4O0VA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 88
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0vA01
2VTTA 4L45A 2E2BA 4FSNA 1PMUA 5CWZA 2ZMCA 4CFUA 3OW3A 5BVNA 4DH7A 1YXXA 5A46A 1UU9A 2PK9A 4MEDA 5F1ZA 1R3CA 3TV7A 5IU2A 5KZ0A 2WTJA 3WILA 5EW3A 5ACKA 1JNKA 3L8PA 3H9RA 3R8PA 5JGBA 4UBAA 4EYMA 4S33A 4X2JA 4BZOA 4MNEB 4EWHA 2RG6A 4RQKA 3UG2A 3CY2A 3L8XA 4BICA 1UVRA 4EZ7A 4D2TA 5A9UA 3NUYA 5DBXA 4O1OA 4M84A 3UOJA 3EN9A 4IX6A 3C9WA 2GNJA 3Q53A 3WI6A 1PYEA 4HYHA 5HU9A 4YJNA 3R9RA 2VO0A 4RIXB 2GU8A 4F4PA 1WVXA 3ORMA 4U79A 2GHLA 4ZS0A 1SVEA 2J4ZA 2YWPA 3GQIA 2OZAA 3H0ZA 1ZYLA 3HGKA 4G5JA 3MH1A 3CTJA 4O0RA 2OFUA 3A7IA 3JY9A 4KKGA 4H05A 1XHAA 2R4BA 4RA4A 3NAYA 4ZAUA 3I1AA 4IAIA 4UWYA 5AR3A 5AADA 3HV7A 3FUPA 3SKCA 2QOKA 2OIQA 2UW5A 2UZEA 4JIAA 3Q60A 1Y57A 4Y73A 4BDCA 3LFAA 3HMNA 4AN3A 5DRBA 2OJIA 3C0GA 3ZLWA 4M69B 4S31A 4I1ZA 3RTPA 3QC4A 3VJNA 4IX5A 3UOHA 1S9IA 3QQUA 3UBDA 3ZSHA 4QMNA 2G2IA 4IB1A 4Q9SA 3WBLA 4BCOA 5A14A 3EJ1A 2BHHA 4PTCA 3KVWA 4XX9A 3JS2A 3UG1A 2O0UA 4ERKA 4YLJA 3F7ZA 3ROCA 2B4SB 3SLSA 2WHBA 3ACKA 3N4UA 3UOKA 4M15A 2GHGA 4P5QA 5B2LA 3RBWA 4OBPA 3II5A 2V5QA 4AWIA 2WOUA 1MQBA 1ATPE 5ETCA 2UW7A 5GHVA 3L8SA 2PZRA 5LVLA 5D11A 3QTIA 2X8DA 4YZDA 3DKOA 2R3PA 5L2TA 3R8MA 5IQEA 3ET7A 3HA8A 4OTDA 5GNKA 2PHKA 2X81A 4ZY5A 5HD4A 2JFMA 3BE9A 2Y0AA 2ZB0A 2QURA 4HNFA 2IG7A 2PUUA 2YCFA 4RZWA 4RJ6A 3QKLA 1OPKA 2ZV8A 2WTKC 1Q97A 3DNDA 5AAGA 3QL8A 4AQCA 3DFAA 4NH1A 4CMOA 4TYGA 4CKIA 4ANBA 4O86A 4FZAB 2C6KA 3ZUUA 4QD6A 2XMYA 4QYFA 3OG7A 4R5SA 3ZBFA 4D0XA 3DKFA 4FV7A 5KUPA 3PVBA 1PW2A 2O63A 3EYHA 4NM7A 1FGIA 1S9JA 4FV8A 2X39A 4H1JA 1TVOA 3MV5A 4KSQA 2ITYA 2UZUE 4UEUA 5I9VA 1MQ4A 4QP2A 4ZTSA 4X2FA 5M55A 4AZEA 3KMWA 4APCA 3ZTXA 3OOGA 1J91A 3H9OA 3OHTA 2W4JA 2WZJA 5CZHA 3PIZA 4DT8A 1Q4LA 1WBPA 5HE3A 4XG2A 4N0SA 3PY1A 5IMXA 3ORLA 4D55A 4F7SA 3PXKA 2X0GA 1Q61A 3OWKA 5ANEA 4L46A 5K4IA 4NZWB 4M68A 4CQGA 2QHNA 3RM6A 3ANRA 1I09A 4MXYA 4UB7A 5EYDA 2XK9A 3GB2A 3PP0A 4IH8A 3SW7A 2X8IA 5HX6A 4MBJA 3AC3A 3A8XA 3QCSA 4PDYA 1ZZ2A 2UW9A 4FC0A 1WBVA 2XIXA 1TQPA 3GENA 2QVSE 1R78A 4JG8A 3Q4CA 5AV3A 4FF8A 5HICA 3ULIA 3ZFMA 3R9NA 4D2PA 3POOA 4CSVA 3GUBA 4EHEA 3R2BA 1SNXA 3SOAA 2Y4PA 3H10A 4IDTA 1WMKA 2Z7RA 4BTMA 5IH5A 4AZSA 4EOOA 2C0IA 3D5XA 3FDNA 3SV0A 3DXQA 3AGMA 1SVGA 4RWJA 5DEYA 4ZLYA 4X6QC 1O6KA 5CVFA 4Q5EA 3DBDA 4QPSA 3EQHA 3KRLA 4ALVA 1XWSA 3E92A 5JN2A 2IVVA 4YZBA 3P5KA 1PYXA 4G2FA 4I23A 4BIBA 4PX6A 4BZNA 4WBBB 4BWXA 4BR3A 3FMHA 2X6EA 2OJFE 4WSQA 4CFVA 5E8VA 2GCDA 3GU5A 5AUXA 3CPBA 4F9YA 2X6DA 4O38A 4OLIA 4QMOA 3ZONA 3C4FA 1ZY5A 4FKVA 5E92A 3ZFXA 2WEVA 1GIJA 4FZDB 5AR4A 4GG7A 1W8CA 1DI9A 4F6SA 4ITHA 4QP9A 5E1EA 2W4KA 4YR8A 4G16A 1UWHA 5IA3A 3LOKA 2UW4A 1IEPA 5AA8A 5HO8A 2JIUA 4J53A 4GFMA 3D7TA 2WU7A 2BRMA 2ZMDA 1XH9A 1U54B 4KS8A 3SC1A 5L8LA 4IZAA 4G3GA 3BWJA 3UO4A 4R5YA 4GJ3A 3HUBA 2XIYA 3A99A 4DFUA 2OK1A 2QOOA 4FV0A 4ZLOA 5HIEA 4O91A 2W1GA 3VQUA 4OTIA 5BUJA 2BHEA 4EH5A 2BILB 5M56A 4DA5A 2BZKB 2GDOA 4AGCA 1LEZA 3NDMA 3LXLA 5M4IA 3QYWA 2UW8A 1B6CB 2YAAA 3A7GA 3A7HA 5T68A 2VGPA 3ZXTA 4AGWA 3NUXA 4MYGA 4ITJA 2C6LA 4GT5A 4PY1A 4E1ZA 1P2AA 1GIIA 1K9AA 1V1KA 3FLNC 4UXLA 1LPUA 1Q62A 2J50A 2XNPA 3D4QA 5IA2A 5DR6A 1CTPE 2PE1A 3MA3A 3OUKA 3BPRA 3V8WA 1KUTA 3ZBXA 2VWBA 4FSTA 4HGTA 4G3CA 2OJJA 1E1VA 3TUDA 3F9NA 2CJMA 3T9IA 1PHKA 2PZ5A 3WIKA 3QZFA 4D1XA 3S95A 3K5VA 3OP5A 4YTCA 4NTSA 5E91A 4E5AX 5KKRC 3RNIA 3U6JA 5GZ8A 4FIEA 3W1FA 1OL1A 5FXQA 3MB7A 4L3LA 5FEDA 4XP2A 2WGJA 5KMNA 1OKWA 4YJPA 5E8WA 4NWMA 2YM4A 3LXNA 1KV2A 4RFMA 5D9HA 3FC1X 1OM1A 3UNKA 3KY2A 3FQHA 5B2KA 4YJQA 1SM2A 3V5TA 3RWPA 3DA6A 4C3PA 3MTLA 4Z7GA 4R6VA 2QC6A 3MVMA 4FNYA 3CTQA 4JQEA 4ZEGA 4GL9A 4HVHA 4OAVB 3EFJA 3V51A 4CFFA 1DAYA 2Z8CA 3OCBA 2JIVA 3FYJX 4MTAA 4IWQA 4NYEA 1UA2A 4X2KA 5AR7A 4BN1A 4ZMEA 3DFCB 4FV6A 4H1MA 4M3QA 5HE0A 4TNDA 3VW8A 2HXLA 3RZBA 3HAVA 3U9CA 2HWOA 4ZTLA 4DCAA 4GYIA 1E1XA 3FMNA 4Q9ZA 4XCUA 3KXZA 3QD4A 4O0SA 4WSYA 1OI9A 3QQGA 5AUWA 2XKFA 4GSBA 4JI9A 3ETAA 3GU8A 4FKJA 5AAFA 4LRKA 2UZWE 1U5RA 4L52A 1H1SA 2EXMA 4O0VA 5GINE 2Y4IC 4I22A 1WBNA 1RJBA 1ZOEA 4RJ7A 3UMXA 4RX5A 4YC8A 2DQ7X 2O2UA 1JWHA 3TKUA 3WF6A 4FK3A 2R9SA 3MFSA 4LM5A 4E4NA 3RJCA 2OIDA 1BMKA 4R7BA 3ATTA 2CLQA 3P9JA 4B6LA 3VBYA 2QOHA 2XJ0A 5L3AA 3FMKA 4YGAA 3EFLA 3PIXA 1H4LA 2WPAA 4CZUA 2RSVA 4FG8A 3U6IA 4KIOA 3WF5A 3UNJA 1WBSA 3PFQA 5E8YA 4WHZA 3TV6A 3AXWA 2X8EA 4U44A 2XCKA 3QRUA 2RFDA 3R1YA 1R39A 1OL6A 4HVSA 4S2ZA 4UN0C 3SVVA 5IKWA 4TYJA 3FQEA 4DCEA 5HCZA 3R7VA 4Y85A 3UIMA 5HBHA 4EJ7A 4G3DA 4MHAA 3VN9A 4FOBA 3TUBA 1OB3A 4RA5A 4YTIA 4QQTA 1QPEA 3LFFA 1V0PA 2C5NA 2F4JA 3DK6A 4NEUA 4BWKA 3TM0A 1Q99A 3F3TA 3OCGA 4DTAA 1XH4A 4PWNA 3AT4A 4PL3A 4MCVA 1ZYJA 2UVZA 3FJQE 3HV5A 4IVAA 5AR8A 4GFOA 5K4JA 2I7QA 3DKGA 3RI1A 4HYSA 2UVYA 4FV3A 2X7FA 5DOSA 2WD1A 5LXMA 2CKOA 4HVDA 4RC4A 3LFSA 1ERKA 4FT0A 2B1PA 3HDNA 4WIHA 5JFXA 3KEXA 2VWVA 1CKIA 5CU4A 3ZO2A 4EK4A 4YTFA 2X7GA 4YO4A 3K3IA 5J8IA 3VULA 2QR8A 3R1NA 4N70A 4QMVA 2J0LA 3S1HA 3V5PA 1OL7A 2J90A 5CXHA 3R7OA 3CQEA 5FBOA 3UTOA 