4O0XA

Back pocket flexibility provides group-ii pak selectivity for type 1 kinase inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
291
structure length
290
Chain Sequence
GSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Back Pocket Flexibility Provides Group II p21-Activated Kinase (PAK) Selectivity for Type I 1/2 Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 94
structure length 290
sequence length 291
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o0xA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o0xA01
4CRLA 2JDTA 5M07A 3M11A 3Q5ZA 4Q5HA 2QOIA 2GCDA 4R1VA 4FG8A 5EDRA 4DGLC 4BF2A 5KE0A 3R9NA 3FY2A 4ZTMA 5E92A 2FA2A 5AUYA 2JKKA 2OXDA 2R0IA 5EYDA 3AMBA 2R3GA 5T6KA 5TF9A 4GMYA 3RTPA 4X6RA 2VWIA 5L2IA 4JR3A 3SXSA 1SNXA 5IZFA 4YPSA 4AZFA 5KUPA 3NW5A 4YTFA 4WSQA 1QL6A 3NAXA 4X7QA 4RGJA 5FG8A 1FVRA 3BEGA 1M7QA 2E9UA 4RJ5A 3G51A 4DGMA 3AD6A 4AX8A 4ZSJA 4BDIA 2RKUA 3NSZA 4U41A 4F7JA 4JDHA 4O81A 3F82A 4EZ5A 4Q9ZA 2XIXA 5IQIA 3EQGA 3WZUA 2GS2A 4L3PA 4FK6A 2OJJA 3I7BA 4FV9A 4TYJA 3BHTA 4WT6A 4HYUA 4BY9E 3LW0A 5IUIA 2HXLA 2GNIA 5HBEA 3R8LA 1FBNA 3ET7A 3KKVA 3D2IA 3BRBA 4OUCA 3CPCA 2GMXA 3PY0A 3HV4A 5BUEA 4IWDA 4KRDA 4KIQA 2X81A 3UPXA 2B4SB 3PXQA 3KU2A 1WAKA 1W0XC 4FKUA 4RIYB 4J98A 4WNPA 5ETFA 3IGOA 4D9TA 3MDYA 3OS3A 1RE8A 3PIZA 2R3MA 4TY1A 3QXPA 4FT0A 3Q4ZA 4YJRA 3QQUA 4U42A 4E8AA 3IDPA 5AV3A 4PF4A 4E6QA 5KMLA 1KUTA 3EQPA 4QMSA 3ACJA 2YEXA 4N0SA 1JQHA 4WG4A 2BAQA 4R7HA 3RPRA 3U8WA 4QQTA 5L2SA 2YIYA 3Q60A 2WU7A 3TI1A 4FMQA 2PSQA 4RJ4A 2GNHA 2V7AA 3PXYA 2ZV7A 2JIIA 1GAGA 1OMWA 1ZOGA 3GBZA 3OW3A 4IX6A 3TIZA 1LUFA 5BPYA 4RWLA 4FR4A 3C5UA 4IWQA 4F1OA 2W96B 3PVUA 4ERKA 2PYWA 3R7GA 5BVKA 5AAGA 4EK3A 2WMSA 5C8KA 3KEXA 4RIXB 5AIRA 1E1XA 4NIFA 3AXWA 2XJ1A 4OGRA 4IMYA 5H8BA 3UODA 2UW5A 5L2TA 1VJYA 1XH9A 4JVGA 3EQDA 3VBXA 2PUIA 4DG0E 3MVJA 1PMNA 4IB1A 2C5NA 4ACGA 