CYQA 4CJSA 1QTMA 1VK0A 1XHXA 3K2PA 4ID1A 2JLEA 1WAJA 3HXMA 4CCHA 1HYSA 2HNYA 2YNHA 4CJQA 3EZ5A 3CQ8A 4BE1A 1VSHA 1J54A 2P51A 3HL8A 3K5LA 3LP2A 3S9HA 1ASVA 3LAKA 3LDSA 2O4GA 3IAYA 3KK3A 3C6UA 3SQ4A 1WSGA 1S1XA 4CF9A 2G8KA 1SUQA 4DTSA 4DWIA 1GOBA 4CEDA 3AVIA 2KZMA 4DSFA 4FM0A 1FXXA 3DRPA 3QINA 5HRNA 1QSYA 3P83D 4O55A 4N56A 4H4MA 1JXBA 3SPYA 4E7IA 3S3OA 2YV0X 4DQSA 5HROA 4ELTA 4AH9A 5KRSA 3UIQA 1TK0A 1ITGA 3NE6A 4Z4HA 2B4JA 4B9SA 4CGJA 4CF2A 4DTMA 2X78A 3K5MA 1RBTA 1BI4B 3HPOA 1BQMA 2OPRA 4FVMA 4FK4A 3V9UA 1UA1A 2OPSA 4OLAA 1NOZA 5KGWA 3VA3A 5J2PA 4QAGA 3NF9A 4OJRA 4CIFA 1HJRA 3TI0A 2FBVA 1G15A 1CXQA 4LH4A 3VQEA 1NK9A 1IKXA 1T7PA 4KI6A 3OYCA 4PQUA 5C24A 4CHOA 2ZE2A 1C1BA 3L2RA 3NDKA 4CFCA 3OS0A 4IKFA 5CZ2A 3VQPA 3AVAA 2LSNA 4FK2A 4DSKA 4E0DA 3CFPA 4E7KA 3TAFA 4ZTJA 1WAFA 4BE2A 3RRHA 3CM5A 3RRGA 1KSPA 4FJMA 2IC3A 2GV9A 1LW2A 4FZYA 3RMBA 4W5QA 4KB0A 4CGFA 1ASUA 3L8BA 4ELUA 3QETA 3KKRA 4B9UA 3CYMA 4NYNA 4W5RA 4M45A 3SCXA 1IG9A 4LD0A 3AVFA 1J9AA 4OLBA 2YHBA 2XRIA 1DTQA 3PY8A 1HRHA 1I39A 1BQNA 1KFDA 1XWLA 4YFUA 3SQ1A 3TAPA 5E41A 5HP1A 1NJZA 2D5RA 3KIOA 2HVIA 3SNNA 3QESA 3HPHA 5FROA 3NCIA 2HNDA 4PUOA 5FRNA 2HHQA 1LWEA 4CJEA 4FJ5A 3AVCA 3K5NA 4LY7A 1WSFA 4FLUA 1TK5A 1TKXA 1KFSA 1EETA 4M3UA 3DMJA 3BDPA 3L3UA 2OPPA 3K58A 1T8EA 3SI6A 4O0JA 3PO5A 1BIZA 4FLYA 4BE0A 4H4OA 4FLVA 1W9HA 1Y97A 4KFBA 3I0SA 4RW4A 3OYBA 3RMDA 5KRTA 2Z1GA 5HRRA 4B9NA 4CJVA 4DQQA 1SKSA 2HHSA 1RDAA 2Y1JA 1NKEA 3ZSZA 4F2RA 2HHVA 2YKMA 4FLTA 2VG5A 3VQ9A 4AHTA 3U3YA 2F8SA 5CYMA 2AJQA 1A5XA 4CERA 4C8OA 1QQCA 4CEAA 3G0ZA 4B9LA 1YVUA 2PYJA 3P5JA 2DFFA 4M41A 1YTAA 2D0CA 1QHTA
chains in the Genus database with same CATH superfamily
1GLAG 3QEIA 1KQSM 4RW6A 2AA4A 4LH5A 1X3MA 4NO7A 3K57A 1C0GA 4AILC 1NKCA 2OYQA 3A2FA 4KTZA 3CCQN 4CESA 1N32K 3OBYA 3I0RA 4K41A 1K8KA 3NF7A 4H03B 5GIOA 4DF8A 3NGYA 4JKHA 4Y1DA 5DM6L 5FRMA 1S22A 3CCEN 5J1EA 4GV9A 5J2QA 4L8RB 1RFQA 3ULEA 2F9WA 3EE9A 3CHWA 1TKTA 1NK8A 1OH5A 4DQPA 2W6LA 1JJ2M 3THVA 4KHYA 1BGXT 4FO0A 4JKBA 4A5BA 3VETA 2BUPA 4FK0A 1BI4A 3WT0A 3M8PA 4JI3K 3SJHA 4H5TA 2G8VA 2OZSA 5C0YA 4WQ4C 3EN9A 3LAMA 3E9LA 3OYHA 1BCMA 4FWSA 3QEPA 1YUWA 2VG6A 3IRXA 2P1JA 1VSJA 3KJVA 4Z4GA 1NGIA 4DUZK 3LALA 1RGIA 2A42A 4HTLA 4V19S 2QWPA 1SL0A 3O4NA 4IO8A 4W5OA 3KD1E 4ILHA 3VEWA 1O1WA 1IKVA 3VPZA 1FK9A 4DS5A 1C1CA 2E4LA 4KTWA 4YOXA 3OYJA 5EOYA 2XO7A 1TAQA 1NG9A 1BWFO 3LWLA 3VA0A 1HNIA 3O9TA 2A1SA 4AM6A 1REVA 5BRFA 1TGOA 5JICA 5GAEP 1TKDA 3O80A 3OYAA 3SBTA 1WBBA 4CZLA 3MN6A 4J8FA 4M42A 1C0FA 5HOOA 4MO4A 1SAZA 4CJ3A 1P8ZA 4IZ9A 2P9PB 3U9DA 1UA0A 3KZBA 5AQXA 2HBMA 4E7LA 3E9PA 4FZZA 2P9NA 4I2QA 4FJXA 3KK1A 1E3MA 3AAPA 3HO1A 3CQXA 2VWKA 3VQ4A 3MMVA 3VF6A 4PWDA 2XY8A 4CEQA 3FGUA 4UQGA 3V1QA 1VAZA 4MLHA 3MECA 3HVRA 2WONA 4DFKA 2IDOA 5EU7A 4JS4A 3M1FA 1YT3A 1WOQA 5C15A 5HL7L 3V9XA 2X6SA 3LM9A 5DK5A 4BDYA 1S6QA 3GDQA 3VEOA 2D4WA 2ZGYA 4DLGA 1NJYA 2YI1A 4OGCA 3GOIA 4JHDA 4KHQA 5M1FA 1NK5A 3PO4A 2GX9A 3G25A 4CJLA 4NYFA 3SQ0A 2DTUA 4CZFA 4XIUA 4GVEA 3CCJN 3V9WA 3MEGA 3GG4A 4E7HA 5AFUA 4IJAA 5LMNK 1Z05A 1X9WA 2P9UB 3DI6A 4DG1A 4E89A 1O13A 4E3SA 3UKUB 3OS1A 5H1SQ 3S3NA 4N47A 4H5VA 3NH1A 4FLWA 3OJUA 3FLCO 4FW2A 3D2FB 1VQ5N 3MXJA 1F21A 3J7YP 3DXMA 2HB5A 4AHSA 4IG0A 4C23A 2E1YA 4FWMA 2O8CA 3O1WA 3P31A 2NUBA 3T1YK 3H45C 3QFUA 3OTOK 2A5XA 1C0UA 1L3TA 3LWMA 2Z1IA 3FZKA 2UU9K 4RTFD 3H6EA 5JVHL 3SK3A 4J2BA 1EKEA 2G8WA 4BREA 5JS1A 4H0PA 2KHOA 4A2BA 1Z6RA 2BANA 3R3LA 3ZCMA 4CHYA 4FJIA 3ZT1A 4E7JA 4AHUA 1NNEA 5CE3A 1RBUA 4B3OA 4JKGA 4KHSA 3KLIA 1KTQA 3ZT2A 1T6DA 2P9KB 1JL2A 3IUCA 1U04A 1RNHA 4DR3K 4GNIA 1RDBA 3ITHA 4EHUA 4B3SK 2A6AA 1X9SA 4CIGA 3NF6A 1T05A 3O4WA 3H46O 4GMJB 4E1MA 1FJGK 1ZBHA 4LF9K 3OJSA 4KB1A 2HW3A 2Z1JA 4YOTA 1CXUA 2QW9A 3DM2A 3QERA 2PYLA 2O8DA 2Q0RA 1GLBG 3MXMA 1NKBA 4BRIA 3O3HA 3HOTA 4FLXA 4JNEA 3THWB 2P9IA 1W97L 1MU2A 3WXMB 1WN7A 3LDQA 4FLZA 2UXCK 1MWKA 3L2UA 3SUPA 3OYLA 1B9FA 5AQIA 5HLFA 4JI8K 5KTQA 2CGLA 4MDBA 3ZSXA 4YOYA 1JLEA 1VQ7N 4IDHA 5AQZA 4ZTFA 2KKZA 3M8SA 4FOIA 1EP4A 2CH5A 4KKOA 1YTUA 3VQ5A 3O3GA 3C6TA 1WSJA 1WSHA 4FJ9A 3FFIA 1OH6A 2QWMA 3LP0A 5C12A 5AZIA 4WFNL 1VSDA 4KTQA 4KBOA 4CJUA 3PIOL 3K9JA 1HNWK 1U45A 3O9QA 4CBWA 1J53A 4OVLA 1K8KB 1WAJA 3HXMA 1HYSA 4CJQA 2YNHA 1DT9A 1N5YA 3WXJA 3HL8A 3K5LA 5AQNA 4FVUA 1ASVA 3LAKA 2O4GA 3IAYA 3KK3A 4H0OA 3VF2A 4BRKA 3FZMA 4CF9A 3ULEB 4DTSA 2VQFK 3ENBA 4L3QA 1FXXA 4FM0A 2PFUA 4IXCA 3SPYA 2YV0X 4CZEA 3CF5L 3VEXA 4AH9A 4Z4HA 4BRDA 5E84A 1J6ZA 4KH5A 4CGJA 1QVGM 2X78A 1RBTA 1BI4B 3HPOA 3WXIA 4IOXA 4PKHA 3TI0A 2P9SA 3A5OC 2FBVA 3VQEA 4ILGB 4JV5K 3CERA 4KI6A 3I33A 5C24A 2ZE2A 4PKGA 3NDKA 4FK2A 4E7KA 3GL1A 3VTHA 4BE2A 1ZBSA 4BR5A 1Q7YO 3EKSA 4YOVA 4FZYA 3ENHA 3UB5A 4KB0A 1D4XA 4CGFA 1IBMK 3CYMA 2PAVA 1BDGA 4H0TB 4BQZA 3AVFA 1J9AA 2FSKA 4IOCL 2XRIA 2WUSA 4YFUA 5E41A 4XH1A 3KIOA 4PL7A 2HVIA 4CJEA 4EIAA 1TK5A 1WSFA 4Y0WA 1TKXA 1OVYA 3L3UA 3B8AX 1T8EA 3N4PA 4FWNA 2UYTA 1BIZA 4NLBA 2E2PA 1N33K 4FLVA 4A5AA 4DHYA 1W9HA 4RW4A 3SLCA 3RMDA 4KH4A 4CJ7A 2HHSA 1SKSA 2Y1JA 1NKEA 4O8KA 2AJQA 1A5XA 3AGKA 1YVUA 2VGMA 3SMSA 3P5JA 2PYJA 2DFFA 3VTIA 2D0CA 2OPQA 2ZF5O 3SV4A 2QA4N 1D9FA 2V52B 4B1YB 1JCFA 3O5BA 4BROA 4FWLA 3OW2M 2QWRA 3NFAA 1KVCA 4O8UA 2FBTA 1RT7A 4K43A 5J2MA 2P9NB 1QS4A 3E66A 1LWCA 4N76A 2XHBA 1Z25A 3JYTA 5JMVA 4O44A 4JKEA 1JCEA 2UXBK 1YITN 1RTIA 3BGRA 3AVHA 1QQOA 3OYIA 5HRSA 4FPAA 2YHYA 2E6MA 1OKJA 3HPGA 3CMEN 4FJKA 3FFKB 1I94K 3AO2A 3IKMA 4H5NA 4ZHRA 1BG3A 3OYMA 5ELZA 3MX5A 4WE1A 3KKSA 2IVOA 3NAEA 1MDUB 1GLCG 3I8BA 4ICLA 1QQNA 4M7XA 4BWJA 4JHDB 4BVPA 1EXQA 3E1YA 4G1QA 3LPTA 4CHZA 3KLHA 4DMNA 3NGIA 3ZT0A 4E19A 4NXNK 4FWPA 3ENOA 3FE1A 1ATNA 1VQMN 1HPZA 3I8DA 3BP8A 4H5RA 5JLFA 3MAQA 3BZCA 3OYEA 4CF0A 4LSNA 3MEEA 2YKNA 3O4QA 2I7PA 4RW8A 1K73O 3CETA 1M1KO 3U8XA 1GLFO 1XI1A 3OYGA 3H08A 3W3DA 3C0BA 3DXMB 3RWUA 4KHWA 1NGBA 3A0IX 2O8CB 1YIJN 2X6NA 4IEEA 3DLHA 4FWOA 5AQVA 3MXIA 1NGCA 1UOCA 3TABA 3F73A 4CBUA 3AO3A 5GADP 3KK7A 4CZJA 1IJJA 3AA2A 2YCHA 4F2SA 3BZKA 3HVTA 1JLQA 2W42A 1U49A 3FZHA 1NGFA 4ELVA 4RG8A 4IOAL 2D0AA 3C7NA 2E6LA 5GAGP 3BF1A 4G9ZA 3VGMA 5FPDA 4CECA 1XMQK 3MEDA 2PY5A 2D1KA 5AQTA 5K14A 3MX2A 3LP3A 3O3FA 5JVGL 1GLJO 1B9DA 4DSIA 3GBTA 3R6MA 1HKBA 4JD2A 4CZHA 2Q1NA 4BR2A 4C1NI 3T19A 1TUYA 1RBSA 2HNZA 3HSTB 4B08A 4DS4A 5HRPA 3SAHA 1KCFA 1U6ZA 3SQ2A 3SYZA 1Q81O 3M8QA 2QK9A 3VGLA 2W6KA 5AQFA 1JL1A 2O8DB 2ATQA 1S1WA 2IVPA 1RT3A 4CJWA 3S3MA 5IWAK 3VF4A 3SUQA 1U4BA 4CHNA 2P9IB 5AQLA 4KV8A 5M1KA 1T03A 3PSFA 3A5NC 4CIEA 3F9MA 1W2BM 1NGDA 4CW7B 4W5TA 4OKJA 1KVBA 1CZ9A 4IFVA 2E2OA 3LANA 1ZBLA 2D0PA 2W40A 1D5AA 1QE1A 3CCLN 4AQYK 3T69A 1XHZA 4BRMA 3TANA 2ITGA 2RPIA 4OKEA 1K8AO 4JYAK 4DR5K 5M1OA 5AZIB 3CFRA 4E1NA 1S1UA 4E1JA 5JLHA 2V7ZA 4FXDA 4J2EA 4BRGA 4ISGA 3G10A 3E01A 3VQCA 3PX4A 4ISFA 3HYFA 4CGHA 2QXLA 4KO0A 4DTUA 1ZBUA 1S9EA 4NCGA 5BN9A 1NGEA 4C8KA 1XC3A 3TSQA 4LFAK 2IGIA 3HP6A 3CFOA 4I7FA 5KI6A 4KI4A 2HMIA 3HTVA 3BY5A 1ATSA 1NOYA 2P9LA 4CF1A 2JWKA 1BO5O 5B8HA 4BR7A 1U47A 3TTDA 5AQJA 3ZYYX 2DY4A 4Z4FA 2EWSA 1BOTO 4B9MA 3K59A 1NLVA 2NNWA 4BDZA 2P9SB 3MN5A 4BRLA 1YXQA 4M3WA 4OX9K 2VCPA 1BHLA 1U48A 2FBXA 4JRQA 3G4SN 4BR4A 1TVRA 1YVNA 3L4IA 3THXA 3S41A 1DTTA 1Q9XA 4JKFA 1C0TA 3HM9A 4U67L 4I6MA 3U3GA 4EZ6A 3M3ZA 4CGDA 4JI7K 1JLBA 3LDNA 1GLDG 1XMOK 4K8XA 3O9RA 5HBMA 1RTHA 3QNNA 1JLFA 5I3UA 3W0LA 4H5WA 2QWNA 3O8MA 1N8RO 1ESVA 1LWFA 3WNHA 1J5EK 4F8RA 3RR8A 3AVLA 3KWGA 5AQKA 4BC4A 1RDWX 5JS2A 4BRQA 1KXPA 4DSJA 4FJ8A 4FYDA 1GOAA 3CMAN 3P39A 4C1NK 4B1XB 4RW7A 1SZ2A 4BGAA 3C94A 4OPHA 1TV6A 2HBJA 1TL3A 1VHXA 2YX6A 4H0XB 2QWOA 4O4GA 3V1OA 5CY4A 4GY2B 3WQUA 5BN8A 4NCBA 4HTUA 1RDDA 3D2EA 3QBXA 3T7ZA 1BU6O 3VEVA 4DU3A 4CI6A 5KPRA 3KLEA 1VSFA 1NWKA 3RVCA 4CEZA 3OYNA 3H3NO 1VSMA 3AA5X 4CJ4A 4X66K 3E9OA 3WEEA 3DXKA 1JLAA 4GKJK 3WNFA 4RWTA 1S1VA 1QTMA 4CJSA 1WBDA 1XHXA 3K2PA 4ID1A 4CCHA 4BE1A 2I7NA 1SUQA 2NRXA 1GOBA 2FF3B 2KZMA 5HRNA 3MWTA 1XUPO 4N56A 1JXBA 4ELTA 2IIRA 1YJ9N 3MCAB 3UIQA 1TK0A 4LC9B 4LFBK 1X9JA 3HI0A 4DTMA 3K5MA 2YHXA 3Q7CA 3V9UA 4JI0K 3MN9A 1QHAA 1G15A 4MO5A 1IKXA 1CZAN 3OYCA 5GAHP 4CHOA 1OVQA 3OHRA 1C1BA 3AGRA 3L2RA 4CFCA 3WUHA 3OS0A 4IKFA 3SBGA 2LSNA 1S3XA 3CFPA 3CPEA 3TAFA 