4O0VA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0vA01
5BQ0A 1NT2A 4WRGA 4RZWA 2WMXA 5CI7A 5CAQA 1YXUA 4I93A 1PHKA 3AOXA 3GU7A 2C5XA 2J9MA 3RWQA 2WTJA 2G9XA 5KBQA 3LQ5A 4QQCA 2I0HA 4DEEA 3BGQA 2WMQA 4ITIA 4AN2A 1ND4A 4FICA 2CHLA 2IWIA 2ZM3A 3HKOA 3PLSA 3R2BA 4UMTA 1YOMA 3QGYA 5E91A 1ZOHA 4O7NA 4BTJA 1OM1A 4U44A 3WYYA 3NR9A 4GYGA 3OEZA 4RX7A 2WTVA 1V0PA 1XH8A 3ZLYA 4APPA 2O5KA 1IEPA 1YHSA 3BBTB 5AMNA 3R9RA 1IR3A 3HA8A 5HBHA 1PW2A 5DEWA 1H0WA 2OKRA 5BUIA 2XMYA 3BLRA 4O84A 3KVWA 3KU2A 3Q5IA 2IN6A 4UXLA 2PMNX 2XIRA 1URCA 4GT5A 4AE9A 4RC3A 5JN2A 4LL5A 4XG3A 4ANMA 2O65A 4IIRA 2HZNA 4XBUA 3P23A 2PZPA 4GSBA 3R1YA 1TVOA 1FQ1B 2PWLA 5BVFA 4BIBA 5CAOA 5L6OA 4JNWA 2ITZA 4R5SA 2QO2A 3ZZEA 2PUIA 4MD7E 3DKOA 2I1MA 4TYHB 4UX9A 2X6EA 3E88A 4EQUA 5IQGA 1AQ1A 2YFXA 4F7SA 2R3NA 3LXKA 3R73A 3SLSA 3EQIA 4U43A 5JKGA 5TE0A 4I5CA 4AGUA 4MK0A 3P9JA 2W1CA 5KZIA 3DK3A 3DKGA 5C8KA 4FNWA 4M0YA 3PXRA 2O2UA 4DLIA 4E20A 4KRDA 4GW8A 1NVRA 4EBVA 2GNIA 4RWKA 4KSQA 3G9NA 3U9NA 1FINA 5I9WA 5JRQA 1H8FA 1XHAA 3AC1A 4GH2A 4QMXA 4DEGA 4EOPA 3C4ZA 2YIRA 4O0YA 1W0XC 2EXMA 2QI8A 3R1QA 3GEQA 3W2QA 3NW6A 4F09A 4OBPA 3HAVA 2GMXA 3IGGA 2PUUA 2ITTA 4YJTA 4YPDA 3FQEA 3GB2A 2HZ0A 2XNPA 4JT3A 3MJ1A 4PDYA 2UW0A 3DK6A 3QQJA 2ZV7A 4IM0A 3QQFA 4O22A 3ZEWA 4HGSA 3BI6A 1L3RE 2J2IB 3RAIA 4FMQA 2VTAA 4O7RA 4G34A 3FUPA 4ASZA 4M3QA 2W9FB 3NNWA 4O0RA 4IJ9A 3TUDA 4BN1A 4YJVA 4ORKA 2AYPA 2QOIA 2OF2A 4IFCA 5CAPA 4CFVA 3R7IA 5EKNA 2VO7A 3W32A 1H25A 4NYEA 4C37A 2DYLA 2YA9A 2RFDA 1GZKA 2OXYA 3M11A 3HDMA 4DFXE 4MXZA 1JOWB 4BWKA 2VO0A 4PP7A 2BZJA 4K11A 3MBLA 2XZSA 4I5MA 4NK9A 4TT7A 5CQWA 5E7RA 5FBNC 2HIWA 2W05A 3WOWA 4BDCA 4RBLA 5D1JA 1QL6A 3ORKA 3CBLA 2VAGA 1Q3DA 4MX9A 2GHLA 4D28A 4E5AX 1ZY5A 3G9LX 3PLAE 4U5JA 3QU0A 4RC2A 3MVJA 3P7BA 4QP8A 4L00A 1XH9A 5CF5A 3C5UA 4X2KA 2VO3A 3PZEA 2X8IA 3A7HA 3UMXA 1FOTA 2ZB0A 3EQHA 3P08A 5AAFA 2X2LA 3EWHA 4L67A 5JFWA 3LFSA 3AT3A 2UZOA 3LFCA 4G3FA 4RA5A 3R9DA 4BDAA 3D5UA 4FT5A 2OJFE 4KIPA 4U42A 3DB6A 4U45A 4O91A 5JFXA 3OVVA 4R7HA 3CTQA 3RTPA 4BCGA 4IAZA 4UMRA 1ZAOA 1PMVA 2B1PA 2WFYA 3TNIA 3KXHA 1CMKE 2BR1A 2ZB1A 4AQCA 5BNJA 3SA0A 3RI1A 4E6CA 1R0EA 4MQ2A 1UA2A 1Q24A 5DA3A 2OZAA 2GTNA 4J8NA 5C8NA 3ZSIA 3D5XA 3CR0A 3B2WA 3FMKA 2F9GA 4X3JA 1ZOGA 4DH5A 3R8LA 3C1XA 2WAJA 3RJCA 3ZO3A 4XLVA 4DFLA 2WQEA 1W7HA 3FKLA 4TWPA 3UP7A 3DK7A 2UZBA 3LCOA 4TWOA 5HKMA 4YBJA 4NJ3A 4ZLZA 3FMDA 5LJJA 2XBAA 4Y95A 4IVCA 3DJ7A 5AUYA 5HESA 2UZWE 4YC6A 2BPMA 3IECA 3SHEA 4ACHA 4D4SA 4RIYB 2QLUA 3TZ8A 4EUTA 4FEQA 4UXQA 2WO6A 5LVLA 3E63A 3PSBA 5HVKA 4YC3A 4E4NA 3QZHA 2VNWA 2GU8A 4FTLA 2VTSA 2WQMA 5M56A 3F6XA 4P2KA 5H8EA 4D0WA 2ZYBA 1DI9A 5A54A 4G6NA 3CQEA 4NFNA 4J71A 1LPUA 1VZOA 2P2HA 4YZMA 4C62A 3FZPA 4UZHA 3DB8A 4LMNA 4XRJA 1P4OA 2HXLA 4YTFA 4RFZA 3D0EA 3MJ2A 4M8TA 2B9IA 3QTQA 5DEYA 1A48A 3UZTA 3LFQA 4ACGA 1PXJA 4WG3A 2VTLA 3KMWA 3FC1X 3ZS5A 3DFCB 3WZKA 5F4NA 5ETCA 3QQLA 3O0GA 4FF8A 1NY3A 4FTMA 5M09A 1YXVA 4CNHA 3DV3A 4M68A 4XBRA 3ORTA 3CGFA 5HIDA 5IQFA 1H27A 3UZPA 3JR1A 3B8QA 4AT3A 5BMSA 3DPKA 3TG1A 3KCFA 5ACBC 2JDSA 3EN6A 2VWIA 4FTAA 5HO8A 4A9SA 4G16A 2ETKA 2PVKA 1H1QA 3HUCA 1E1VA 1BKXA 3F69A 1UKHA 3UG1A 3UNZA 4PNIA 4FV3A 2GCDA 4HVSA 2X9EA 2IVVA 3FWQA 2X7FA 5EW3A 4AN3A 1YQJA 3OTVA 4G3GA 3F88A 3KKVA 4I0TA 5TKDA 3ITZA 3L1SA 3U55A 4UALA 5C4KA 3R9OA 3ZDUA 4O96A 4KIOA 3Q6WA 4RIWA 3TNHA 4BKYA 2YEXA 5M57A 3L8PA 3NIEA 2YIXA 2YABA 3ZRMA 4AOIA 3OWLA 2GNHA 2WTKB 3SW4A 3O7LD 3W10A 2VTOA 3KREA 3UBDA 4R7IA 2PSQA 2XNNA 3VUDA 1FGKA 3CKWA 4C34A 2G01A 1F3MC 4JOAA 3ORPA 1OIUA 2XYNA 2F7ZE 2G2HA 2P4IA 2VTNA 3DDQA 3G0FA 4IW0A 4C36A 5LVMA 2GSFA 4DITA 4KIQA 3THBA 4YO4A 3V8SA 5AV2A 3TT0A 1DS5A 1Y6AA 2IPXA 2FA2A 1ZOEA 3VUIA 1JNKA 2BMCA 5JZNA 3GC9A 5I9YA 2XNMA 2J5FA 1ZYCA 3P7CA 2NRUA 3SXFA 2ZVAA 3AGMA 4L3LA 4ZJIA 3VBXA 2OIQA 4J96A 1Q61A 4JQEA 4IB3A 4Z16A 5L2QA 4JBPA 3VIDA 2PUNA 4XEYA 4BHZA 5TR6A 4LG4A 5ANEA 4PMPA 2X39A 4LOOA 1WFCA 4GEOA 4K6ZA 4PUZA 3OWKA 3QRIA 5M08A 3TTIA 3ORMA 1NW1A 3QUDA 4IANA 2ITUA 4MNEA 5BVKA 2E9PA 1JKKA 4UMPA 2PY3A 5E1EA 4JX3A 3BBWA 4FTCA 5DHJA 1I09A 2XNEA 5HVYA 3W2CA 4DCEA 4D2VA 4JLCA 2XJ2A 4N4SA 3O8PA 5IDPA 3QD4A 4D0XA 2HY0A 2WNTA 4FT7A 3AQVA 4P5ZA 4I92A 3U8WA 3QWKA 1FMKA 4APCA 4FKLA 2B0QA 2Y4IB 3AC4A 4PL4A 2H8HA 4ZJJA 3T9IA 4FSMA 2ZOQA 3WBLA 3EQFA 2X8DA 4KABA 1KV1A 3BGPA 4RRVA 3ZDIA 1SYKA 4R77A 4BCPA 4QNAA 1XJDA 5FG8A 1H08A 1Q8YA 5EW8A 3CPCA 4MWIA 4K0YA 2ACXA 3R7UA 5AP2A 3A7FA 1B39A 5FXSA 4ANQA 4EOSA 5D7AA 4GFMA 4EH9A 5CT7A 4EONA 3COKA 2J50A 3DNDA 4YLJA 4F4PA 2YM5A 4JR3A 4WBBB 1J1BA 3QWJA 3UO6A 3IOKA 4M66A 4BDGA 3D7TA 3W8QA 3ZOSA 2BROA 5K0KA 4DEDA 5BX0A 5IISA 1V0BA 4CVAA 5EM5A 2RKUA 4GCJA 3QRKA 4JIKA 1R78A 3PIXA 4OT5A 3D2IA 5E8UA 4F7LA 3DAKA 4QMZA 2SRCA 1GNGA 4XHKB 4IDVA 5KX8A 5JMSA 3TKHA 3GQIA 5TOZA 1CTPE 3HL7A 4EOMA 3R1SA 5KKRB 1AD5A 2FVDA 2WMBA 2YM7A 2R3IA 4BBEA 1SVEA 4IC8A 4UMQA 4XG4A 4DF3A 3MVHA 4O1PA 2JD5A 4FT9A 5AP1A 2WU7A 4K1BA 3D94A 4O7WA 1QMZA 2CGWA 3DBFA 2C0IA 1URWA 4ACMA 1KE8A 2X7OA 3ORZA 3PTGA 4ACCA 3D5WA 2RFNA 4L53A 5EOBA 