3KXZA 5LJJA 4DH3A 2VO0A 4ZLOA 2UZVA 1P5EA 4O86A 4LUEA 4CLIA 5LARA 4L9IA 3LJ0A 4Y5HA 5EM8A 2CCHA 3NVKI 1MUOA 3QRKA 2QOFA 3THBA 1E9HA 3DLZA 1XH8A 3ZO4A 2NPQA 3GCUA 4FX3A 5HQ0A 3V01A 4JDIA 4CG9A 3WOWA 3F9NA 4APCA 2XJ0A 1IEPA 3GU6A 1R3CA 1NVSA 5KMNA 3LM0A 3VUHA 5JZJA 1OIUA 3VBQA 2FSMX 1OKVA 4DFNA 1SNUA 5JMSA 3HRBA 4YZBA 3AD4A 2VNYA 2OH0E 3Q3BA 3TV7A 3FDNA 4UALA 2X8EA 3HMPA 3MA3A 2XCHA 2Y4IC 4D2TA 3MVLA 5DFPA 5A4QA 1A06A 2PVRA 4QQJA 1YDTE 3ZXZA 1GJOA 4Z3VA 4QTEA 2XKCA 3R21A 3NUAA 5E4HA 3LPBA 3SGCA 5HLPA 4U6RA 2BPMA 2DQ7X 4A4LA 3QRTA 3F3VA 4C38A 4XV2A 1ZY5A 3D83A 4C2WA 4EOOA 2ETRA 5BVNA 4X3FB 1H00A 4FEXA 4JG6A 4TYIA 4PL4A 5EYMA 4CFMA 2CLQA 3R6XA 4EBWA 3WZDA 1CKPA 3QQHA 3NUXA 4I21A 2BTSA 2VTPA 3QGYA 5BMMA 3DK3A 3W2RA 2WKMA 5BVEA 5CZHA 4O84A 3VQUA 3CP9A 2C0TA 3R8ZA 3OUNB 2JIUA 2QI8A 4PMMA 4EORA 4I24A 4MXYA 3HV5A 4QPMA 4BBFA 3GXLA 3E8NA 3QTZA 5IKWA 4FYNA 3WE4A 3MIAA 2X2LA 5AV4A 4IVBA 3FJQE 3KB7A 5KHXA 3DFAA 3FV8A 2RGPA 3QC9A 2EXCX 5DR9A 3UO4A 4ALUA 3EL7A 4BDBA 2WOTA 3HA8A 2ZM3A 2WTDA 3PIYA 5DWRA 3BE2A 3UQFA 5CNNA 4XCUA 3BQRA 3ROCA 3W2PA 1KV1A 3KCFA 1ZAOA 3D5VA 2GNGA 5HE1A 2OICA 3AGLA 2B9IA 2HWOA 1PXNA 1PXIA 2X7OA 3NLBA 4LL5A 4NEUA 3NW6A 4IDVA 3SQQA 4CGAA 1NA7A 3Q4CA 3HMMA 3R02A 2CKEA 4GL9A 1H1SA 3VS7A 1UU7A 2Q83A 4AUAA 2W9ZB 2X4ZA 3EH9A 4JX3A 4ASXA 3T9TA 3DAEA 3RZBA 3BZ3A 5JGBA 4NTSA 1YWRA 4ANOA 4D5HA 4LRMA 4BC6A 4ERWA 3V51A 2JKQA 2R3QA 2VTTA 3P5KA 2IVUA 2GS7A 3FL5A 2ERKA 4GS6A 2BALA 5F20A 4FC0A 3WBLA 1ZYSA 3QUEA 3A60A 3VVHA 3EN7A 3HL7A 4MQ1A 2VGPA 3FMJA 4M3QA 5CXZA 4ANQA 2CN5A 5K0XA 3JR1A 2YIXA 2E9VA 5AP2A 5EI6A 2PVLA 3VWAA 5BMSA 1YDSE 2REIA 2WQOA 1JKKA 1OVEA 1SVHA 2FO0A 2VX0A 3HRCA 4BYJA 1STCE 3UPZA 4DEAA 2YJRA 3IS5A 4HZSA 3QF9A 2HAKA 3TJDA 3ERKA 2XBJA 4MXZA 3PP1A 2WGJA 3QRIA 5AP1A 4ZTQA 3RM7A 2ZAZA 3LVPA 2OF2A 2Y4IB 4YJSA 3PZEA 3QUDA 2ONLA 3QTSA 5CEQA 3TUDA 3VS5A 3L9NA 1IAHA 3JPVA 