3LCKA 3LM0A 3PXYA 4ALUA 4O84A 1YQJA 2R2PA 4JQ7A 4JVGA 3UMWA 1GZNA 2B9HA 2EXCX 2W5AA 3GP0A 5EI6A 3BU6A 4ZY6A 3VUHA 2YM7A 4NJ3A 3IO7A 3LJ1A 3QTQA 4MQ1A 3ZUTA 2P33A 4O7VA 4DEIA 4U97A 4RIYB 4RVLA 2VZ6A 1VJYA 5J87A 2OH4A 2XNGA 2WOTA 1YXUA 4FTNA 5FD2A 3EQIA 3TZ8A 1GNGA 3HRCA 5DR2A 4E5BA 1WAKA 5IPJA 3R8ZA 4DFNA 3FHRA 4KABA 3NNUA 4RLKA 3QUEA 4FTCA 1X8BA 4YJRA 3QXOA 3ZO1A 4PDPA 4O7RA 3FLWA 4TL0A 3FKNA 3Q9YA 4FSQA 4TTHB 4QP1A 3BKBA 3QCXA 3QAME 4EJNA 5C8KA 4PF4A 4G17A 2JLDA 3QA0A 2R7IA 2HENA 3U51A 4JJRA 2A2AA 5HHWA 4BDIA 2A4LA 4MK0A 5D41A 3IOPA 4A9UA 3LVPA 3ORXA 1H28A 3R7GA 3PRFA 2YIYA 2PU8A 5KMJA 3FPMA 4XBRA 5JT2A 2VX3A 3EN6A 3OTUA 4L53A 4LGHA 2P2IA 4IJPA 1YI3A 4BKYA 1NXKA 3QTRA 5C1QB 1R0PA 3FMLA 4FV9A 3I5ZA 5HNIX 3I79A 4P5ZA 5JEBA 3D7TB 3F3VA 3QTXA 3TIYA 3K3JA 3PA5A 4JS8A 4C35A 3ENMA 5GJGA 3R8VA 5I9WA 1YKRA 1H07A 3E8DA 3NLBA 3CD8A 4ZK5A 2GHMA 4L6QA 4FKRA 4IC8A 4XOZA 3VBQA 3F61A 5IQAA 1BUHA 2CKEA 4QTCA 4XOYA 4ZSGA 4FT9A 3KULA 4FEWA 3LLTA 2BZJA 3R2YA 4BTKA 2GNGA 2UW3A 4BZDA 5EFQA 4EWQA 3AC4A 4U3YA 4FVPA 2BTRA 4ZY4A 1A06A 1GJOA 3QGWA 5EKOA 5HE2A 3P23A 4ANQA 4I5CA 4IAKA 3ZO4A 3DCVA 1PY5A 3VUGA 5ANOA 4O7YA 3EB0A 4GV1A 3EN4A 2W1HA 5DEWA 3RAKA 5IG1A 3C7QA 3FEGA 5CAQA 3E7VA 4GU6A 3TKHA 4FL2A 5E8XA 3O23A 3VAPA 1R0EA 2PVLA 1YDSE 4KD1A 1V0OA 1P4OA 3P79A 5K9IA 1M7NA 5HG5A 3ZZWA 4CV8A 4FG9A 4EOMA 1ZARA 3I7CA 4QTEA 4H3QA 1XH8A 4FIJA 2XNOA 4IXPA 3HAMA 2YFXA 5CEOA 4C59A 1J7LA 5HG9A 4U80A 4IWOA 5CT0A 5C03A 3OY3A 3AC5A 4AFEA 2VTSA 1IAJA 3G33A 3M2WA 4J99A 3GCQA 2C68A 3DTCA 5J9ZA 2VX0A 4PDOA 1P5EA 4DFXE 2ITZA 2XS0A 2WFYA 4V01A 3W10A 3WE4A 4CFNA 5M08A 3QQFA 2VRXA 3FYKX 3MGYA 4C8BA 3TZ9A 4J98A 1YOMA 4OR5A 1OIUA 3NUSA 3ORZA 4IX4A 2X2KA 3U6HA 2WELA 4LGGA 3PXQA 3VS4A 4XH6A 1PRYA 4S32A 4O2PA 3QFVA 2G2FA 2J51A 3MW1A 5IUIA 5F20A 4GG5A 2HW6A 4AZVA 3HEGA 2P0CA 3DK3A 4J7BA 4EHVA 4O7SA 3PLAE 4FI1A 2JBPA 2WTVA 2JBOA 2YN8A 3HECA 1YDRE 3ORNA 4BCNA 3I81A 3PSDA 3TZMA 5CQWA 2NO3A 3UNZA 4BBMA 3NIZA 4EORA 1OBDA 3UYTA 5I9ZA 3U9NA 4KIQA 5ANKA 1OUYA 3DKCA 2OJGA 5FM2A 3DDQA 3OMVA 4D2VA 4JNWA 5M4FA 4AG8A 4BY9E 5ANJA 1XR1A 3DBQA 4XLVA 3O7LD 4BBEA 4IVCA 3JXWA 3Q4TA 1H1RA 4QMLA 4PP7A 2X9FA 4R3PA 4ANSA 4KNBA 3G6HA 4I4EA 3PJ2A 4OTFA 4AT5A 4EC9A 2W1EA 3AD6A 2PWLA 1PXPA 2OF2A 3BGZA 3MYGA 4K6ZA 4QMZA 3VUIA 4BRXA 4JDKA 3D2IA 3UVRA 4DINA 5CSVA 2JITA 5KX8A 3MPAA 4YNEA 5J79A 5AP5A 4YMJA 4BI2A 3MIAA 3VUDA 2W96B 3LCDA 2R3LA 2QO2A 5H8GA 4MH7A 4DAWA 1Q8YA 4YBKA 3DLZA 3Q2JA 3VRZA 4BDGA 1YWRA 2PVNA 2RFSA 2X2MA 3RK7A 2BVAA 5KMOA 2Q83A 4Z16A 4KBAA 3FMEA 3ROYA 1CSNA 4FSYA 4AN9A 3TCPA 2AUHA 3UGCA 4A9RA 3CY3A 4C4GA 5CSXA 3RAHA 4I0SA 4RJ5A 3OXZA 3QTZA 2FYSA 4FOCA 3LJ0A 2WKMA 5IEYA 3DV3A 2PUNA 1O6YA 3KCKA 4FTQA 4R8QA 5AUVA 1QPCA 4F0FA 4CLIA 4XG4A 3SG9A 4M7IA 3GC8A 2I0YA 4OBQA 1LUFA 1OPLA 2OIBA 3TNHA 3SXFA 4CG9A 4Y8DA 5C8MA 5DI1A 5AX3A 4DH1A 4F7LA 2OO8X 3LFBA 4O96A 4B99A 2B53A 3T8OA 3QLFA 1JKLA 3UVQA 1M52A 4JDJA 4U6RA 3JUHA 2BTSA 3HRBA 2ZV7A 4KIPA 1GIHA 3POZA 5CSHA 4I0TA 2JKOA 2Y6MA 5DPVA 2WMXA 5AA9A 3EQGA 2JDOA 3T3UA 4ANNA 5CU0A 2V55A 3TN8A 1YW2A 5ETAA 2R0IA 3W33A 2XKDA 1JOWB 4ZTQA 4C62A 4D9TA 4DTKA 4XUFA 1LP4A 4UALA 3P7AA 1XH6A 4K2RA 3FY2A 4PP9A 4ENXA 5AR5A 4W9XA 1OL2A 2VX1A 4BIEA 3NEWA 3KF7A 2ZDUA 4ID7A 5JQ8A 5HO7A 4TWPA 4RVTA 3G9NA 4XEYA 2ITPA 3A60A 3E87A 3WARA 2XRUA 3DPKA 3LQ8A 3L8VA 4FSUA 4YTHA 1HCKA 3FL5A 1FBNA 3ZLXA 4H3BA 3OVVA 4A9TA 4F63A 3B2TA 3UIBA 4DGOA 1JLUE 4JX7A 3VUKA 4EK8A 4M12A 1IG1A 4I20A 5CSWA 2BRNA 3EOCA 4FGRA 3ENHA 3HDMA 2I6LA 3O50A 3PE1A 3UE4A 5I5ZA 4JX3A 4MXZA 3NRMA 2XYNA 4MNFA 4G3FA 4J8NA 3OCSA 3DBFA 4FSWA 3DS6A 3QA8A 2QU5A 4FKIA 4IAAA 4I92A 4YZMA 4PTEA 4BCFA 3CQWA 4B9DA 5FDXA 2J7TA 3VQHA 3QQLA 4IZ5A 4AGDA 3NNXA 4I94A 2ITNA 5BQ0A 4C38A 2OZOA 4FSZA 3R01A 4DG0E 2R0UA 4J96A 1GZ8A 2XCHA 2R7BA 5EHYA 4L8MA 3UVPA 2VWUA 3QBNA 3R7YA 4CT2A 4UMUA 2Y8OA 1PXIA 1Y6AA 2CHLA 4JRVA 3LW0A 4BGQA 3TNQB 2VTAA 1B38A 4UY9A 2REIA 5GJFA 4FK6A 2VTQA 3QZHA 4K1BA 4FUXA 3WE8A 3F66A 1ZYSA 2H9VA 3VF9A 5FEQA 4P4CA 4HGSA 3UZTA 4D2WA 3HYHA 2CNUA 3ODYX 3F69A 3TDVA 2FVDA 3DB6A 3PJ3A 2IVUA 4DH5A 4EHGA 2IPXA 4MX9A 3SW4A 2UZVA 4FTUA 2I0VA 1QPJA 5AP4A 2FGIA 3IW7A 3R02A 4ANLA 4EYJA 4OT6A 3C0HA 4FKQA 2W4OA 4EOQA 5FDPA 2CKPA 5TT7A 4GIIA 2BKKA 2UW0A 3KK8A 4X3FC 2SRCA 3Q5IA 1YI4A 4YUQA 2QONA 1ZLTA 4F1MA 4YPSA 3P4KA 5FTOA 2EVAA 3AD4A 3PG3A 5E1SA 3DAJA 3QD2B 4JBQA 2BFYA 4BCPA 4IVBA 4BYJA 4EKLA 4BGGA 1DS5A 3ULZA 4QYHA 5AWMA 4LL0A 1ZWSA 2CNQA 3R8UA 2QOCA 4TPTA 3PVGA 3CQUA 5ANGA 4F65A 3HNGA 3FLYA 3Q3BA 3SRVB 2R3MA 2C47A 3OEFX 5KNJA 2QG5A 1QCFA 4D5KA 3F88A 4DYMA 4XS2A 4XP0A 2EUFB 2R3HA 2DS1A 4PMPA 4I41A 4FTIA 4RBLA 3GEQA 3V3VA 4WNPA 5M07A 3RP9A 3U54A 1OKVA 2IN6A 2WMAA 3QZGA 4D2RA 3IW8A 3C13A 3C51A 3ZSIA 1MP8A 1OL5A 4GS6A 2GNLA 3DGKA 4A4XA 2OJ9A 4WD5A 2JAVA 5C26A 4CVAA 4QPMA 1M2QA 4JG6A 4EH9A 3GT8A 3P08A 2OXDA 4JLCA 4ASDA 3N4TA 3HVCA 5E8ZA 4C4IA 3TJDA 3FPQA 5CEKA 2UZLA 3PVUA 2O65A 3CJGA 2YITA 4L67A 4GEOA 3DTWA 5ACBC 4PMSA 2GMXA 2C1BA 4BI1A 2CGXA 1UU8A 3ID6C 4C58A 2VO3A 3F5XA 3D5VA 2IWIA 2PSQA 