3G6EN 3CM5A 2GV9A 2E2NA 3RMBA 1ASUA 1TYQA 4JKCA 3O1BA 4B9UA 4NYNA 2F7TA 3BEXA 4LD0A 4OLBA 3O08A 1HR0K 1DTQA 5AFUH 2NRZA 1BQNA 1XWLA 2O8FA 4CVNE 3BUZB 3SNNA 2HHQA 2HNDA 1LWEA 4FJ5A 4A57A 3K5NA 4M3UA 4FLUA 3DMJA 3BDPA 3CCRN 3VOVA 5I9EB 4NLCA 4FLYA 4BE0A 2QM1A 1DGKN 2IVNA 4DQQA 3SAFA 4F2RA 2HHVA 2VG5A 5CYMA 4C8OA 4CEAA 3G0ZA 3THYA 2WTUA 3QB0A 4BC5A 3C7NB 4FSVA 4DR2K 4M3XA 1YTAA 1SKRA 1NK4A 4CEFA 1JCGA 1T3VA 2HF3A 4PKIA 1Q18A 1X1PA 2E20A 4YOUA 1ASWA 1ATRA 4CGIA 2VG7A 2YHWA 2VQEK 4BWMA 3GE1A 4C8LA 4YORA 1KRPA 4B8CA 4LSLA 5LJWA 2GELA 1S72N 2ITMA 4H8KA 3KLFA 3U6FA 4EP4A 1NGHA 4OGEA 4XH4A 2PBDA 4JD2B 4AHRA 2Q36A 4I9LA 3DLBA 3QIPA 1OH8A 3QO9A 4J2DA 4KREA 3LZJA 4HUGA 2NLXA 4KAZA 1E4GT 2IOCA 4B1WB 3DLLL 1S1TA 3CC4N 2WOMA 2IS3A 4DF4A 1DLOA 2A1RA 2RKIA 1QVFM 1KLMA 1ZBFA 1LCUA 2VGNA 3AVMA 1FW6A 4F4KA 2V7YA 2KTQA 3KWIA 2XY7A 2HBLA 5BPNA 2A3ZA 3D0PA 3OBWA 4Z94A 4YNQA 4DTRA 3CPWM 3ZSWA 2FBYA 4HCBA 3IFRA 5EXWA 1N36K 1ZXOA 3VENA 2ZM6K 1IBKK 1JLCA 3IG1A 4AHVA 4DLEA 4B3RK 2F9TA 3ZT3A 2OA8A 3NMUA 4KHPK 3LP1A 4FWRA 1YAGA 1D9DA 4M7YA 1GLEG 1QSLA 1JKHA 4WQ5A 3ID6A 3O9SA 1VQNN 1UWBA 1HMVA 1EQYA 2G8UA 5BR8K 3ASMA 2ZJQL 3SV3A 4B1ZA 1QZ5A 3AVJA 1C0MA 4FCYA 2DPNA 1UAXA 4NXMK 3NVKA 3AO5A 4CEEA 4DQ8A 3NVMA 3PV8A 1NU0A 2XY6A 2WFBA 1U2VA 3EYZA 3VEZA 2XY5A 4R79A 3AO1A 3KLGA 2Q0UA 1NJXA 1KC8O 1A5VA 2I5JA 2G8FA 3EZWA 1XC9A 4BY9C 1V4SA 2P9LB 1BCOA 1QZ6A 3ZSRA 4KRFA 1MA9B 3KTQA 2GUPA 3UE5A 1IBLK 2HOEA 3I55N 5DMRA 3VQDA 2OZMA 2ZJRL 3NH0A 5CZ1A 3WXLA 3CQYA 4JK9A 2HHXA 1VQLN 4FL9A 2ZGZA 3L0QA 4BRAA 2HBKA 1KD1O 4F9OA 3HZ6A 4TSXA 2EHGA 4PHTX 3WXKA 3THXB 4YOWA 4B9VA 2F8TA 3PX0A 1A5WA 4I6MB 3MK6A 3K0SA 2BGGA 2HSTA 1JXEA 2EX3A 1K6YA 2YNIA 3NHGA 1HKGA 1SV5A 5C10A 1GLLO 3SPZA 3HM8A 2JWLA 5MLCQ 1CZBA 3U4LA 1LAVA 2P5GA 3TSUA 2NRWA 1HYVA 1VSIA 3QNOA 3VESA 3MDQA 4W5NA 3VEYA 2Q2RA 1B92A 2HHUA 3EL2A 4DQIA 4GW6A 3V6DA 2DFHA 1XQSC 2GEMA 3NBPA 3H1QA 2FF6A 3SZ2A 2JGUA 3JXUA 4DV0K 4WQ4A 4DKWA 5EY4A 4FOEA 4PL8A 2RF2A 2BE2A 1NK7A 4CJRA 3RTVA 1Q8IA 1L3VA 5AQHA 3ZETA 3D2EB 3CCUN 1NGJA 4B8AB 2BDPA 2BTFA 3DYAA 4FWQA 2YNFA 4Z4CA 3CCVN 1R59O 3A8YA 4JRPA 1LW0A 2OCEA 3F5TA 3VQBA 4J2AA 4DR6K 4MDAA 2ZQBA 3AVKA 3M6GA 5CHIA 3EE8A 1EO1A 2KW4A 3WEEB 1RTJA 4CJ5A 2QTDA 3DXKB 3OYFA 4CJPA 3LZIA 1BIUA 4I9QA 1Z26A 3PX6A 3OYKA 2HVHA 4OPJA 1XNRK 3NGZA 1HNVA 4Z4IA 4DV1K 3M8RA 5AQOA 3KVGA 4KH6A 1NJWA 1Y64A 4M3TA 3UKRA 4O5BA 5T7BA 4DFJA 4Y1CA 3L2QA 4QS9A 1RCHA 1RDUA 1C6VA 1VQON 5C2DA 4B1VA 4WCEL 3PSIA 3TPQA 4O5FA 4DV2K 3L2VA 4OKKA 2NRTA 3AA4A 3F2KA 3DWLA 3AARA 3ZX2A 5C25A 5J2NA 2QI2A 3KK2A 2VWJA 5LY3A 2FLOA 5TKYA 3OY9A 4BRHA 4Q0BA 4HVJA 2Z1HA 3AV9A 3WQTA 5F0XA 3AVBA 4C8NA 4CJKA 4XEIA 5M1QA 4B9TA 1RT4A 1OH7A 2YNGA 1JLGA 5FLXO 4MLEA 5BRHA 3VQAA 2YHAA 4JKGB 4IO9L 2R7YA 2NRRA 2OTLN 1LOTB 3CJ7A 2UXDK 1TYQB 3DJCA 1RT1A 3J80O 3A5LC 4O0IA 3P1GA 2VWBA 4FZXC 4JK8A 3VN5A 4DCHA 1Q82O 2O8FB 4BQLA 4FJLA 4BRFA 1RT2A 4Z0UA 1CLQA 2O4IA 3OVNA 3IDHA 3AO4A 3J8AA 2KZZA 4PA1A 4DUYK 3RSEA 3M5RA 3DLGA 3AA3A 2WBNA 1HKCA 3B6OA 3TAEA 3FR0A 4A62A 3ULDA 3C95A 1IO2A 1LAWA 4DSLA 1SL1A 4DV5K 3TTFA 1QSSA 1L3SA 3EKUA 4BG8A 4EP5A 3TAGA 4KHUA 1EWRA 4DR1K 3PIPL 4CD3A 1SL2A 3THYB 1S5JA 3TR8A 3TAMA 3KD5E 2ETJA 1VRTA 1YF5L 4FWKA 2A41A 3ZSVA 1R0AA 4JKDA 3ZEUA 1RT6A 4FM2A 4A61A 2D0BA 4CZGA 4CK3A 3T3FA 4AHCA 4FJGA 4M3RA 3L6QA 3ISNC 4X65K 3QBWA 3D45A 5CYQA 2FSNA 1VK0A 2JLEA 3JAMO 2HNYA 3CQ8A 1NJIO 3S3OA 1J54A 2P51A 3LDSA 5GIPA 3C6UA 3L4QA 1HJOA 1S1XA 1WSGA 3SQ4A 1WB9A 4DR4K 2O8BA 2OTJN 2ASPA 4DSFA 1G99A 3QINA 4WF9L 3P83D 4E7IA 4DQSA 5HROA 5KRSA 2HHHK 5TKWA 1ITGA 4CD1A 5ADXA 2ASMA 2B4JA 2E5LK 4B9SA 1BQMA 4FVMA 4FK4A 1UA1A 4JAXA 4OLAA 2CGJA 5J2PA 4YDUC 1EWQA 3NF9A 4CIFA 4M63C 3O6WA 4LH4A 1T7PA 1NMNA 4K42A 3SMPA 3LDPA 2ZJPL 3R9PA 2D0OA 4DSKA 4JEPA 3HRGA 5LJVA 4ZTJA 3QDKA 3RRGA 1KSPA 1V4TA 2IC3A 1LW2A 4BR0A 5DM7L 4ELUA 3C6HA 3AY9A 3KKRA 1U2VB 3SCXA 4ILJA 2GWKA 2YHBA 4JN4A 1HRHA 5FPNA 3J7AP 1NJZA 3NCIA 4JI6K 3TU5A 4GKKK 3CCMN 3AVCA 3H3OB 1HNZK 2QWQA 1YJNN 2OPPA 3G71N 3K58A 3SI6A 3PO5A 1Y97A 3CJ1A 4KFBA 1BUPA 3OYBA 1SS6A 5KRTA 4B9NA 4CJVA 2E2QA 5ADXH 4WYBA 5M1NA 3ZSZA 1KAYA 2YKMA 5AZJA 4FLTA 4AHTA 1QQCA 3OA9A 3R8EA 5E26A 5A2QO 2YJEA 1QHTA 1VQPN 3CG7A 4CBXA 3LL3A 4DTOA 1ILYA 3I56N 1KVAA 5EX5A 1DEJA 3CJCA 4C8MA 3HSCA 4AM7A 4IFEA 3VQ7A 3OS2A 4FJ7A 3DLEA 4CFAA 1HQUA 4JK7A 4CK1A 1VQ6N 3V81A 4DV3K 3DOKA 2ASOA 5KQDA 1WSIA 4CFBA 3LPUA 1MWMA 1BISA 2A40A 4N5SA 1S9GA 4JS5A 3DRSA 1L5UA 2Q3SA 3PUFA 4HUEA 2E1ZA 1P90A 4CGGA 2UUBK 3TSPA 2E88A 4PY5A 3ZT4A 1IKYA 1ZC6A 2GBZA 2KQ2A 2VYPA 3FZFA 2GTDA 1I3AA 1EX4A 1NM1A 4DTXA 4BC3A 3OYDA 3HJFA 4H0YB 1YI2N 5BREA 3SUOA 5BRDA 1Q9YA 1IKWA 1VQKN 3T1AA 4DV7K 4F3TA 1YJWN 3ZETB 1J5OA 4HCCA 5KPZA 4MQ3A 4LF4K 3LDLA 4JI1K 4CHPA 4OPAA 4CZIA 2B5JA 1D8YA 1FKOA 1T6CA 1C1AA 2ZD1A 4FJNA 3MCPA 5LMUK 2O8EA 4HWIA 1IG8A 3QLHA 1TKZA 3SUNA 4K8ZA 5C42A 1BA1A 1SQKA 4FPBA 3QEXA 1RBRA 4WFBL 3LDOA 4QCLA 2P5OA 2QWLA 1HUXA 4B3MK 3HOSA 3V9ZA 3L3VA 3P38A 1L3UA 1TAUA 4AF1A 2FSJA 3UKRB 4CJFA 1VRUA 4EHTA 4IG3A 3CJBA 3ZLJA 2CH6A 3ID8A 3K5OA 1SKWA 4BACA 3VQ6A 4CZMA 1FKPA 2KFZA 5FPEA 3J81O 2NRHA 4DTPA 5FPMA 3MWPA 3ZSYA 1RDCA 2YJFA 5BR9A 4Z4EA 5KPTA 4IEIA 4YY3K 1IH7A 4RCHA 3K9KA 2GUIA 3RMAA 1W0HA 3D6RA 3LM2A 4BRNA 1E4FT 4CK2A 2UUAK 2FC0A 4EFHA 4NCAA 1DKGD 5M1PA 4ISEA 3CM6A 4FJJA 5IT9O 3WNEA 4B3TK 5SZTA 4EAHD 2QKBA 4ID5A 2KFNA 3MN7A 4A2AA 1NK6A 4LF7K 2IAJA 3QEWA 1K9MO 5KGXA 3AVGA 4WFAL 1W7AA 4K25A 3SJJA 1WSEA 4H0VB 5GINA 3C65A 3CC7N 4DU4A 5D3GA 3F9KA 3NH2A 3ZX0A 3V1RA 2HHTA 5AR0A 3VMFB 3WNGA 3ATVA 3RSEB 4LF5K 1NK0A 4JKAA 5AQPA 3DRRA 1S6PA 2WC9A 1LV5A 2H3GX 2QXFA 4DR7K 4CFDA 4XH5A 3N4QA 2V51B 4KPYA 4DSEA 2F96A 4JLHA 4BVOA 5AQSA 4IWVA 4GV6A 3HBTA 4HUFA 2HHWA 1WLJA 3DLKA 2OANA 3SAGA 4LF6K 4BC2A 3ZEUB 3IMXA 2PZSA 1ZYQA 1WNSA 2DFEA 3C6AA 4CF8A 4CHQA 3TWHA 5I42A 1NGGA 3B6PA 1HNXK 4U7BA 3HK2A 4CZKA 5SWMA 1TL1A 3V9SA 3QIOA 3EEQA 4DFMA 3VQQA 4CJTA 4KHNA 2O8BB 3EY1A 4EZ9A 4DU1A 1M90O 1GOCA 4B9QA 3HT3A 4M3ZA 2B6AA 1VSKA 4IBNA 3TARA 5C2FA 4FJHA 1TK8A 4DTJA 3T1HK 4UY8O 1VQ4N 4OO1J 2G8IA 2E8AA 3AAQA 4R5PA 5CR4A 3ALYA 4YHHK 3U9ZA 4JI2K 4CEBA 4OPKA 2CGKA 3R1XA 3CJ9A 4IFYA 3DAWA 5FDLA 4F3OA 1H1VA 1HPMA 3Q7BA 4BGBA 1KLNA 3PLAA 4I2PA 4BG9A 3P4IA 2J4RA 2P9PA 4CEOA 3QEVA 3AVNA 4BDPA 2W41A 1N6QA 4FM1A 2Q97A 3ZSOA 2GWJA 4CE9A 4JI5K 1IV0A 1TUUA 5AQWA 5BPLA 3CIPA 4QS8A 3DLRA 3L2WA 1HQEA 5F2RA 1VSLA 1XNQK 3DOLA 3FZLA 1WUAA 1RBVA 3ZSQA 3HP9A 1HX1A 4DTNA 4DV4K 2Y1IA 2ZWHA 4DFPA 3VERA 4BR9A 5AQYA 3QFPA 3J7ZO 4IDKA 4X64K 2KLAA 3TAQA 1HYZA 1VSEA 1ZBIA 4LFCK 4MFBA 1X9MA 4X62K 3CXCM 5EVZA 5AQGA 4FW1A 3A5MC 4DB3A 4RW9A 4DV6K 2FXUA 3IS9A 4GVMA 5AQQA 5AZJB 3JSMA 4Q5VA 3CJAA 3QMLA 2X74A 1RT5A 4HHTA 4N41A 1RILA 1YHQN 1NGAA 1NMDA 2RE2A 3CI5A 3VQ8A 3V4IA 4M3YA 2G8HA 2RN2A 2P9UA 1BL3A 5AQRA 3RMCA 2QKKA 1NBWA 3UKUA 4QOZB 2AP1A 1RTDA 2F4VK 3NF8A 2BH1A 4DQRA 3D2FA 4JI4K 5AJ3K 1KAZA 3H1VX 3EZ5A 3CCSN 3S9HA 3RR7A 1VSHA 4A59A 3LP2A 4BRPA 5AQMA 2G8KA 4DWIA 4CEDA 3AVIA 4IJNA 1T44A 4YDUA 5LL6Z 5BPMA 3DRPA 3O9UA 1QSYA 4O55A 2HMPA 4H4MA 1Q86O 3NE6A 3TTCA 1VQ9N 4CF2A 2OPRA 3ZX3A 2OPSA 1NOZA 5KGWA 3VA3A 4QAGA 4OJRA 1HJRA 4QS7A 1CXQA 1NK9A 4PQUA 4GV3A 1QQMA 5CZ2A 3VQPA 3AVAA 4K0KK 4E0DA 2P9KA 1WAFA 2O8EB 3RRHA 1X3NA 4FJMA 4WQ5C 4NB4A 4W5QA 3VGKA 3D7EO 3L8BA 3QETA 1VQ8N 4W5RA 4M45A 1IG9A 4LF8K 2Q31A 3BF3A 3PY8A 1I39A 3TAPA 1KFDA 3SQ1A 2QEXN 5HP1A 2D5RA 3QESA 3HPHA 3EO3A 5FROA 2HF4A 3CC2N 4PUOA 5FRNA 1KAXA 3ATUA 1BA0A 1KFSA 4LY7A 1HLUA 1EETA 4O0JA 3THWA 4H4OA 3CD6N 4BRCA 3I0SA 3QICA 3KHYA 2Z1GA 5HRRA 3JS6A 2UUCK 1RDAA 5F1XA 5KQ8A 3VQ9A 3U3YA 2F8SA 2NRVA 4CERA 2NZTA 4B9LA 4B1UB 1N34K 4M41A 2RHKA 5AQUA
chains in the Genus database with same CATH topology