3ERKA 3UIUA 3BCEA 4BIEA 4D2TA 5CEPA 3PY3A 1FBNA 3R7YA 4IZ7A 5LCKA 5EM7A 2VWVA 2WTKC 4I23A 4ZMFA 4TPTA 4R3PA 4JAIA 4RG0A 4AOJA 2OK1A 3AC8A 5H8BA 3OT8A 3V6RA 3PWYA 5EG3A 4QTAA 4CT1A 5IUHA 1IAJA 3QRUA 2FYSA 3UPXA 1ZY4A 4D2SA 3EJ1A 4BDBA 3TDVA 3IPHA 4CMTA 2NO3A 2G1TA 4MXXA 5J8IA 3TZ7A 4G31A 3QL8A 4B6LA 5D41A 1YW2A 3AMAA 4HPTE 2XM9A 4M0ZA 2ZJWA 3LLAA 3O8TA 3R8MA 1YDSE 3S0OA 4GS6A 2QVSE 3BRBA 5CU4A 2HWPA 4KKEA 5AR8A 3QCXA 2VTPA 4R1YA 4XG8A 5CNNA 5TT7A 3RWPA 5HIEA 2IO6A 3O96A 4G5PA 4ZTHA 3W2SA 4IM3A 3RHXA 4BDEA 2YIWA 3B8RA 3GFEA 1RQQA 2WTIA 2R64A 4DEIA 4DLJA 3HX4A 4WBOA 2B53A 5CF4A 5IA3A 4HGLA 5EI8A 3LFEA 1S9JA 3UQFA 1XH6A 1GZ8A 3VUMA 3ORXA 4JI9A 2FB8A 2WKMA 3R9HA 3G6GA 3QTUA 4QPSA 5HG5A 3DNEA 3EL7A 4AGDA 4EOIA 3SRVA 4C4FA 4WG5A 1U46A 3SXRA 4LUDA 3RK7A 1E9HA 2Y4IC 2C3JA 3QBNA 3UYTA 3FI2A 3HV3A 4F7NA 4IWOA 3EMGA 2UVYA 2QR8A 3DKCA 3K54A 3R0TA 4IM2A 5EDPA 5F94A 3DJ6A 5EK7A 2CDZA 2VO6A 4AA5A 5KNJA 2WMSA 5F1ZA 2REIA 4FYOA 4YTCA 3OUKA 2BIYA 2J0LA 3C51A 3UGCA 4RWIA 4AT4A 4AZFA 3BZ3A 3FV8A 2X6DA 2R3JA 1UNGA 3RK9A 3FL5A 5E9EA 5E8XA 1R0PA 5CALA 3F3TA 3PG3A 4FT0A 4FV8A 2VTIA 4ASXA 2ERZE 5D9HA 4CFFA 2PVYA 2CGUA 5D12A 1GAGA 3VO3A 3D7ZA 2WQBA 4YP8A 4EH7A 3VN9A 2X7GA 4O7VA 5HG9A 2NP8A 1RDQE 5KKRC 1W8CA 4F1MA 3EH9A 2PVFA 3BHUA 5FEQA 3HV5A 1BI7A 1WCCA 2QG5A 3R83A 5KZ0A 5FM3A 4FZAB 2BFYA 4AOTA 4RIWB 1PRYA 4DTBA 2ONLA 4YTHA 2BALA 2I0VA 3FDNA 3QCQA 5ETAA 2WMVA 2BRMA 2WTCA 2XIKA 2QONA 5FUTA 2ITWA 2YM8A 3I60A 4FNZA 4LGDA 5AX9A 2UVXA 2OF4A 3FLWA 4U80A 3F3WA 4MVFA 3F5XA 5E90A 4JDIA 4QYYA 3ZBFA 5E92A 1FVRA 3O2MA 2PZRA 5L6WL 4AN9A 3OS3A 4EUUA 4PMTA 5ITAA 4A7CA 1OPLA 3RBWA 2XJ1A 1YOJA 4RIOA 4YHJA 1A9UA 1HCKA 2VN9A 2Y7JA 4FGBA 4V04A 3FZSA 3MYGA 5DRDA 3VBVA 4RWJA 3A4PA 3DY7A 2VZ6A 4FE2A 4I6BA 3QX4A 4FSWA 4LV5A 2UZLA 2XF0A 4FODA 4F63A 4A9UA 3GCVA 3LFDA 3BGZA 3FXXA 3D2KA 4W9WA 5EW9A 5FEEA 2Z7SA 3HECA 5KMJA 1J3HA 4IBMA 3GU6A 3R30A 4XV2A 2B55A 3VJOA 4CYJA 4BDIA 4YSMA 4Y46A 5F20A 2WPAA 3LJ1A 4QYGA 4F9BA 4FVQA 4YU2A 5CEOA 5J9ZA 2JFLA 1Q41A 2JIVA 3VS2A 1PMNA 2RGPA 4XV9A 3TNWA 4D4VA 2YWVA 2WZJA 4L68A 2LGCA 3D5VA 2PK9A 1BYGA 4XYFA 3GFWA 3VQHA 4MNEB 2CSNA 3PWDA 4MXOA 2VTQA 4FNXA 5EHLA 5IQAA 4FSNA 4F6SA 2R3RA 1XH5A 3FQSA 3MW1A 2IW6A 4L44A 4O0XA 4WOVA 1M7NA 4BTKA 4FEVA 4GKIA 3OBJA 4GT4A 3SDJA 5DVRA 4FTKA 4QMYA 3FLZA 3AC5A 4IACA 3ZFYA 1WBNA 3KXMA 1JAMA 4BI0A 2EB2A 4NT4A 3GCPA 4FKQA 4WNKA 4FA2A 5CANA 3KB7A 4F0FA 5AADA 1PKDA 3AT4A 2ETRA 2EXEA 2YN8A 3D9VA 5IUIA 2B9JA 4FIHA 3WI6A 3EIDA 5A4LA 4MBIA 2X9FA 2BAQA 2GNLA 4TKSA 4U3ZA 3ZC6A 3D7TB 2HCKA 3K5VA 5M4UA 2OJJA 3JVSA 4QPAA 3HRBA 2BHEA 2OGVA 2XBJA 4FKVA 5DYJA 5IA4A 4L9IA 2VWZA 4O7ZA 4I22A 3V8TA 2X2KA 4NTTA 2R7BA 3IQ7A 4HCVA 4KAOA 3COHA 3OMVA 1SM2A 5DR6A 3KVXA 4XS2A 5TO8A 2IZSA 2I40A 3QCSA 1PJKA 4WKQA 3BX5A 2QG7A 4AGWA 5IH5A 3PYYA 3ANRA 4Z7HA 2A0CX 4CFXA 4UYAA 3W8LA 2J4ZA 2UW6A 1UNLA 2BFXA 2C5YA 2R2PA 2QOHA 3EZRA 3G15A 3KN5A 3CQUA 1KOAA 4E26A 1JKTA 2GQRA 4FK6A 2C47A 4CXAA 2F49A 3QFVA 2X4ZA 4I21A 4CV9A 5L4QA 2BUJA 5HE0A 5LVNA 2I7QA 3GCSA 4FT3A 3PP1A 4FV7A 1Q97A 5CSXA 3OG7A 4U79A 2UW4A 3A8XA 4L52A 3VNTA 3TJCA 4FEXA 3G5DA 3LW0A 2UW5A 3IW6A 3QKLA 4G6OA 2HZ4A 5JGAA 4NEUA 4O7YA 2HXQA 3LCTA 4Z7GA 2R3MA 1TQPA 1WBVA 3KRLA 4D4YA 1BLXA 1P4FA 3CD3A 3H0ZA 5HTBA 4IQ6A 5H3QA 3WE4A 3T9TA 4UWCA 4QP3A 4U8ZA 3BPRA 4EK3A 4DH8A 4CFUA 2Y0AA 1ZXEA 4H1MA 3SGCA 3OT3A 4H3BA 3ZUTA 3DBQA 1WVWA 2UZEA 4G3EA 5M4CA 5IQHA 1WVXA 3HA6A 4TYIA 1OL7A 3C7QA 4YR8A 1PMUA 4ZTNA 2C0TA 4L8MA 1ZYLA 3VS1A 2WHBA 4GUBA 3UVRA 1BL6A 3HLLA 3F5PA 4RQKA 1XH4A 1O9UA 1MQ4A 4TTHB 4ZP5A 4O83A 3MIAA 4CSVA 5JK3A 3SG8A 3MN3A 2QNJA 4OTRA 2WMUA 3PJ2A 4Q5HA 5J5TA 2R3PA 5L8KA 2I0YA 4HOKA 2CGVA 4YNOA 4GK3A 5H2UA 3AD6A 3BYUA 3UE4A 4DGLC 1YXSA 1W84A 4ZJVA 4D55A 3NNXA 4AWIA 4FTUA 4AU8A 3NZ0A 3SRVB 4EEVA 4ENXA 4QMVA 2HYYA 3FQHA 4L7SA 3ULIA 3ZRKA 5JQ5A 3DTWA 3N51A 3BLQA 2C30A 4E93A 2BIKB 4E6DA 4FG9A 3ID6C 2WQOA 1VYWA 2C69A 4G3CA 3I5ZA 3F5GA 3PY0A 3WARA 4FZDB 2YM3A 5LWNA 4KUJA 3N4UA 4CFMA 1YHWA 4UB7A 4L3PA 3SX9A 5AUUA 3NGAA 1FPUA 1OZ1A 1WBPA 3GGFA 4I6FA 4WIHA 4MXAA 1PXPA 5DE2A 5E8SA 3I0OA 1OECA 4L7FA 3TKUA 5HCXA 3N4VA 3FZOA 1BUHA 4BCHA 4ANLA 1JQHA 4M69A 2WELA 3ENHA 5M06A 5J7HA 2CNUA 2CLQA 2HZIA 3VBQA 5I9ZA 3ZM4A 4YMJA 1SVHA 2VWXA 3GP0A 4IHPA 5G6VA 1WBTA 2YCFA 2YJRA 3EYHA 2UUEA 2R0UA 1UV5A 5IU2A 4FKWA 2C6DA 4X6QC 3MFRA 5HG7A 5BVWA 3G90X 4BDHA 2UW3A 4FIJA 4DA5A 4TRLA 2XJ0A 4QTCA 3HDNA 3KF4A 4FV1A 3DTCA 4GJ2A 5AUTA 2Z7LA 3TIYA 4FUYA 3W18A 3KULA 2YDIA 3BIZA 1OPJA 4FV6A 5AIKA 3CY3A 2VRXA 4EZ5A 2JDTA 3DQXA 3QTIA 3SOCA 3A2CA 3PIYA 1OBGA 3QUPA 4X2GA 4E4LA 4BZOA 5K9IA 3REPA 2BRGA 3ZLWA 4NW5A 2CJMA 3KXZA 3FE3A 3R28A 2FSTX 3QTZA 4BCFA 2YHVA 5CQUA 2F4JA 3EN9A 3ALOA 4CZYB 4F7JA 4O86A 2F57A 3VS6A 1IG1A 4RX9A 4TNBA 2C6LA 4DG3E 4DC2A 4EHVA 4P7EA 5DWRA 4X0MA 4DEBA 5EM8A 3MTFA 5KMLA 3CCNA 4C7TA 4ASDA 4FKUA 5A46A 1Q62A 4KWPA 4DYMA 5CZHA 1YI4A 4HCTA 4F64A 4LI5A 5FGKA 3R7GA 1OPKA 2F7EE 3VUTA 2PL0A 3LPBA 4H1JA 5HBJA 3SD0A 3AT2A 4X21A 2C6MA 3FPMA 4JAJA 5CSHA 5AUVA 3JS2A 