2P4IA 1FQ1B 4EWHA 5IUHA 4XLVA 3TCPA 4U3ZA 4EONA 5CVFA 3QTWA 4CRSA 4O7RA 3FHIA 3FMEA 3GCQA 4X2FA 2WMQA 4BI0A 1WBNA 1JSVA 4U44A 5DE2A 1IRKA 1WBOA 5A4CA 3CTQA 4QO9A 3R7VA 1CKIA 2R9SA 2V62A 3FI2A 3OOMA 3ZC6A 4B7TA 3M2WA 4OT6A 3O23A 4U40A 3EMGA 3MA6A 3NZ0A 3OXIA 3TNHA 4F7LA 5IEXA 3N4UA 2C5OA 4L44A 3FZRA 2HZ4A 1KSWA 2W5HA 2EXMA 4CLJA 5J9LA 3DJ5A 3GOKA 3MJ1A 4N4SA 4CCBA 4E6AA 5A46A 5HD4A 3SVVA 4O38A 1YHVA 2C0OA 1DS5A 3BGZA 1O9UA 3HV3A 2JBOA 4C3PA 4LUDA 4NFNA 5GZ8A 4IBMA 3TL8A 4BCMA 3W18A 3D2KA 2QR7A 2WQBA 4V05A 1ZYCA 4M14A 4QMVA 5A9UA 1R78A 2IJMA 3PUPA 4PX6A 4R5SA 3LMGA 3MB7A 3KMMA 4FKPA 4QMPA 3W2SA 4FV0A 5DT4A 3II5A 5G6VA 5E1EA 4UMUA 3DBEA 4EZ3A 4EEVA 4FVRA 4DT9A 5AP7A 2YZAA 4O0XA 3QYWA 5HVJA 3LFDA 2JDSA 3MH1A 3WILA 3NVMB 5LVMA 5A4LA 3NUPA 1YRPA 3KK8A 4R6VA 1XH5A 4GV1A 4WKQA 3BYUA 4FKTA 1U54B 4BCOA 1CTPE 2A0CX 2I0HA 3A8WA 4RZVA 5I0BA 3GGFA 5M55A 1UA2A 3UMWA 4ENYA 3D7TB 2G2IA 3PXKA 2WNTA 4ZS0A 2Z7LA 4HVSA 4F6UA 3ALOA 2JFLA 5K0KA 4UV0A 5CEOA 3R7UA 2BCJA 5G1XA 4BHZA 2GNJA 3RAWA 2R0UA 4W9WA 3W2QA 1YHSA 2HY81 3OUKA 2W1IA 2WPAA 3GT8A 4L01A 3F6XA 2YA9A 2C0IA 5ACBC 2HY0A 3KRLA 5M4UA 2Z8CA 2J90A 5HIBA 1OL7A 3DKFA 4QYGA 2HZNA 4KD1A 5JFSA 1Y6AA 4UB7A 4D4VA 2UZOA 4U8ZA 5IQHA 1GOLA 3MIYA 4J8MA 5AV2A 4RVKA 2ONLC 4RZWA 5HVYA 2JAMA 5E8SA 2BZIB 3ZBFA 2WMUA 4AZSA 3R2BA 1HOWA 3IPHA 4C02A 2X8DA 3CY2A 3R9DA 3ZRKA 4C4EA 1OBDA 3KULA 4G2FA 2EB3A 5IQDA 5ANIA 4NM7A 3IW4A 4OAVB 2VN9A 1TQMA 1YOLA 4TYEA 4ENXA 4TZRA 3WF5A 4ACDA 4BTMA 4YLJA 1PKDA 1PF8A 3T9IA 2UW8A 4AW0A 3GU5A 4FV2A 3CLYA 4RC2A 2OIBA 3C4CA 3PY1A 3EQHA 3KGAA 1H4LA 3MSSA 5C27A 4EQUA 2R3OA 3QZHA 4OBQA 4FTLA 1XWSA 2ZV8A 3OCTA 2OFUA 3IK3A 3AG9A 3QGWA 4IFGA 4IEBA 4F7NA 5IQEA 3SDJA 3K3IA 3BHYA 4XG4A 3UIXA 4O7VA 4QNYA 3FZTA 5GINE 4LQMA 2W0JA 3HECA 2QU6A 1W82A 4QMZA 4C37A 3GFWA 3R22A 3TM0A 2OLCA 5D1JA 4MYGA 2WTKB 3GU7A 4YTCA 4FZ6A 1VR2A 5AP4A 3C7QA 3LLTA 