2OPQA 3SV4A 3QEIA 1SKRA 3CG7A 1D9FA 1NK4A 4CEFA 4DTOA 4RW6A 4LH5A 1KVAA 1X1PA 1ASWA 3K57A 4CGIA 3NFAA 1KVCA 4C8MA 2VG7A 2FBTA 1RT7A 4AILC 4BWMA 1NKCA 4C8LA 5J2MA 1KRPA 1QS4A 4B8CA 2OYQA 4LSLA 3A2FA 4KTZA 4CESA 4H8KA 3KLFA 3U6FA 4EP4A 4OGEA 3VQ7A 1LWCA 3OS2A 4FJ7A 3DLEA 4CFAA 4N76A 3I0RA 4AHRA 4I9LA 2XHBA 1HQUA 1Z25A 3NF7A 3QIPA 3QO9A 3JYTA 3DLBA 4J2DA 4CK1A 4DF8A 4KREA 3NGYA 3LZJA 3V81A 4O44A 4Y1DA 4HUGA 4KAZA 3DOKA 5FRMA 2IOCA 5J1EA 5J2QA 1S1TA 1WSIA 1RTIA 3BGRA 4L8RB 2WOMA 4CFBA 3LPUA 2IS3A 1BISA 1DLOA 3AVHA 4N5SA 4JS5A 1S9GA 5HRSA 3DRSA 3OYIA 2Q3SA 2RKIA 3PUFA 2A1RA 1L5UA 1TKTA 1NK8A 4HUEA 4DQPA 2E6MA 3THVA 4CGGA 4KHYA 3HPGA 1BGXT 1KLMA 4FJKA 1ZBFA 3AO2A 4PY5A 4ZHRA 3OYMA 3AVMA 3ZT4A 1IKYA 4WE1A 4F4KA 2GBZA 2KQ2A 3KKSA 2KTQA 2XY7A 4FK0A 3NAEA 1BI4A 1I3AA 1EX4A 3D0PA 4ICLA 3M8PA 4BWJA 4YNQA 3OYDA 4DTXA 4DTRA 3HJFA 1EXQA 3ZSWA 3SUOA 2G8VA 2OZSA 2FBYA 4G1QA 4HCBA 3LPTA 1Q9YA 1IKWA 3LAMA 4CHZA 3KLHA 3T1AA 1JLCA 4F3TA 4DMNA 3IG1A 4AHVA 3OYHA 4DLEA 1J5OA 3NGIA 3ZT0A 4MQ3A 1BCMA 4E19A 4HCCA 3ZT3A 3QEPA 2OA8A 2VG6A 3IRXA 4CHPA 3LP1A 2P1JA 1VSJA 3KJVA 2B5JA 1D8YA 1FKOA 1D9DA 1C1AA 1QSLA 1JKHA 4Z4GA 1HPZA 2ZD1A 3I8DA 4FJNA 3MAQA 3OYEA 1UWBA 1HMVA 3LALA 2G8UA 4CF0A 3ASMA 3MEEA 2YKNA 3O4QA 4LSNA 3SV3A 3QLHA 4RW8A 3AVJA 1C0MA 1TKZA 4FCYA 3SUNA 1UAXA 3O4NA 1SL0A 4K8ZA 5C42A 3AO5A 4CEEA 4W5OA 3PV8A 3KD1E 2XY6A 3QEXA 1RBRA 1XI1A 3OYGA 1O1WA 3EYZA 4QCLA 2P5OA 1IKVA 3H08A 3RWUA 4KHWA 1FK9A 4DS5A 2XY5A 3RR7A 1C1CA 2E4LA 3AO1A 4KTWA 3KLGA 3V9ZA 3L3VA 3OYJA 2X6NA 1NJXA 1L3UA 1TAUA 1A5VA 3DLHA 2XO7A 1TAQA 2I5JA 2G8FA 3MXIA 3LWLA 3VA0A 1XC9A 1HNIA 1UOCA 4CJFA 1VRUA 3TABA 4IG3A 1BCOA 3F73A 2A1SA 3AO3A 3ZSRA 3K5OA 1REVA 1TGOA 1SKWA 3AA2A 3VQ6A 4BACA 4KRFA 3KTQA 1FKPA 2KFZA 4F2SA 1TKDA 3HVTA 5DMRA 1JLQA 3VQDA 3OYAA 4DTPA 2W42A 3ZSYA 2OZMA 1U49A 3NH0A 5CZ1A 1RDCA 4M42A 4Z4EA 2HHXA 4ELVA 1IH7A 4RG8A 2D0AA 2GUIA 4CJ3A 3RMAA 4FJJA 4TSXA 1W0HA 2EHGA 4CK2A 2E6LA 1UA0A 2FC0A 4B9VA 4NCAA 2F8TA 4CECA 3PX0A 1A5WA 3MEDA 2PY5A 2BGGA 5K14A 4E7LA 3LP3A 4FZZA 3CM6A 3O3FA 1JXEA 2EX3A 1K6YA 2YNIA 4I2QA 3WNEA 1B9DA 5SZTA 1SV5A 3KK1A 3NHGA 4DSIA 4FJXA 3HO1A 2VWKA 4ID5A 3SPZA 2QKBA 2KFNA 3VQ4A 1CZBA 1NK6A 2XY8A 4PWDA 4CEQA 1LAVA 2P5GA 4UQGA 2IAJA 3QEWA 3T19A 3AVGA 2HNZA 1RBSA 3HSTB 3V1QA 4B08A 1WSEA 5KGXA 4DS4A 5HRPA 3MECA 1HYVA 1VSIA 3SJJA 3HVRA 2WONA 3QNOA 4DFKA 2IDOA 5EU7A 4DU4A 1KCFA 5D3GA 3F9KA 3NH2A 4JS4A 4W5NA 3SQ2A 3SYZA 3M8QA 2QK9A 1YT3A 1B92A 3V9XA 3V1RA 2X6SA 2HHTA 2HHUA 1JL1A 5DK5A 4BDYA 1S6QA 4GW6A 4DQIA 2ATQA 3V6DA 2DFHA 1S1WA 3WNGA 1RT3A 1NK0A 4CJWA 3NBPA 3SUQA 3S3MA 1U4BA 4CHNA 4DLGA 3DRRA 1S6PA 3SZ2A 2JGUA 4KV8A 1T03A 1NJYA 4CIEA 4OGCA 1LV5A 2QXFA 2RF2A 4W5TA 4KHQA 4OKJA 4CFDA 1KVBA 2BE2A 1NK7A 1CZ9A 4KPYA 4IFVA 4CJRA 1NK5A 4DSEA 2F96A 4JLHA 3PO4A 3LANA 3RTVA 1Q8IA 4CJLA 1ZBLA 1L3VA 4NYFA 3SQ0A 4M3XA 2DTUA 1D5AA 1QE1A 4B8AB 2BDPA 4XIUA 3DYAA 3V9WA 3MEGA 4HUFA 2YNFA 2HHWA 1WLJA 3DLKA 4E7HA 1XHZA 4Z4CA 4JRPA 3TANA 1LW0A 2ITGA 2RPIA 4OKEA 1X9WA 3VQBA 4J2AA 2PZSA 3DI6A 4DG1A 2ZQBA 3AVKA 4E89A 3CFRA 4E1NA 1S1UA 1ZYQA 2KW4A 1RTJA 4CJ5A 1WNSA 2DFEA 4CHQA 4CF8A 3OYFA 3TWHA 4CJPA 4E3SA 4FXDA 3OS1A 3LZIA 1BIUA 3S3NA 4J2EA 5I42A 4I9QA 3G10A 1Z26A 3E01A 4N47A 3OYKA 3VQCA 3PX6A 2HVHA 3NH1A 4OPJA 3B6PA 4FLWA 3OJUA 3PX4A 3HYFA 3NGZA 4FW2A 4CGHA 3HK2A 1HNVA 3MXJA 4KO0A 1F21A 4DTUA 5SWMA 1TL1A 1ZBUA 3V9SA 3QIOA 1S9EA 4NCGA 4DFMA 4Z4IA 2HB5A 4AHSA 4IG0A 3VQQA 4CJTA 3M8RA 4KHNA 2NUBA 3EY1A 4C8KA 4EZ9A 4DU1A 2IGIA 3HP6A 1C0UA 1GOCA 3CFOA 4I7FA 5KI6A 3HT3A 1NJWA 1L3TA 3LWMA 2B6AA 4KI4A 1VSKA 4M3ZA 2HMIA 4IBNA 3TARA 4M3TA 4FJHA 1TK8A 4DTJA 1NOYA 4CF1A 2Z1IA 4O5BA 5T7BA 2G8IA 4DFJA 1U47A 4Y1CA 3L2QA 4R5PA 4J2BA 1RCHA 3ALYA 1EKEA 4DF4A 4Z4FA 2DY4A 1C6VA 2G8WA 5JS1A 4B9MA 4CEBA 4OPKA 3K59A 3L2VA 4IFYA 4OKKA 5FDLA 4F3OA 2BANA 3ZCMA 4CHYA 4BDZA 3AA4A 1KLNA 5C25A 4I2PA 5J2NA 4M3WA 3KK2A 2VWJA 4FJIA 1BHLA 3ZT1A 4AHUA 4E7JA 3OY9A 1U48A 2FBXA 1RBUA 4B3OA 4JRQA 1TVRA 4CEOA 4Q0BA 4HVJA 2Z1HA 3AV9A 3AVNA 3QEVA 1N6QA 4BDPA 4KHSA 1DTTA 3AVBA 3KLIA 4FM1A 4C8NA 1KTQA 4CJKA 1Q9XA 1C0TA 3ZT2A 3HM9A 3ZSOA 1JL2A 4B9TA 1RT4A 1U04A 1RNHA 2YNGA 3U3GA 1JLGA 4CE9A 4EZ6A 1RDBA 3ITHA 4CGDA 1JLBA 1N5YA 3VQAA 2YHAA 2R7YA 1X9SA 4K8XA 5HBMA 4CIGA 3NF6A 1T05A 1RTHA 3DLRA 3QNNA 3L2WA 1HQEA 4GMJB 1VSLA 1JLFA 4E1MA 5I3UA 3DOLA 1ZBHA 1RT1A 3OJSA 4O0IA 1RBVA 4KB1A 2HW3A 2Z1JA 3ZSQA 3HP9A 3P1GA 4DTNA 1CXUA 1LWFA 4FZXC 3DM2A 3VN5A 3WNHA 2Y1IA 4F8RA 3RR8A 3AVLA 4DSJA 5JS2A 4FJ8A 4FYDA 4DFPA 4FJLA 3QERA 1RT2A 1GOAA 4Z0UA 1CLQA 2O4IA 3OVNA 4IDKA 4RW7A 3AO4A 2PYLA 3TAQA 2KZZA 4PA1A 3C94A 3MXMA 1HYZA 1VSEA 1NKBA 3O3HA 3DLGA 1ZBIA 3AA3A 4FLXA 1TV6A 1TL3A 1MU2A 1WN7A 4FLZA 4O4GA 3B6OA 4MFBA 3L2UA 3TAEA 3SUPA 3V1OA 1B9FA 3OYLA 5HLFA 1X9MA 5KTQA 5CY4A 4FW1A 3ULDA 3C95A 3ZSXA 1IO2A 1LAWA 4RW9A 4DSLA 1SL1A 1JLEA 3IS9A 4GVMA 3JSMA 1L3SA 1QSSA 4NCBA 4Q5VA 4HTUA 4ZTFA 4EP5A 3TAGA 3M8SA 1RDDA 4KHUA 2X74A 1RT5A 1EP4A 4HHTA 1SL2A 1S5JA 3TR8A 4N41A 4KKOA 4DU3A 3TAMA 1RILA 1YTUA 3KD5E 2ETJA 3VQ5A 3O3GA 1VRTA 3C6TA 3KLEA 1VSFA 1WSJA 1WSHA 3FFIA 3VQ8A 4CEZA 3OYNA 3V4IA 4FJ9A 3ZSVA 1R0AA 4M3YA 2G8HA 2RN2A 3LP0A 1RT6A 1VSMA 1BL3A 3AA5X 4CJ4A 3RMCA 2QKKA 4FM2A 1VSDA 4KTQA 2D0BA 4CJUA 1JLAA 4CK3A 3T3FA 4AHCA 4FJGA 4M3RA 4QOZB 1U45A 1RTDA 3ISNC 3WNFA 1S1VA 3NF8A 1J53A 4DQRA 4OVLA 3D45A 5CYQA 4CJSA 1QTMA 1VK0A 1XHXA 3K2PA 4ID1A 2JLEA 1WAJA 3HXMA 4CCHA 1HYSA 2HNYA 2YNHA 4CJQA 3EZ5A 3CQ8A 4BE1A 1VSHA 1J54A 2P51A 3HL8A 3K5LA 3LP2A 3S9HA 1ASVA 3LAKA 3LDSA 2O4GA 3IAYA 3KK3A 3C6UA 3SQ4A 1WSGA 1S1XA 4CF9A 2G8KA 1SUQA 4DTSA 4DWIA 1GOBA 4CEDA 3AVIA 2KZMA 4DSFA 4FM0A 1FXXA 3DRPA 3QINA 5HRNA 1QSYA 3P83D 4O55A 4N56A 4H4MA 1JXBA 3SPYA 4E7IA 3S3OA 2YV0X 4DQSA 5HROA 4ELTA 4AH9A 5KRSA 3UIQA 1TK0A 1ITGA 3NE6A 4Z4HA 2B4JA 4B9SA 4CGJA 4CF2A 4DTMA 2X78A 3K5MA 1RBTA 1BI4B 3HPOA 1BQMA 2OPRA 4FVMA 4FK4A 3V9UA 1UA1A 2OPSA 4OLAA 1NOZA 5KGWA 3VA3A 5J2PA 4QAGA 3NF9A 4OJRA 4CIFA 1HJRA 3TI0A 2FBVA 1G15A 1CXQA 4LH4A 3VQEA 1NK9A 1IKXA 1T7PA 4KI6A 3OYCA 4PQUA 5C24A 4CHOA 2ZE2A 1C1BA 3L2RA 3NDKA 4CFCA 3OS0A 4IKFA 5CZ2A 3VQPA 3AVAA 2LSNA 4FK2A 4DSKA 4E0DA 3CFPA 4E7KA 3TAFA 4ZTJA 1WAFA 4BE2A 3RRHA 3CM5A 3RRGA 1KSPA 4FJMA 2IC3A 2GV9A 1LW2A 4FZYA 3RMBA 4W5QA 4KB0A 4CGFA 1ASUA 3L8BA 4ELUA 3QETA 3KKRA 4B9UA 3CYMA 4NYNA 4W5RA 4M45A 3SCXA 1IG9A 4LD0A 3AVFA 1J9AA 4OLBA 2YHBA 2XRIA 1DTQA 3PY8A 1HRHA 1I39A 1BQNA 1KFDA 1XWLA 4YFUA 3SQ1A 3TAPA 5E41A 5HP1A 1NJZA 2D5RA 3KIOA 2HVIA 3SNNA 3QESA 3HPHA 5FROA 3NCIA 2HNDA 4PUOA 5FRNA 2HHQA 1LWEA 4CJEA 4FJ5A 3AVCA 3K5NA 4LY7A 1WSFA 4FLUA 1TK5A 1TKXA 1KFSA 1EETA 4M3UA 3DMJA 3BDPA 3L3UA 2OPPA 3K58A 1T8EA 3SI6A 4O0JA 3PO5A 1BIZA 4FLYA 4BE0A 4H4OA 4FLVA 1W9HA 1Y97A 4KFBA 3I0SA 4RW4A 3OYBA 3RMDA 5KRTA 2Z1GA 5HRRA 4B9NA 4CJVA 4DQQA 1SKSA 2HHSA 1RDAA 2Y1JA 1NKEA 3ZSZA 4F2RA 2HHVA 2YKMA 4FLTA 2VG5A 3VQ9A 4AHTA 3U3YA 2F8SA 5CYMA 2AJQA 1A5XA 4CERA 4C8OA 1QQCA 4CEAA 3G0ZA 4B9LA 1YVUA 2PYJA 3P5JA 2DFFA 4M41A 1YTAA 2D0CA 1QHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPQ A;  3SV4 A;  3QEI A;  1SKR A;  3CG7 A;  1D9F A;  1NK4 A;  4CEF A;  4DTO A;  4RW6 A;  4LH5 A;  1KVA A;  1X1P A;  1ASW A;  3K57 A;  4CGI A;  3NFA A;  1KVC A;  4C8M A;  2VG7 A;  2FBT A;  1RT7 A;  4AIL C;  4BWM A;  1NKC A;  4C8L A;  5J2M A;  1KRP A;  1QS4 A;  4B8C A;  2OYQ A;  4LSL A;  3A2F A;  4KTZ A;  4CES A;  4H8K A;  3KLF A;  3U6F A;  4EP4 A;  4OGE A;  3VQ7 A;  1LWC A;  3OS2 A;  4FJ7 A;  3DLE A;  4CFA A;  4N76 A;  3I0R A;  4AHR A;  4I9L A;  2XHB A;  1HQU A;  1Z25 A;  3NF7 A;  3QIP A;  3QO9 A;  3JYT A;  3DLB A;  4J2D A;  4CK1 A;  4DF8 A;  4KRE A;  3NGY A;  3LZJ A;  3V81 A;  4O44 A;  4Y1D A;  4HUG A;  4KAZ A;  3DOK A;  5FRM A;  2IOC A;  5J1E A;  5J2Q A;  1S1T A;  1WSI A;  1RTI A;  3BGR A;  4L8R B;  2WOM A;  4CFB A;  3LPU A;  2IS3 A;  1BIS A;  1DLO A;  3AVH A;  4N5S A;  4JS5 A;  1S9G A;  5HRS A;  3DRS A;  3OYI A;  2Q3S A;  2RKI A;  3PUF A;  2A1R A;  1L5U A;  1TKT A;  1NK8 A;  4HUE A;  4DQP A;  2E6M A;  3THV A;  4CGG A;  4KHY A;  3HPG A;  1BGX T;  1KLM A;  4FJK A;  1ZBF A;  3AO2 A;  4PY5 A;  4ZHR A;  3OYM A;  3AVM A;  3ZT4 A;  1IKY A;  4WE1 A;  4F4K A;  2GBZ A;  2KQ2 A;  3KKS A;  2KTQ A;  2XY7 A;  4FK0 A;  3NAE A;  1BI4 A;  1I3A A;  1EX4 A;  3D0P A;  4ICL A;  3M8P A;  4BWJ A;  4YNQ A;  3OYD A;  4DTX A;  4DTR A;  3HJF A;  1EXQ A;  3ZSW A;  3SUO A;  2G8V A;  2OZS A;  2FBY A;  4G1Q A;  4HCB A;  3LPT A;  1Q9Y A;  1IKW A;  3LAM A;  4CHZ A;  3KLH A;  3T1A A;  1JLC A;  4F3T A;  4DMN A;  3IG1 A;  4AHV A;  3OYH A;  4DLE A;  1J5O A;  3NGI A;  3ZT0 A;  