3VBTA 2HY81 2BTSA 3ET7A 4BB4A 5I9UA 4AW2A 4QTBA 4O7LA 2QHNA 3MDYA 3R8UA 2WMRA 4F08A 2VNYA 3NYXA 4BYIA 2Z2WA 5AUXA 3NAYA 4G5JA 3TXOA 3ZUVA 2GFCA 4FGRA 4NM7A 5CT0A 4FIGA 1U54B 4II5A 1H00A 4O21A 1YI3A 5EM6A 3PE1A 1UWJA 2H6DA 3R1NA 4E3CA 1UKIA 4YLLA 3TUBA 3Q53A 4GK4A 4ARKA 1W82A 3GNIB 2WIHA 5C1QB 3Q9YA 4IWDA 4XG7A 4GFGA 4LM5A 3RHKA 4IB0A 3UC3A 3V5QA 2CN5A 4TY1A 3SQQA 4BDJA 5LQFA 3SV0A 3FMEA 5JFSA 2CN8A 3BV3A 4RGJA 4FX3A 3C0GA 3FY2A 3LQ3A 5JH6A 5EQEA 3IW8A 5GJDA 1U5RA 4LRMA 3RPYA 4DH3A 3ULZA 2PPQA 3FZRA 2Z02A 4QMQA 4RC4A 3VRZA 3HMPA 5HCYA 4F70A 3KMMA 4CGAA 3CC6A 4MF1A 4QQ5A 2XS0A 5K3YA 4WO5A 4EH8A 3V8WA 3RPOA 3V51A 4B8MA 3PFQA 3HMIA 3PXZA 3RGFA 4ITJA 3DU8A 4NH1A 5CVGA 4Z55A 2HAKA 5T68A 4ANOA 1LR4A 3LJ2A 4FSUA 4BF2A 3T3UA 3QA8A 5I3RA 2XRUA 2VX1A 4MHAA 4L01A 5EH0A 5J95A 2R4BA 1Q3WA 2XK9A 3DOGA 5AV4A 4AE6A 2O63A 3H0YA 2W96B 4WHZA 1S9IA 2OIDA 3A7JA 3D83A 5CYIA 4DHFA 4YLKA 3MVLA 4QTDA 5AX3A 2QC6A 2XVDA 2XKEA 1LP4A 2JAMA 5AP6A 1P2AA 3AMYA 1Y91A 5KMKA 2OW3A 3GUBA 4G3DA 4EL9A 4F9WA 3FAAA 5HEZA 2PULA 2BRHA 2H9VA 3F3VA 3ZEPA 2CGXA 4QMPA 5J1WA 2YIYA 3BHVA 4W4VA 2ONLC 3E8NA 3KRWA 1AGWA 2C3KA 4C38A 1CKJA 2CCHA 3JY0A 2IG7A 1WZYA 2W9ZB 5ANKA 4DT8A 1FGIA 3H10A 2HELA 3DQWA 4BGHA 2R0IA 3IW7A 4W8DA 1M7QA 4WSYA 3OXZA 4X7QA 4FG7A 4F0IA 3VS3A 5A4TA 1QPCA 2RIOA 5B0XA 4X6RA 2X4FA 4YJPA 1W98A 3ODYX 4I3ZA 5CNOA 4AZVA 2JDOA 2OFUA 3QQGA 1CKPA 1SVGA 5LVOA 2WMAA 3NEWA 2J7TA 4FV9A 3FI4A 2JKOA 1DM2A 4GMYA 4ZSLA 2Y9QA 4JBQA 4EHZA 2Q0BA 3CY2A 4AFJA 2Y6OA 2J0MB 3ZFXA 3E92A 3OCSA 4D5KA 3R6XA 5HU3A 5C03A 4FEUA 4FUXA 3VBWA 2GQSA 4WRSA 4IDTA 3GCQA 3N4TA 4ZTLA 4IAFA 3GU5A 4WNPA 2VUWA 2IJMA 3PIZA 3DGKA 4EK8A 3NIZA 2W5AA 1RJBA 1Z57A 3R21A 2C6OA 4CT2A 2JKMA 2GS7A 2W1FA 2ZM1A 1HOWA 2W5BA 4J53A 4KD1A 2IZTA 2OJIA 2V7OA 3MA3A 2ETMA 1MP8A 2ZAZA 4DFNA 1DAWA 4K9YA 1H1PA 3ZTXA 3EL8A 3IK3A 1H01A 4RZVA 4LRKA 3FZ1A 4ZIMA 1ZMVA 3DZQA 1PF8A 4XLIA 5HGIA 4I41A 4QMLA 4Z3VA 2RF9A 2VWWA 3SG9A 4K33A 1GJOA 4F9AA 5BUJA 3MV5A 3HGKA 3MPMA 4NSTA 4W4XA 2XB7A 4YUQA 3E64A 3NUPA 4DBNA 3KRXA 4EOKA 1Q8ZA 4TYEA 3NWWA 3IONA 4XUFA 5IQDA 4LQMA 4M7IA 3ELJA 2QURA 3DFAA 3H9FA 2KTYA 3TWJA 3Q04A 5BUEA 1G3NA 4U0IA 4ZTRA 1J7LA 3MI9A 1OITA 2XK8A 3MTLA 4W4WA 4ZZOA 4UYNA 4H05A 2ITNA 3GQLA 1ZYJA 3VUKA 2ITOA 4NL0A 2W1HA 3ZXZA 1NVQA 4M69B 5EDQA 3WZEA 2R7IA 3NSZA 5D11A 3R7OA 3Q4ZA 3VULA 4X2JA 5LMKA 5C01A 3V6SA 2YM6A 1PXOA 4MNFA 3ZHPC 5EOLA 4GIIA 4L3JA 4S30A 4TNDA 5DH3A 4J1RA 2O0UA 5GHVA 4FKSA 5IQCA 4FIFA 5IA5A 3R00A 2QR7A 3QGWA 4H58A 4LMUA 2R9SA 1OUKA 2CPKE 1XWSA 3C0IA 3KULB 5BPYA 4R6VA 4AZEA 4HVHA 4XP3A 3W55A 4ZTMA 4QQTA 4QNYA 1BI8A 1X8BA 2XUUA 4N6ZA 1XBAA 1V0OA 4FIEA 3BU3A 4FKRA 3UTOA 4FBXA 3PP0A 4PDSA 4S32A 4FTTA 1M14A 3M2WA 3ZXTA 4DINA 5L3AA 4ANSA 2BHHA 2G2IA 4U7ZA 5GJGA 4BTMA 5JGBA 3TV6A 1H1RA 3I1AA 4RX5A 5CY3A 2X8EA 4BY9E 4IJPA 3W33A 2V7AA 4DGGA 3IOPA 3A61A 4IWPA 3T8OA 4ZS0A 4NJDA 5M51A 5GIOE 3DXNA 2AC5A 3BELA 3C0HA 3HZTA 3CTHA 4OT6A 2IVUA 4YC8A 5ANJA 4B0GA 1MRVA 2PE1A 4EQCA 2DUVA 3LLTA 5HE2A 3S4QA 3Q32A 3DLSA 1IAHA 2YERA 5HIBA 2VWUA 3BEGA 4WNMA 5CX9A 1OBDA 2HK5A 3TKIA 3EQBA 3GOKA 5FLFA 3MB7A 3UVPA 5IF1A 1KE6A 2JKKA 3DS6A 3I4BA 4CYIA 5KUPA 5IA0A 3UJGA 3MGYA 3P7AA 5ANDA 1JWHA 1REKA 2XCKA 3BYVA 3K3JA 3I7BA 2GQGA 2RG6A 3GU4A 4IAKA 5HICA 1Z9XA 2ITXA 5IQBA 5M44A 5IPJA 4BGQA 3U4UA 2G15A 2P33A 1DI8A 2CKEA 2QOFA 4I24A 3MS9A 5B2KA 4GU9A 2PE2A 1G8SA 4U97A 3L9MA 2W4JA 3CJFA 4CLIA 4D2RA 2UZTA 3AC2A 3Q9WA 4HNIA 2VTTA 3QTXA 2ITYA 4JX7A 3AGLA 3Q4TA 1H4LA 3NUUA 4N6YA 4RJ5A 4ZEGA 4B8LA 4CQEA 5JT2A 3NUAA 5DT4A 4J52A 2J51A 4M67A 3DBCA 1BMKA 3VHEA 3L8VA 4J98A 4CV8A 5HZNA 3V01A 4EH6A 2EB3A 3Q4UA 2Z7QA 3RNIA 2YLFA 4N70A 5CENA 1MUOA 2A27A 2QOKA 3ALNA 3F7WA 3FKNA 3I79A 4FC0A 4L45A 5FTQA 2CNQA 3DAJA 3IW5A 2R3OA 1WAKA 1YVJA 2OH0E 4EYMA 4F6UA 4YSJA 3FMJA 1XO2B 4U40A 3VC4A 3ZSHA 5IQIA 4C4GA 3FKOA 3QZGA 1XKKA 1G5SA 4YZCA 5A6OA 3EKKA 4GFOA 1PXNA 4FOCA 1TQMA 4G17A 3LJ0A 1A06A 3W2RA 2OSCA 4LYNA 4QYFA 1ZLTA 4OLIA 3FLSA 4O0SA 4LFIA 3A7IA 4GG5A 2CCIA 3ACKA 2GHGA 1J91A 4XX9A 3WF7A 2UZUE 4FTQA 5HVJA 3ETAA 4YO6A 3UYSA 4FTNA 3WF6A 3LFAA 2Y8OA 3S3IA 4R3CA 4FTIA 2WMTA 5CLPA 5KE0A 4JVGA 4XRLA 5IDNA 4QMNA 1P14A 5AV0A 3FMMA 3I6WA 4JJRA 1GZNA 2A4LA 1APME 4EHEA 1YOLA 3II5A 4RIXB 5HBEA 4Y72A 4A07A 4EK4A 4RJ4A 3L9PA 2B7AA 4PV0A 2W99B 5AEPA 2YITA 3UODA 5EHYA 5IKWA 3TCPA 1B6CB 4X2NA 3MFUA 4FZFB 3HMOA 4C33A 3QQKA 4QMTA 4CFNA 3LCKA 3OZ6A 1FMOE 2PVJA 4RPVA 4C61A 1JBPE 4RQVA 4HVGA 4PF4A 5DPVA 3D4QA 5CASA 3C5IA 4M13A 4E4MA 2WB8A 4MCVA 1GZOA 2JDRA 2KULA 2R3KA 4KSPA 3TJDA 4HVIA 1J7IA 4CCBA 1OI9A 4M15A 4LL0A 4F65A 4JDKA 4PTCA 3A62A 3C4WA 5FXRA 3BWJA 3EN7A 2PVMA 5EYDA 2PVLA 1VYZA 3UQCA 3C4EA 3EQPA 3QHRA 4QD6A 4IB1A 4RMZA 1ZZLA 3KK9A 3LKMA 4K2RA 5C4LA 4AW5A 3QXOA 3EN4A 4MAOA 5D10A 1UWHA 5LWMA 4TYGA 4XG9A 4EWHA 3OXIA 1W83A 3RK5A 1BX6A 3OUNB 3NNVA 3F2NA 3RCJA 3PJCA 4YGAA 4BBFA 3PY1A 2O3PA 2JGZA 4IB5A 2BDFA 2RFEA 4FOBA 2RSVA 5DT0A 2GNFA 1Z5MA 4HVDA 1PXMA 4D2PA 4CKRA 5IZFA 2GDOA 3NCGA 3AMBA 3VF8A 1OKWA 3DKFA 4CCUA 4BDKA 3PVWA 