2J9MA 3LCDA 4AWIA 1FMOE 2KTYA 4W4WA 1REKA 2Z7SA 3AD5A 4DFXE 2QG7A 4KUJA 3DY7A 4IB5A 4DG3E 5IA2A 3DZQA 4QTDA 3K5UA 3GC9A 2VWWA 4NIFB 4NKSA 2GFCA 3OXZA 4FIFA 2CHLA 3MGYA 5AX9A 3GB2A 3TKIA 1JNKA 2YACA 5ETCA 4CMUA 2FSOX 4WNMA 4EL9A 2J5EA 4I0TA 4Y8DA 4DHFA 2LGCA 4GIHA 2XRWA 3BEAA 4JL9A 4RQKA 4S30A 3R7OA 4K77A 5KMIA 3K2LA 2QC6A 5E8VA 2XJ2A 1LEWA 4ZTHA 1RJBA 5JQ5A 2XMYA 2J6MA 3A2CA 5CU6A 3P79A 4Q5EA 3RVGA 4K2RA 3TG1A 4KRCA 3QTRA 4I4EA 4XUFA 4D2SA 2BR1A 4G3FA 4RX8A 4Z55A 2HELA 2C6OA 1PXKA 2CKQA 3FPMA 4OT5A 4U45A 3CTHA 1PMVA 3BYVA 3WYXA 4BWPA 3BI6A 1CKJA 2XNNA 4XS2A 4ANSA 4D2WA 4EH3A 3PJ2A 3FI4A 3RKBA 4HZRA 1F3MC 5FUTA 4IAAA 3DK7A 4FK3A 4IVDA 3HDNA 5EDQA 4FUYA 4DH5A 2QKWB 3SA0A 2VTHA 2F2CB 3BHHA 5FLFA 3GU8A 3BHVA 3PSDA 4GUBA 4F0FA 3SG9A 4RSSA 4TN6A 2OJ9A 2C1AA 4O82A 3SAYA 4Y95A 3G15A 4MWIA 4OLIA 4HPTE 3DXQA 4GH2A 4EOIA 5ETIA 3MY1A 3DK6A 1OL6A 1K2PA 1YWVA 3IGGA 1CM8A 3MPAA 3PLSA 1PXPA 3QC4A 4CTBA 4BR3A 1Q5KA 2YM5A 4TRLA 5HU9A 4AT5A 5H8EA 4ZJVA 3VHKA 2BZHB 4NJDA 1CDKA 1MRYA 3BX5A 3LCKA 4V04A 4O83A 4IW0A 2J2IB 3OW4A 1L8TA 4DEEA 1Y91A 2B7AA 5DNRA 3DXNA 4JR7A 1KV2A 3FWQA 4G16A 5AJQA 4DFYA 5FD2A 3TIYA 3TJCA 3A99A 2R3PA 1WBSA 3KN6A 3RM6A 5ICPA 3MH2A 2OF4A 5DH3A 2Y7JA 2W1HA 3R9HA 4V0GB 1M2PA 3IQ7A 4BCKA 4MNEB 1ZOEA 4N70A 4GVJA 2J0LA 2VRXA 3LCTA 5DGZA 5ANKA 3UQGA 4MQ2A 4DGNA 3DJ7A 2YAAA 3COHA 3OCBA 5FGKA 4LMNA 4U43A 1VYWA 5K5XA 3NCZA 4FSUA 4F6WA 2JC6A 3PA4A 2PVJA 4RVLA 4X6QC 5J87A 3ULIA 3DTWA 5CLPA 4PY1A 3KRRA 5BYYA 5HTBA 4O7YA 4AE9A 4NM5A 3RGFA 3RHXA 5GZ9A 2ZYBA 4I20A 3DB6A 1FOTA 2CGVA 3UYSA 5KKRB 4JIKA 2IWIA 4A06A 4MX9A 2YM4A 5AP0A 4I0RA 3TV6A 3DBCA 4RJ7A 3QKKA 4EOJA 3OC1A 3D7TA 3NUNA 4ZJJA 2OJGA 1H07A 4QPSA 3RAKA 3FI8A 3FXXA 3FLNC 5LCKA 4YTHA 2UW6A 4FIHA 3OEZA 3LFSA 2ZDTA 3QQGA 3VO3A 2WD1A 4FI1A 5DA3A 1GNGA 3LQ5A 1O6KA 4WBBB 4XG3A 4IANA 4NFMA 2X2KA 4D58A 2B9FA 4KWPA 4Z16A 4FV7A 2Q0BA 4FT3A 