1W7HA 2RKUA 3RMFA 3VRYA 4KS7A 4AT4A 5IDNA 5L6PA 3I6UA 2NRYA 2ZOQA 4PNIA 4WNOA 2VN9A 3ZCLA 4AAAA 1O6LA 4NM3A 4CGAA 1YWNA 3OZ6A 2PE2A 4PDSA 2IW8A 3RK5A 3TZ7A 3EMGA 4HZRA 5EI2A 3VWAA 4GH2A 4Y72A 4JBPA 2C5YA 2ITUA 4BKZA 3NUNA 4F08A 5KMIA 2FSOX 5EK7A 3PPZA 4WO5A 3WIGA 3OBJA 5DRDA 4K77A 4ZJVA 4QP4A 1BL7A 4F0GA 5M57A 1KE6A 1W82A 1WBWA 4QP6A 2V7OA 4D5HA 3VHKA 2WO6A 3O17A 4KUJA 4GK3A 1QL6A 2IVTA 1JSTA 2QKRA 1JBPE 4K8AA 2XB7A 2ZJWA 3EKNA 3Q9XA 1YVJA 2WQBA 3MSSA 2OXYA 4CYJA 3ALNA 3QQHA 3R04A 2OBJA 1DM2A 3O71A 3GVUA 3KXXA 4C4FA 3Q4ZA 1BX6A 3TKIA 3LM5A 4IACA 4NT4A 4UXQA 2PUIA 2CSNA 4Q5HA 5H8BA 1FPUA 3NYNA 2YAKA 4GT3A 1IASA 1IRKA 3V5LA 5J9LA 4IWDA 5AX9A 2HY0A 3HMIA 4HPUE 4CEGA 1JKKA 3WZUA 4YLKA 2QO9A 3FI2A 4XG6A 5FG8A 5D10A 4HCUA 5L8KA 4JT3A 4QMUA 1W84A 2HCKA 3MTFA 5EH0A 3CLYA 3MN3A 3BHTA 2GQRA 2QOIA 1YI6A 4XP3A 4C4EA 1U59A 4NK9A 3ZDUA 3G0EA 3OBGA 3WOWA 5J1WA 2VUWA 3C4XA 2PVKA 4X21A 5AV4A 5LCJA 4G1WA 3C4ZA 2VO6A 3JPVA 5CF6A 4EOPA 2E9UA 3G15A 4Z55A 1SNUA 4H36A 2YCRA 3EN7A 4K9YA 5CNNA 4X2NA 5J95A 3EL8A 3PLSA 5D1JA 1KOAA 4S30A 3R7IA 3FZPA 4CMTA 3ORPA 4UWBA 4NM0A 4LYNA 1H24A 3GOPA 4OTRA 4AA5A 3QWJA 4MD9E 5DNRA 4EOIA 4EOLA 2W1ZA 5CALA 2P4IA 4R78A 2YM6A 3A4PA 3ZOSA 3PJ8A 2RG5A 5BMMA 4I24A 4YPDA 4M13A 2BRHA 4B8LA 5EKNA 5CASA 5CU2A 3BHHA 3NPCA 4OGRA 3Q52A 4W9WA 5DHJA 3P7BA 2W06A 3R9HA 5AMNA 2HZ0A 3TEIA 4YJVA 2VWIA 1PMNA 3KMMA 4MVFA 4ZTHA 4FV1A 5BPYA 1H26A 3QWKA 4QNAA 5C9CA 2VTPA 3ZHPC 4DEHA 4XV9A 1KE8A 4A07A 5HTCA 1ZYCA 2A27A 4ZZOA 3FZRA 4IWPA 4YHFA 2EXEA 3KXGA 3QRIA 3CTHA 3VS1A 3W16A 3OTVA 2YJRA 3VUTA 3QD0A 3ZRLA 4CFMA 2WMRA 5H9BA 4W8DA 3ANQA 2C5VA 1AQ1A 4AU8A 4CCUA 4UMPA 4JOAA 5IISA 2PL0A 1H01A 1PXJA 3AMBA 2PZIA 4OTGA 4F9WA 5C4LA 2J0JA 1WVYA 3BLRA 5AV0A 5HI2A 3TUCA 1YXSA 3ZM9A 2QODA 4U7ZA 2ZDTA 4AW1A 4CMUA 4O0YA 4YURA 2XVDA 1G8SA 3IW6A 5KMMA 5AM7A 2H34A 2BROA 3IONA 4MF1A 5CNOA 1SYKA 4Y5QA 5AJQA 3KB7A 4C4HA 4CYIA 2ITVA 2QQ7A 4XRLA 3BLHA 2F49A 3MVJA 4HZSA 5F95A 3IPHA 3RCDA 3RINA 5CEMA 5FXRA 1J7UA 1NY3A 3FZSA 4FTRA 3G5DA 4KKEA 3LZBA 2P2HA 3F3UA 3MPMA 3NX8A 4DG2E 2F7EE 3HKOA 1T46A 3HX4A 2VGOA 1OMWA 5AP6A 4O0TA 2J9MA 4F9AA 4BDFA 3W2OA 5AUYA 2ERZE 4AOJA 5B7VA 1CKJA 1NVRA 4FT3A 4NIFA 5CEPA 4AW0A 4GYGA 4BCMA 1W98A 3RPVA 4LUEA 5L2WA 3Q04A 2E9NA 5K0KA 1XQZA 2W9FB 3P86A 4PPCA 3VS5A 3MPTA 4GCJA 4PUZA 2P3GX 3A2CA 5CU6A 2CCIA 4ALWA 3QZIA 5KKRB 4NSTA 2CDZA 3A8WA 4V05A 4JDHA 4UYNA 3LQ5A 4BIDA 4QTBA 3DZQA 4A9YA 4ZMFA 4ANOA 2VTHA 1I44A 2EU9A 4RX9A 3KKVA 3VBXA 3VS0A 4GJ2A 1R1WA 4P90A 4FGBA 3COMA 5A6NA 4EZ5A 2HELA 2IO6A 4YHTA 3E5AA 4I0RA 4IAFA 5LWMA 3W8QA 4BWPA 1NVQA 4KKHA 4JQ8A 3DJ5A 4ZOGA 4USEA 4JR7A 4ZP5A 1M14A 4RWLA 3E63A 3ORKA 3OUNB 4OTHA 4CTCA 4LOOA 3SA0A 4OAUC 2RL5A 5HOAA 3D94A 5J7BA 3CD3A 4AFJA 1W83A 2UUEA 1PKDA 4RG0A 2IW9A 3GC0A 4O27B 5DH3A 3TNPC 4A06A 5KBQA 4NTTA 3PTGA 2XEZA 3A4OX 2E9OA 5EDRA 4L01A 5TOZA 1RQQA 2R3OA 2H8HA 4PV0A 1OITA 4V0GA 1Q8TA 1SVHA 3I7BA 1NT2A 4FTTA 2W99B 4IHPA 4F9BA 3V5WA 3HUCA 4DG3E 4J8MA 3MH2A 4GVJA 4YC3A 1JVPP 4NCTC 3N9XA 4OTQA 2XUUA 4XYFA 2HOGA 2WB8A 3ZMMA 3L9PA 4IZ7A 5IZFA 2XKEA 3E93A 4L3JA 5AP1A 3DJ6A 1GZOA 2WTDA 3BHVA 3QX4A 4L43A 3UP7A 1J1CA 2B9IA 3RGFA 4NIFB 4FT7A 2XM9A 1UV5A 4AW5A 2JDRA 4B4LA 3OXIA 4GUBA 4ZZMA 3KC3A 5KMLA 4EK6A 4F6UA 3JR1A 1YHVA 3ZFYA 4YU2A 4ITIA 2HZNA 2PMIA 3OD6X 4I4FA 2JKQA 5C01A 3KRRA 1NA7A 4O7LA 4D0WA 1CKPA 4FE2A 4HGEA 5EG3A 4PNKA 5LMKC 5HLNA 5HNGA 2OI4X 4DTBA 2J6MA 2EB2A 3HV6A 3R63A 3FXWA 5JFSA 2W1DA 2ONLA 3ORTA 5M53A 2PPQA 2C69A 5DVRA 5I0BA 3MY5A 2B9JA 3TNWA 1M2PA 3C4EA 4QMMA 3QTSA 4FYNA 3F5UA 3OXTA 4QO9A 4QYYA 5B0XA 4C3FA 3QHRA 5M06A 3MI9A 3GU4A 2UV2A 3PRIA 4EH6A 4IQ6A 4G6NA 2JD5A 2ITWA 5EYKA 4FIFA 3VS6A 4AE6A 3B2WA 3O8PA 3DXNA 3SG8A 2JDVA 1REJA 5ANDA 4BVUA 3LCTA 4OW8A 4FTKA 5K5NA 4QOXA 4AXAA 3QRTA 3UJGA 4E3CA 4QTDA 5FP5A 5CQUA 4AF3A 4G6OA 2QNJA 2BKZA 3GOKA 4PMTA 5CAOA 5LVPA 4R3RA 3RNYA 3UZPA 3DDPA 4FBXA 4M0ZA 3FLZA 1ZMUA 1H0VA 3EN5A 3WZJA 4FV4A 2C3JA 4U45A 4A9SA 5GZAA 4IDVA 2RFNA 5FP6A 1P14A 1Y8GA 3R7UA 2HY81 2NP8A 3NYOA 4DH3A 2VNYA 2VWZA 4RLLA 1XBBA 5EDQA 3EHAA 5AV2A 1M7QA 3BX5A 4WOVA 2BFXA 4B8MA 3BYSA 2GPHA 5K3YA 5M51A 3EQBA 2V22A 5DGZA 3R9DA 4FNZA 5IUHA 3D7ZA 2ZYBA 3PG1A 2OH0E 3RM7A 4NKSA 4R7HA 5IQIA 4LOQA 4YJTA 3LFCA 2BRBA 4IJ9A 3FXZA 5TF9A 4DEEA 2JDTA 2W05A 5H8EA 2F7ZE 5IQBA 1GZKA 5AR2A 5FXSA 4IFGA 4BDKA 5JRQA 4ZXTA 4MQ2A 4CRSA 1CDKA 2BDFA 4X6RA 2CPKE 2UZTA 5DT4A 2OGVA 4I6HA 4I6QA 3ACJA 4LRMA 4FEXA 1NVSA 4ZIMA 3NCGA 5L2QA 3UO5A 2B54A 5CLPA 3F5PA 4YNOA 4C4JA 5DFPA 4F09A 2PVJA 5HLPA 3FZ1A 4EQCA 2ZAZA 3ZLYA 3RWQA 3ITZA 3CGFA 4Y95A 4JIKA 4QMPA 4OTPA 5F4NA 4FL1A 2BZHB 4A4LA 3A7JA 3QTWA 3MA6A 3NWWA 4NM5A 4WKQA 4WG4A 5KZIA 4MKCA 4BTFA 5I9YA 1K2PA 4BDHA 3ODZX 4QQCA 1APME 2B7AA 2VAGA 3F2NA 2GTNA 3QX2A 5G1XA 3W55A 4ENYA 2CMWA 5HD7A 1ZRZA 5TE0A 1ZOHA 4EOSA 4BHZA 4NUSA 3ZUVA 4EBWA 1YXTA 3MBLA 2RFEA 2WTWA 1FMKA 5CSPA 2F2UA 3SDJA 3UPXA 3D83A 4BBFA 3BV2A 2WQMA 3GI3A 3IOKA 3R73A 4EBVA 4N6YA 5L8JA 5KE0A 5J9YA 5T6KA 5C8NA 2H96A 4IM3A 3GC9A 3DLSA 3HLLA 4M14A 2BAQA 3KA0A 