3PA3A 3ZO4A 3BU5A 1XBCA 3FY0A 5AP0A 5IUGA 4D9UA 4EOJA 2QOLA 2WMWA 3TN8A 4GU6A 3FJQE 4YPSA 5GINE 3VVHA 3FEGA 3UC4A 3Q3BA 3KGAA 5HD7A 5FDPA 1WBWA 4I5PA 5ANIA 4C3PA 5DT3A 2C3LA 4BI2A 3G2FA 3PRFA 4C8BA 1VR2A 3DJ5A 3K2LA 2E2BA 5AP4A 1SZMA 3R04A 4BCIA 3E3BX 3PJ3A 2VGOA 1OL6A 1IRKA 4FNYA 4CZUA 4D5HA 4DG0E 5GNKA 2VX3A 3MWUA 4ALUA 4QYHA 1JSUA 1JVPP 1K9AA 3DCVA 3UMWA 4HZSA 5BVEA 3WYXA 5L2SA 4BWXA 4XOYA 3LXLA 4F99A 3WF5A 4BVUA 1UU8A 5TF9A 4AS0A 4P5QA 3HNGA 3NVKI 2BILB 4FTOA 5F9EA 4Y73A 2DQ7X 4NW6A 1ZMWA 4HYHA 3R02A 5CS6A 4EZ7A 3NCZA 4WT6A 4BYJA 4B9DA 3TNPC 5I3OA 4P4CA 2J0IA 3OP5A 4KIKA 4IAAA 4BZDA 2R3GA 4PNKA 2PVNA 2C6KA 3IG7A 4IXPA 4L46A 1OIRA 2I0EA 4FSTA 4OAVB 4ZY4A 2GS6A 1KUTA 3OOMA 1O6LA 3PA4A 5E8TA 2ZV9A 4EC8A 1OVEA 1Y8GA 4HJOA 3S95A 3IDPA 4FTJA 1OKZA 4BKJA 4ANNA 1ZZ2A 3HEGA 2WQNA 2EUFB 3I0QA 4GG7A 4JR7A 4RJ7A 1U54A 5J9LA 3KMUA 5CEQA 3TUCA 4OTGA 3L8XA 3EQGA 1ATPE 4BDFA 3CPBA 3FHRA 1CDKA 3DDPA 4QYEA 5J87A 3V5PA 2OJGA 5AM6A 3GC7A 2YDKA 2RG5A 4F9YA 5JSMA 4AZSA 4P90A 3UIXA 4EJ7A 3MH2A 3UIMA 2OWBA 4BCMA 1UU7A 1ZYDA 4HPUE 3E8DA 4JL9A 4MD8E 5CSWA 2XEYA 1YWVA 4GUEA 5H9BA 4MF0A 2P2IA 3U6HA 4C4JA 3LMGA 4H39A 4TW9A 2A1AB 3FPQA 5B2LA 5K0XA 2JLDA 4IX3A 5I4NA 5IEVA 4DFZE 4GYIA 2O8YA 3JPVA 4UWYA 2BRBA 3U51A 5GZ8A 5LCJA 2UVZA 2BDJA 4RFYA 3AC3A 4H3PA 4GL9A 5L8JA 3PVGA 3O23A 2QU5A 3AXWA 2AUHA 4I4EA 2WGJA 4GVAA 3JUHA 4Q2AA 4Q9SA 4RSSA 5EYKA 3WF8A 4U9AA 3BWFA 3DXPA 1K3AA 4O6LA 3ORIA 4YZNA 4ASEA 5AAGA 5CXZA 3QHWA 1H26A 2C6EA 3S2PA 3QD2B 2VU3A 5AAEA 2JIIA 3I7CA 3UZRA 4GVJA 2C5OA 4RA4A 1ERKA 4AZTA 1TQIA 1Q8UA 1SNUA 4FKOA 4FSRA 3R8VA 4BTFA 4OTFA 2ZDUA 2QHMA 3R7VA 3P4KA 4I6HA 4IVBA 2C1BA 3A60A 4J7BA 4PRJA 4ONAA 5HLWA 3L9LA 3U87A 4OTWA 3TNQB 3IDBA 3LAUA 5LMKC 1YWRA 2VV9A 4NM5A 3PSDA 3ZH8A 4D1SA 3BQRA 3CS9A 4W9XA 5HO7A 4O82A 4DN5A 3LFFA 4F1OA 5J79A 4BCKA 1CSNA 5HOAA 5CEKA 3NRMA 4ZK5A 2HW6A 3JXWA 2ITQA 4H36A 4AAAA 5L8LA 4JRVA 4ZSGA 5AV1A 4GT3A 3KCKA 2C68A 2PZYA 3MVMA 4FVPA 3C50A 4NM3A 2HW7A 5KHWA 4DFYA 2Y4PA 2JITA 2QOCA 5GZAA 4QMMA 4ZY5A 4O2ZA 5JGDA 3RAHA 2UV2A 3OEFX 1Q8WA 3LCDA 2YJSA 4B99A 2HWOA 3F9NA 4O0TA 3U54A 3QTSA 4FKIA 4M14A 4QO9A 4XV1A 2BCJA 4ZZMA 1OB3A 4LGGA 3FI3A 4BCOA 3WZUA 3QC9A 5HX6A 2UZNA 4DH1A 4JG7A 3L9NA 3UOLA 3W2PA 2OLCA 4BR3A 3CKXA 1DAYA 4NWMA 4ZOGA 3WE8A 4A4LA 5IMXA 3CGOA 4WNOA 2V62A 3IDCA 4QPMA 4B4LA 4AG8A 4KS8A 3I6UA 1Q5KA 2WEVA 5JEBA 5HX8A 5LMAA 4QT1A 3OW3A 3PJ8A 3LM0A 4AACA 3OC1A 5LVPA 3QQUA 4AUAA 1JSTA 2NPQA 2B4SB 1UU9A 2C5VA 2X1NA 3LFNA 3RALA 5FP6A 3AG9A 2C6TA 2ZM4A 4YZBA 5HE3A 4CTCA 3TV7A 4IFGA 2UW7A 4ZSJA 2OXDA 3F61A 4TWCA 3VHKA 3ZFMA 1Y57A 4NM0A 3UDBA 4RLKA 3GC8A 3RAWA 4EYJA 3PZHA 1OIQA 1OL2A 1PMEA 2BZKB 4QP7A 4Y5QA 4O38A 1R1WA 3R9NA 5M53A 1P5EA 3ANQA 3NUXA 4EH2A 1E1XA 1KV2A 3UQGA 4BDDA 5K5XA 1XH7A 3PSCA 5HHWA 3RAKA 4A4OA 4DTKA 3QCYA 4IC7A 4YJRA 4WUNA 4E6QA 3FI8A 1STCE 4ZLOA 4QP4A 3WIKA 2CKQA 3F82A 2JFMA 4PP9A 4DCAA 1PXKA 4RVMA 3BU6A 5GZ9A 2XNGA 4E6AA 1XQZA 2J0KA 2FSOX 1K2PA 1OL1A 4OBOA 2IZRA 4CMOA 2AC3A 3Q9XA 4MEDA 4NZWB 4W8EA 2YLEA 3GOPA 1GIHA 1PXLA 4MKCA 5JZJA 1LEWA 4XH6A 4O7SA 2YAKA 3GXLA 4V01A 4BRXA 3HMNA 3EYGA 3R8PA 1YXTA 5IEYA 1J7UA 3NS9A 2EVAA 3OWPA 2R5TA 3E5AA 3DXQA 3S1HA 3ZRLA 2OU7A 2PMIA 2W4OA 3EQCA 3TL8A 4AGCA 2A19B 4C4IA 3EFKA 1UU3A 5FM2A 1QPJA 2XK7A 3C4FA 3LOKA 4GIHA 5EKOA 5EDRA 4G2FA 3ORLA 5DI1A 5EI2A 3O8UA 2ZMCA 3FC2A 4YJUA 3UO5A 3ZZWA 2H96A 3HV6A 3I5NA 3QZFA 4NKAA 4R5YA 5ACKA 4JS8A 4F0GA 3ACJA 3EN5A 4Y5HA 4FKJA 3QAME 1GY3A 3NYOA 1ZRZA 5CU0A 2FO0A 3QA0A 5AV3A 4DE4A 4U81A 2WEIA 3QTWA 3NUNA 3MFSA 3PXQA 1H0VA 4OR5A 4FSYA 4RJ6A 4UY9A 4ALWA 4BZNA 4S33A 2NNWB 3LE6A 4KIKB 3TZ9A 3BHTA 1PKGA 5FBOA 4LRJA 2XIYA 3QF9A 5I9XA 4BGGA 5B7VA 4ERKA 2WU6A 4CQGA 3O17A 4RJ3A 5JRSA 2OICA 4E73A 2E9OA 4LV8A 2CKPA 3COMA 4JBOA 4ZSEA 3EKNA 3DLZA 3TIZA 2W4KA 4FIIA 3ZC5A 2VTJA 4PMSA 4BL1A 2GNGA 5HQ0A 5J5SA 5KMNA 4A9TA 3EFLA 4BI1A 5HCZA 1MRYA 4RJ8A 2C6IA 5J7BA 2CNVA 4NUSA 4CG9A 4Z9LA 5EYMA 2QOBA 3KL8A 5FWKK 3UPZA 1XR1A 2GPHA 3I81A 4EBWA 2OZOA 3CIKA 4JDHA 4MTAA 4UZDA 1QPDA 1PXIA 4I0RA 4NKSA 3GT8A 4GK2A 5IH6A 4BWPA 3KRJA 3PUPA 3C9WA 4G9CA 2BKZA 1WVYA 5HE1A 4CZTA 2XEZA 3HYHA 1JKLA 2UZVA 4OW8A 3SC1A 2BKKA 1PYXA 5EQPA 2X0GA 4GV1A 2Z8CA 2UW8A 4DT9A 5I0BA 3QUEA 1G8AA 4AW1A 2C1AA 4QP9A 4RLLA 5CI6A 1LUFA 3LXPA 2W17A 3UOJA 4FEWA 3W1FA 5M4IA 4KS7A 4J99A 4KKGA 3E7VA 2YIQA 3WF9A 3R71A 3ZYAA 2DWBA 3RCDA 4KA3A 4HYIA 3NUSA 4IX5A 3VRYA 3RM7A 3TACA 3ZUUA 4C58A 4YJOA 2EWAA 3QQHA 4KKHA 5DIAA 5HD4A 4O6EA 1U4DA 3VJNA 4FYNA 4NCTC 4NIFA 4U6RA 3LVPA 4E8AA 2PYWA 1ZYSA 4Y8DA 4MYGA 2WXVA 3ATTA 3VW8A 3PPZA 4ANBA 5T6KA 5CAVA 2PVHA 4QQJA 3PXFA 4CD0A 2BTRA 2FSMX 4PL5A 3VS7A 4L43A 3ZCLA 3JY9A 3O50A 3D14A 4O1OA 1NXKA 4QP1A 4RT7A 4KB8A 5FEDA 5HG8A 5JFVA 2X81A 1J1CA 3OF0A 3FYKX 5AJQA 4OTDA 3MY0A 2QU6A 1T45A 2ZV8A 2QOQA 2OJ9A 5ETFA 5DOSA 4YJQA 5AR3A 2R3LA 4C02A 3HRCA 4IH8A 1MRUA 4QRCA 3MY5A 2W1EA 1IASA 2XNBA 4ZS4A 3CQWA 4YZDA 2IW8A 4JQ7A 3NW5A 3FXZA 3MH3A 5CTPA 2JAVA 3E87A 3W2OA 5CAUA 4RIXA 3U6JA 2C3IB 3CSVA 3MH1A 3KC3A 5CF8A 4GKHA 