3DKCA 4KB8A 5B2MA 4RWKA 1GIHA 4WRGA 1XKKA 5ANGA 4XNEA 5GZAA 5HNIX 4C4HA 4RBLA 2W1DA 4FSRA 1I09A 2DYLA 4RWIA 3W32A 3VUDA 5HVKA 3QD2B 1J7IA 3FYJX 3LFQA 3P7CA 4XOZA 2QODA 1OKYA 4ITHA 2PK9A 3IW6A 4KKGA 4YHTA 2BRGA 3DQXA 3R63A 5L6OA 3DFCB 1NW1A 4E4NA 4OBOA 1MRUA 3RINA 4AGUA 4RRVA 3UZPA 4J52A 3M42A 3LQ8A 3QBNA 4ZIMA 3GVUA 5JFXA 4QP4A 2RFDA 4TL0A 4IHPA 3CEKA 1JKSA 1WBTA 3P7AA 3LXLA 5L2QA 4OTDA 4MD8E 4EHGA 5LOHA 2OSCA 4WRSA 5HCZA 4M66A 4GUEA 2UW7A 3POZA 2GDOA 3E87A 3PA3A 2QO7A 3HUCA 2GPHA 4JBPA 1ZZLA 3A7FA 3D15A 3FMNA 3IKAA 4FKWA 2IW9A 4DH1A 3OXTA 1PXMA 5AMNA 4KAOA 4ZMFA 1BX6A 2BAKA 1APME 2HWPA 2QNJA 4FTIA 4RG0A 5DBXA 3BKBA 3L9PA 1SVGA 3MY5A 4EZ7A 3KXNA 3QAME 1H0VA 1UNGA 3ZHPC 4MHAA 4G3DA 3S95A 3TNQB 1PJKA 4L53A 2UW0A 4FIEA 4QQ5A 4YBKA 4QP7A 4RC4A 4QMOA 4R7BA 3PSCA 2H6DA 3GNIB 3OWJA 3R9OA 4OTGA 5KMJA 4GYIA 4O6EA 3EZVA 5IEVA 3UO6A 3JY9A 4CKRA 5CF4A 3MFRA 5CT7A 4GRBA 1O6YA 2UV2A 4G9RA 4YP8A 1UU9A 2PZPA 3PJ3A 4FTTA 2OZAA 3ZUUA 3VW8A 3P0MA 4F7SA 3OY3A 5HO7A 4HCUA 3FXWA 4A07A 2CGUA 4NH1A 3OTUA 2OZOA 4CSVA 2XNBA 3U4UA 4PUZA 4QMTA 3RNYA 2XH5A 2XIRA 1FVVA 3EJ1A 3I5ZA 1TVOA 3LAUA 2FSLX 2VTOA 2ZOQA 4EBVA 5LCJA 4D2VA 3CY3A 2QCSA 1QPJA 3H3CA 3ORKA 1XJDA 2C5YA 4PMTA 3K54A 3QQLA 3V5LA 4YSJA 3BLQA 5CSHA 2BRBA 2PVHA 4EK4A 5DEYA 4HYIA 5IDPA 3P23A 3GOPA 3VN9A 4BZOA 1BKXA 5AUUA 3VUMA 5T68A 3KRWA 4DFLA 3OBJA 1BUHA 3UMXA 1Q8UA 2I0YA 4BBEA 4BIDA 3ORIA 1W84A 4JG8A 4CFFA 3DKGA 3CPBA 3FI3A 3U9CA 2FGIA 4E6CA 2X4FA 1T45A 1YWNA 4GT5A 2QQ7A 3ORNA 4AA4A 3QKMA 4AZTA 5JSMA 4TYHB 5HORA 2HW7A 3LFFA 5C26A 2J7TA 5BYLA 3SV0A 2E9NA 2OI4X 5GIOE 3FMLA 2C6TA 4DFUA 5E8YA 5CSPA 5JFVA 4KIKA 1J1CA 4I3ZA 3R8PA 2UZWE 3TDVA 3KULB 3Q2MA 4F08A 5HTCA 4LRKA 4BYIA 3LCSA 2NP8A 1J3HA 3SD0A 4I92A 3RP9A 2PMOX 3QWKA 5HX8A 2XIZA 4NWMA 2PUUA 4UBAA 4XEYA 1J7LA 3ZH8A 4ZZMA 2C4GA 3A7JA 4M0YA 3EFWA 3LM5A 4O96A 4FSYA 2H34A 2WHBA 4I93A 2JKOA 3GEQA 