4MQ3 A;  1BCM A;  4E19 A;  4HCC A;  3ZT3 A;  3QEP A;  2OA8 A;  2VG6 A;  3IRX A;  4CHP A;  3LP1 A;  2P1J A;  1VSJ A;  3KJV A;  2B5J A;  1D8Y A;  1FKO A;  1D9D A;  1C1A A;  1QSL A;  1JKH A;  4Z4G A;  1HPZ A;  2ZD1 A;  3I8D A;  4FJN A;  3MAQ A;  3OYE A;  1UWB A;  1HMV A;  3LAL A;  2G8U A;  4CF0 A;  3ASM A;  3MEE A;  2YKN A;  3O4Q A;  4LSN A;  3SV3 A;  3QLH A;  4RW8 A;  3AVJ A;  1C0M A;  1TKZ A;  4FCY A;  3SUN A;  1UAX A;  3O4N A;  1SL0 A;  4K8Z A;  5C42 A;  3AO5 A;  4CEE A;  4W5O A;  3PV8 A;  3KD1 E;  2XY6 A;  3QEX A;  1RBR A;  1XI1 A;  3OYG A;  1O1W A;  3EYZ A;  4QCL A;  2P5O A;  1IKV A;  3H08 A;  3RWU A;  4KHW A;  1FK9 A;  4DS5 A;  2XY5 A;  3RR7 A;  1C1C A;  2E4L A;  3AO1 A;  4KTW A;  3KLG A;  3V9Z A;  3L3V A;  3OYJ A;  2X6N A;  1NJX A;  1L3U A;  1TAU A;  1A5V A;  3DLH A;  2XO7 A;  1TAQ A;  2I5J A;  2G8F A;  3MXI A;  3LWL A;  3VA0 A;  1XC9 A;  1HNI A;  1UOC A;  4CJF A;  1VRU A;  3TAB A;  4IG3 A;  1BCO A;  3F73 A;  2A1S A;  3AO3 A;  3ZSR A;  3K5O A;  1REV A;  1TGO A;  1SKW A;  3AA2 A;  3VQ6 A;  4BAC A;  4KRF A;  3KTQ A;  1FKP A;  2KFZ A;  4F2S A;  1TKD A;  3HVT A;  5DMR A;  1JLQ A;  3VQD A;  3OYA A;  4DTP A;  2W42 A;  3ZSY A;  2OZM A;  1U49 A;  3NH0 A;  5CZ1 A;  1RDC A;  4M42 A;  4Z4E A;  2HHX A;  4ELV A;  1IH7 A;  4RG8 A;  2D0A A;  2GUI A;  4CJ3 A;  3RMA A;  4FJJ A;  4TSX A;  1W0H A;  2EHG A;  4CK2 A;  2E6L A;  1UA0 A;  2FC0 A;  4B9V A;  4NCA A;  2F8T A;  4CEC A;  3PX0 A;  1A5W A;  3MED A;  2PY5 A;  2BGG A;  5K14 A;  4E7L A;  3LP3 A;  4FZZ A;  3CM6 A;  3O3F A;  1JXE A;  2EX3 A;  1K6Y A;  2YNI A;  4I2Q A;  3WNE A;  1B9D A;  5SZT A;  1SV5 A;  3KK1 A;  3NHG A;  4DSI A;  4FJX A;  3HO1 A;  2VWK A;  4ID5 A;  3SPZ A;  2QKB A;  2KFN A;  3VQ4 A;  1CZB A;  1NK6 A;  2XY8 A;  4PWD A;  4CEQ A;  1LAV A;  2P5G A;  4UQG A;  2IAJ A;  3QEW A;  3T19 A;  3AVG A;  2HNZ A;  1RBS A;  3HST B;  3V1Q A;  4B08 A;  1WSE A;  5KGX A;  4DS4 A;  5HRP A;  3MEC A;  1HYV A;  1VSI A;  3SJJ A;  3HVR A;  2WON A;  3QNO A;  4DFK A;  2IDO A;  5EU7 A;  4DU4 A;  1KCF A;  5D3G A;  3F9K A;  3NH2 A;  4JS4 A;  4W5N A;  3SQ2 A;  3SYZ A;  3M8Q A;  2QK9 A;  1YT3 A;  1B92 A;  3V9X A;  3V1R A;  2X6S A;  2HHT A;  2HHU A;  1JL1 A;  5DK5 A;  4BDY A;  1S6Q A;  4GW6 A;  4DQI A;  2ATQ A;  3V6D A;  2DFH A;  1S1W A;  3WNG A;  1RT3 A;  1NK0 A;  4CJW A;  3NBP A;  3SUQ A;  3S3M A;  1U4B A;  4CHN A;  4DLG A;  3DRR A;  1S6P A;  3SZ2 A;  2JGU A;  4KV8 A;  1T03 A;  1NJY A;  4CIE A;  4OGC A;  1LV5 A;  2QXF A;  2RF2 A;  4W5T A;  4KHQ A;  4OKJ A;  4CFD A;  1KVB A;  2BE2 A;  1NK7 A;  1CZ9 A;  4KPY A;  4IFV A;  4CJR A;  1NK5 A;  4DSE A;  2F96 A;  4JLH A;  3PO4 A;  3LAN A;  3RTV A;  1Q8I A;  4CJL A;  1ZBL A;  1L3V A;  4NYF A;  3SQ0 A;  4M3X A;  2DTU A;  1D5A A;  1QE1 A;  4B8A B;  2BDP A;  4XIU A;  3DYA A;  3V9W A;  3MEG A;  4HUF A;  2YNF A;  2HHW A;  1WLJ A;  3DLK A;  4E7H A;  1XHZ A;  4Z4C A;  4JRP A;  3TAN A;  1LW0 A;  2ITG A;  2RPI A;  4OKE A;  1X9W A;  3VQB A;  4J2A A;  2PZS A;  3DI6 A;  4DG1 A;  2ZQB A;  3AVK A;  4E89 A;  3CFR A;  4E1N A;  1S1U A;  1ZYQ A;  2KW4 A;  1RTJ A;  4CJ5 A;  1WNS A;  2DFE A;  4CHQ A;  4CF8 A;  3OYF A;  3TWH A;  4CJP A;  4E3S A;  4FXD A;  3OS1 A;  3LZI A;  1BIU A;  3S3N A;  4J2E A;  5I42 A;  4I9Q A;  3G10 A;  1Z26 A;  3E01 A;  4N47 A;  3OYK A;  3VQC A;  3PX6 A;  2HVH A;  3NH1 A;  4OPJ A;  3B6P A;  4FLW A;  3OJU A;  3PX4 A;  3HYF A;  3NGZ A;  4FW2 A;  4CGH A;  3HK2 A;  1HNV A;  3MXJ A;  4KO0 A;  1F21 A;  4DTU A;  5SWM A;  1TL1 A;  1ZBU A;  3V9S A;  3QIO A;  1S9E A;  4NCG A;  4DFM A;  4Z4I A;  2HB5 A;  4AHS A;  4IG0 A;  3VQQ A;  4CJT A;  3M8R A;  4KHN A;  2NUB A;  3EY1 A;  4C8K A;  4EZ9 A;  4DU1 A;  2IGI A;  3HP6 A;  1C0U A;  1GOC A;  3CFO A;  4I7F A;  5KI6 A;  3HT3 A;  1NJW A;  1L3T A;  3LWM A;  2B6A A;  4KI4 A;  1VSK A;  4M3Z A;  2HMI A;  4IBN A;  3TAR A;  4M3T A;  4FJH A;  1TK8 A;  4DTJ A;  1NOY A;  4CF1 A;  2Z1I A;  4O5B A;  5T7B A;  2G8I A;  4DFJ A;  1U47 A;  4Y1C A;  3L2Q A;  4R5P A;  4J2B A;  1RCH A;  3ALY A;  1EKE A;  4DF4 A;  4Z4F A;  2DY4 A;  1C6V A;  2G8W A;  5JS1 A;  4B9M A;  4CEB A;  4OPK A;  3K59 A;  3L2V A;  4IFY A;  4OKK A;  5FDL A;  4F3O A;  2BAN A;  3ZCM A;  4CHY A;  4BDZ A;  3AA4 A;  1KLN A;  5C25 A;  4I2P A;  5J2N A;  4M3W A;  3KK2 A;  2VWJ A;  4FJI A;  1BHL A;  3ZT1 A;  4AHU A;  4E7J A;  3OY9 A;  1U48 A;  2FBX A;  1RBU A;  4B3O A;  4JRQ A;  1TVR A;  4CEO A;  4Q0B A;  4HVJ A;  2Z1H A;  3AV9 A;  3AVN A;  3QEV A;  1N6Q A;  4BDP A;  4KHS A;  1DTT A;  3AVB A;  3KLI A;  4FM1 A;  4C8N A;  1KTQ A;  4CJK A;  1Q9X A;  1C0T A;  3ZT2 A;  3HM9 A;  3ZSO A;  1JL2 A;  4B9T A;  1RT4 A;  1U04 A;  1RNH A;  2YNG A;  3U3G A;  1JLG A;  4CE9 A;  4EZ6 A;  1RDB A;  3ITH A;  4CGD A;  1JLB A;  1N5Y A;  3VQA A;  2YHA A;  2R7Y A;  1X9S A;  4K8X A;  5HBM A;  4CIG A;  3NF6 A;  1T05 A;  1RTH A;  3DLR A;  3QNN A;  3L2W A;  1HQE A;  4GMJ B;  1VSL A;  1JLF A;  4E1M A;  5I3U A;  3DOL A;  1ZBH A;  1RT1 A;  3OJS A;  4O0I A;  1RBV A;  4KB1 A;  2HW3 A;  2Z1J A;  3ZSQ A;  3HP9 A;  3P1G A;  4DTN A;  1CXU A;  1LWF A;  4FZX C;  3DM2 A;  3VN5 A;  3WNH A;  2Y1I A;  4F8R A;  3RR8 A;  3AVL A;  4DSJ A;  5JS2 A;  4FJ8 A;  4FYD A;  4DFP A;  4FJL A;  3QER A;  1RT2 A;  1GOA A;  4Z0U A;  1CLQ A;  2O4I A;  3OVN A;  4IDK A;  4RW7 A;  3AO4 A;  2PYL A;  3TAQ A;  2KZZ A;  4PA1 A;  3C94 A;  3MXM A;  1HYZ A;  1VSE A;  1NKB A;  3O3H A;  3DLG A;  1ZBI A;  3AA3 A;  4FLX A;  1TV6 A;  1TL3 A;  1MU2 A;  1WN7 A;  4FLZ A;  4O4G A;  3B6O A;  4MFB A;  3L2U A;  3TAE A;  3SUP A;  3V1O A;  1B9F A;  3OYL A;  5HLF A;  1X9M A;  5KTQ A;  5CY4 A;  4FW1 A;  3ULD A;  3C95 A;  3ZSX A;  1IO2 A;  1LAW A;  4RW9 A;  4DSL A;  1SL1 A;  1JLE A;  3IS9 A;  4GVM A;  3JSM A;  1L3S A;  1QSS A;  4NCB A;  4Q5V A;  4HTU A;  4ZTF A;  4EP5 A;  3TAG A;  3M8S A;  1RDD A;  4KHU A;  2X74 A;  1RT5 A;  1EP4 A;  4HHT A;  1SL2 A;  1S5J A;  3TR8 A;  4N41 A;  4KKO A;  4DU3 A;  3TAM A;  1RIL A;  1YTU A;  3KD5 E;  2ETJ A;  3VQ5 A;  3O3G A;  1VRT A;  3C6T A;  3KLE A;  1VSF A;  1WSJ A;  1WSH A;  3FFI A;  3VQ8 A;  4CEZ A;  3OYN A;  3V4I A;  4FJ9 A;  3ZSV A;  1R0A A;  4M3Y A;  2G8H A;  2RN2 A;  3LP0 A;  1RT6 A;  1VSM A;  1BL3 A;  3AA5 X;  4CJ4 A;  3RMC A;  2QKK A;  4FM2 A;  1VSD A;  4KTQ A;  2D0B A;  4CJU A;  1JLA A;  4CK3 A;  3T3F A;  4AHC A;  4FJG A;  4M3R A;  4QOZ B;  1U45 A;  1RTD A;  3ISN C;  3WNF A;  1S1V A;  3NF8 A;  1J53 A;  4DQR A;  4OVL A;  3D45 A;  5CYQ A;  4CJS A;  1QTM A;  1VK0 A;  1XHX A;  3K2P A;  4ID1 A;  2JLE A;  1WAJ A;  3HXM A;  4CCH A;  1HYS A;  2HNY A;  2YNH A;  4CJQ A;  3EZ5 A;  3CQ8 A;  4BE1 A;  1VSH A;  1J54 A;  2P51 A;  3HL8 A;  3K5L A;  3LP2 A;  3S9H A;  1ASV A;  3LAK A;  3LDS A;  2O4G A;  3IAY A;  3KK3 A;  3C6U A;  3SQ4 A;  1WSG A;  1S1X A;  4CF9 A;  2G8K A;  1SUQ A;  4DTS A;  4DWI A;  1GOB A;  4CED A;  3AVI A;  2KZM A;  4DSF A;  4FM0 A;  1FXX A;  3DRP A;  3QIN A;  5HRN A;  1QSY A;  3P83 D;  4O55 A;  4N56 A;  4H4M A;  1JXB A;  3SPY A;  4E7I A;  3S3O A;  2YV0 X;  4DQS A;  5HRO A;  4ELT A;  4AH9 A;  5KRS A;  3UIQ A;  1TK0 A;  1ITG A;  3NE6 A;  4Z4H A;  2B4J A;  4B9S A;  4CGJ A;  4CF2 A;  4DTM A;  2X78 A;  3K5M A;  1RBT A;  1BI4 B;  3HPO A;  1BQM A;  2OPR A;  4FVM A;  4FK4 A;  3V9U A;  1UA1 A;  2OPS A;  4OLA A;  1NOZ A;  5KGW A;  3VA3 A;  5J2P A;  4QAG A;  3NF9 A;  4OJR A;  4CIF A;  1HJR A;  3TI0 A;  2FBV A;  1G15 A;  1CXQ A;  4LH4 A;  3VQE A;  1NK9 A;  1IKX A;  1T7P A;  4KI6 A;  3OYC A;  4PQU A;  5C24 A;  4CHO A;  2ZE2 A;  1C1B A;  3L2R A;  3NDK A;  4CFC A;  3OS0 A;  4IKF A;  5CZ2 A;  3VQP A;  3AVA A;  2LSN A;  4FK2 A;  4DSK A;  4E0D A;  3CFP A;  4E7K A;  3TAF A;  4ZTJ A;  1WAF A;  4BE2 A;  3RRH A;  3CM5 A;  3RRG A;  1KSP A;  4FJM A;  2IC3 A;  2GV9 A;  1LW2 A;  4FZY A;  3RMB A;  4W5Q A;  4KB0 A;  4CGF A;  1ASU A;  3L8B A;  4ELU A;  3QET A;  3KKR A;  4B9U A;  3CYM A;  4NYN A;  4W5R A;  4M45 A;  3SCX A;  1IG9 A;  4LD0 A;  3AVF A;  1J9A A;  4OLB A;  2YHB A;  2XRI A;  1DTQ A;  3PY8 A;  1HRH A;  1I39 A;  1BQN A;  1KFD A;  1XWL A;  4YFU A;  3SQ1 A;  3TAP A;  5E41 A;  5HP1 A;  1NJZ A;  2D5R A;  3KIO A;  2HVI A;  3SNN A;  3QES A;  3HPH A;  5FRO A;  3NCI A;  2HND A;  4PUO A;  5FRN A;  2HHQ A;  1LWE A;  4CJE A;  4FJ5 A;  3AVC A;  3K5N A;  4LY7 A;  1WSF A;  4FLU A;  1TK5 A;  1TKX A;  1KFS A;  1EET A;  4M3U A;  3DMJ A;  3BDP A;  3L3U A;  2OPP A;  3K58 A;  1T8E A;  3SI6 A;  4O0J A;  3PO5 A;  1BIZ A;  4FLY A;  4BE0 A;  4H4O A;  4FLV A;  1W9H A;  1Y97 A;  4KFB A;  3I0S A;  4RW4 A;  3OYB A;  3RMD A;  5KRT A;  2Z1G A;  5HRR A;  4B9N A;  4CJV A;  4DQQ A;  1SKS A;  2HHS A;  1RDA A;  2Y1J A;  1NKE A;  3ZSZ A;  4F2R A;  2HHV A;  2YKM A;  4FLT A;  2VG5 A;  3VQ9 A;  4AHT A;  3U3Y A;  2F8S A;  5CYM A;  2AJQ A;  1A5X A;  4CER A;  4C8O A;  1QQC A;  4CEA A;  3G0Z A;  4B9L A;  1YVU A;  2PYJ A;  3P5J A;  2DFF A;  4M41 A;  1YTA A;  2D0C A;  1QHT A; 