2NRYA 2BRNA 3IKAA 4PDOA 2PE0A 3QALE 4MBLA 1O6YA 3NYNA 4J95A 3ZO2A 3RMFA 3CE3A 5KBRA 1VJYA 5EI6A 4QMWA 2B52A 4XV3A 3W16A 5HNGA 4C35A 2YISA 3VBYA 2V5QA 2XH5A 3FMLA 4MXCA 4CTBA 4C3FA 3POZA 4C0TA 2ESMA 3IW4A 4XOZA 2Z7RA 4YHTA 3BKBA 1JSVA 3RM6A 3PVBA 3TTJA 2OH4A 3E62A 5AR5A 5AA8A 2BZIB 3FHIA 2XRWA 3SOAA 4BKZA 5T3QA 4D4RA 1QCFA 5AP5A 5BVNA 3UVQA 5I9VA 5BYLA 1KE9A 2QD9A 5D7VA 5DR9A 1U59A 5L2TA 2YDJA 4DAWA 4QTEA 3QYZA 2YACA 2F2UA 2XK3A 5A4EA 3ZBXA 5FXQA 3CTJA 3PA5A 4OGRA 1FVTA 3EQDA 3F2AA 5DGZA 2B54A 3P79A 2CLXA 5DRBA 5AUWA 2F7XE 4K77A 3V3VA 4AT5A 5BVDA 5EQYA 3ZMMA 4R1VA 4DFBA 1XBBA 2GHMA 2J5EA 4IVAA 4ENYA 4DG2E 2F2CB 2CKOA 3TI1A 3FMHA 5IG1A 4FTRA 1Q99A 4M12A 4IMYA 5L2WA 1H07A 1JLUE 4FI1A 5L6PA 3ORNA 5CU2A 4N0SA 4QMSA 5CZIA 5DLSA 5DN3A 4ID7A 4DGOA 3MESA 2QO7A 3D15A 1VEBA 3MPTA 2OBJA 3GENA 1RE8A 3KXGA 4IVDA 4JDJA 4BC6A 3E8EA 3CXWA 5A6NA 3QD3A 4MWHA 1IA8A 4FVRA 2OIBA 5HNBA 5IA1A 3L8SA 3HV7A 3EQRA 3IGOA 4HYUA 4BCQA 5GIPE 2EU9A 1H1WA 3ZLSA 2HOGA 4EORA 5FP5A 3R2YA 3UNJA 4FG8A 3OY3A 3FLQA 5CVFA 3SXSA 3G0EA 4BIDA 4XNEA 4ZTSA 4X3FA 4A9RA 3HP5A 4S2ZA 2WOTA 4YJSA 1BL7A 2FUMA 3VS0A 4L6QA 3RVGA 4FZ6A 4LGHA 4PWNA 4EK5A 5AWMA 5AFVA 5AR2A 3RZFA 4Q5EA 4EJNA 4TWNA 3OCTA 3LIJA 3OD6X 5ETIA 2WTDA 4D1XA 2W7XA 3P5KA 5FTGA 1SNXA 1PY5A 2P55A 3G51A 4DGNA 2WD1A 4NFMA 4ZY6A 4XP0A 1M2QA 2BAKA 4FL1A 4Y85A 3R01A 2VTHA 4AZWA 4A06A 3P78A 3SW7A 5BYYA 2E9UA 3F7ZA 3QLFA 4NTSA 3MB6A 5J1VA 5KMOA 1Q8TA 3EOCA 3FMNA 2GTMA 3ENMA 3NYVA 5ANGA 2QODA 1KE5A 3B2TA 3FL4A 3OWJA 3UG2A 3VF9A 3IO7A 2PU8A 5GJFA 4FV2A 2V22A 5HO6A 4YHFA 4C3RA 3KXXA 3V5WA 1GIIA 1T46A 4MXYA 3H3CA 4O0UA 3Q2JA 3O51A 4FKGA 5AM7A 2PTKA 4FV5A 2V55A 4USEA 3Q52A 2QQ7A 3P1AA 2H34A 3BHYA 4IWQA 4LOPA 5CVHA 4I1ZA 4OBQA 2ZMDA 4NU1A 4QMOA 4I5HA 5AP7A 5BVOA 4YTIA 3R8ZA 4ZMEA 2PHKA 4G1WA 1OKYA 4DBXA 5KMIA 3H30A 1YHVA 3NAXA 4YBKA 1YRPA 3FYJX 4EWQA 2XK6A 4EC9A 4Y83A 2XP2A 3QD0A 3OY1A 5C9CA 2FGIA 3VUGA 3F66A 3KQ7A 4EI4A 4E1ZA 3FSKA 1ZWSA 5C27A 1GOLA 4H3QA 3C4XA 4QP2A 3M1SA 3Q4CA 4D9TA 3TV4A 3HV4A 3HMMA 1M52A 4FZ7A 4FR4A 4C2VA 4BICA 5M07A 3RNYA 4TZRA 4EOOA 3F5UA 3U4WA 3OROA 3VW6A 2IZUA 1Y6BA 4UWBA 4CFWA 4PY1A 5AP3A 4UEUA 4GJ3A 2OG8A 3R7EA 4RWLA 3LM5A 3EFWA 5A4CA 3UNKA 4IADA 4EZ3A 2XKDA 3OBGA 3QC4A 5FQDC 3MPAA 3PG1A 5BMMA 1H28A 1QPEA 3OCBA 4O0WA 3FXWA 4AFEA 4JG6A 4D2WA 5CEMA 4C59A 1YDRE 5LMBA 2VWBA 1F5QA 2OXXA 2VWYA 2W1ZA 4KNBA 5AUZA 3LMIA 5K4JA 4NIFB 2B9FA 1M2PA 5C26A 2QKWB 2XYUA 3AD4A 4U41A 3ZM9A 3COIA 3VS5A 4V0GA 4R7BA 5IQEA 4FSQA 4O7TA 2XM8A 3BYMA 4CG8A 5E8ZA 4EH5A 1YI6A 4HZRA 4XJ0A 3OW4A 4KBAA 2RFSA 3QYWA 4BBMA 4R78A 1JKSA 4TL0A 5CXHA 4UMUA 5KO1A 2QO9A 3ROYA 3EHAA 3TEIA 3Q6UA 2QKRA 4OTQA 3O71A 1NA7A 3QLGA 2XA4A 4HGTA 1RW8A 3V04A 3V5LA 2FH9A 2VD5A 2J6MA 2GS2A 3Q96A 3CLYA 4QMUA 4YJNA 5AA9A 2LAVA 4XMOA 3UP2A 4RVLA 5E1SA 1OIYA 4L42A 3POOA 1FVVA 3PDTA 3NX8A 3QX2A 2YCRA 5EYCA 3P0MA 4PPAA 3MA6A 2E9NA 2XK4A 4R8QA 1Q4LA 2IW9A 2C5NA 2IVSA 3MSSA 3OOGA 4I20A 4EKLA 3GC0A 2YCSA 5BYZA 5IEXA 4W4YA 3WIGA 5E4HA 4DEHA 2UW9A 4J8MA 4CRSA 3OHTA 2Q83A 2OZAB 5HTIA 2JIUA 3KK8A 4V05A 4BCNA 3EB0A 4CMUA 5F95A 4PMMA 3BV2A 3DA6A 4EOQA 4C4HA 2A2AA 5HI2A 3PVUA 3RPSA 4Q9ZA 4FL3A 5J9YA 3QTRA 2E9VA 3PXKA 3CEKA 5LARA 3ZO1A 4G6LA 3RP9A 1B38A 5LXMA 3TZMA 3GI3A 3QXPA 4FK3A 1WBOA 4TYJA 5IA2A 2JEDA 4E7WA 2W06A 4IX4A 4USFA 4O81A 2ITPA 2WIPA 3E3PA 3BE2A 4UV0A 3P86A 5M55A 1UNHA 2W1GA 3NMUF 1M17A 1H24A 3Q60A 4CRLA 4XG2A 5ICPA 3RPRA 4WSQA 3LFBA 5IMEA 4FL2A 4PX6A 4WD5A 4EKKA 5AR7A 3CP9A 4IAIA 3LHJA 3OXTA 1OMWA 2PMOX 2Q0NA 3DAEA 2BAJA 4WA9A 4ERWA 4OTPA 4E5BA 2XKCA 4EK6A 2PZ5A 4ZLYA 5E8WA 2XNOA 4HCUA 2W5HA 4KINA 4D58A 5A3XA 1MQBA 4EOLA 5HLNA 2BZHB 3EFJA 4IX6A 4OTIA 4CLJA 4BFMA 4NCTA 5JQ8A 2QLQA 3A7GA 1KE7A 2VGPA 1M2RA 4MQ1A 3ROCA 4C4EA 3GU8A 5AR4A 2QOOA 4CKIA 4AF3A 2I6LA 2GFSA 1OGUA 5A9UA 4LOQA 4A4XA 2OFVA 2IVTA 2YZAA 3PXYA 2P0CA 3NDMA 4RX8A 5DNRA 5B2MA 2PUPA 4UN0C 4YURA 3T3VA 3H9RA 4MD9E 3NVMB 3E8CA 4J97A 2PZIA 4XP2A 4CEGA 1NVSA 3R63A 1HCLA 1KSWA 3O7LB 4F1TA 1O6KA 2Y6MA 5DFPA 4C2WA 2UZDA 5EHOA 4D1ZA 5LOHA 4ITHA 4HGEA 2RL5A 3F3UA 2BDWA 3V5TA 3Q2MA 3WILA 5CF6A 4K8AA 5HU9A 4G9RA 4KRCA 4PPBA 1OL5A 3VWAA 3E93A 4O2PA 1YKRA 3FBVA 4RVTA 3VUHA 4TYHA 2W0JA 4X3FB 5CWZA 3ZLXA 3QKKA 4EQMA 3DBDA 4YZ9A 5HTCA 2ITVA 3BHHA 4XCUA 4E4XA 4FSZA 3N9XA 1WMKA 1L8TA 2XKFA 4I4FA 4OTHA 3PE2A 3GBZA 3U6IA 4EH3A 3GCUA 3R22A 4M84A 4PTGA 1TKIA 4ZAUA 4MH7A 2ERKA 3LMHA 2V0DA 3UO4A 2OI4X 3AD5A 3F2RA 5C8MA 4RFMA 3OCGA 4O27B 1R3CA 3PRIA 4JRNA 2JBPA 2PVRA 3G6HA 3DZOA 3GVUA 3PPJA 2OO8X 4O0VA 3PJ1A 1OUYA 1UVRA 2YCQA 3F3ZA 4GRBA 2VTRA 3MIYA 4FKPA 3E7OA 4DTAA 2J90A 2JBOA 3A99A 2EXCX 3OTUA 3JYAA 1LEZA 2YWPA 3LCSA 1I44A 3HVCA 4A9YA 3LXNA 4C57A 1IA9A 4N57A 3FLYA 4PL3A 2FSLX 2BVAA 2GNJA 4OAUC 3ZSGA 3KXNA 3BEAA 3H9OA 1CKIA 3TDWA 3U9CA 4JG8A 2PMLX 2W1IA 1WBSA 3KY2A 4JBVA 2C0OA 4TN6A 2R3HA 4FKTA 5FD2A 4IZYA 3SAYA 3A8WA 1PYEA 4B7TA 2R3QA 3M42A 1Y8YA 4FV4A 4IZAA 3HUBA 5E8VA 2ZDTA 3QKMA 3RKBA 3UIBA 2J0JA 4JIAA 4F6WA 1F0QA 3Q9ZA 5DBXA 1ZMUA 2CMWA 3QZIA 2YAAA 4IEBA 3WZJA 