4OT5A 5DIAA 2WAJA 2A0CX 2XBAA 4I6BA 4UZHA 1PXKA 3AMYA 3VS7A 4RC2A 5I4NA 1OGUA 2PE0A 3PXFA 3PZHA 2XH5A 4M97A 3B8RA 3ERKA 4KRCA 1GY3A 2V62A 4FEQA 3GCVA 3QALE 4FODA 4ERWA 4IAYA 3O96A 2I0EA 2XEYA 4YZCA 2PMOX 2Z7SA 5HX8A 3LPBA 2BIYA 2JFLA 4ZSJA 4E6CA 3EQCA 3CE3A 1XO2B 3JY0A 5TO8A 4LV5A 4HNIA 4ZS4A 4MWIA 5BVOA 4LG4A 4USDA 5FTQA 2C6EA 2I1MA 4ZZNA 5FM3A 5BYZA 3FKOA 3O51A 2OKRA 4BL1A 3PYYA 4DBXA 4QRCA 4DF3A 4RFYA 5M44A 1XJDA 3D0EA 4E6QA 3COHA 3WYXA 1B39A 3FC2A 2XJ2A 4FKPA 5EQPA 3BZ3A 2WU6A 2CKQA 2R3RA 4FNWA 3OW4A 4CZTA 4JDIA 4DITA 4QNYA 4TNBA 1BL6A 4BDJA 3KREA 3NNVA 2YA9A 3QUPA 2FB8A 3QQKA 4AN2A 4L7SA 4L44A 3QGYA 2XF0A 4RX8A 4FEUA 4D4SA 4FVRA 3K54A 4H39A 5CVGA 4BKJA 3O8UA 3IW5A 4AA0A 5FWKK 3DB8A 3FZTA 4FL3A 2J5EA 3I60A 4IZYA 4F9CA 4CQEA 2OWBA 5A4TA 1U4DA 4XG7A 4D4VA 5IEXA 3GFEA 3KRWA 4YC6A 2F57A 2VTJA 2VV9A 1UU7A 2VTOA 4NFMA 5DN3A 3KK9A 4B0GA 5CANA 4QYGA 2DUVA 4LI5A 2VO7A 3NW7A 5EM5A 3GNIB 5AUZA 3E88A 5CZIA 1HCLA 3DQWA 4X3JA 2YM5A 3MH0A 3NZ0A 2VWYA 2Z7QA 3P78A 3FV8A 3EZVA 1KE9A 4G5PA 4MXXA 3TACA 5ETFA 5E4HA 3FI4A 2Y9QA 4B7TA 1F3MC 3E8EA 1VZOA 3Q9ZA 3CCNA 5BUIA 2OW3A 3P0MA 4Y46A 1OPJA 3MFUA 4ASXA 5EW8A 4XG8A 3MH3A 4CKRA 1XKKA 2VTMA 3LAUA 4WRGA 3WZDA 1U5QA 4EK3A 2ZVAA 1QPDA 4IAZA 2FO0A 4BCKA 5JQ5A 3U55A 4FX3A 5GJDA 5JGDA 3RHKA 3KU2A 2XK7A 4M8TA 2JDSA 1FQ1B 2OFVA 4RT7A 2HW7A 4EOKA 4AOIA 4CRLA 4WG3A 3OCTA 3CPCA 4FTJA 2XK6A 5HTBA 3PA3A 3OWLA 5ANIA 4XV3A 3ZU7A 4LOPA 4FA2A 5EM8A 3CEKA 1E9HA 3E8NA 4UMRA 4GVAA 5CTPA 1JQHA 5HIDA 3BELA 4HJOA 1Q5KA 3GU6A 4FKUA 2CCHA 3QU0A 4BF2A 5A4LA 1O9UA 2QOFA 2EWAA 4JAIA 5HEZA 5AIKA 5EOBA 3PDTA 4PMMA 2YACA 5IQGA 4RRVA 3Q96A 3PP1A 3C0IA 3LMHA 2Z7LA 2AC3A 4XBUA 4JG7A 2QKWB 2GFSA 3MB6A 4EOJA 2R64A 3R1SA 4DBNA 4FNXA 3KMUA 4ZTMA 1FOTA 4YZ9A 4I21A 4TN6A 4DLIA 3N51A 4X3FB 3BYOA 4LMUA 1YWVA 4MXCA 5H2UA 4EKKA 5HBJA 4RVMA 2NPQA 4L3PA 3NUPA 4FG7A 5FUTA 4DT9A 3KFAA 5CS6A 4ASZA 3P1AA 5D7AA 2YCSA 2GNIA 4GK2A 4UMTA 3BYVA 4N4SA 2I0HA 2G2HA 1PKGA 2YM8A 4QTAA 2GS2A 3BBWA 4O7ZA 1Q8ZA 4MWHA 3ZO3A 4V04A 1BI7A 4RJ8A 3ATSA 3A7FA 4II5A 4O82A 5HQ0A 4GK4A 4KB8A 5A6OA 1RDQE 4RJ3A 5TR6A 1ZZLA 1M2RA 3ZH8A 2AYPA 3I4BA 2ETKA 3EFWA 2C0OA 1FVVA 2VWWA 2XNBA 2Z2WA 3V6SA 1KV1A 4R3CA 3Q2MA 4F7JA 2FH9A 1JSVA 1OVEA 3DY7A 3RALA 3GU7A 2GQSA 4W8EA 5KHWA 5DYJA 3CS9A 4FKLA 4D1ZA 1ZOGA 2OF4A 3L1SA 3LIJA 5E7RA 3GFWA 5FBNC 4BGHA 2C6TA 4JRNA 4M69A 4O2ZA 4ZTNA 3K2LA 3PPKA 2UVXA 4O0XA 3W18A 4AA4A 2X4ZA 3KGAA 5HE1A 5AUTA 3M1SA 3UQGA 4UYAA 4EQUA 3CGOA 3UZRA 4DE4A 3G90X 3SD0A 2CGUA 4DC2A 3DT1A 4GT4A 2X1NA 1MRVA 2WMQA 1OZ1A 4FSMA 3Q6UA 4BYIA 4GFGA 3ZZEA 3TTJA 2GS7A 1XH7A 3R1QA 5L2IA 5LMAA 4JBVA 2ITQA 1KSWA 2XA4A 3QRJA 4XHKB 3RVGA 3E3BX 1PMEA 2JAMA 4WNMA 4RIOA 1H08A 4ACDA 4YP8A 4DN5A 3MY0A 1WBOA 2QOQA 4C33A 4CKJA 4F6WA 4XV1A 3DJ7A 3IDCA 4YJUA 4G34A 5E8TA 5FTGA 4L42A 4W4XA 1UU3A 3GCUA 2IZSA 2JIIA 4R7IA 4D4RA 4TT7A 2WMUA 2JGZA 3COKA 2NNWB 4XG3A 3WF7A 4P2KA 1BKXA 1H25A 4TWOA 4D9UA 3VF8A 2CN5A 3DAEA 3Q32A 5HVJA 3FZOA 5DLSA 3LCSA 3I6WA 1Q41A 4FKSA 2IZTA 3QQJA 2WNTA 3NSZA 4CT1A 2BPMA 4EI4A 2BDWA 5AM6A 2XRWA 3UP2A 5LVOA 4O21A 4PRJA 5BNJA 1W0XC 4CCBA 4QQ5A 1XBCA 3F3WA 2ZM4A 5A3XA 2XYUA 3ZM4A 2NRUA 5GIPE 4FKTA 2RIOA 3OS3A 5DWRA 4YLLA 2YIRA 4CLJA 3NS9A 4TYHA 2XNNA 4QMWA 3E7OA 2OLCA 4FICA 5IH6A 4QP3A 3OROA 4AZFA 3HMMA 3VC4A 3QUDA 1YRPA 2PVRA 4FIHA 2PUPA 1PXOA 3E8CA 1XH5A 4AE9A 4CTBA 4F64A 4HW7A 2RGPA 4RFZA 5FQDC 4QYEA 4C34A 4I5HA 5A54A 3MESA 5LQFA 2FA2A 2OG8A 4V0GB 4IW0A 4LGDA 3UC3A 3NYXA 4MBIA 4JR3A 5E8UA 5ITAA 5IDPA 4PQNA 5LVNA 3O8TA 3CIKA 4CG8A 4RMZA 2VWXA 4WUAA 4F7NA 3C5UA 3GCSA 3T3VA 4BDBA 4H58A 4AX8A 4KIKA 3JYAA 3CR0A 4J1RA 4LL5A 3OY1A 3KCFA 3UQFA 3SGCA 4GMYA 3FXXA 4RJ4A 4BCJA 3DAKA 2J5FA 1A9UA 2V0DA 2VTIA 3R7EA 4C2WA 3IQ7A 3OC1A 2WXVA 4U81A 5BVWA 3G51A 1WBTA 2YHVA 4FV5A 2ITTA 4C0TA 4D2SA 4F1TA 2J2IB 3RHXA 3AT3A 3NR9A 1T45A 4GU9A 4HYUA 4A4OA 2XKCA 5CF8A 4AUAA 4DEAA 3OT3A 5AP2A 2IVSA 2B9FA 1G3NA 1YDTE 1G8AA 1CMKE 4XJ0A 2Y6OA 3MJ1A 4BCIA 3C5IA 2HIWA 3KN6A 2DYLA 4AACA 1DI8A 5DA3A 2J0KA 2PVMA 3OWPA 4WA9A 4D4YA 3SHEA 4IADA 4O83A 2B55A 3F6XA 3PY0A 3M11A 4N6ZA 3LFEA 4FTLA 2O5KA 4DEDA 4DEBA 3EWHA 2PULA 4KBKA 3R71A 4M0YA 4XMOA 1UKIA 2C0TA 4RVKA 3PJ1A 4U9AA 3FBVA 5JFWA 4ARKA 4RSSA 3OF0A 2C5XA 4I6FA 4ANMA 3UYSA 3H4JA 3IG7A 2W17A 3UIXA 3LFQA 3R28A 4DGGA 5JKGA 4HVGA 3ZSGA 5CAUA 4I3ZA 4E6DA 4E8AA 3IW4A 4ZJIA 2WMBA 4LFIA 3FLSA 2R3NA 1OIQA 3AGLA 4KRDA 2YCQA 4YO6A 2RF9A 2ZB1A 3PSCA 4FT5A 4E26A 4K0YA 5HLWA 2XIRA 4USFA 2HK5A 2YM3A 4DGMA 3HZTA 3BEGA 4NJDA 4O22A 4PL5A 5KMKA 5LMKA 1WZYA 3TTIA 5HGIA 4QP7A 3C50A 4O0UA 4XRJA 2HYYA 4CFXA 2QR7A 4C37A 3MS9A 1KE5A 2CGVA 3LXPA 4PL4A 5CAPA 2GQGA 4X2GA 2GNFA 3IK3A 3LLAA 4JAJA 4IB0A 2YIWA 3HMPA 3KRXA 3SX9A 5J5TA 5L2SA 4BB4A 2W0JA 4DH8A 2BCJA 4A7CA 1FMOE 2V7AA 1AGWA 2W1IA 3BLQA 3R00A 2C3KA 5IMEA 3DQXA 3HA6A 3DXPA 2J0IA 4LV8A 5K0XA 5JRSA 4O7TA 4F70A 4QMXA 4IB5A 5EYCA 4IMYA 4YSJA 3BYUA 3PWYA 2QCSA 3QTUA 3NCZA 1RW8A 3QCQA 1FVTA 5FGKA 2XBJA 2XZSA 2IW6A 3R0TA 4X7QA 3TNIA 1ZMVA 3CJFA 2F2CB 2CNVA 5HNBA 3IGOA 2QHMA 4G31A 