#chains in the Genus database with same CATH topology
 1GLA G;  3QEI A;  1KQS M;  4RW6 A;  2AA4 A;  4LH5 A;  1X3M A;  4NO7 A;  3K57 A;  1C0G A;  4AIL C;  1NKC A;  2OYQ A;  3A2F A;  4KTZ A;  3CCQ N;  4CES A;  1N32 K;  3OBY A;  3I0R A;  4K41 A;  1K8K A;  3NF7 A;  4H03 B;  5GIO A;  4DF8 A;  3NGY A;  4JKH A;  4Y1D A;  5DM6 L;  5FRM A;  1S22 A;  3CCE N;  5J1E A;  4GV9 A;  5J2Q A;  4L8R B;  1RFQ A;  3ULE A;  2F9W A;  3EE9 A;  3CHW A;  1TKT A;  1NK8 A;  1OH5 A;  4DQP A;  2W6L A;  1JJ2 M;  3THV A;  4KHY A;  1BGX T;  4FO0 A;  4JKB A;  4A5B A;  3VET A;  2BUP A;  4FK0 A;  1BI4 A;  3WT0 A;  3M8P A;  4JI3 K;  3SJH A;  4H5T A;  2G8V A;  2OZS A;  5C0Y A;  4WQ4 C;  3EN9 A;  3LAM A;  3E9L A;  3OYH A;  1BCM A;  4FWS A;  3QEP A;  1YUW A;  2VG6 A;  3IRX A;  2P1J A;  1VSJ A;  3KJV A;  4Z4G A;  1NGI A;  4DUZ K;  3LAL A;  1RGI A;  2A42 A;  4HTL A;  4V19 S;  2QWP A;  1SL0 A;  3O4N A;  4IO8 A;  4W5O A;  3KD1 E;  4ILH A;  3VEW A;  1O1W A;  1IKV A;  3VPZ A;  1FK9 A;  4DS5 A;  1C1C A;  2E4L A;  4KTW A;  4YOX A;  3OYJ A;  5EOY A;  2XO7 A;  1TAQ A;  1NG9 A;  1BWF O;  3LWL A;  3VA0 A;  1HNI A;  3O9T A;  2A1S A;  4AM6 A;  1REV A;  5BRF A;  1TGO A;  5JIC A;  5GAE P;  1TKD A;  3O80 A;  3OYA A;  3SBT A;  1WBB A;  4CZL A;  3MN6 A;  4J8F A;  4M42 A;  1C0F A;  5HOO A;  4MO4 A;  1SAZ A;  4CJ3 A;  1P8Z A;  4IZ9 A;  2P9P B;  3U9D A;  1UA0 A;  3KZB A;  5AQX A;  2HBM A;  4E7L A;  3E9P A;  4FZZ A;  2P9N A;  4I2Q A;  4FJX A;  3KK1 A;  1E3M A;  3AAP A;  3HO1 A;  3CQX A;  2VWK A;  3VQ4 A;  3MMV A;  3VF6 A;  4PWD A;  2XY8 A;  4CEQ A;  3FGU A;  4UQG A;  3V1Q A;  1VAZ A;  4MLH A;  3MEC A;  3HVR A;  2WON A;  4DFK A;  2IDO A;  5EU7 A;  4JS4 A;  3M1F A;  1YT3 A;  1WOQ A;  5C15 A;  5HL7 L;  3V9X A;  2X6S A;  3LM9 A;  5DK5 A;  4BDY A;  1S6Q A;  3GDQ A;  3VEO A;  2D4W A;  2ZGY A;  4DLG A;  1NJY A;  2YI1 A;  4OGC A;  3GOI A;  4JHD A;  4KHQ A;  5M1F A;  1NK5 A;  3PO4 A;  2GX9 A;  3G25 A;  4CJL A;  4NYF A;  3SQ0 A;  2DTU A;  4CZF A;  4XIU A;  4GVE A;  3CCJ N;  3V9W A;  3MEG A;  3GG4 A;  4E7H A;  5AFU A;  4IJA A;  5LMN K;  1Z05 A;  1X9W A;  2P9U B;  3DI6 A;  4DG1 A;  4E89 A;  1O13 A;  4E3S A;  3UKU B;  3OS1 A;  5H1S Q;  3S3N A;  4N47 A;  4H5V A;  3NH1 A;  4FLW A;  3OJU A;  3FLC O;  4FW2 A;  3D2F B;  1VQ5 N;  3MXJ A;  1F21 A;  3J7Y P;  3DXM A;  2HB5 A;  4AHS A;  4IG0 A;  4C23 A;  2E1Y A;  4FWM A;  2O8C A;  3O1W A;  3P31 A;  2NUB A;  3T1Y K;  3H45 C;  3QFU A;  3OTO K;  2A5X A;  1C0U A;  1L3T A;  3LWM A;  2Z1I A;  3FZK A;  2UU9 K;  4RTF D;  3H6E A;  5JVH L;  3SK3 A;  4J2B A;  1EKE A;  2G8W A;  4BRE A;  5JS1 A;  4H0P A;  2KHO A;  4A2B A;  1Z6R A;  2BAN A;  3R3L A;  3ZCM A;  4CHY A;  4FJI A;  3ZT1 A;  4E7J A;  4AHU A;  1NNE A;  5CE3 A;  1RBU A;  4B3O A;  4JKG A;  4KHS A;  3KLI A;  1KTQ A;  3ZT2 A;  1T6D A;  2P9K B;  1JL2 A;  3IUC A;  1U04 A;  1RNH A;  4DR3 K;  4GNI A;  1RDB A;  3ITH A;  4EHU A;  4B3S K;  2A6A A;  1X9S A;  4CIG A;  3NF6 A;  1T05 A;  3O4W A;  3H46 O;  4GMJ B;  4E1M A;  1FJG K;  1ZBH A;  4LF9 K;  3OJS A;  4KB1 A;  2HW3 A;  2Z1J A;  4YOT A;  1CXU A;  2QW9 A;  3DM2 A;  3QER A;  2PYL A;  2O8D A;  2Q0R A;  1GLB G;  3MXM A;  1NKB A;  4BRI A;  3O3H A;  3HOT A;  4FLX A;  4JNE A;  3THW B;  2P9I A;  1W97 L;  1MU2 A;  3WXM B;  1WN7 A;  3LDQ A;  4FLZ A;  2UXC K;  1MWK A;  3L2U A;  3SUP A;  3OYL A;  1B9F A;  5AQI A;  5HLF A;  4JI8 K;  5KTQ A;  2CGL A;  4MDB A;  3ZSX A;  4YOY A;  1JLE A;  1VQ7 N;  4IDH A;  5AQZ A;  4ZTF A;  2KKZ A;  3M8S A;  4FOI A;  1EP4 A;  2CH5 A;  4KKO A;  1YTU A;  3VQ5 A;  3O3G A;  3C6T A;  1WSJ A;  1WSH A;  4FJ9 A;  3FFI A;  1OH6 A;  2QWM A;  3LP0 A;  5C12 A;  5AZI A;  4WFN L;  1VSD A;  4KTQ A;  4KBO A;  4CJU A;  3PIO L;  3K9J A;  1HNW K;  1U45 A;  3O9Q A;  4CBW A;  1J53 A;  4OVL A;  1K8K B;  1WAJ A;  3HXM A;  1HYS A;  4CJQ A;  2YNH A;  1DT9 A;  1N5Y A;  3WXJ A;  3HL8 A;  3K5L A;  5AQN A;  4FVU A;  1ASV A;  3LAK A;  2O4G A;  3IAY A;  3KK3 A;  4H0O A;  3VF2 A;  4BRK A;  3FZM A;  4CF9 A;  3ULE B;  4DTS A;  2VQF K;  3ENB A;  4L3Q A;  1FXX A;  4FM0 A;  2PFU A;  4IXC A;  3SPY A;  2YV0 X;  4CZE A;  3CF5 L;  3VEX A;  4AH9 A;  4Z4H A;  4BRD A;  5E84 A;  1J6Z A;  4KH5 A;  4CGJ A;  1QVG M;  2X78 A;  1RBT A;  1BI4 B;  3HPO A;  3WXI A;  4IOX A;  4PKH A;  3TI0 A;  2P9S A;  3A5O C;  2FBV A;  3VQE A;  4ILG B;  4JV5 K;  3CER A;  4KI6 A;  3I33 A;  5C24 A;  2ZE2 A;  4PKG A;  3NDK A;  4FK2 A;  4E7K A;  3GL1 A;  3VTH A;  4BE2 A;  1ZBS A;  4BR5 A;  1Q7Y O;  3EKS A;  4YOV A;  4FZY A;  3ENH A;  3UB5 A;  4KB0 A;  1D4X A;  4CGF A;  1IBM K;  3CYM A;  2PAV A;  1BDG A;  4H0T B;  4BQZ A;  3AVF A;  1J9A A;  2FSK A;  4IOC L;  2XRI A;  2WUS A;  4YFU A;  5E41 A;  4XH1 A;  3KIO A;  4PL7 A;  2HVI A;  4CJE A;  4EIA A;  1TK5 A;  1WSF A;  4Y0W A;  1TKX A;  1OVY A;  3L3U A;  3B8A X;  1T8E A;  3N4P A;  4FWN A;  2UYT A;  1BIZ A;  4NLB A;  2E2P A;  1N33 K;  4FLV A;  4A5A A;  4DHY A;  1W9H A;  4RW4 A;  3SLC A;  3RMD A;  4KH4 A;  4CJ7 A;  2HHS A;  1SKS A;  2Y1J A;  1NKE A;  4O8K A;  2AJQ A;  1A5X A;  3AGK A;  1YVU A;  2VGM A;  3SMS A;  3P5J A;  2PYJ A;  2DFF A;  3VTI A;  2D0C A;  2OPQ A;  2ZF5 O;  3SV4 A;  2QA4 N;  1D9F A;  2V52 B;  4B1Y B;  1JCF A;  3O5B A;  4BRO A;  4FWL A;  3OW2 M;  2QWR A;  3NFA A;  1KVC A;  4O8U A;  2FBT A;  1RT7 A;  4K43 A;  5J2M A;  2P9N B;  1QS4 A;  3E66 A;  1LWC A;  4N76 A;  2XHB A;  1Z25 A;  3JYT A;  5JMV A;  4O44 A;  4JKE A;  1JCE A;  2UXB K;  1YIT N;  1RTI A;  3BGR A;  3AVH A;  1QQO A;  3OYI A;  5HRS A;  4FPA A;  2YHY A;  2E6M A;  1OKJ A;  3HPG A;  3CME N;  4FJK A;  3FFK B;  1I94 K;  3AO2 A;  3IKM A;  4H5N A;  4ZHR A;  1BG3 A;  3OYM A;  5ELZ A;  3MX5 A;  4WE1 A;  3KKS A;  2IVO A;  3NAE A;  1MDU B;  1GLC G;  3I8B A;  4ICL A;  1QQN A;  4M7X A;  4BWJ A;  4JHD B;  4BVP A;  1EXQ A;  3E1Y A;  4G1Q A;  3LPT A;  4CHZ A;  3KLH A;  4DMN A;  3NGI A;  3ZT0 A;  4E19 A;  4NXN K;  4FWP A;  3ENO A;  3FE1 A;  1ATN A;  1VQM N;  1HPZ A;  3I8D A;  3BP8 A;  4H5R A;  5JLF A;  3MAQ A;  3BZC A;  3OYE A;  4CF0 A;  4LSN A;  3MEE A;  2YKN A;  3O4Q A;  2I7P A;  4RW8 A;  1K73 O;  3CET A;  1M1K O;  3U8X A;  1GLF O;  1XI1 A;  3OYG A;  3H08 A;  3W3D A;  3C0B A;  3DXM B;  3RWU A;  4KHW A;  1NGB A;  3A0I X;  2O8C B;  1YIJ N;  2X6N A;  4IEE A;  3DLH A;  4FWO A;  5AQV A;  3MXI A;  1NGC A;  1UOC A;  3TAB A;  3F73 A;  4CBU A;  3AO3 A;  5GAD P;  3KK7 A;  4CZJ A;  1IJJ A;  3AA2 A;  2YCH A;  4F2S A;  3BZK A;  3HVT A;  1JLQ A;  2W42 A;  1U49 A;  3FZH A;  1NGF A;  4ELV A;  4RG8 A;  4IOA L;  2D0A A;  3C7N A;  2E6L A;  5GAG P;  3BF1 A;  4G9Z A;  3VGM A;  5FPD A;  4CEC A;  1XMQ K;  3MED A;  2PY5 A;  2D1K A;  5AQT A;  5K14 A;  3MX2 A;  3LP3 A;  3O3F A;  5JVG L;  1GLJ O;  1B9D A;  4DSI A;  3GBT A;  3R6M A;  1HKB A;  4JD2 A;  4CZH A;  2Q1N A;  4BR2 A;  4C1N I;  3T19 A;  1TUY A;  1RBS A;  2HNZ A;  3HST B;  4B08 A;  4DS4 A;  5HRP A;  3SAH A;  1KCF A;  1U6Z A;  3SQ2 A;  3SYZ A;  1Q81 O;  3M8Q A;  2QK9 A;  3VGL A;  2W6K A;  5AQF A;  1JL1 A;  2O8D B;  2ATQ A;  1S1W A;  2IVP A;  1RT3 A;  4CJW A;  3S3M A;  5IWA K;  3VF4 A;  3SUQ A;  1U4B A;  4CHN A;  2P9I B;  5AQL A;  4KV8 A;  5M1K A;  1T03 A;  3PSF A;  3A5N C;  4CIE A;  3F9M A;  1W2B M;  1NGD A;  4CW7 B;  4W5T A;  4OKJ A;  1KVB A;  1CZ9 A;  4IFV A;  2E2O A;  3LAN A;  1ZBL A;  2D0P A;  2W40 