1JPAA 1KWPA 3SVVA 4AW0A 2YZLA 2WTWA 4AA0A 2VX0A 3HRFA 5A4QA 4WG4A 4PTEA 4PPCA 4S31A 3H4JA 3UOKA 3CJGA 3RINA 4QOXA 3KF7A 3K5UA 4QP6A 3G33A 4S34A 2WOUA 3KA0A 4MBJA 4JXFA 3NPCA 2O64A 5HNIX 4IE9A 4HNFA 5L2IA 3KFAA 4I0SA 4CKJA 5KCVA 2JC6A 2XIZA 3BQCA 4K18A 4HYSA 4YNEA 4V0GB 5DMZA 3MY1A 2R3FA 4FV0A 3SKCA 3HAMA 4DFUA 1R39A 2W1DA 3FLNC 1EH4A 3DBEA 4LUEA 5AIRA 3A4OX 3RPVA 4AP7A 3DT1A 1OKVA 3ZONA 4RVKA 4AA4A 3BLHA 1H1SA 3EZVA 3FZTA 4I94A 5ANOA 5H8GA 4EH4A 4X3FC 1V1KA 2G2FA 4ZTQA 2QCSA 3WZDA 5KMMA 2VTMA 1GIJA 4TXCA 3ODZX 3S00A 5CU6A 2DS1A 3IS5A 5CU3A 3HP2A 5CSVA 4U3YA 1YXXA 2XCHA 4IZ5A 3V5JA 3Q5ZA 5CEIA 3ZU7A 2JDVA 1REJA 5FTOA 4ZSAA 5IH4A 3K3IA 3PPKA 2B9HA 3NUYA 3VQUA 3LQ8A 5I5ZA 2P3GX 5K4IA 4I6QA 3FSFA 2XIXA 3NW7A 2YM4A 3C4CA 3C13A 4M97A 5EFQA 4ALVA 5K5NA 4KBKA 5E8YA 1KOBA 3BYOA 3BYSA 3MH0A 1CM8A 5FDXA 5DR2A 3NLBA 4AXAA 3LZBA 3ATSA 4RIYA 4USDA 2X2MA 3OFMA 4F9CA 3QRJA 4WUAA 1U5QA 3QRTA 2Z60A 3RZBA 2ZV2A 4DH7A 3KEXA 3TM0A 1SMHA 1YDTE 4JQ8A 4OUCA 5KHXA 4KBCA 4BCJA 5HORA 3UOHA 3CD8A 3VAPA 2HENA 3NNUA 4EHGA 5A14A 3VS4A 3JVRA 5G1XA 4R3RA 4XG6A 3KRRA 5DG5A 4HW7A 5M4FA 4AX8A 5CSPA 4UBAA 5FRIA 4BHNA 1YWNA 2JKQA 5HLPA 4E5WA 4PQNA 3KN6A 3MFTA 4IAYA 4ZXTA 4X2FA 3BE9A 4ACDA 4DGMA 1ZARA 4PDPA 2C4GA 4ZZNA 4DEAA
chains in the Genus database with same CATH superfamily
5BQ0A 1NT2A 4WRGA 4RZWA 2WMXA 5CI7A 5CAQA 1YXUA 4I93A 1PHKA 3AOXA 3GU7A 2C5XA 2J9MA 3RWQA 2WTJA 2G9XA 5KBQA 3LQ5A 4QQCA 2I0HA 4DEEA 3BGQA 2WMQA 4ITIA 4AN2A 1ND4A 4FICA 2CHLA 2IWIA 2ZM3A 3HKOA 3PLSA 3R2BA 4UMTA 1YOMA 3QGYA 5E91A 1ZOHA 4O7NA 4BTJA 1OM1A 3AKLA 4U44A 3WYYA 3NR9A 4GYGA 3OEZA 4RX7A 2WTVA 1V0PA 1XH8A 4FRFA 3ZLYA 2O5KA 1IEPA 1YHSA 3BBTB 5AMNA 4APPA 3R9RA 1IR3A 3HA8A 5HBHA 1PW2A 5DEWA 1H0WA 2OKRA 5BUIA 2XMYA 3BLRA 4O84A 3KVWA 3KU2A 3Q5IA 2IN6A 4UXLA 2PMNX 2XIRA 1URCA 4GT5A 4AE9A 4RC3A 5JN2A 4LL5A 4XG3A 4ANMA 2O65A 4IIRA 2HZNA 4XBUA 3P23A 2PZPA 4GSBA 3R1YA 1TVOA 1FQ1B 2PWLA 5BVFA 4BIBA 5CAOA 5L6OA 4JNWA 2ITZA 4R5SA 2QO2A 3ZZEA 2PUIA 4MD7E 3DKOA 2I1MA 4TYHB 4UX9A 2X6EA 3E88A 4EQUA 5IQGA 1AQ1A 2YFXA 4F7SA 2R3NA 3LXKA 3R73A 3SLSA 3EQIA 4U43A 5JKGA 5TE0A 4I5CA 4AGUA 4MK0A 3P9JA 2W1CA 5KZIA 3DK3A 3DKGA 5C8KA 4FNWA 4M0YA 3PXRA 2O2UA 4DLIA 4E20A 4KRDA 4GW8A 1NVRA 4EBVA 2GNIA 4RWKA 4KSQA 3G9NA 3U9NA 1FINA 5I9WA 5JRQA 1H8FA 1XHAA 3AC1A 4GH2A 4QMXA 4DEGA 4EOPA 3C4ZA 2YIRA 4O0YA 1W0XC 2EXMA 2QI8A 3R1QA 3GEQA 3W2QA 3NW6A 4F09A 4OBPA 3HAVA 2GMXA 3IGGA 2PUUA 2ITTA 4YJTA 4YPDA 3FQEA 3GB2A 2HZ0A 2XNPA 4JT3A 3MJ1A 4PDYA 2UW0A 3DK6A 3QQJA 2ZV7A 4IM0A 3QQFA 4O22A 3ZEWA 4HGSA 3BI6A 1L3RE 2J2IB 3RAIA 4FMQA 4DHZA 2VTAA 4O7RA 4G34A 3FUPA 4ASZA 4M3QA 2W9FB 3NNWA 4O0RA 4IJ9A 3TUDA 4BN1A 4YJVA 4ORKA 2AYPA 2QOIA 2OF2A 4IFCA 5CAPA 4CFVA 3R7IA 5EKNA 2VO7A 3W32A 1H25A 4NYEA 4C37A 2DYLA 2YA9A 2RFDA 1GZKA 2OXYA 3M11A 3HDMA 4DFXE 4MXZA 1JOWB 4BWKA 2VO0A 4PP7A 2BZJA 4K11A 3MBLA 2XZSA 4I5MA 4NK9A 4TT7A 5CQWA 5E7RA 5FBNC 2HIWA 2W05A 3WOWA 4BDCA 4O4EA 4RBLA 5D1JA 1QL6A 3ORKA 3CBLA 2VAGA 1Q3DA 4MX9A 2GHLA 4D28A 4E5AX 1ZY5A 3G9LX 3PLAE 4U5JA 3QU0A 4RC2A 3MVJA 3P7BA 4QP8A 4L00A 1XH9A 5CF5A 3C5UA 4X2KA 2VO3A 3PZEA 2X8IA 3A7HA 3UMXA 1FOTA 3AKKA 2ZB0A 3EQHA 3P08A 5AAFA 2X2LA 3EWHA 4L67A 5JFWA 3LFSA 3AT3A 2UZOA 3LFCA 4G3FA 4RA5A 3R9DA 4BDAA 3D5UA 4FT5A 2OJFE 4KIPA 4U42A 3DB6A 4U45A 4O91A 5JFXA 3OVVA 4R7HA 3CTQA 3RTPA 4BCGA 4IAZA 4UMRA 1ZAOA 1PMVA 2B1PA 2WFYA 3TNIA 3KXHA 1CMKE 2BR1A 2ZB1A 4AQCA 5BNJA 3SA0A 3RI1A 4E6CA 1R0EA 4MQ2A 1UA2A 1Q24A 5DA3A 2OZAA 2GTNA 4J8NA 5C8NA 3ZSIA 3D5XA 3CR0A 3B2WA 3FMKA 2F9GA 4X3JA 1ZOGA 4DH5A 3R8LA 3C1XA 2WAJA 3RJCA 3ZO3A 4XLVA 4DFLA 2WQEA 1W7HA 3FKLA 4TWPA 3UP7A 3DK7A 2UZBA 3LCOA 4TWOA 5HKMA 4YBJA 4NJ3A 4ZLZA 3FMDA 5LJJA 2XBAA 4Y95A 4IVCA 3DJ7A 5AUYA 5HESA 2UZWE 4YC6A 2BPMA 3IECA 3SHEA 4ACHA 4D4SA 4RIYB 2QLUA 3TZ8A 4EUTA 4FEQA 4UXQA 2WO6A 5LVLA 3E63A 3PSBA 5HVKA 4YC3A 4E4NA 3QZHA 2VNWA 2GU8A 4FTLA 2VTSA 2WQMA 5M56A 3F6XA 4P2KA 5H8EA 4D0WA 2ZYBA 1DI9A 5A54A 4G6NA 3CQEA 4NFNA 4J71A 1LPUA 1VZOA 2P2HA 4YZMA 4C62A 3FZPA 4UZHA 3DB8A 1XMMA 4LMNA 4XRJA 1P4OA 2HXLA 4YTFA 4RFZA 3D0EA 3MJ2A 4M8TA 2B9IA 3QTQA 5DEYA 1A48A 3UZTA 3LFQA 4ACGA 1PXJA 4WG3A 2VTLA 3KMWA 3FC1X 3ZS5A 3DFCB 3WZKA 5F4NA 5ETCA 3QQLA 3O0GA 4FF8A 1NY3A 4FTMA 5M09A 1YXVA 4CNHA 3DV3A 4M68A 4XBRA 3ORTA 3CGFA 5HIDA 5IQFA 1H27A 3UZPA 3JR1A 3B8QA 4AT3A 5BMSA 3DPKA 3TG1A 3KCFA 5ACBC 2JDSA 3EN6A 2VWIA 4FTAA 5HO8A 4A9SA 4G16A 2ETKA 2PVKA 1H1QA 3HUCA 1E1VA 1BKXA 3F69A 1UKHA 3UG1A 3UNZA 4PNIA 4FV3A 2GCDA 4HVSA 2X9EA 2IVVA 3FWQA 2X7FA 5EW3A 4AN3A 1YQJA 3W0NA 3OTVA 4G3GA 3F88A 3KKVA 4I0TA 5TKDA 3ITZA 3L1SA 3U55A 4UALA 5C4KA 3R9OA 3ZDUA 4O96A 4KIOA 3Q6WA 4RIWA 3TNHA 4BKYA 2YEXA 5M57A 3L8PA 3NIEA 2YIXA 2YABA 3ZRMA 4AOIA 3OWLA 2GNHA 2WTKB 3SW4A 3O7LD 3W10A 2VTOA 3KREA 3UBDA 4R7IA 2PSQA 2XNNA 3VUDA 1FGKA 3CKWA 4C34A 2G01A 1F3MC 4JOAA 3ORPA 1OIUA 2XYNA 2F7ZE 2G2HA 2P4IA 2VTNA 3DDQA 3G0FA 4IW0A 4C36A 5LVMA 2GSFA 4DITA 4KIQA 3THBA 4YO4A 3V8SA 5AV2A 3TT0A 1DS5A 1Y6AA 2IPXA 2FA2A 1W2FA 1ZOEA 3VUIA 1JNKA 2BMCA 