3A4OX 4R3PA 4DEGA 3AT3A 3EQCA 1Z5MA 2ZM4A 4HYSA 4I94A 5AP3A 2ERZE 4YJTA 4E5BA 3PWYA 4L7SA 1T46A 5EHYA 4WIHA 3HV7A 4ARKA 1WFCA 4RA4A 4UYNA 4B4LA 1UWJA 2ACXA 1QPDA 1WCCA 1H1QA 1V1KA 5M09A 2F9GA 5FEDA 5LVOA 4YZCA 2RIOA 4BDGA 3DXPA 4FV4A 4HGLA 3CR0A 3OHTA 4USDA 5FWKK 3TZMA 2YIWA 2PY3A 3FQEA 3QALE 1BL7A 5L2WA 1PHKA 4UX9A 4DLIA 4FSNA 3HLLA 4QP1A 4O0TA 3ENHA 3R7IA 4AGWA 5I4NA 3ZFYA 5F95A 5FTOA 3PJ8A 2PVNA 4O0WA 5KX8A 3EQRA 3CE3A 5CZIA 3PY3A 4YJNA 4EJ7A 3KRJA 4RWJA 2JEDA 4PDYA 4FYOA 3T3VA 2IVSA 3NRMA 2E9PA 3WZKA 3D4QA 2VTJA 5ACKA 1U46A 2AUHA 3TTJA 4LRJA 2XYNA 4F1MA 3PJ1A 4G34A 5TKDA 4BKJA 3HUBA 4G3GA 5C03A 3GCPA 3BQCA 3HZTA 3TKHA 4CFVA 1H01A 5C8MA 3LKMA 4ASEA 3O8UA 4XRJA 3PSBA 3WF6A 4Y72A 3MW1A 2B0QA 3R0TA 4RJ6A 4IAKA 1XHAA 4CEGA 5L8JA 4XH6A 4O0YA 3ORLA 5EM7A 5J9ZA 1YKRA 4GG5A 2PL0A 2XK6A 5A3XA 3L1SA 4FIIA 3ATSA 4JBQA 4K6ZA 4QMNA 4I5CA 3DAJA 4TWPA 2XK8A 3MS9A 3C0GA 2Z2WA 5HG8A 1UU3A 2ITPA 3GQLA 1W7HA 3OD6X 2OWBA 3VBTA 2B9HA 2X9EA 1HCKA 3PG3A 2GHGA 4XV9A 3V8SA 4AFEA 1OPKA 4WO5A 1JBPE 3CGFA 3PP0A 4OR5A 4F0IA 5KBQA 5M57A 3KF4A 4BCPA 4FV3A 2W17A 3N51A 4HNFA 2GQRA 4D2RA 4HVHA 4FVPA 3ZO3A 4IX5A 2EUFB 4BB4A 4DTAA 4FKLA 5F1ZA 4XP2A 4RIXA 2R3FA 4B9DA 2O65A 2ITZA 1U4DA 4MBLA 4R3RA 1H26A 5HESA 4IE9A 1OKZA 4FTAA 4EOKA 5TT7A 1TKIA 3HP5A 2F7ZE 2UUEA 1PXOA 1J1BA 1W98A 4AT3A 3VF8A 4EK8A 2W4OA 2R64A 2VWYA 3H10A 5BQ0A 3BHUA 4AW2A 3BBTB 2JKMA 4P90A 2YDIA 4WHZA 4Y83A 2YZLA 4NCTA 3VS2A 3QCYA 2XNOA 3I6WA 3U6JA 4NZWB 3EWHA 4MXAA 4DITA 1YW2A 2BIYA 2GNLA 3FLYA 4QP6A 1ZXEA 3QZIA 3I60A 5CXHA 5EYCA 4GT4A 3TTIA 4UMTA 4FKSA 4U80A 4MNEA 4BGGA 5M56A 3HVCA 4HVGA 4L67A 3O8PA 1TQPA 5K5NA 3AC8A 2ESMA 3QKLA 3E62A 4XJ0A 2IVTA 5EK7A 3W8QA 4BDFA 4MD7E 4OTWA 4M8TA 4WNKA 3R30A 1B38A 2R4BA 3QTQA 4I5PA 4PTCA 5CYIA 5EG3A 2W05A 4E1ZA 5FXRA 5CNOA 4UWCA 1ZMUA 4DH8A 3GU4A 3ZLXA 3PDTA 2P2IA 3D9VA 4OTPA 4UWYA 2QHMA 3KMUA 4JBVA 2YCSA 