A;  1D5A A;  1QE1 A;  3CCL N;  4AQY K;  3T69 A;  1XHZ A;  4BRM A;  3TAN A;  2ITG A;  2RPI A;  4OKE A;  1K8A O;  4JYA K;  4DR5 K;  5M1O A;  5AZI B;  3CFR A;  4E1N A;  1S1U A;  4E1J A;  5JLH A;  2V7Z A;  4FXD A;  4J2E A;  4BRG A;  4ISG A;  3G10 A;  3E01 A;  3VQC A;  3PX4 A;  4ISF A;  3HYF A;  4CGH A;  2QXL A;  4KO0 A;  4DTU A;  1ZBU A;  1S9E A;  4NCG A;  5BN9 A;  1NGE A;  4C8K A;  1XC3 A;  3TSQ A;  4LFA K;  2IGI A;  3HP6 A;  3CFO A;  4I7F A;  5KI6 A;  4KI4 A;  2HMI A;  3HTV A;  3BY5 A;  1ATS A;  1NOY A;  2P9L A;  4CF1 A;  2JWK A;  1BO5 O;  5B8H A;  4BR7 A;  1U47 A;  3TTD A;  5AQJ A;  3ZYY X;  2DY4 A;  4Z4F A;  2EWS A;  1BOT O;  4B9M A;  3K59 A;  1NLV A;  2NNW A;  4BDZ A;  2P9S B;  3MN5 A;  4BRL A;  1YXQ A;  4M3W A;  4OX9 K;  2VCP A;  1BHL A;  1U48 A;  2FBX A;  4JRQ A;  3G4S N;  4BR4 A;  1TVR A;  1YVN A;  3L4I A;  3THX A;  3S41 A;  1DTT A;  1Q9X A;  4JKF A;  1C0T A;  3HM9 A;  4U67 L;  4I6M A;  3U3G A;  4EZ6 A;  3M3Z A;  4CGD A;  4JI7 K;  1JLB A;  3LDN A;  1GLD G;  1XMO K;  4K8X A;  3O9R A;  5HBM A;  1RTH A;  3QNN A;  1JLF A;  5I3U A;  3W0L A;  4H5W A;  2QWN A;  3O8M A;  1N8R O;  1ESV A;  1LWF A;  3WNH A;  1J5E K;  4F8R A;  3RR8 A;  3AVL A;  3KWG A;  5AQK A;  4BC4 A;  1RDW X;  5JS2 A;  4BRQ A;  1KXP A;  4DSJ A;  4FJ8 A;  4FYD A;  1GOA A;  3CMA N;  3P39 A;  4C1N K;  4B1X B;  4RW7 A;  1SZ2 A;  4BGA A;  3C94 A;  4OPH A;  1TV6 A;  2HBJ A;  1TL3 A;  1VHX A;  2YX6 A;  4H0X B;  2QWO A;  4O4G A;  3V1O A;  5CY4 A;  4GY2 B;  3WQU A;  5BN8 A;  4NCB A;  4HTU A;  1RDD A;  3D2E A;  3QBX A;  3T7Z A;  1BU6 O;  3VEV A;  4DU3 A;  4CI6 A;  5KPR A;  3KLE A;  1VSF A;  1NWK A;  3RVC A;  4CEZ A;  3OYN A;  3H3N O;  1VSM A;  3AA5 X;  4CJ4 A;  4X66 K;  3E9O A;  3WEE A;  3DXK A;  1JLA A;  4GKJ K;  3WNF A;  4RWT A;  1S1V A;  1QTM A;  4CJS A;  1WBD A;  1XHX A;  3K2P A;  4ID1 A;  4CCH A;  4BE1 A;  2I7N A;  1SUQ A;  2NRX A;  1GOB A;  2FF3 B;  2KZM A;  5HRN A;  3MWT A;  1XUP O;  4N56 A;  1JXB A;  4ELT A;  2IIR A;  1YJ9 N;  3MCA B;  3UIQ A;  1TK0 A;  4LC9 B;  4LFB K;  1X9J A;  3HI0 A;  4DTM A;  3K5M A;  2YHX A;  3Q7C A;  3V9U A;  4JI0 K;  3MN9 A;  1QHA A;  1G15 A;  4MO5 A;  1IKX A;  1CZA N;  3OYC A;  5GAH P;  4CHO A;  1OVQ A;  3OHR A;  1C1B A;  3AGR A;  3L2R A;  4CFC A;  3WUH A;  3OS0 A;  4IKF A;  3SBG A;  2LSN A;  1S3X A;  3CFP A;  3CPE A;  3TAF A;  3G6E N;  3CM5 A;  2GV9 A;  2E2N A;  3RMB A;  1ASU A;  1TYQ A;  4JKC A;  3O1B A;  4B9U A;  4NYN A;  2F7T A;  3BEX A;  4LD0 A;  4OLB A;  3O08 A;  1HR0 K;  1DTQ A;  5AFU H;  2NRZ A;  1BQN A;  1XWL A;  2O8F A;  4CVN E;  3BUZ B;  3SNN A;  2HHQ A;  2HND A;  1LWE A;  4FJ5 A;  4A57 A;  3K5N A;  4M3U A;  4FLU A;  3DMJ A;  3BDP A;  3CCR N;  3VOV A;  5I9E B;  4NLC A;  4FLY A;  4BE0 A;  2QM1 A;  1DGK N;  2IVN A;  4DQQ A;  3SAF A;  4F2R A;  2HHV A;  2VG5 A;  5CYM A;  4C8O A;  4CEA A;  3G0Z A;  3THY A;  2WTU A;  3QB0 A;  4BC5 A;  3C7N B;  4FSV A;  4DR2 K;  4M3X A;  1YTA A;  1SKR A;  1NK4 A;  4CEF A;  1JCG A;  1T3V A;  2HF3 A;  4PKI A;  1Q18 A;  1X1P A;  2E20 A;  4YOU A;  1ASW A;  1ATR A;  4CGI A;  2VG7 A;  2YHW A;  2VQE K;  4BWM A;  3GE1 A;  4C8L A;  4YOR A;  1KRP A;  4B8C A;  4LSL A;  5LJW A;  2GEL A;  1S72 N;  2ITM A;  4H8K A;  3KLF A;  3U6F A;  4EP4 A;  1NGH A;  4OGE A;  4XH4 A;  2PBD A;  4JD2 B;  4AHR A;  2Q36 A;  4I9L A;  3DLB A;  3QIP A;  1OH8 A;  3QO9 A;  4J2D A;  4KRE A;  3LZJ A;  4HUG A;  2NLX A;  4KAZ A;  1E4G T;  2IOC A;  4B1W B;  3DLL L;  1S1T A;  3CC4 N;  2WOM A;  2IS3 A;  4DF4 A;  1DLO A;  2A1R A;  2RKI A;  1QVF M;  1KLM A;  1ZBF A;  1LCU A;  2VGN A;  3AVM A;  1FW6 A;  4F4K A;  2V7Y A;  2KTQ A;  3KWI A;  2XY7 A;  2HBL A;  5BPN A;  2A3Z A;  3D0P A;  3OBW A;  4Z94 A;  4YNQ A;  4DTR A;  3CPW M;  3ZSW A;  2FBY A;  4HCB A;  3IFR A;  5EXW A;  1N36 K;  1ZXO A;  3VEN A;  2ZM6 K;  1IBK K;  1JLC A;  3IG1 A;  4AHV A;  4DLE A;  4B3R K;  2F9T A;  3ZT3 A;  2OA8 A;  3NMU A;  4KHP K;  3LP1 A;  4FWR A;  1YAG A;  1D9D A;  4M7Y A;  1GLE G;  1QSL A;  1JKH A;  4WQ5 A;  3ID6 A;  3O9S A;  1VQN N;  1UWB A;  1HMV A;  1EQY A;  2G8U A;  5BR8 K;  3ASM A;  2ZJQ L;  3SV3 A;  4B1Z A;  1QZ5 A;  3AVJ A;  1C0M A;  4FCY A;  2DPN A;  1UAX A;  4NXM K;  3NVK A;  3AO5 A;  4CEE A;  4DQ8 A;  3NVM A;  3PV8 A;  1NU0 A;  2XY6 A;  2WFB A;  1U2V A;  3EYZ A;  3VEZ A;  2XY5 A;  4R79 A;  3AO1 A;  3KLG A;  2Q0U A;  1NJX A;  1KC8 O;  1A5V A;  2I5J A;  2G8F A;  3EZW A;  1XC9 A;  4BY9 C;  1V4S A;  2P9L B;  1BCO A;  1QZ6 A;  3ZSR A;  4KRF A;  1MA9 B;  3KTQ A;  2GUP A;  3UE5 A;  1IBL K;  2HOE A;  3I55 N;  5DMR A;  3VQD A;  2OZM A;  2ZJR L;  3NH0 A;  5CZ1 A;  3WXL A;  3CQY A;  4JK9 A;  2HHX A;  1VQL N;  4FL9 A;  2ZGZ A;  3L0Q A;  4BRA A;  2HBK A;  1KD1 O;  4F9O A;  3HZ6 A;  4TSX A;  2EHG A;  4PHT X;  3WXK A;  3THX B;  4YOW A;  4B9V A;  2F8T A;  3PX0 A;  1A5W A;  4I6M B;  3MK6 A;  3K0S A;  2BGG A;  2HST A;  1JXE A;  2EX3 A;  1K6Y A;  2YNI A;  3NHG A;  1HKG A;  1SV5 A;  5C10 A;  1GLL O;  3SPZ A;  3HM8 A;  2JWL A;  5MLC Q;  1CZB A;  3U4L A;  1LAV A;  2P5G A;  3TSU A;  2NRW A;  1HYV A;  1VSI A;  3QNO A;  3VES A;  3MDQ A;  4W5N A;  3VEY A;  2Q2R A;  1B92 A;  2HHU A;  3EL2 A;  4DQI A;  4GW6 A;  3V6D A;  2DFH A;  1XQS C;  2GEM A;  3NBP A;  3H1Q A;  2FF6 A;  3SZ2 A;  2JGU A;  3JXU A;  4DV0 K;  4WQ4 A;  4DKW A;  5EY4 A;  4FOE A;  4PL8 A;  2RF2 A;  2BE2 A;  1NK7 A;  4CJR A;  3RTV A;  1Q8I A;  1L3V A;  5AQH A;  3ZET A;  3D2E B;  3CCU N;  1NGJ A;  4B8A B;  2BDP A;  2BTF A;  3DYA A;  4FWQ A;  2YNF A;  4Z4C A;  3CCV N;  1R59 O;  3A8Y A;  4JRP A;  1LW0 A;  2OCE A;  3F5T A;  3VQB A;  4J2A A;  4DR6 K;  4MDA A;  2ZQB A;  3AVK A;  3M6G A;  5CHI A;  3EE8 A;  1EO1 A;  2KW4 A;  3WEE B;  1RTJ A;  4CJ5 A;  2QTD A;  3DXK B;  3OYF A;  4CJP A;  3LZI A;  1BIU A;  4I9Q A;  1Z26 A;  3PX6 A;  3OYK A;  2HVH A;  4OPJ A;  1XNR K;  3NGZ A;  1HNV A;  4Z4I A;  4DV1 K;  3M8R A;  5AQO A;  3KVG A;  4KH6 A;  1NJW A;  1Y64 A;  4M3T A;  3UKR A;  4O5B A;  5T7B A;  4DFJ A;  4Y1C A;  3L2Q A;  4QS9 A;  1RCH A;  1RDU A;  1C6V A;  1VQO N;  5C2D A;  4B1V A;  4WCE L;  3PSI A;  3TPQ A;  4O5F A;  4DV2 K;  3L2V A;  4OKK A;  2NRT A;  3AA4 A;  3F2K A;  3DWL A;  3AAR A;  3ZX2 A;  5C25 A;  5J2N A;  2QI2 A;  3KK2 A;  2VWJ A;  5LY3 A;  2FLO A;  5TKY A;  3OY9 A;  4BRH A;  4Q0B A;  4HVJ A;  2Z1H A;  3AV9 A;  3WQT A;  5F0X A;  3AVB A;  4C8N A;  4CJK A;  4XEI A;  5M1Q A;  4B9T A;  1RT4 A;  1OH7 A;  2YNG A;  1JLG A;  5FLX O;  4MLE A;  5BRH A;  3VQA A;  2YHA A;  4JKG B;  4IO9 L;  2R7Y A;  2NRR A;  2OTL N;  1LOT B;  3CJ7 A;  2UXD K;  1TYQ B;  3DJC A;  1RT1 A;  3J80 O;  3A5L C;  4O0I A;  3P1G A;  2VWB A;  4FZX C;  4JK8 A;  3VN5 A;  4DCH A;  1Q82 O;  2O8F B;  4BQL A;  4FJL A;  4BRF A;  1RT2 A;  4Z0U A;  1CLQ A;  2O4I A;  3OVN A;  3IDH A;  3AO4 A;  3J8A A;  2KZZ A;  4PA1 A;  4DUY K;  3RSE A;  3M5R A;  3DLG A;  3AA3 A;  2WBN A;  1HKC A;  3B6O A;  3TAE A;  3FR0 A;  4A62 A;  3ULD A;  3C95 A;  1IO2 A;  1LAW A;  4DSL A;  1SL1 A;  4DV5 K;  3TTF A;  1QSS A;  1L3S A;  3EKU A;  4BG8 A;  4EP5 A;  3TAG A;  4KHU A;  1EWR A;  4DR1 K;  3PIP L;  4CD3 A;  1SL2 A;  3THY B;  1S5J A;  3TR8 A;  3TAM A;  3KD5 E;  2ETJ A;  1VRT A;  1YF5 L;  4FWK A;  2A41 A;  3ZSV A;  1R0A A;  4JKD A;  3ZEU A;  1RT6 A;  4FM2 A;  4A61 A;  2D0B A;  4CZG A;  4CK3 A;  3T3F A;  4AHC A;  4FJG A;  4M3R A;  3L6Q A;  3ISN C;  4X65 K;  3QBW A;  3D45 A;  5CYQ A;  2FSN A;  1VK0 A;  2JLE A;  3JAM O;  2HNY A;  3CQ8 A;  1NJI O;  3S3O A;  1J54 A;  2P51 A;  3LDS A;  5GIP A;  3C6U A;  3L4Q A;  1HJO A;  1S1X A;  1WSG A;  3SQ4 A;  1WB9 A;  4DR4 K;  2O8B A;  2OTJ N;  2ASP A;  4DSF A;  1G99 A;  3QIN A;  4WF9 L;  3P83 D;  4E7I A;  4DQS A;  5HRO A;  5KRS A;  2HHH K;  5TKW A;  1ITG A;  4CD1 A;  5ADX A;  2ASM A;  2B4J A;  2E5L K;  4B9S A;  1BQM A;  4FVM A;  4FK4 A;  1UA1 A;  4JAX A;  4OLA A;  2CGJ A;  5J2P A;  4YDU C;  1EWQ A;  3NF9 A;  4CIF A;  4M63 C;  3O6W A;  4LH4 A;  1T7P A;  1NMN A;  4K42 A;  3SMP A;  3LDP A;  2ZJP L;  3R9P A;  2D0O A;  4DSK A;  4JEP A;  3HRG A;  5LJV A;  4ZTJ A;  3QDK A;  3RRG A;  1KSP A;  1V4T A;  2IC3 A;  1LW2 A;  4BR0 A;  