5JZNA 3GC9A 5I9YA 2XNMA 2J5FA 1ZYCA 3P7CA 2NRUA 3SXFA 2ZVAA 3AGMA 4L3LA 4ZJIA 3VBXA 2OIQA 4J96A 1Q61A 4JQEA 4IB3A 4Z16A 5L2QA 1ST0A 4JBPA 3VIDA 2PUNA 4XEYA 4BHZA 5TR6A 1TZDA 4LG4A 5ANEA 4PMPA 3O5AA 2X39A 4LOOA 1WFCA 4GEOA 4K6ZA 4PUZA 3OWKA 3QRIA 5M08A 3TTIA 3ORMA 1NW1A 3QUDA 4IANA 2ITUA 4MNEA 5BVKA 2E9PA 1JKKA 4UMPA 2PY3A 5E1EA 4JX3A 3BBWA 4FTCA 5DHJA 1I09A 2XNEA 5HVYA 3W2CA 4DCEA 4D2VA 4JLCA 2XJ2A 4N4SA 3O8PA 5IDPA 3QD4A 4D0XA 2HY0A 2WNTA 4FT7A 3AQVA 4P5ZA 4I92A 3U8WA 3QWKA 1FMKA 4APCA 4FKLA 2B0QA 2Y4IB 3AC4A 4PL4A 2H8HA 4ZJJA 3T9IA 4FSMA 2ZOQA 3WBLA 3EQFA 2X8DA 4KABA 1KV1A 3BGPA 4RRVA 3ZDIA 3UDSA 1SYKA 4R77A 4BCPA 4QNAA 1XJDA 5FG8A 1H08A 1Q8YA 5EW8A 3CPCA 4MWIA 4K0YA 2ACXA 3R7UA 5AP2A 3A7FA 1B39A 5FXSA 4ANQA 4EOSA 5D7AA 4GFMA 4EH9A 5CT7A 4EONA 3COKA 2J50A 3DNDA 4YLJA 4F4PA 2YM5A 4JR3A 4WBBB 1J1BA 3QWJA 3UO6A 3IOKA 4M66A 4BDGA 3D7TA 3W8QA 3ZOSA 2BROA 5K0KA 4DEDA 5BX0A 5IISA 1V0BA 4CVAA 5EM5A 2RKUA 4GCJA 3QRKA 4JIKA 1R78A 3PIXA 4OT5A 3D2IA 5E8UA 4F7LA 3DAKA 4QMZA 2SRCA 1GNGA 4XHKB 4IDVA 5KX8A 3PUFC 5JMSA 3TKHA 3GQIA 5TOZA 1CTPE 3HL7A 4EOMA 3R1SA 5KKRB 1AD5A 2FVDA 2WMBA 2YM7A 4LDTA 2R3IA 4BBEA 1SVEA 4IC8A 4UMQA 4XG4A 4DF3A 3MVHA 4O1PA 2JD5A 4FT9A 5AP1A 2WU7A 4K1BA 3D94A 4O7WA 1QMZA 2CGWA 3DBFA 2C0IA 1URWA 4ACMA 1KE8A 2X7OA 3ORZA 3PTGA 4ACCA 3D5WA 2RFNA 4L53A 5EOBA 3ERKA 3UIUA 3BCEA 4BIEA 4D2TA 5CEPA 3PY3A 4I6LA 1FBNA 3R7YA 4IZ7A 5LCKA 5EM7A 2VWVA 2WTKC 4I23A 4ZMFA 4TPTA 4R3PA 4JAIA 4RG0A 4AOJA 2OK1A 3AC8A 5H8BA 3OT8A 3V6RA 3PWYA 5EG3A 4QTAA 4CT1A 5IUHA 1IAJA 3QRUA 2FYSA 3UPXA 1ZY4A 4D2SA 3EJ1A 4BDBA 3TDVA 3IPHA 4CMTA 2NO3A 2G1TA 4MXXA 5J8IA 3TZ7A 4G31A 3QL8A 4B6LA 5D41A 1YW2A 3AMAA 3UDZA 4HPTE 2XM9A 4M0ZA 2ZJWA 3LLAA 3O8TA 3R8MA 1YDSE 3S0OA 4GS6A 2QVSE 3BRBA 5CU4A 2HWPA 4KKEA 5AR8A 3QCXA 2VTPA 4R1YA 4XG8A 5CNNA 5TT7A 3RWPA 5HIEA 2IO6A 3O96A 4G5PA 4ZTHA 3W2SA 4IM3A 3RHXA 4BDEA 2YIWA 3B8RA 3GFEA 1RQQA 2WTIA 2R64A 4DEIA 4DLJA 3HX4A 4WBOA 2B53A 5CF4A 5IA3A 4HGLA 5EI8A 3LFEA 1S9JA 3UQFA 1XH6A 1GZ8A 3VUMA 3ORXA 4JI9A 2FB8A 2WKMA 3R9HA 3G6GA 3QTUA 4QPSA 5HG5A 3DNEA 3EL7A 4AGDA 4EOIA 3SRVA 4C4FA 4WG5A 1U46A 3SXRA 4LUDA 3RK7A 1E9HA 2Y4IC 2C3JA 3QBNA 3UYTA 3FI2A 3HV3A 4F7NA 4IWOA 3EMGA 2UVYA 2QR8A 3DKCA 3K54A 3R0TA 4IM2A 5EDPA 5F94A 3DJ6A 5EK7A 2CDZA 2VO6A 4AA5A 5KNJA 2WMSA 5F1ZA 2REIA 4FYOA 4YTCA 3OUKA 2BIYA 2J0LA 3C51A 3UGCA 4RWIA 4AT4A 4AZFA 3BZ3A 3FV8A 2X6DA 2R3JA 1UNGA 3RK9A 3FL5A 5E9EA 5E8XA 1R0PA 5CALA 3F3TA 3PG3A 4FT0A 4FV8A 2VTIA 4ASXA 2ERZE 5D9HA 4CFFA 2PVYA 2CGUA 5D12A 1GAGA 3VO3A 3D7ZA 2WQBA 4YP8A 4EH7A 3VN9A 2X7GA 4O7VA 5HG9A 2NP8A 1RDQE 5KKRC 1W8CA 4F1MA 3EH9A 2PVFA 3BHUA 5FEQA 3HV5A 1BI7A 1WCCA 2QG5A 3R83A 5KZ0A 5FM3A 4FZAB 2BFYA 4AOTA 4RIWB 1PRYA 4DTBA 2ONLA 4YTHA 2BALA 2I0VA 3FDNA 3QCQA 5ETAA 2WMVA 2BRMA 2WTCA 2XIKA 2QONA 5FUTA 2ITWA 2YM8A 3I60A 4FNZA 4LGDA 5AX9A 2UVXA 2OF4A 3FLWA 4U80A 3F3WA 4MVFA 3F5XA 5E90A 4JDIA 4QYYA 3ZBFA 5E92A 1FVRA 3O2MA 2PZRA 5L6WL 4AN9A 3OS3A 4EUUA 4PMTA 5ITAA 4A7CA 1OPLA 3RBWA 2XJ1A 1YOJA 4RIOA 4YHJA 1A9UA 1HCKA 2VN9A 2Y7JA 4FGBA 4V04A 3FZSA 3MYGA 5DRDA 3VBVA 1ST4A 4RWJA 3A4PA 3DY7A 2VZ6A 4FE2A 4I6BA 3QX4A 4FSWA 4LV5A 3BLAA 2UZLA 2XF0A 4FODA 4F63A 4A9UA 3GCVA 3LFDA 3BGZA 3FXXA 3D2KA 4W9WA 5EW9A 5FEEA 2Z7SA 3HECA 5KMJA 1J3HA 4IBMA 3GU6A 3R30A 4XV2A 2B55A 3VJOA 4CYJA 4BDIA 4YSMA 4Y46A 5F20A 2WPAA 3LJ1A 4QYGA 4F9BA 4FVQA 4YU2A 5CEOA 5J9ZA 2JFLA 1Q41A 2JIVA 3VS2A 1PMNA 2RGPA 4XV9A 3TNWA 4D4VA 2YWVA 2WZJA 4L68A 2LGCA 3D5VA 2PK9A 1BYGA 4XYFA 3GFWA 3VQHA 4MNEB 2CSNA 3PWDA 4MXOA 2VTQA 4FNXA 5EHLA 5IQAA 4FSNA 4F6SA 2R3RA 1XH5A 3FQSA 3MW1A 2IW6A 4L44A 4O0XA 4WOVA 1M7NA 4BTKA 4FEVA 4GKIA 3OBJA 4GT4A 4F78A 3SDJA 5DVRA 4FTKA 4QMYA 3FLZA 3AC5A 4IACA 3BL7A 3ML1A 3ZFYA 1WBNA 3KXMA 1JAMA 4BI0A 2EB2A 4NT4A 3GCPA 4FKQA 4WNKA 4FA2A 5CANA 3KB7A 4F0FA 5AADA 1PKDA 3AT4A 2ETRA 2EXEA 2YN8A 3D9VA 5IUIA 2B9JA 4FIHA 3WI6A 3EIDA 5A4LA 4MBIA 2X9FA 2BAQA 2GNLA 4TKSA 4U3ZA 3ZC6A 3D7TB 2HCKA 3K5VA 5M4UA 2OJJA 3JVSA 4QPAA 3HRBA 2BHEA 2OGVA 2XBJA 4FKVA 5DYJA 5IA4A 4L9IA 2VWZA 4O7ZA 4I22A 3V8TA 2X2KA 4NTTA 2R7BA 3IQ7A 4HCVA 4KAOA 3COHA 3OMVA 1SM2A 5DR6A 3KVXA 4XS2A 5TO8A 2IZSA 2I40A 3QCSA 1PJKA 4WKQA 3BX5A 2QG7A 4AGWA 5IH5A 3PYYA 3ANRA 4Z7HA 2A0CX 4CFXA 4UYAA 3W8LA 2J4ZA 2UW6A 1UNLA 2BFXA 2C5YA 2R2PA 2QOHA 3EZRA 3G15A 3KN5A 3CQUA 1KOAA 4E26A 1JKTA 2GQRA 4FK6A 4O4FA 2C47A 4CXAA 2F49A 3QFVA 2X4ZA 4I21A 4CV9A 5L4QA 2BUJA 5HE0A 5LVNA 2I7QA 3GCSA 4FT3A 3PP1A 4FV7A 3VONA 1Q97A 5CSXA 3OG7A 4U79A 2UW4A 3A8XA 4L52A 3VNTA 3TJCA 4FEXA 3G5DA 3LW0A 2UW5A 3IW6A 3QKLA 4G6OA 2HZ4A 5JGAA 4NEUA 4O7YA 2HXQA 3LCTA 4Z7GA 1W2DA 2R3MA 1TQPA 1WBVA 3KRLA 4D4YA 1BLXA 1P4FA 3CD3A 3H0ZA 5HTBA 4IQ6A 5H3QA 4DDGA 3WE4A 3T9TA 4UWCA 4QP3A 4U8ZA 3BPRA 4EK3A 4DH8A 4CFUA 2Y0AA 1ZXEA 4H1MA 3SGCA 3OT3A 4H3BA 3ZUTA 3DBQA 1WVWA 2UZEA 4G3EA 5M4CA 5IQHA 1WVXA 3HA6A 4TYIA 1OL7A 3C7QA 4YR8A 1PMUA 4ZTNA 2C0TA 4QDVA 4L8MA 1ZYLA 3VS1A 2WHBA 4GUBA 3UVRA 1BL6A 3HLLA 3F5PA 4RQKA 1XH4A 1O9UA 1MQ4A 4TTHB 4ZP5A 4O83A 3MIAA 4CSVA 5JK3A 