5DT0A 3V01A 4E5WA 3FMJA 3BIZA 4G6LA 5EHOA 4L00A 4DEGA 5IA1A 1WFCA 3VHEA 4YJSA 3COIA 4EUTA 5G6VA 2JEDA 4FZFB 3EQFA 5CX9A 4N57A 3LFDA 4WRSA 2XM8A 3BQCA 4TWCA 3SOCA 5D7VA 1PXMA 2LGCA 4WT6A 1GAGA 3Q6WA 3KXHA 1GOLA 1Q8WA 1Z9XA 4FKGA 2F7XE 4AZWA 4AZTA 3D5WA 2HAKA 1OIYA 3QF9A 4FKWA 4J71A 3S3IA 4AS0A 3LXKA 3E62A 3EQDA 4HCVA 4D58A 1Y8YA 3OWJA 1A48A 5IQDA 5H3QA 1JKTA 2QOLA 4EH3A 2QD9A 4MBLA 4GKIA 1H1WA 4BI0A 3FHIA 3FMMA 4NW6A 5LCKA 5IF1A 4C02A 5IQCA 2ETMA 5LOHA 4FR4A 3VBWA 5CVHA 3PSBA 3REPA 3ZC5A 2HWPA 2W1FA 3VO3A 2GFCA 2PZPA 1Y91A 2DWBA 4LMNA 2FUMA 2VNWA 5CENA 3R83A 2UW6A 1BLXA 2LAVA 2W7XA 1H27A 4WNKA 2YABA 3BGQA 3H0YA 4U41A 3FWQA 4XG9A 5D12A 3QHWA 4PPBA 3NUAA 3V6RA 4KA3A 3TDWA 5J7HA 5K5XA 2B0QA 1H1QA 2ETRA 4O6EA 4ZTRA 1PMVA 2X4FA 5M4UA 4CD0A 5DG5A 5I3RA 4U40A 1K3AA 2E9VA 4AOTA 1ZYDA 4E7WA 4HYIA 4R1YA 5EW9A 4RC3A 3IDPA 3R8LA 3RCJA 3RPRA 4YHJA 4BCGA 1J1BA 4E20A 2FSMX 2YZAA 2YZLA 4IBMA 1JPAA 3H30A 1URCA 1OECA 1U46A 2HXQA 2X7OA 3IECA 2UZDA 4DFYA 3MFRA 3KL8A 4FKOA 5HCYA 3KF4A 5HVKA 1JSUA 4IVDA 3KRJA 3NUUA 3D15A 3MVHA 1IA9A 3Q5ZA 3UQCA 5CF5A 2YLFA 4UV0A 2J0MB 5HESA 4EONA 3QCYA 4UX9A 5HG7A 2A1AB 5HO6A 4IIRA 1EH4A 2YIQA 3UIUA 1DAWA 1KE7A 2UZNA 1UNGA 4IM2A 5AP3A 4C3RA 4TYHB 2C4GA 4MXAA 1Z57A 3MFTA 4TKSA 3TIZA 4CFWA 3DU8A 3BEAA 3FE3A 2WMWA 5IQFA 3ZDIA 1YXVA 3PA4A 2FSLX 3HV4A 3UO6A 1NW1A 2G01A 2ZM3A 3FAAA 4TYIA 4M66A 2IZRA 3BBTB 4HCTA 2YDKA 4WUNA 3PPJA 2PMNX 3W32A 2C6IA 1MRYA 5CEQA 4C57A 5F9EA 5JK3A 3FI3A 5IUGA 2Z60A 4K33A 4BDDA 3UPZA 3TL8A 3AC1A 3ZEWA 4CZYB 1RE8A 3SRVA 4DLJA 5EQEA 5IEVA 1TQMA 3BI6A 4C36A 4EZ3A 4RX7A 3BQRA 1ZAOA 3DBCA 4GW8A 3A61A 5IQHA 2VU3A 1KWPA 3GCPA 4C7TA 4IM0A 4ONAA 1L3RE 5LARA 5JFVA 3VW6A 3D14A 5M4CA 3IGGA 3CSVA 2PYWA 4X0MA 3HMOA 1STCE 4YSMA 4BFMA 2R3GA 1MRUA 4FYOA 3AT2A 2OICA 2XJ1A 5HVYA 3LE6A 3DK7A 5JZJA 3H3CA 2QLQA 3OT8A 4WG5A 4RIYA 3BYMA 3RZFA 3WF8A 4F0IA 5BVKA 1QMZA 4E93A 3M42A 2B52A 4RWKA 2R3IA 1G5SA 4QPAA 3BWFA 2R3KA 3V04A 2CGWA 3I5NA 3C4WA 3PE2A 1L8TA 4ACHA 1TKIA 1VR2A 4QMTA 5AIRA 4C2VA 4IB3A 1JAMA 4E73A 5A4CA 5JZNA 4W4WA 1CM8A 2YIXA 4DGNA 3L9NA 2BALA 3G6GA 1REKA 3VBVA 4DFZE 3E3PA 4F99A 3S00A 1IA8A 3DBEA 1AD5A 3L9LA 2Q0NA 1Y6BA 3ZRKA 5FEEA 2PZYA 5LVMA 2ESMA 1V0BA 2WMVA 3TWJA 2YDJA 3OOMA 3R6XA 3EQPA 4FIIA 5HTIA 3F2RA 4LRJA 4XNEA 3VJOA 2IZUA 2GNHA 2CN8A 3BHUA 3EKKA 5I9UA 3LMGA 5AAEA 2G1TA 4HPTE 4U42A 4BC6A 2BIKB 4KSPA 3EH9A 2XK8A 3EFKA 3F7WA 4QT1A 5FLFA 3G0FA 1OIRA 3HV3A 4X3FA 1SMHA 3NW6A 1UNLA 5CYIA 5EHLA 4J95A 3CXWA 3MDYA 5J1VA 3T9TA 2YISA 2GTMA 1MUOA 2ACXA 2XNMA 3LCOA 2CLXA 4FTAA 4I5MA 4IX3A 4R1VA 1M17A 3VNTA 4KAOA 4MD8E 3NIEA 3F82A 4CNHA 3JVSA 4TRLA 5JMSA 3EZRA 4AP7A 3MJ2A 3F3ZA 4FZ6A 4U8ZA 4FUYA 2IJMA 4EC8A 5DE2A 3E64A 4FV2A 3FSKA 3ZS5A 5CT7A 3EL7A 2R3JA 2E9PA 3QD3A 3FMDA 2ITOA 5AP7A 5GZ9A 5AV1A 1OKZA 3GGFA 4QMQA 4RGJA 4LQMA 3LQ3A 5TKDA 3AG9A 3ZC6A 3AD5A 2WQEA 4MAOA 2X2LA 1PF8A 3D2KA 5ETIA 4E4LA 1YHSA 2O8YA 3ZYAA 3R30A 4UWCA 4BTJA 5AFVA 2Y7JA 1BYGA 4UMQA 1OUKA 2PTKA 3BV3A 2WTIA 3WYYA 1ND4A 5KO1A 3CP9A 1Q8UA 3ZRMA 3VVHA 4J52A 4FMQA 4Z9LA 5CY3A 2BAKA 3WF9A 2YEXA 2BRGA 5DR9A 3ZEPA 3W2SA 2ZV9A 4AT3A 5C27A 4YBJA 5EOLA 5CAVA 2X9EA 3DOGA 4G3EA 3QKMA 5BVDA 5L4QA 3MWUA 3AQVA 3DNEA 2P55A 4NU1A 4XLIA 3BU5A 5A4QA 3W2PA 4AW2A 4ACGA 1Q3WA 4BCQA 3A62A 3FQSA 2WQOA 4ORKA 2W5HA 4YJOA 1UWJA 4QMSA 2YWVA 3NVMB 2VTNA 2I40A 3TV4A 2VD5A 4WBOA 1KOBA 5BYLA 5A4EA 4O1PA 2VTRA 3VS3A 4TZRA 1LEWA 4HVIA 3IDBA 2F9GA 3QKKA 3V5JA 3O0GA 5LWNA 2QOBA 5T3QA 3W8LA 5HCXA 3F2AA 4BDEA 3O7LB 4FEVA 4NL0A 2BUJA 3EQRA 4Y5HA 4PPAA 4QQJA 3RKBA 2C6MA 2ZV2A 3EYGA 4HOKA 4Q2AA 2ONLC 4TXCA 3S2PA 4EQMA 3PXZA 4R77A 3FY0A 2OXXA 4TW9A 3ZXZA 4OUCA 1H1PA 2H6DA 1YHWA 4CXAA 2ITXA 3PWDA 2BZIB 4GUEA 3CKWA 3NYVA 5DT3A 5LMBA 4IC7A 2ZM1A 2PMLX 4DHFA 1J7IA 2OZAB 3G2FA 2XP2A 3PIYA 2UZOA 4ZJJA 4E4MA 4D1SA 2HZIA 3S0OA 3TT0A 4DFBA 3SXRA 4L7FA 4DFLA 2WTCA 3UOLA 2XIZA 4EUUA 2C30A 3WZEA 3C1XA 4W4VA 4LUDA 4RIWB 2R3QA 2C6DA 2KULA 4IEBA 5HU3A 1H00A 2JC6A 3FI8A 2Z02A 3NVKI 1LR4A 5CEIA 4MF0A 3UC4A 3FSFA 5EM7A 2UZBA 4MD7E 4RWIA 5CU3A 3S4QA 3KXMA 5BVFA 3BCEA 3VUMA 2QU6A 1U54A 2ERKA 3RK9A 5AEPA 5BMSA 3NNWA 4ASEA 2Y4IB 2FSTX 4BDAA 3QYZA 5KBRA 4I93A 4EL9A 3NMUF 3TI1A 4FSRA 5L6WL 5ICPA 5B2MA 3ALOA 1H0WA 2QLUA 4NKAA 5DMZA 1ZMWA 2AC5A 3Q9WA 2A19B 4KIKB 3GQLA 4JXFA 5KCVA 3D9VA 3NGAA 1Z5MA 4FVQA 3SQQA 4ZSAA 2O64A 3FL4A 1SZMA 3FLQA 3GC7A 5CI7A 4I5PA 3W2CA 1VEBA 5HG8A 1ZY4A 5LJJA 2JKKA 2XK3A 3BRBA 3IKAA 4GKHA 3PZEA 3MY1A 4O7WA 2BMCA 3QXPA 5HBEA 2QI8A 4CV9A 2WMSA 3GXLA 3O2MA 3PJCA 3HRFA 3PY3A 3MVLA 4GIHA 4U5JA 4EEVA 2WTKB 3KQ7A 5CXZA 4YZNA 5BUEA 3LFNA 5EI8A 3N4VA 5M09A 4Z7HA 3CKXA 3CC6A 3HP2A 4RQVA 4U3ZA 3NAXA 1PXNA 4E6AA 4EHZA 5IA0A 3OFMA 3MIYA 1FVRA 3Q4UA 5E90A 4P7EA 2O3PA 5E8SA 3IS5A 3RAIA 3R9OA 1VYWA 1ZXEA 2JKMA 3FKLA 2C3IB 3KVXA 4IFCA 2VTLA 3NW5A 5HKMA 3V8TA 2WEIA 3BGPA 3F5GA 3BU3A 1IAHA 4ZLZA 5BX0A 3HL7A 5EYMA 3LJ2A 3RPOA 3U4UA 3V8SA 3QLGA 3ORIA 3W2QA 4K18A 4J97A 5J5SA 4OTWA 2QG7A 5JH6A 2R3FA 3I0QA 4O0WA 1WVWA 4MXOA 5EDPA 3CBLA 3W2RA 4FTOA 4UZDA 3BHYA 