5DM7 L;  4ELU A;  3C6H A;  3AY9 A;  3KKR A;  1U2V B;  3SCX A;  4ILJ A;  2GWK A;  2YHB A;  4JN4 A;  1HRH A;  5FPN A;  3J7A P;  1NJZ A;  3NCI A;  4JI6 K;  3TU5 A;  4GKK K;  3CCM N;  3AVC A;  3H3O B;  1HNZ K;  2QWQ A;  1YJN N;  2OPP A;  3G71 N;  3K58 A;  3SI6 A;  3PO5 A;  1Y97 A;  3CJ1 A;  4KFB A;  1BUP A;  3OYB A;  1SS6 A;  5KRT A;  4B9N A;  4CJV A;  2E2Q A;  5ADX H;  4WYB A;  5M1N A;  3ZSZ A;  1KAY A;  2YKM A;  5AZJ A;  4FLT A;  4AHT A;  1QQC A;  3OA9 A;  3R8E A;  5E26 A;  5A2Q O;  2YJE A;  1QHT A;  1VQP N;  3CG7 A;  4CBX A;  3LL3 A;  4DTO A;  1ILY A;  3I56 N;  1KVA A;  5EX5 A;  1DEJ A;  3CJC A;  4C8M A;  3HSC A;  4AM7 A;  4IFE A;  3VQ7 A;  3OS2 A;  4FJ7 A;  3DLE A;  4CFA A;  1HQU A;  4JK7 A;  4CK1 A;  1VQ6 N;  3V81 A;  4DV3 K;  3DOK A;  2ASO A;  5KQD A;  1WSI A;  4CFB A;  3LPU A;  1MWM A;  1BIS A;  2A40 A;  4N5S A;  1S9G A;  4JS5 A;  3DRS A;  1L5U A;  2Q3S A;  3PUF A;  4HUE A;  2E1Z A;  1P90 A;  4CGG A;  2UUB K;  3TSP A;  2E88 A;  4PY5 A;  3ZT4 A;  1IKY A;  1ZC6 A;  2GBZ A;  2KQ2 A;  2VYP A;  3FZF A;  2GTD A;  1I3A A;  1EX4 A;  1NM1 A;  4DTX A;  4BC3 A;  3OYD A;  3HJF A;  4H0Y B;  1YI2 N;  5BRE A;  3SUO A;  5BRD A;  1Q9Y A;  1IKW A;  1VQK N;  3T1A A;  4DV7 K;  4F3T A;  1YJW N;  3ZET B;  1J5O A;  4HCC A;  5KPZ A;  4MQ3 A;  4LF4 K;  3LDL A;  4JI1 K;  4CHP A;  4OPA A;  4CZI A;  2B5J A;  1D8Y A;  1FKO A;  1T6C A;  1C1A A;  2ZD1 A;  4FJN A;  3MCP A;  5LMU K;  2O8E A;  4HWI A;  1IG8 A;  3QLH A;  1TKZ A;  3SUN A;  4K8Z A;  5C42 A;  1BA1 A;  1SQK A;  4FPB A;  3QEX A;  1RBR A;  4WFB L;  3LDO A;  4QCL A;  2P5O A;  2QWL A;  1HUX A;  4B3M K;  3HOS A;  3V9Z A;  3L3V A;  3P38 A;  1L3U A;  1TAU A;  4AF1 A;  2FSJ A;  3UKR B;  4CJF A;  1VRU A;  4EHT A;  4IG3 A;  3CJB A;  3ZLJ A;  2CH6 A;  3ID8 A;  3K5O A;  1SKW A;  4BAC A;  3VQ6 A;  4CZM A;  1FKP A;  2KFZ A;  5FPE A;  3J81 O;  2NRH A;  4DTP A;  5FPM A;  3MWP A;  3ZSY A;  1RDC A;  2YJF A;  5BR9 A;  4Z4E A;  5KPT A;  4IEI A;  4YY3 K;  1IH7 A;  4RCH A;  3K9K A;  2GUI A;  3RMA A;  1W0H A;  3D6R A;  3LM2 A;  4BRN A;  1E4F T;  4CK2 A;  2UUA K;  2FC0 A;  4EFH A;  4NCA A;  1DKG D;  5M1P A;  4ISE A;  3CM6 A;  4FJJ A;  5IT9 O;  3WNE A;  4B3T K;  5SZT A;  4EAH D;  2QKB A;  4ID5 A;  2KFN A;  3MN7 A;  4A2A A;  1NK6 A;  4LF7 K;  2IAJ A;  3QEW A;  1K9M O;  5KGX A;  3AVG A;  4WFA L;  1W7A A;  4K25 A;  3SJJ A;  1WSE A;  4H0V B;  5GIN A;  3C65 A;  3CC7 N;  4DU4 A;  5D3G A;  3F9K A;  3NH2 A;  3ZX0 A;  3V1R A;  2HHT A;  5AR0 A;  3VMF B;  3WNG A;  3ATV A;  3RSE B;  4LF5 K;  1NK0 A;  4JKA A;  5AQP A;  3DRR A;  1S6P A;  2WC9 A;  1LV5 A;  2H3G X;  2QXF A;  4DR7 K;  4CFD A;  4XH5 A;  3N4Q A;  2V51 B;  4KPY A;  4DSE A;  2F96 A;  4JLH A;  4BVO A;  5AQS A;  4IWV A;  4GV6 A;  3HBT A;  4HUF A;  2HHW A;  1WLJ A;  3DLK A;  2OAN A;  3SAG A;  4LF6 K;  4BC2 A;  3ZEU B;  3IMX A;  2PZS A;  1ZYQ A;  1WNS A;  2DFE A;  3C6A A;  4CF8 A;  4CHQ A;  3TWH A;  5I42 A;  1NGG A;  3B6P A;  1HNX K;  4U7B A;  3HK2 A;  4CZK A;  5SWM A;  1TL1 A;  3V9S A;  3QIO A;  3EEQ A;  4DFM A;  3VQQ A;  4CJT A;  4KHN A;  2O8B B;  3EY1 A;  4EZ9 A;  4DU1 A;  1M90 O;  1GOC A;  4B9Q A;  3HT3 A;  4M3Z A;  2B6A A;  1VSK A;  4IBN A;  3TAR A;  5C2F A;  4FJH A;  1TK8 A;  4DTJ A;  3T1H K;  4UY8 O;  1VQ4 N;  4OO1 J;  2G8I A;  2E8A A;  3AAQ A;  4R5P A;  5CR4 A;  3ALY A;  4YHH K;  3U9Z A;  4JI2 K;  4CEB A;  4OPK A;  2CGK A;  3R1X A;  3CJ9 A;  4IFY A;  3DAW A;  5FDL A;  4F3O A;  1H1V A;  1HPM A;  3Q7B A;  4BGB A;  1KLN A;  3PLA A;  4I2P A;  4BG9 A;  3P4I A;  2J4R A;  2P9P A;  4CEO A;  3QEV A;  3AVN A;  4BDP A;  2W41 A;  1N6Q A;  4FM1 A;  2Q97 A;  3ZSO A;  2GWJ A;  4CE9 A;  4JI5 K;  1IV0 A;  1TUU A;  5AQW A;  5BPL A;  3CIP A;  4QS8 A;  3DLR A;  3L2W A;  1HQE A;  5F2R A;  1VSL A;  1XNQ K;  3DOL A;  3FZL A;  1WUA A;  1RBV A;  3ZSQ A;  3HP9 A;  1HX1 A;  4DTN A;  4DV4 K;  2Y1I A;  2ZWH A;  4DFP A;  3VER A;  4BR9 A;  5AQY A;  3QFP A;  3J7Z O;  4IDK A;  4X64 K;  2KLA A;  3TAQ A;  1HYZ A;  1VSE A;  1ZBI A;  4LFC K;  4MFB A;  1X9M A;  4X62 K;  3CXC M;  5EVZ A;  5AQG A;  4FW1 A;  3A5M C;  4DB3 A;  4RW9 A;  4DV6 K;  2FXU A;  3IS9 A;  4GVM A;  5AQQ A;  5AZJ B;  3JSM A;  4Q5V A;  3CJA A;  3QML A;  2X74 A;  1RT5 A;  4HHT A;  4N41 A;  1RIL A;  1YHQ N;  1NGA A;  1NMD A;  2RE2 A;  3CI5 A;  3VQ8 A;  3V4I A;  4M3Y A;  2G8H A;  2RN2 A;  2P9U A;  1BL3 A;  5AQR A;  3RMC A;  2QKK A;  1NBW A;  3UKU A;  4QOZ B;  2AP1 A;  1RTD A;  2F4V K;  3NF8 A;  2BH1 A;  4DQR A;  3D2F A;  4JI4 K;  5AJ3 K;  1KAZ A;  3H1V X;  3EZ5 A;  3CCS N;  3S9H A;  3RR7 A;  1VSH A;  4A59 A;  3LP2 A;  4BRP A;  5AQM A;  2G8K A;  4DWI A;  4CED A;  3AVI A;  4IJN A;  1T44 A;  4YDU A;  5LL6 Z;  5BPM A;  3DRP A;  3O9U A;  1QSY A;  4O55 A;  2HMP A;  4H4M A;  1Q86 O;  3NE6 A;  3TTC A;  1VQ9 N;  4CF2 A;  2OPR A;  3ZX3 A;  2OPS A;  1NOZ A;  5KGW A;  3VA3 A;  4QAG A;  4OJR A;  1HJR A;  4QS7 A;  1CXQ A;  1NK9 A;  4PQU A;  4GV3 A;  1QQM A;  5CZ2 A;  3VQP A;  3AVA A;  4K0K K;  4E0D A;  2P9K A;  1WAF A;  2O8E B;  3RRH A;  1X3N A;  4FJM A;  4WQ5 C;  4NB4 A;  4W5Q A;  3VGK A;  3D7E O;  3L8B A;  3QET A;  1VQ8 N;  4W5R A;  4M45 A;  1IG9 A;  4LF8 K;  2Q31 A;  3BF3 A;  3PY8 A;  1I39 A;  3TAP A;  1KFD A;  3SQ1 A;  2QEX N;  5HP1 A;  2D5R A;  3QES A;  3HPH A;  3EO3 A;  5FRO A;  2HF4 A;  3CC2 N;  4PUO A;  5FRN A;  1KAX A;  3ATU A;  1BA0 A;  1KFS A;  4LY7 A;  1HLU A;  1EET A;  4O0J A;  3THW A;  4H4O A;  3CD6 N;  4BRC A;  3I0S A;  3QIC A;  3KHY A;  2Z1G A;  5HRR A;  3JS6 A;  2UUC K;  1RDA A;  5F1X A;  5KQ8 A;  3VQ9 A;  3U3Y A;  2F8S A;  2NRV A;  4CER A;  2NZT A;  4B9L A;  4B1U B;  1N34 K;  4M41 A;  2RHK A;  5AQU A; 
#chains in the Genus database with same CATH homology
 2OPQ A;  3SV4 A;  3QEI A;  1SKR A;  3CG7 A;  1D9F A;  1NK4 A;  4CEF A;  4DTO A;  4RW6 A;  4LH5 A;  1KVA A;  1X1P A;  1ASW A;  3K57 A;  4CGI A;  3NFA A;  1KVC A;  4C8M A;  2VG7 A;  2FBT A;  1RT7 A;  4AIL C;  4BWM A;  1NKC A;  4C8L A;  5J2M A;  1KRP A;  1QS4 A;  4B8C A;  2OYQ A;  4LSL A;  3A2F A;  4KTZ A;  4CES A;  4H8K A;  3KLF A;  3U6F A;  4EP4 A;  4OGE A;  3VQ7 A;  1LWC A;  3OS2 A;  4FJ7 A;  3DLE A;  4CFA A;  4N76 A;  3I0R A;  4AHR A;  4I9L A;  2XHB A;  1HQU A;  1Z25 A;  3NF7 A;  3QIP A;  3QO9 A;  3JYT A;  3DLB A;  4J2D A;  4CK1 A;  4DF8 A;  4KRE A;  3NGY A;  3LZJ A;  3V81 A;  4O44 A;  4Y1D A;  4HUG A;  4KAZ A;  3DOK A;  5FRM A;  2IOC A;  5J1E A;  5J2Q A;  1S1T A;  1WSI A;  1RTI A;  3BGR A;  4L8R B;  2WOM A;  4CFB A;  3LPU A;  2IS3 A;  1BIS A;  1DLO A;  3AVH A;  4N5S A;  4JS5 A;  1S9G A;  5HRS A;  3DRS A;  3OYI A;  2Q3S A;  2RKI A;  3PUF A;  2A1R A;  1L5U A;  1TKT A;  1NK8 A;  4HUE A;  4DQP A;  2E6M A;  3THV A;  4CGG A;  4KHY A;  3HPG A;  1BGX T;  1KLM A;  4FJK A;  1ZBF A;  3AO2 A;  4PY5 A;  4ZHR A;  3OYM A;  3AVM A;  3ZT4 A;  1IKY A;  4WE1 A;  4F4K A;  2GBZ A;  2KQ2 A;  3KKS A;  2KTQ A;  2XY7 A;  4FK0 A;  3NAE A;  1BI4 A;  1I3A A;  1EX4 A;  3D0P A;  4ICL A;  3M8P A;  4BWJ A;  4YNQ A;  3OYD A;  4DTX A;  4DTR A;  3HJF A;  1EXQ A;  3ZSW A;  3SUO A;  2G8V A;  2OZS A;  2FBY A;  4G1Q A;  4HCB A;  3LPT A;  1Q9Y A;  1IKW A;  3LAM A;  4CHZ A;  3KLH A;  3T1A A;  1JLC A;  4F3T A;  4DMN A;  3IG1 A;  4AHV A;  3OYH A;  4DLE A;  1J5O A;  3NGI A;  3ZT0 A;  4MQ3 A;  1BCM A;  4E19 A;  4HCC A;  3ZT3 A;  3QEP A;  2OA8 A;  2VG6 A;  3IRX A;  4CHP A;  3LP1 A;  2P1J A;  1VSJ A;  3KJV A;  2B5J A;  1D8Y A;  1FKO A;  1D9D A;  1C1A A;  1QSL A;  1JKH A;  4Z4G A;  1HPZ A;  2ZD1 A;  3I8D A;  4FJN A;  3MAQ A;  3OYE A;  1UWB A;  1HMV A;  3LAL A;  2G8U A;  4CF0 A;  3ASM A;  3MEE A;  2YKN A;  3O4Q A;  4LSN A;  3SV3 A;  3QLH A;  4RW8 A;  3AVJ A;  1C0M A;  1TKZ A;  4FCY A;  3SUN A;  1UAX A;  3O4N A;  1SL0 A;  4K8Z A;  5C42 A;  3AO5 A;  4CEE A;  4W5O A;  3PV8 A;  3KD1 E;  2XY6 A;  3QEX A;  1RBR A;  1XI1 A;  3OYG A;  1O1W A;  3EYZ A;  4QCL A;  2P5O A;  1IKV A;  3H08 A;  3RWU A;  4KHW A;  1FK9 A;  4DS5 A;  2XY5 A;  3RR7 A;  1C1C A;  2E4L A;  3AO1 A;  4KTW A;  3KLG A;  3V9Z A;  3L3V A;  3OYJ A;  2X6N A;  1NJX A;  1L3U A;  1TAU A;  1A5V A;  3DLH A;  2XO7 A;  1TAQ A;  