3SG8A 3MN3A 2QNJA 4OTRA 2WMUA 3PJ2A 4Q5HA 5J5TA 2R3PA 5L8KA 2I0YA 4HOKA 2CGVA 4YNOA 4GK3A 5H2UA 3AD6A 3BYUA 3UE4A 4DGLC 1YXSA 1W84A 4ZJVA 4D55A 3NNXA 4AWIA 4FTUA 4AU8A 3NZ0A 3SRVB 4EEVA 4ENXA 4QMVA 2HYYA 3FQHA 4L7SA 3ULIA 3ZRKA 5JQ5A 3DTWA 3N51A 3BLQA 2C30A 4E93A 2BIKB 4E6DA 4FG9A 3ID6C 2WQOA 1VYWA 2C69A 4G3CA 3I5ZA 3F5GA 3PY0A 3WARA 4FZDB 2YM3A 5LWNA 4KUJA 3N4UA 4CFMA 1YHWA 4UB7A 4L3PA 3SX9A 5AUUA 3NGAA 1FPUA 1OZ1A 1WBPA 3GGFA 4I6FA 4WIHA 4MXAA 1PXPA 5DE2A 5E8SA 3I0OA 1OECA 4L7FA 3TKUA 5HCXA 3N4VA 3FZOA 1BUHA 4BCHA 4ANLA 1JQHA 4M69A 2WELA 3ENHA 5M06A 5J7HA 2CNUA 2CLQA 2HZIA 3VBQA 5I9ZA 3ZM4A 4YMJA 1SVHA 2VWXA 3GP0A 4IHPA 5G6VA 1WBTA 2YCFA 2YJRA 3EYHA 2UUEA 2R0UA 1UV5A 5IU2A 4FKWA 2C6DA 4X6QC 3MFRA 5HG7A 5BVWA 3G90X 4BDHA 2UW3A 4FIJA 4DA5A 4TRLA 2XJ0A 4QTCA 3HDNA 3KF4A 4FV1A 3DTCA 4GJ2A 5AUTA 2Z7LA 3TIYA 4FUYA 3W18A 3KULA 2YDIA 3BIZA 1OPJA 4FV6A 5AIKA 3CY3A 2VRXA 4EZ5A 2JDTA 3DQXA 3QTIA 3SOCA 3A2CA 3PIYA 1OBGA 3QUPA 4X2GA 4E4LA 4BZOA 5K9IA 3REPA 2BRGA 3ZLWA 4NW5A 2CJMA 3KXZA 3FE3A 3R28A 2A98A 2FSTX 3QTZA 4BCFA 2YHVA 5CQUA 2F4JA 3EN9A 3ALOA 4CZYB 4F7JA 4O86A 2F57A 3VS6A 1IG1A 4RX9A 4TNBA 2C6LA 4DG3E 4DC2A 4EHVA 4P7EA 5DWRA 4X0MA 4DEBA 5EM8A 3MTFA 5KMLA 3CCNA 4C7TA 4ASDA 4FKUA 5A46A 1Q62A 4KWPA 4DYMA 5CZHA 1YI4A 4HCTA 4F64A 4LI5A 5FGKA 3R7GA 1OPKA 2F7EE 3VUTA 2PL0A 3LPBA 4H1JA 5HBJA 3SD0A 3AT2A 4X21A 2C6MA 3FPMA 4JAJA 5CSHA 5AUVA 3JS2A 3VBTA 2HY81 2BTSA 3ET7A 4BB4A 5I9UA 4AW2A 4QTBA 4O7LA 2QHNA 3MDYA 3R8UA 2WMRA 4F08A 2VNYA 3NYXA 4BYIA 2Z2WA 5AUXA 3NAYA 4G5JA 3TXOA 3ZUVA 2GFCA 4FGRA 4NM7A 5CT0A 4FIGA 1U54B 4II5A 1H00A 4O21A 1YI3A 5EM6A 3PE1A 1UWJA 2H6DA 3R1NA 4E3CA 1UKIA 4YLLA 3TUBA 3Q53A 4GK4A 4ARKA 1W82A 3GNIB 2WIHA 5C1QB 3Q9YA 4IWDA 4XG7A 4GFGA 4LM5A 3RHKA 4IB0A 3UC3A 3V5QA 2CN5A 4TY1A 3SQQA 4BDJA 5LQFA 3SV0A 3FMEA 5JFSA 2CN8A 3BV3A 4RGJA 4FX3A 3C0GA 3FY2A 3LQ3A 5JH6A 5EQEA 3IW8A 5GJDA 1U5RA 4LRMA 3RPYA 4DH3A 3ULZA 2PPQA 3FZRA 2Z02A 4QMQA 4RC4A 3VRZA 3HMPA 5HCYA 4F70A 3KMMA 4CGAA 3CC6A 4MF1A 4QQ5A 2XS0A 5K3YA 4WO5A 4EH8A 3V8WA 3RPOA 3V51A 4B8MA 4JMQA 3PFQA 3HMIA 3PXZA 3RGFA 4ITJA 3DU8A 4NH1A 5CVGA 4Z55A 2HAKA 5T68A 4ANOA 1LR4A 3LJ2A 4FSUA 4BF2A 3T3UA 3QA8A 5I3RA 2XRUA 2VX1A 4MHAA 4L01A 5EH0A 5J95A 2R4BA 1Q3WA 2XK9A 3DOGA 5AV4A 4AE6A 2O63A 3H0YA 2W96B 4WHZA 1S9IA 2OIDA 3A7JA 3D83A 5CYIA 4DHFA 4YLKA 3MVLA 4QTDA 5AX3A 2QC6A 2XVDA 2XKEA 1LP4A 2JAMA 5AP6A 1P2AA 3AMYA 1Y91A 5KMKA 2OW3A 3GUBA 4G3DA 4EL9A 4F9WA 3FAAA 5HEZA 2PULA 2BRHA 2H9VA 3F3VA 3ZEPA 2CGXA 4QMPA 5J1WA 2YIYA 3BHVA 4W4VA 2ONLC 3E8NA 3KRWA 1AGWA 2C3KA 4C38A 1CKJA 2CCHA 3JY0A 2IG7A 1WZYA 2W9ZB 5ANKA 4DT8A 1FGIA 3H10A 2HELA 3DQWA 4BGHA 2R0IA 3IW7A 4W8DA 1M7QA 4WSYA 3OXZA 4X7QA 4FG7A 4F0IA 3VS3A 5A4TA 1QPCA 2RIOA 5B0XA 4X6RA 2X4FA 4YJPA 1W98A 3ODYX 4I3ZA 5CNOA 4AZVA 2JDOA 2OFUA 3QQGA 1CKPA 1SVGA 5LVOA 2WMAA 3NEWA 2J7TA 4FV9A 3FI4A 2JKOA 1DM2A 4GMYA 4ZSLA 2Y9QA 4JBQA 4EHZA 2Q0BA 3CY2A 4AFJA 2Y6OA 2J0MB 3ZFXA 3E92A 3OCSA 4D5KA 3R6XA 5HU3A 2XALA 5C03A 4FEUA 4FUXA 3VBWA 2GQSA 4LV7A 4WRSA 4IDTA 3GCQA 3N4TA 4ZTLA 4IAFA 3GU5A 4WNPA 2VUWA 2IJMA 3PIZA 3DGKA 4EK8A 3NIZA 2W5AA 1RJBA 1Z57A 3R21A 2C6OA 4CT2A 2JKMA 2GS7A 2W1FA 2ZM1A 1HOWA 2W5BA 4J53A 4KD1A 2IZTA 2OJIA 2V7OA 3MA3A 2ETMA 1MP8A 2ZAZA 4DFNA 1DAWA 4K9YA 1H1PA 3ZTXA 3EL8A 3IK3A 1H01A 4RZVA 4LRKA 3FZ1A 4ZIMA 1ZMVA 3DZQA 1PF8A 4XLIA 5HGIA 4I41A 2IF8A 4QMLA 4Z3VA 2RF9A 2VWWA 3SG9A 4K33A 1GJOA 4F9AA 5BUJA 3MV5A 3HGKA 3MPMA 4NSTA 4W4XA 2XB7A 4YUQA 3E64A 3NUPA 4DBNA 3KRXA 4EOKA 1Q8ZA 4TYEA 3NWWA 3IONA 4XUFA 5IQDA 4LQMA 4M7IA 3ELJA 2QURA 3DFAA 3H9FA 2KTYA 3TWJA 3Q04A 5BUEA 1G3NA 4U0IA 4ZTRA 1J7LA 3MI9A 1OITA 2XK8A 3MTLA 4W4WA 4ZZOA 4UYNA 4H05A 2ITNA 3GQLA 1ZYJA 3VUKA 2ITOA 4NL0A 2W1HA 3ZXZA 1NVQA 4M69B 5EDQA 3WZEA 2R7IA 3NSZA 5D11A 3R7OA 3Q4ZA 3VULA 4X2JA 5LMKA 5C01A 3V6SA 2YM6A 1PXOA 4MNFA 3ZHPC 5EOLA 4GIIA 4L3JA 4S30A 4TNDA 5DH3A 4J1RA 2O0UA 5GHVA 4FKSA 5IQCA 4FIFA 5IA5A 3R00A 2QR7A 3QGWA 4H58A 4LMUA 2R9SA 1OUKA 2CPKE 1XWSA 3C0IA 3KULB 5BPYA 4R6VA 4AZEA 4HVHA 4XP3A 3W55A 4ZTMA 4QQTA 4QNYA 1BI8A 1X8BA 2XUUA 4N6ZA 1XBAA 1V0OA 4FIEA 3BU3A 4FKRA 3UTOA 1XMLA 4FBXA 3PP0A 4PDSA 4S32A 4FTTA 1M14A 3M2WA 3ZXTA 4DINA 5L3AA 4ANSA 2BHHA 2G2IA 4U7ZA 5GJGA 4BTMA 5JGBA 3TV6A 1H1RA 3I1AA 4RX5A 5CY3A 2X8EA 4BY9E 4IJPA 3W33A 2V7AA 4DGGA 3IOPA 3A61A 4IWPA 3T8OA 4ZS0A 4NJDA 5M51A 5GIOE 3DXNA 2AC5A 3BELA 3C0HA 3HZTA 3CTHA 4OT6A 2IVUA 4YC8A 5ANJA 4B0GA 1MRVA 2PE1A 4EQCA 2DUVA 3LLTA 5HE2A 3S4QA 3Q32A 3DLSA 1IAHA 2YERA 5HIBA 2VWUA 3BEGA 4WNMA 5CX9A 1OBDA 2HK5A 3TKIA 3EQBA 3GOKA 5FLFA 3MB7A 3UVPA 5IF1A 1KE6A 2JKKA 3DS6A 3I4BA 4CYIA 5KUPA 5IA0A 3UJGA 3MGYA 3P7AA 5ANDA 1JWHA 1REKA 2XCKA 3BYVA 3K3JA 3I7BA 3W0QA 2GQGA 2RG6A 3GU4A 4IAKA 5HICA 1Z9XA 2ITXA 5IQBA 5M44A 5IPJA 4BGQA 3U4UA 2G15A 2P33A 1DI8A 2CKEA 2QOFA 4I24A 3MS9A 5B2KA 4GU9A 2PE2A 1G8SA 1W2CA 4U97A 3L9MA 2W4JA 3CJFA 4CLIA 4D2RA 2UZTA 3AC2A 3Q9WA 4HNIA 2VTTA 3QTXA 2ITYA 4JX7A 3AGLA 3Q4TA 1H4LA 3NUUA 4N6YA 4RJ5A 4ZEGA 4B8LA 4CQEA 5JT2A 3NUAA 5DT4A