3PVWA 3BE2A 4Y83A 4EH8A 5AUUA 5CF4A 2EB3A 4G9CA 4L68A 4MNEA 4W4YA 3G9LX 1P4FA 2HZ4A 1OKYA 2Q0BA 1YOJA 3HP5A 4D28A 4BCHA 2KTYA 5GIOE 3RAWA 5L6OA 3LKMA 3V5QA 1IR3A 3AC2A 2YJSA 3PUPA 2XIKA 3UODA 4EH4A 1F5QA 3VS2A 3QC9A 5HZNA 1YOLA 3AMAA 4TWNA 4TY1A 5E9EA 3C4CA 2GSFA 4IANA 4RIXA 5IA4A 3KULB 4ACMA 1OBGA 2OU7A 1Q24A 1H8FA 5F94A 3RPYA 2G9XA 3P7CA 3L9MA 5AP0A 1HOWA 1FGKA 2C6OA 4NCTA 2PY3A 3I0OA 5JGAA 2WIPA 4ACCA 4RPVA 2GS6A 3AOXA 3LMIA 3B8QA 4PTGA 4TYEA 2XK4A 4S34A 4O6LA 2YERA 2R5TA 3DZOA 4GRBA 4RIWA 4KWPA 4APPA 5HORA 2BAJA 1UNHA 4NFNA 4U0IA 4H3PA 1URWA 5I9XA 4G9RA 4IE9A 4XV2A 4O81A 2W1CA 1J3HA 2C1AA 3U8WA 3LHJA 1TQIA 3GBZA 4KBCA 4ZSEA 5BYYA 3KXNA 2WIHA 5C4KA 1PJKA 5IA5A 3K5UA 3QRKA 1BI8A 4EH2A 3TXOA 4Z3VA 2PVFA 3PXRA 4EH7A 4AGUA 2OSCA 3TG1A 1PXLA 2C3LA 4JBOA 3U87A 4C61A 3OEZA 4FTMA 1JKSA 4KINA 4DGLC 1UKHA 5FRIA 4U43A 5HIBA 4K11A 3D5UA 2C5OA 4FIGA 4OBOA 3WZKA 4O7NA 2G15A 3KN5A 4L9IA 2PVHA 4ZSLA 5IH4A 3AC8A 4JL9A 4E4XA 1FINA 2XNEA 1XBAA 3ZLSA 2QO7A 4QMYA 3U4WA 5I3OA 1WCCA 2W5BA 3SXSA 3VBTA 3TJCA 4M67A 1Q3DA 2W9ZB 5EM6A 5JSMA 2WQNA 2YLEA 3R22A 4FZ7A 2BDJA 3EIDA 3ELJA 3R21A 2WMTA 2YDIA 3H9FA 3THBA 4QP8A 1F0QA 3UDBA 5KHXA 4NW5A 4RZVA 1VYZA 3VIDA 2BR1A 4HGLA 5BVEA 3JVRA 5CI6A 4BHNA 3SAYA 4F1OA 4EK5A 2PVYA 3RPSA 5EQYA
chains in the Genus database with same CATH superfamily
2VTTA 4L45A 3W0SA 2E2BA 4FSNA 1PMUA 5CWZA 2ZMCA 4CFUA 3OW3A 5BVNA 4DH7A 1YXXA 5A46A 1UU9A 2PK9A 4MEDA 5F1ZA 1R3CA 3TV7A 5IU2A 5KZ0A 2WTJA 3WILA 5EW3A 5ACKA 1JNKA 3L8PA 3H9RA 3R8PA 5JGBA 4UBAA 4EYMA 4S33A 4X2JA 4BZOA 4MNEB 4EWHA 2RG6A 4RQKA 3UG2A 3CY2A 3L8XA 4BICA 1UVRA 4EZ7A 4D2TA 5A9UA 3NUYA 5DBXA 4O1OA 4M84A 3UOJA 3EN9A 4IX6A 1W2FA 3C9WA 2GNJA 3Q53A 3WI6A 1PYEA 4HYHA 5HU9A 4YJNA 3R9RA 2VO0A 4RIXB 2GU8A 4F4PA 1WVXA 3ORMA 4U79A 2GHLA 4ZS0A 1SVEA 2J4ZA 2YWPA 3GQIA 2OZAA 3H0ZA 2XARA 1ZYLA 3HGKA 4G5JA 3MH1A 3CTJA 4O0RA 2OFUA 3A7IA 3JY9A 4KKGA 4H05A 1XHAA 2R4BA 4RA4A 3NAYA 4ZAUA 3I1AA 4IAIA 4UWYA 5AR3A 5AADA 3HV7A 3FUPA 4AAYA 3SKCA 2QOKA 2OIQA 2UW5A 2UZEA 4JIAA 3Q60A 1Y57A 4Y73A 4BDCA 3LFAA 3HMNA 4AN3A 5DRBA 2OJIA 3C0GA 3ZLWA 4M69B 4S31A 4I1ZA 3RTPA 3QC4A 3VJNA 4IX5A 3UOHA 1S9IA 3QQUA 3UBDA 3ZSHA 4QMNA 2G2IA 4IB1A 4Q9SA 3WBLA 4BCOA 5A14A 3EJ1A 2BHHA 4PTCA 3KVWA 4XX9A 3JS2A 3UG1A 2O0UA 4ERKA 4YLJA 3F7ZA 3ROCA 2B4SB 3SLSA 2WHBA 3ACKA 3N4UA 3UOKA 4M15A 2XALA 2GHGA 4P5QA 5B2LA 3RBWA 1G8JA 4OBPA 3II5A 2V5QA 4AWIA 2WOUA 1MQBA 1ATPE 5ETCA 2UW7A 5GHVA 3L8SA 2PZRA 5LVLA 5D11A 3QTIA 2X8DA 4YZDA 3DKOA 2R3PA 5L2TA 3R8MA 5IQEA 3ET7A 3HA8A 4OTDA 5GNKA 2PHKA 2X81A 4ZY5A 5HD4A 2JFMA 3BE9A 2Y0AA 2ZB0A 2QURA 4HNFA 2IG7A 2PUUA 2YCFA 4RZWA 4RJ6A 3QKLA 1OPKA 2ZV8A 2WTKC 1Q97A 3DNDA 5AAGA 3QL8A 4AQCA 3DFAA 4NH1A 4CMOA 4TYGA 4CKIA 4ANBA 4O86A 4FZAB 2C6KA 3ZUUA 4QD6A 2XMYA 4QYFA 3OG7A 4R5SA 3ZBFA 4D0XA 1G8KA 3DKFA 4FV7A 5KUPA 3PVBA 1PW2A 2O63A 3EYHA 4NM7A 1FGIA 1S9JA 4FV8A 2X39A 4H1JA 1TVOA 3MV5A 4KSQA 2ITYA 2UZUE 4UEUA 5I9VA 1MQ4A 4QP2A 4ZTSA 4X2FA 5M55A 4AZEA 3KMWA 4APCA 3ZTXA 3OOGA 1J91A 3H9OA 3OHTA 2W4JA 2WZJA 5CZHA 3PIZA 4DT8A 1Q4LA 1WBPA 5HE3A 4XG2A 4N0SA 3PY1A 5IMXA 3ORLA 4D55A 4F7SA 3PXKA 2X0GA 1Q61A 3OWKA 5ANEA 4L46A 5K4IA 4NZWB 4M68A 4CQGA 2QHNA 3RM6A 3ANRA 1I09A 4MXYA 4UB7A 5EYDA 2XK9A 3GB2A 3PP0A 4IH8A 3SW7A 2X8IA 5HX6A 4MBJA 3AC3A 3A8XA 3QCSA 4PDYA 1ZZ2A 2UW9A 4FC0A 1WBVA 2XIXA 1TQPA 3GENA 2QVSE 1R78A 4JG8A 3Q4CA 5AV3A 4FF8A 5HICA 3ULIA 3ZFMA 3R9NA 4D2PA 3POOA 4CSVA 3GUBA 4EHEA 3R2BA 1SNXA 3SOAA 2Y4PA 3H10A 4IDTA 1WMKA 2Z7RA 4BTMA 5IH5A 4AZSA 4EOOA 2C0IA 3D5XA 3FDNA 3SV0A 3DXQA 3AGMA 1SVGA 4RWJA 5DEYA 4ZLYA 4X6QC 1O6KA 5CVFA 4Q5EA 3DBDA 4QPSA 3EQHA 3KRLA 4ALVA 1XWSA 3E92A 5JN2A 2IVVA 4YZBA 3P5KA 1PYXA 4G2FA 4I23A 4BIBA 4PX6A 4BZNA 4WBBB 4BWXA 4BR3A 3FMHA 2X6EA 2OJFE 4WSQA 4CFVA 5E8VA 2GCDA 3GU5A 5AUXA 3CPBA 4F9YA 2X6DA 4O38A 4OLIA 4QMOA 3ZONA 3C4FA 3UDSA 1ZY5A 4FKVA 5E92A 3ZFXA 2WEVA 1GIJA 4FZDB 5AR4A 4GG7A 1W8CA 1DI9A 4F6SA 4ITHA 4QP9A 5E1EA 2W4KA 4YR8A 4G16A 1UWHA 5IA3A 3LOKA 2UW4A 1IEPA 3W0NA 5AA8A 5HO8A 2JIUA 4J53A 4GFMA 3D7TA 2WU7A 2BRMA 2ZMDA 1XH9A 1U54B 4KS8A 3SC1A 5L8LA 4IZAA 4G3GA 3BWJA 3UO4A 4R5YA 4GJ3A 3HUBA 2XIYA 3A99A 1W2DA 4DFUA 1OGYA 2OK1A 2QOOA 4FV0A 4ZLOA 5HIEA 4O91A 2W1GA 3VQUA 4OTIA 5BUJA 2BHEA 4EH5A 2BILB 5M56A 4DA5A 2BZKB 2GDOA 4AGCA 1LEZA 3NDMA 3LXLA 5M4IA 3QYWA 2UW8A 1B6CB 2YAAA 3A7GA 3A7HA 5T68A 2VGPA 3ZXTA 4AGWA 3NUXA 4MYGA 4ITJA 2C6LA 4GT5A 4PY1A 4E1ZA 1P2AA 1GIIA 1K9AA 1V1KA 3FLNC 4UXLA 1LPUA 1Q62A 2J50A 2XNPA 3D4QA 5IA2A 3BL7A 5DR6A 1CTPE 2PE1A 3MA3A 3OUKA 3BPRA 3V8WA 1KUTA 3ZBXA 2VWBA 4FSTA 4HGTA 4G3CA 2OJJA 1E1VA 3TUDA 3F9NA 2CJMA 3T9IA 1PHKA 2PZ5A 3WIKA 3QZFA 4D1XA 3S95A 3K5VA 3OP5A 4YTCA 4NTSA 5E91A 4E5AX 5KKRC 3RNIA 3U6JA 5GZ8A 4FIEA 3W1FA 1OL1A 5FXQA 3MB7A 4L3LA 5FEDA 4XP2A 2WGJA 5KMNA 1OKWA 4YJPA 5E8WA 4NWMA 2YM4A 3LXNA 1KV2A 4RFMA 5D9HA 3FC1X 1OM1A 3UNKA 3KY2A 3FQHA 5B2KA 4YJQA 1SM2A 3V5TA 3RWPA 3DA6A 4C3PA 3MTLA 4Z7GA 1TFFA 4R6VA 2QC6A 3MVMA 4FNYA 3CTQA 4JQEA 4ZEGA 4GL9A 4HVHA 4OAVB 3EFJA 3V51A 4CFFA 1DAYA 