2I5J A;  2G8F A;  3MXI A;  3LWL A;  3VA0 A;  1XC9 A;  1HNI A;  1UOC A;  4CJF A;  1VRU A;  3TAB A;  4IG3 A;  1BCO A;  3F73 A;  2A1S A;  3AO3 A;  3ZSR A;  3K5O A;  1REV A;  1TGO A;  1SKW A;  3AA2 A;  3VQ6 A;  4BAC A;  4KRF A;  3KTQ A;  1FKP A;  2KFZ A;  4F2S A;  1TKD A;  3HVT A;  5DMR A;  1JLQ A;  3VQD A;  3OYA A;  4DTP A;  2W42 A;  3ZSY A;  2OZM A;  1U49 A;  3NH0 A;  5CZ1 A;  1RDC A;  4M42 A;  4Z4E A;  2HHX A;  4ELV A;  1IH7 A;  4RG8 A;  2D0A A;  2GUI A;  4CJ3 A;  3RMA A;  4FJJ A;  4TSX A;  1W0H A;  2EHG A;  4CK2 A;  2E6L A;  1UA0 A;  2FC0 A;  4B9V A;  4NCA A;  2F8T A;  4CEC A;  3PX0 A;  1A5W A;  3MED A;  2PY5 A;  2BGG A;  5K14 A;  4E7L A;  3LP3 A;  4FZZ A;  3CM6 A;  3O3F A;  1JXE A;  2EX3 A;  1K6Y A;  2YNI A;  4I2Q A;  3WNE A;  1B9D A;  5SZT A;  1SV5 A;  3KK1 A;  3NHG A;  4DSI A;  4FJX A;  3HO1 A;  2VWK A;  4ID5 A;  3SPZ A;  2QKB A;  2KFN A;  3VQ4 A;  1CZB A;  1NK6 A;  2XY8 A;  4PWD A;  4CEQ A;  1LAV A;  2P5G A;  4UQG A;  2IAJ A;  3QEW A;  3T19 A;  3AVG A;  2HNZ A;  1RBS A;  3HST B;  3V1Q A;  4B08 A;  1WSE A;  5KGX A;  4DS4 A;  5HRP A;  3MEC A;  1HYV A;  1VSI A;  3SJJ A;  3HVR A;  2WON A;  3QNO A;  4DFK A;  2IDO A;  5EU7 A;  4DU4 A;  1KCF A;  5D3G A;  3F9K A;  3NH2 A;  4JS4 A;  4W5N A;  3SQ2 A;  3SYZ A;  3M8Q A;  2QK9 A;  1YT3 A;  1B92 A;  3V9X A;  3V1R A;  2X6S A;  2HHT A;  2HHU A;  1JL1 A;  5DK5 A;  4BDY A;  1S6Q A;  4GW6 A;  4DQI A;  2ATQ A;  3V6D A;  2DFH A;  1S1W A;  3WNG A;  1RT3 A;  1NK0 A;  4CJW A;  3NBP A;  3SUQ A;  3S3M A;  1U4B A;  4CHN A;  4DLG A;  3DRR A;  1S6P A;  3SZ2 A;  2JGU A;  4KV8 A;  1T03 A;  1NJY A;  4CIE A;  4OGC A;  1LV5 A;  2QXF A;  2RF2 A;  4W5T A;  4KHQ A;  4OKJ A;  4CFD A;  1KVB A;  2BE2 A;  1NK7 A;  1CZ9 A;  4KPY A;  4IFV A;  4CJR A;  1NK5 A;  4DSE A;  2F96 A;  4JLH A;  3PO4 A;  3LAN A;  3RTV A;  1Q8I A;  4CJL A;  1ZBL A;  1L3V A;  4NYF A;  3SQ0 A;  4M3X A;  2DTU A;  1D5A A;  1QE1 A;  4B8A B;  2BDP A;  4XIU A;  3DYA A;  3V9W A;  3MEG A;  4HUF A;  2YNF A;  2HHW A;  1WLJ A;  3DLK A;  4E7H A;  1XHZ A;  4Z4C A;  4JRP A;  3TAN A;  1LW0 A;  2ITG A;  2RPI A;  4OKE A;  1X9W A;  3VQB A;  4J2A A;  2PZS A;  3DI6 A;  4DG1 A;  2ZQB A;  3AVK A;  4E89 A;  3CFR A;  4E1N A;  1S1U A;  1ZYQ A;  2KW4 A;  1RTJ A;  4CJ5 A;  1WNS A;  2DFE A;  4CHQ A;  4CF8 A;  3OYF A;  3TWH A;  4CJP A;  4E3S A;  4FXD A;  3OS1 A;  3LZI A;  1BIU A;  3S3N A;  4J2E A;  5I42 A;  4I9Q A;  3G10 A;  1Z26 A;  3E01 A;  4N47 A;  3OYK A;  3VQC A;  3PX6 A;  2HVH A;  3NH1 A;  4OPJ A;  3B6P A;  4FLW A;  3OJU A;  3PX4 A;  3HYF A;  3NGZ A;  4FW2 A;  4CGH A;  3HK2 A;  1HNV A;  3MXJ A;  4KO0 A;  1F21 A;  4DTU A;  5SWM A;  1TL1 A;  1ZBU A;  3V9S A;  3QIO A;  1S9E A;  4NCG A;  4DFM A;  4Z4I A;  2HB5 A;  4AHS A;  4IG0 A;  3VQQ A;  4CJT A;  3M8R A;  4KHN A;  2NUB A;  3EY1 A;  4C8K A;  4EZ9 A;  4DU1 A;  2IGI A;  3HP6 A;  1C0U A;  1GOC A;  3CFO A;  4I7F A;  5KI6 A;  3HT3 A;  1NJW A;  1L3T A;  3LWM A;  2B6A A;  4KI4 A;  1VSK A;  4M3Z A;  2HMI A;  4IBN A;  3TAR A;  4M3T A;  4FJH A;  1TK8 A;  4DTJ A;  1NOY A;  4CF1 A;  2Z1I A;  4O5B A;  5T7B A;  2G8I A;  4DFJ A;  1U47 A;  4Y1C A;  3L2Q A;  4R5P A;  4J2B A;  1RCH A;  3ALY A;  1EKE A;  4DF4 A;  4Z4F A;  2DY4 A;  1C6V A;  2G8W A;  5JS1 A;  4B9M A;  4CEB A;  4OPK A;  3K59 A;  3L2V A;  4IFY A;  4OKK A;  5FDL A;  4F3O A;  2BAN A;  3ZCM A;  4CHY A;  4BDZ A;  3AA4 A;  1KLN A;  5C25 A;  4I2P A;  5J2N A;  4M3W A;  3KK2 A;  2VWJ A;  4FJI A;  1BHL A;  3ZT1 A;  4AHU A;  4E7J A;  3OY9 A;  1U48 A;  2FBX A;  1RBU A;  4B3O A;  4JRQ A;  1TVR A;  4CEO A;  4Q0B A;  4HVJ A;  2Z1H A;  3AV9 A;  3AVN A;  3QEV A;  1N6Q A;  4BDP A;  4KHS A;  1DTT A;  3AVB A;  3KLI A;  4FM1 A;  4C8N A;  1KTQ A;  4CJK A;  1Q9X A;  1C0T A;  3ZT2 A;  3HM9 A;  3ZSO A;  1JL2 A;  4B9T A;  1RT4 A;  1U04 A;  1RNH A;  2YNG A;  3U3G A;  1JLG A;  4CE9 A;  4EZ6 A;  1RDB A;  3ITH A;  4CGD A;  1JLB A;  1N5Y A;  3VQA A;  2YHA A;  2R7Y A;  1X9S A;  4K8X A;  5HBM A;  4CIG A;  3NF6 A;  1T05 A;  1RTH A;  3DLR A;  3QNN A;  3L2W A;  1HQE A;  4GMJ B;  1VSL A;  1JLF A;  4E1M A;  5I3U A;  3DOL A;  1ZBH A;  1RT1 A;  3OJS A;  4O0I A;  1RBV A;  4KB1 A;  2HW3 A;  2Z1J A;  3ZSQ A;  3HP9 A;  3P1G A;  4DTN A;  1CXU A;  1LWF A;  4FZX C;  3DM2 A;  3VN5 A;  3WNH A;  2Y1I A;  4F8R A;  3RR8 A;  3AVL A;  4DSJ A;  5JS2 A;  4FJ8 A;  4FYD A;  4DFP A;  4FJL A;  3QER A;  1RT2 A;  1GOA A;  4Z0U A;  1CLQ A;  2O4I A;  3OVN A;  4IDK A;  4RW7 A;  3AO4 A;  2PYL A;  3TAQ A;  2KZZ A;  4PA1 A;  3C94 A;  3MXM A;  1HYZ A;  1VSE A;  1NKB A;  3O3H A;  3DLG A;  1ZBI A;  3AA3 A;  4FLX A;  1TV6 A;  1TL3 A;  1MU2 A;  1WN7 A;  4FLZ A;  4O4G A;  3B6O A;  4MFB A;  3L2U A;  3TAE A;  3SUP A;  3V1O A;  1B9F A;  3OYL A;  5HLF A;  1X9M A;  5KTQ A;  5CY4 A;  4FW1 A;  3ULD A;  3C95 A;  3ZSX A;  1IO2 A;  1LAW A;  4RW9 A;  4DSL A;  1SL1 A;  1JLE A;  3IS9 A;  4GVM A;  3JSM A;  1L3S A;  1QSS A;  4NCB A;  4Q5V A;  4HTU A;  4ZTF A;  4EP5 A;  3TAG A;  3M8S A;  1RDD A;  4KHU A;  2X74 A;  1RT5 A;  1EP4 A;  4HHT A;  1SL2 A;  1S5J A;  3TR8 A;  4N41 A;  4KKO A;  4DU3 A;  3TAM A;  1RIL A;  1YTU A;  3KD5 E;  2ETJ A;  3VQ5 A;  3O3G A;  1VRT A;  3C6T A;  3KLE A;  1VSF A;  1WSJ A;  1WSH A;  3FFI A;  3VQ8 A;  4CEZ A;  3OYN A;  3V4I A;  4FJ9 A;  3ZSV A;  1R0A A;  4M3Y A;  2G8H A;  2RN2 A;  3LP0 A;  1RT6 A;  1VSM A;  1BL3 A;  3AA5 X;  4CJ4 A;  3RMC A;  2QKK A;  4FM2 A;  1VSD A;  4KTQ A;  2D0B A;  4CJU A;  1JLA A;  4CK3 A;  3T3F A;  4AHC A;  4FJG A;  4M3R A;  4QOZ B;  1U45 A;  1RTD A;  3ISN C;  3WNF A;  1S1V A;  3NF8 A;  1J53 A;  4DQR A;  4OVL A;  3D45 A;  5CYQ A;  4CJS A;  1QTM A;  1VK0 A;  1XHX A;  3K2P A;  4ID1 A;  2JLE A;  1WAJ A;  3HXM A;  4CCH A;  1HYS A;  2HNY A;  2YNH A;  4CJQ A;  3EZ5 A;  3CQ8 A;  4BE1 A;  1VSH A;  1J54 A;  2P51 A;  3HL8 A;  3K5L A;  3LP2 A;  3S9H A;  1ASV A;  3LAK A;  3LDS A;  2O4G A;  3IAY A;  3KK3 A;  3C6U A;  3SQ4 A;  1WSG A;  1S1X A;  4CF9 A;  2G8K A;  1SUQ A;  4DTS A;  4DWI A;  1GOB A;  4CED A;  3AVI A;  2KZM A;  4DSF A;  4FM0 A;  1FXX A;  3DRP A;  3QIN A;  5HRN A;  1QSY A;  3P83 D;  4O55 A;  4N56 A;  4H4M A;  1JXB A;  3SPY A;  4E7I A;  3S3O A;  2YV0 X;  4DQS A;  5HRO A;  4ELT A;  4AH9 A;  5KRS A;  3UIQ A;  1TK0 A;  1ITG A;  3NE6 A;  4Z4H A;  2B4J A;  4B9S A;  4CGJ A;  4CF2 A;  4DTM A;  2X78 A;  3K5M A;  1RBT A;  1BI4 B;  3HPO A;  1BQM A;  2OPR A;  4FVM A;  4FK4 A;  3V9U A;  1UA1 A;  2OPS A;  4OLA A;  1NOZ A;  5KGW A;  3VA3 A;  5J2P A;  4QAG A;  3NF9 A;  4OJR A;  4CIF A;  1HJR A;  3TI0 A;  2FBV A;  1G15 A;  1CXQ A;  4LH4 A;  3VQE A;  1NK9 A;  1IKX A;  1T7P A;  4KI6 A;  3OYC A;  4PQU A;  5C24 A;  4CHO A;  2ZE2 A;  1C1B A;  3L2R A;  3NDK A;  4CFC A;  3OS0 A;  4IKF A;  5CZ2 A;  3VQP A;  3AVA A;  2LSN A;  4FK2 A;  4DSK A;  4E0D A;  3CFP A;  4E7K A;  3TAF A;  4ZTJ A;  1WAF A;  4BE2 A;  3RRH A;  3CM5 A;  3RRG A;  1KSP A;  4FJM A;  2IC3 A;  2GV9 A;  1LW2 A;  4FZY A;  3RMB A;  4W5Q A;  4KB0 A;  4CGF A;  1ASU A;  3L8B A;  4ELU A;  3QET A;  3KKR A;  4B9U A;  3CYM A;  4NYN A;  4W5R A;  4M45 A;  3SCX A;  1IG9 A;  4LD0 A;  3AVF A;  1J9A A;  4OLB A;  2YHB A;  2XRI A;  1DTQ A;  3PY8 A;  1HRH A;  1I39 A;  1BQN A;  1KFD A;  1XWL A;  4YFU A;  3SQ1 A;  3TAP A;  5E41 A;  5HP1 A;  1NJZ A;  2D5R A;  3KIO A;  2HVI A;  3SNN A;  3QES A;  3HPH A;  5FRO A;  3NCI A;  2HND A;  4PUO A;  5FRN A;  2HHQ A;  1LWE A;  4CJE A;  4FJ5 A;  3AVC A;  3K5N A;  4LY7 A;  1WSF A;  4FLU A;  1TK5 A;  1TKX A;  1KFS A;  1EET A;  4M3U A;  3DMJ A;  3BDP A;  3L3U A;  2OPP A;  3K58 A;  1T8E A;  3SI6 A;  4O0J A;  3PO5 A;  1BIZ A;  4FLY A;  4BE0 A;  4H4O A;  4FLV A;  1W9H A;  1Y97 A;  4KFB A;  3I0S A;  4RW4 A;  3OYB A;  3RMD A;  5KRT A;  2Z1G A;  5HRR A;  4B9N A;  4CJV A;  4DQQ A;  1SKS A;  2HHS A;  1RDA A;  2Y1J A;  1NKE A;  3ZSZ A;  4F2R A;  2HHV A;  2YKM A;  4FLT A;  2VG5 A;  3VQ9 A;  4AHT A;  3U3Y A;  2F8S A;  5CYM A;  2AJQ A;  1A5X A;  4CER A;  4C8O A;  1QQC A;  4CEA A;  3G0Z A;  4B9L A;  1YVU A;  2PYJ A;  3P5J A;  2DFF A;  4M41 A;  1YTA A;  2D0C A;  1QHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...