2Z8CA 3OCBA 2JIVA 3FYJX 4MTAA 4IWQA 4NYEA 1UA2A 4X2KA 5AR7A 4BN1A 4ZMEA 3DFCB 4FV6A 4H1MA 4M3QA 5HE0A 4TNDA 3VW8A 5BV3A 2HXLA 3RZBA 3HAVA 3U9CA 2HWOA 4ZTLA 4DCAA 4GYIA 1E1XA 3FMNA 4Q9ZA 4XCUA 3KXZA 3QD4A 4O0SA 4WSYA 1OI9A 3QQGA 5AUWA 2XKFA 4GSBA 4JI9A 3ETAA 3GU8A 4FKJA 5AAFA 4LRKA 2UZWE 1U5RA 4L52A 1H1SA 2EXMA 4O0VA 5GINE 2Y4IC 4I22A 1WBNA 1RJBA 1ZOEA 4RJ7A 3UMXA 4RX5A 4YC8A 2DQ7X 2O2UA 1JWHA 3TKUA 3WF6A 4BJJB 4FK3A 2R9SA 3MFSA 4LM5A 4E4NA 3RJCA 2OIDA 1BMKA 4R7BA 3ATTA 2CLQA 3P9JA 4B6LA 3VBYA 2QOHA 2XJ0A 5L3AA 3FMKA 4YGAA 3EFLA 3PIXA 1H4LA 2WPAA 4CZUA 2RSVA 4FG8A 3U6IA 4KIOA 3WF5A 3UNJA 1WBSA 3PFQA 5E8YA 4WHZA 3TV6A 3AXWA 2X8EA 4U44A 2XCKA 3QRUA 2RFDA 3R1YA 1R39A 1OL6A 4HVSA 4S2ZA 4UN0C 3SVVA 5IKWA 4TYJA 3FQEA 4DCEA 5HCZA 3R7VA 4Y85A 3UIMA 5HBHA 4EJ7A 4G3DA 4MHAA 3VN9A 4FOBA 3TUBA 1OB3A 4RA5A 4YTIA 4QQTA 1QPEA 3LFFA 1V0PA 2C5NA 2F4JA 3DK6A 4NEUA 4BWKA 3TM0A 1Q99A 3F3TA 3OCGA 4DTAA 1XH4A 4PWNA 3AT4A 4PL3A 4MCVA 1ZYJA 2UVZA 3FJQE 3HV5A 4IVAA 5AR8A 4GFOA 5K4JA 2I7QA 3DKGA 3RI1A 4HYSA 2UVYA 4FV3A 2X7FA 5DOSA 2WD1A 5LXMA 2CKOA 4HVDA 4RC4A 3LFSA 1ERKA 4FT0A 2B1PA 3HDNA 4WIHA 5JFXA 3KEXA 2VWVA 1CKIA 5CU4A 3ZO2A 4EK4A 4YTFA 2X7GA 4YO4A 3K3IA 5J8IA 3VULA 2QR8A 3R1NA 4N70A 4QMVA 2J0LA 3S1HA 3V5PA 1OL7A 2J90A 5CXHA 3R7OA 3CQEA 5FBOA 3UTOA 3LCKA 3LM0A 3PXYA 4ALUA 4O84A 1YQJA 2R2PA 4JQ7A 4JVGA 3UMWA 1GZNA 2B9HA 2EXCX 2W5AA 3GP0A 5EI6A 3BU6A 4ZY6A 3VUHA 2YM7A 4NJ3A 3IO7A 3LJ1A 3QTQA 4MQ1A 3ZUTA 2P33A 4O7VA 4DEIA 4U97A 4RIYB 4RVLA 2VZ6A 1VJYA 5J87A 2OH4A 2XNGA 2WOTA 1YXUA 4FTNA 5FD2A 3EQIA 3TZ8A 1GNGA 3HRCA 5DR2A 4E5BA 1WAKA 5IPJA 3R8ZA 4DFNA 3FHRA 4KABA 3NNUA 4RLKA 3QUEA 4FTCA 1X8BA 4YJRA 3QXOA 3ZO1A 4PDPA 4O7RA 3FLWA 4TL0A 4QEBA 3FKNA 3Q9YA 4FSQA 4TTHB 4QP1A 3BKBA 3QCXA 3QAME 4EJNA 5C8KA 4PF4A 4G17A 2JLDA 3QA0A 2R7IA 2HENA 3U51A 4JJRA 2A2AA 5HHWA 4BDIA 2A4LA 2X0OA 4MK0A 5D41A 3IOPA 4A9UA 3LVPA 3ORXA 1H28A 3R7GA 3PRFA 2YIYA 2PU8A 5KMJA 3FPMA 4XBRA 5JT2A 2VX3A 3EN6A 3OTUA 4L53A 4LGHA 2P2IA 4IJPA 1YI3A 4BKYA 1NXKA 3QTRA 5C1QB 1R0PA 3FMLA 4FV9A 3I5ZA 5HNIX 3I79A 4P5ZA 5JEBA 3D7TB 3F3VA 3QTXA 3TIYA 3K3JA 3PA5A 4JS8A 4C35A 3ENMA 5GJGA 3R8VA 5I9WA 1YKRA 1H07A 3E8DA 3NLBA 3CD8A 4ZK5A 2GHMA 4L6QA 4FKRA 4IC8A 4XOZA 3VBQA 3F61A 5IQAA 1BUHA 2CKEA 4QTCA 4XOYA 4ZSGA 4FT9A 3KULA 4FEWA 3LLTA 2BZJA 3R2YA 4BTKA 2GNGA 2UW3A 4BZDA 5EFQA 4EWQA 3AC4A 4U3YA 4FVPA 2BTRA 4ZY4A 1A06A 1GJOA 3QGWA 5EKOA 5HE2A 3P23A 4ANQA 4I5CA 4IAKA 3ZO4A 3DCVA 1PY5A 3VUGA 5ANOA 4O7YA 3EB0A 4GV1A 3EN4A 2W1HA 5DEWA 3RAKA 5IG1A 3C7QA 3FEGA 5CAQA 3E7VA 4GU6A 3TKHA 4FL2A 5E8XA 3O23A 3VAPA 1R0EA 2PVLA 1YDSE 4KD1A 1V0OA 1P4OA 3P79A 5K9IA 1M7NA 5HG5A 3ZZWA 4CV8A 4FG9A 4EOMA 1ZARA 3I7CA 4QTEA 4H3QA 1XH8A 4FIJA 2XNOA 4IXPA 3HAMA 2YFXA 5CEOA 4C59A 1J7LA 5HG9A 4U80A 4IWOA 5CT0A 5C03A 3OY3A 3AC5A 4AFEA 2VTSA 1IAJA 3G33A 3M2WA 4J99A 3GCQA 2C68A 3DTCA 5J9ZA 3AKJA 2VX0A 4PDOA 1P5EA 4DFXE 2ITZA 2XS0A 2WFYA 4V01A 3W10A 3WE4A 4CFNA 5M08A 3QQFA 2VRXA 3FYKX 3MGYA 4C8BA 3TZ9A 4J98A 1YOMA 4OR5A 1OIUA 3NUSA 3ORZA 2ZFYA 4IX4A 2X2KA 3U6HA 2WELA 4LGGA 3PXQA 3VS4A 1XMLA 4XH6A 1PRYA 4S32A 4DHZA 4O2PA 3QFVA 2G2FA 2J51A 3MW1A 5IUIA 5F20A 4GG5A 2HW6A 4AZVA 3HEGA 2P0CA 3DK3A 4J7BA 4EHVA 4O7SA 3PLAE 4FI1A 2JBPA 2WTVA 2JBOA 2YN8A 3HECA 1YDRE 3ORNA 4BCNA 3I81A 3PSDA 3TZMA 5CQWA 2NO3A 3UNZA 4BBMA 3NIZA 4EORA 1OBDA 3UYTA 5I9ZA 3U9NA 4KIQA 5ANKA 1OUYA 3DKCA 2OJGA 5FM2A 3DDQA 3OMVA 4D2VA 4JNWA 5M4FA 4AG8A 4BY9E 5ANJA 1XR1A 3DBQA 4XLVA 3O7LD 4BBEA 4IVCA 3JXWA 3Q4TA 1H1RA 4FJVA 4QMLA 3VONA 4PP7A 2X9FA 4R3PA 4ANSA 4KNBA 3G6HA 4I4EA 3PJ2A 4OTFA 4AT5A 4EC9A 2W1EA 3AD6A 2PWLA 1PXPA 2OF2A 3BGZA 3MYGA 4K6ZA 4QMZA 3VUIA 4BRXA 4JDKA 3D2IA 3UVRA 4DINA 5CSVA 2JITA 5KX8A 3MPAA 4YNEA 5J79A 5AP5A 4YMJA 4BI2A 3MIAA 3VUDA 2W96B 3LCDA 2R3LA 2QO2A 5H8GA 4MH7A 4DAWA 1Q8YA 4YBKA 3DLZA 3Q2JA 3VRZA 4BDGA 1YWRA 2PVNA 2RFSA 2X2MA 3RK7A 2BVAA 5KMOA 2Q83A 4Z16A 4KBAA 3FMEA 3ROYA 1CSNA 4FSYA 4AN9A 3TCPA 2AUHA 3UGCA 4A9RA 3CY3A 4C4GA 5CSXA 3RAHA 4I0SA 4RJ5A 3OXZA 3QTZA 2FYSA 4FOCA 3LJ0A 2WKMA 5IEYA 3DV3A 2PUNA 1O6YA 3KCKA 4FTQA 4R8QA 5AUVA 1QPCA 4F0FA 4CLIA 4XG4A 3SG9A 4M7IA 3GC8A 2I0YA 4OBQA 1LUFA 1OPLA 2OIBA 3TNHA 3SXFA 4CG9A 4Y8DA 5C8MA 5DI1A 5AX3A 4DH1A 4F7LA 2OO8X 3LFBA 4O96A 4B99A 2B53A 3T8OA 3QLFA 1JKLA 3UVQA 3W0MA 1M52A 4JDJA 4U6RA 3JUHA 2BTSA 3HRBA 2ZV7A 4KIPA 1GIHA 3POZA 5CSHA 4I0TA 2JKOA 2Y6MA 5DPVA 2WMXA 5AA9A 3EQGA 2AEGA 2JDOA 3T3UA 4ANNA 5CU0A 2V55A 4O4FA 3TN8A 1YW2A 5ETAA 2R0IA 3W33A 2XKDA 1JOWB 4ZTQA 4C62A 4D9TA 4DTKA 4XUFA 1LP4A 4UALA 3P7AA 1XH6A 4K2RA 3FY2A 4PP9A 4ENXA 5AR5A 4W9XA 1OL2A 2VX1A 4BIEA 3NEWA 3KF7A 2ZDUA 4ID7A 5JQ8A 5HO7A 4TWPA 4RVTA 3G9NA 4XEYA 2ITPA 3A60A 3E87A 3WARA 2XRUA 3DPKA 3LQ8A 3L8VA 4FSUA 4YTHA 1HCKA 3FL5A 1FBNA 3ZLXA 4H3BA 3OVVA 4A9TA 4F63A 3B2TA 3UIBA 4DGOA 1JLUE 4JX7A 3VUKA 4EK8A 4M12A 1IG1A 2AQXA 4I20A 5CSWA 2BRNA 3EOCA 4FGRA 3ENHA 3HDMA 2I6LA 3O50A 3PE1A 3UE4A 5I5ZA 4JX3A 4MXZA 3NRMA 2XYNA 4MNFA 4G3FA 4J8NA 3OCSA 3DBFA 4FSWA 3DS6A 3QA8A 2QU5A 4FKIA 4IAAA 4I92A 4YZMA 4PTEA 4BCFA 3CQWA 4B9DA 5FDXA 1ST0A 2J7TA 3VQHA 4LV7A 3QQLA 4IZ5A 4AGDA 3NNXA 4I94A 2ITNA 5BQ0A 4C38A 2OZOA 4FSZA 3R01A 4DG0E 2R0UA 4J96A 1GZ8A 2XCHA 2R7BA 5EHYA 4L8MA 3UVPA 2VWUA 3QBNA 3R7YA 4CT2A 4UMUA 2Y8OA 1PXIA 1Y6AA 2CHLA 4JRVA 3LW0A 4BGQA 3TNQB 2VTAA 1B38A 4UY9A 2REIA 5GJFA 4FK6A 2VTQA 3QZHA 4K1BA 4FUXA 3WE8A 2IF8A 3F66A 1ZYSA 2H9VA 3VF9A 5FEQA 4P4CA 4HGSA 3UZTA 4D2WA 3HYHA 2CNUA 3ODYX 3F69A 3TDVA 2FVDA 3DB6A 3PJ3A 2IVUA 4DH5A 4EHGA 2IPXA 4MX9A 3SW4A 2UZVA 4FTUA 2I0VA 1QPJA 5AP4A 2FGIA 3IW7A 3R02A 4ANLA 4EYJA 4OT6A 3C0HA 4FKQA 2W4OA 4EOQA 5FDPA 2CKPA 5TT7A 4GIIA 2BKKA 2UW0A 3KK8A 4X3FC 2SRCA 3Q5IA 1YI4A 4MUQA 4YUQA 2QONA 1ZLTA 4F1MA 4YPSA 3P4KA 5FTOA 2EVAA 3AD4A 3PG3A 5E1SA 3DAJA 3QD2B 4JBQA 2BFYA 4BCPA 4IVBA 4BYJA 4EKLA 4BGGA 3W0QA 1DS5A 3ULZA 4QYHA 5AWMA 4LL0A 1ZWSA 2CNQA 3R8UA 2QOCA 4TPTA 3PVGA 3CQUA 5ANGA 4F65A 3HNGA 3FLYA 3Q3BA 3SRVB 2R3MA 2C47A 3OEFX 5KNJA 2QG5A 1QCFA 4D5KA 3F88A 4DYMA 4XS2A 4XP0A 2EUFB 2R3HA 2DS1A 4PMPA 4I41A 4FTIA 4RBLA 3GEQA 3V3VA 4WNPA 5M07A 3RP9A 3U54A 1OKVA 3UDZA 2IN6A 2WMAA 3QZGA 4D2RA 3IW8A 3C13A 3C51A 3ZSIA 1MP8A 1OL5A 4GS6A 2GNLA 3DGKA 4A4XA 2OJ9A 4WD5A 2JAVA 5C26A 4CVAA 4QPMA 1M2QA 4JG6A 4EH9A 3GT8A 3P08A 2OXDA 4JLCA 4ASDA 3N4TA 3HVCA 5E8ZA 4C4IA 3TJDA 3FPQA 5CEKA 2UZLA 3PVUA 2O65A 3CJGA 2YITA 4L67A 4GEOA 3DTWA 5ACBC 4PMSA 2GMXA 2C1BA 4BI1A 2CGXA 1UU8A 3ID6C 4C58A 2VO3A 3F5XA 3D5VA 2IWIA 2PSQA 1W7HA 2RKUA 3RMFA 3VRYA 4KS7A 4AT4A 5IDNA 5L6PA 3I6UA 2NRYA 2ZOQA 2X0PA 4PNIA 4WNOA 2VN9A 3ZCLA 4AAAA 1O6LA 4NM3A 4CGAA 1YWNA 3OZ6A 2PE2A 4PDSA 2IW8A 3RK5A 3TZ7A 3EMGA 4HZRA 5EI2A 3VWAA 4GH2A 4Y72A 4JBPA 2C5YA 2ITUA 4BKZA 3NUNA 4F08A 5KMIA 2FSOX 5EK7A 3PPZA 4WO5A 3WIGA 3OBJA 5DRDA 4K77A 4ZJVA 4QP4A 1BL7A 4F0GA 5M57A 1KE6A 1W82A 1WBWA 4QP6A 2V7OA 4D5HA 3VHKA 2WO6A 3O17A 4KUJA 4GK3A 1QL6A 2IVTA 1JSTA 2QKRA 1JBPE 4K8AA 2XB7A 2ZJWA 3EKNA 3Q9XA 1YVJA 2WQBA 3MSSA 2OXYA 4CYJA 3ALNA 3QQHA 3R04A 2OBJA 1DM2A 3O71A 3GVUA 3KXXA 4C4FA 3Q4ZA 1BX6A 3TKIA 3LM5A 4IACA 4NT4A 4UXQA 2PUIA 2CSNA 4Q5HA 5H8BA 1FPUA 3NYNA 2YAKA 4GT3A 1IASA 1IRKA 3V5LA 5J9LA 4IWDA 5AX9A 2HY0A 3HMIA 4HPUE 4CEGA 1JKKA 3WZUA 4YLKA 2QO9A 3FI2A 4XG6A 5FG8A 5D10A 4HCUA 5L8KA 4JT3A 4QMUA 3NFFB 1W84A 2HCKA 3MTFA 5EH0A 3CLYA 3MN3A 3BHTA 2GQRA 2QOIA 1YI6A 4XP3A 4C4EA 1U59A 4NK9A 3ZDUA 3G0EA 3OBGA 3WOWA 5J1WA 2VUWA 3C4XA 2PVKA 4X21A 5AV4A 5LCJA 4G1WA 3C4ZA 2VO6A 3JPVA 5CF6A 4EOPA 2E9UA 3G15A 4Z55A 1SNUA 4H36A 2YCRA 3EN7A 4K9YA 5CNNA 4X2NA 5J95A 3EL8A 3PLSA 5D1JA 1KOAA 4S30A 3R7IA 3FZPA 4CMTA 3ORPA 4UWBA 4NM0A 4LYNA 1H24A 3GOPA 4OTRA 4AA5A 3QWJA 4MD9E 5DNRA 4EOIA 4EOLA 2W1ZA 5CALA 2P4IA 4R78A 2YM6A 3A4PA 3ZOSA 3PJ8A 2RG5A 5BMMA 4I24A 4YPDA 4M13A 2BRHA 4B8LA 5EKNA 5CASA 5CU2A 3BHHA 3NPCA 4OGRA 3Q52A 4W9WA 3P5JC 5DHJA 3P7BA 2W06A 3R9HA 5AMNA 2HZ0A 3TEIA 4YJVA 2VWIA 1PMNA 3KMMA 4MVFA 4ZTHA 4FV1A 5BPYA 1H26A 3QWKA 4QNAA 5C9CA 2VTPA 3ZHPC 4DEHA 4XV9A 1KE8A 4A07A 5HTCA 1ZYCA 2A27A 4ZZOA 3FZRA 4IWPA 4YHFA 2EXEA 3KXGA 3QRIA 3CTHA 3VS1A 3W16A 3OTVA 2YJRA 3VUTA 3QD0A 3ZRLA 4CFMA 2WMRA 5H9BA 4W8DA 3ANQA 2C5VA 1AQ1A 4AU8A 4CCUA 3TMOA 4UMPA 4JOAA 5IISA 2PL0A 1H01A 1PXJA 3AMBA 1TZDA 2PZIA 4OTGA 4F9WA 5C4LA 2J0JA 1WVYA 3ML1A 3BLRA 5AV0A 5HI2A 3TUCA 1YXSA 3ZM9A 2QODA 4U7ZA 2ZDTA 4AW1A 4CMUA 4O0YA 4YURA 2XVDA 1G8SA 3IW6A 5KMMA 5AM7A 2H34A 2BROA 3IONA 4MF1A 5CNOA 1SYKA 4Y5QA 5AJQA 3KB7A 4C4HA 4CYIA 2ITVA 2QQ7A 4XRLA 3BLHA 2F49A 3MVJA 4HZSA 5F95A 3IPHA 3RCDA 3RINA 5CEMA 5FXRA 1J7UA 1NY3A 3FZSA 4FTRA 3G5DA 4KKEA 3LZBA 2P2HA 3F3UA 3MPMA 3NX8A 4DG2E 2F7EE 3HKOA 1T46A 3HX4A 2VGOA 1OMWA 5AP6A 4O0TA 2J9MA 4F9AA 4BDFA 3W2OA 5AUYA 2ERZE 4AOJA 5B7VA 1CKJA 1NVRA 4FT3A 4NIFA 5CEPA 4AW0A 4GYGA 4BCMA 1W98A 3RPVA 4LUEA 5L2WA 3Q04A 2E9NA 5K0KA 1XQZA 2W9FB 3P86A 4PPCA 3VS5A 3MPTA 4GCJA 4PUZA 2P3GX 3A2CA 5CU6A 2CCIA 4ALWA 3QZIA 5KKRB 4NSTA 2CDZA 3A8WA 4V05A 4JDHA 4UYNA 4DHIB 3LQ5A 4BIDA 4QTBA 3DZQA 4A9YA 4ZMFA 4ANOA 2VTHA 1I44A 2EU9A 4RX9A 3KKVA 3VBXA 3VS0A 4GJ2A 1R1WA 4P90A 4FGBA 3COMA 5A6NA 4EZ5A 4AXEA 2HELA 2IO6A 4YHTA 3E5AA 4I0RA 4IAFA 5LWMA 3W8QA 4BWPA 1NVQA 4KKHA 4JQ8A 3DJ5A 4ZOGA 4USEA 4JR7A 4ZP5A 1M14A 4RWLA 3E63A 3ORKA 3OUNB 4OTHA 4CTCA 4LOOA 3SA0A 4OAUC 2RL5A 5HOAA 3D94A 5J7BA 3CD3A 4AFJA 1W83A 2UUEA 1PKDA 4RG0A 2IW9A 3GC0A 4O27B 5DH3A 3TNPC 4A06A 5KBQA 4NTTA 3PTGA 2XEZA 3A4OX 2E9OA 5EDRA 4L01A 5TOZA 1RQQA 2R3OA 2H8HA 4PV0A 1OITA 4V0GA 1Q8TA 1SVHA 3I7BA 1NT2A 4FTTA 2W99B 4IHPA 4F9BA 3V5WA 3HUCA 4DG3E 4J8MA 3MH2A 4GVJA 4YC3A 1JVPP 4NCTC 3N9XA 4OTQA 2XUUA 4XYFA 2HOGA 2WB8A 3ZMMA 3L9PA 4QDEA 4IZ7A 5IZFA 2XKEA 3E93A 4L3JA 5AP1A 3DJ6A 1GZOA 2WTDA 3BHVA 3QX4A 4L43A 3UP7A 1J1CA 2B9IA 3RGFA 4NIFB 4FT7A 2XM9A 1UV5A 4AW5A 2JDRA 4B4LA 3OXIA 4GUBA 4ZZMA 3KC3A 5KMLA 4EK6A 4F6UA 3JR1A 1YHVA 3ZFYA 4YU2A 4ITIA 2HZNA 2PMIA 3OD6X 4I4FA 2JKQA 5C01A 3KRRA 1NA7A 4O7LA 4D0WA 1CKPA 4FE2A 4HGEA 5EG3A 4O4DA 4PNKA 5LMKC 5HLNA 5HNGA 2OI4X 4DTBA 2J6MA 2EB2A 3HV6A 3R63A 3FXWA 5JFSA 2W1DA 2ONLA 3ORTA 5M53A 2PPQA 2C69A 5DVRA 5I0BA 3MY5A 2B9JA 3TNWA 1M2PA 3C4EA <