3DKOA 4ALWA 4EH8A 1OIQA 4O2PA 5EW9A 4FL3A 5E8ZA 3ODZX 2V0DA 5GNKA 5IMXA 3MPTA 3ZCLA 2XA4A 1BLXA 3OBGA 3EIDA 4IQ6A 3QCXA 3Q6UA 3QZGA 1VEBA 3RBWA 2BROA 4MH7A 4ORKA 4BBMA 3UOHA 4FT9A 4LGGA 3UIBA 3O2MA 1KOBA 3QD3A 2EVAA 2O3PA 2C5XA 3BU5A 4YTIA 4ASZA 5M53A 3S1HA 4CV9A 3FE3A 4QP9A 4TW9A 3O51A 2OG8A 1KE7A 2P33A 3G9LX 4IIRA 4YNEA 4O91A 3ZSHA 4U3YA 5K4IA 4USEA 3RK7A 1Q62A 2ITNA 2UW3A 3MN3A 1LR4A 2ITXA 3OMVA 4K9YA 5CF6A 4TWOA 1WZYA 4S34A 3G33A 3QD0A 4IAYA 5EW3A 4JDJA 4QMLA 3FYKX 4AN3A 3ULZA 3RWQA 2PZ5A 3LCOA 4EOMA 1ERKA 5KCVA 4S31A 4FA2A 4E20A 2W1FA 4AF3A 5HE0A 5JGDA 3O8TA 4O1OA 3ORZA 3PIXA 3DA6A 3G6GA 4OTHA 4YZNA 3IO7A 3SHEA 3VJOA 4MK0A 4RIWA 4FL1A 2KULA 3P78A 3U51A 1P2AA 2R3HA 2JIVA 3BCEA 1M14A 3PRIA 3QQFA 4XG8A 2UZBA 3OCGA 5FTQA 3W16A 5CU4A 4F65A 4EH2A 3C13A 3EFJA 3NS9A 3R1QA 2ITWA 1ZY4A 5ANOA 4F70A 1DI8A 4O21A 2HW6A 4A7CA 5H9BA 1NXKA 3NIEA 1Z57A 4RJ3A 3ZEWA 4XG6A 3F3TA 4FVQA 3EB0A 2B55A 2YDKA 4FTKA 4G9CA 3UOLA 3VC4A 2FVDA 1YXXA 1CMKE 3ZFMA 1U59A 3ALNA 3P7BA 4FGBA 3F5XA 1YI3A 4IM3A 5CEIA 1QPCA 4PPCA 2C47A 4WUAA 4X2KA 3FY0A 4AS0A 1G8AA 2CKPA 3V04A 4RLLA 2J0IA 3F2NA 3R8UA 4EH7A 2X6EA 1Q3WA 2QONA 3E8DA 4I5MA 5AFVA 4PPBA 3BGPA 5CQUA 4ZSAA 3F2RA 4QMWA 1H24A 4C61A 4KNBA 3GENA 1OECA 2CJMA 3C4XA 5M4CA 1Q41A 2P0CA 3VAPA 3W8LA 1V0BA 3TV4A 5CALA 3V3VA 3COKA 2HOGA 2J0JA 3R28A 5E7RA 1LP4A 4DGGA 3LFBA 3E3PA 1IASA 1WBVA 3H0YA 4R7IA 5CI7A 3W2OA 4ANLA 4OAUC 2BFYA 2O63A 3H30A 4G6LA 3O50A 1GIIA 3SOCA 3FZSA 1GY3A 4KS7A 1Q8TA 2YIRA 4APPA 2XNPA 2XIYA 4X0MA 5CS6A 3ZXTA 4O22A 4M0ZA 3FKOA 3I1AA 3O7LD 4P5ZA 4E4XA 2QOBA 4JQ8A 4FNZA 2W4KA 3ZM4A 4TWCA 3WI6A 4D55A 3PVGA 2ZVAA 4O6LA 1S9JA 3QZFA 2HZ0A 2IW6A 3C4FA 1YOJA 2WO6A 3L9LA 5H8GA 5IA5A 3UVPA 3ITZA 1OZ1A 4BIEA 2IPXA 1MRVA 2VAGA 3Q9XA 4AOJA 1M17A 5CI6A 5BVWA 4NKAA 4J71A 5CY3A 3FZPA 1F5QA 2X39A 5CWZA 3RAHA 5H3QA 3S00A 3UP7A 3ZDUA 3E7VA 3RPVA 4DGOA 3SG8A 4X3JA 3C0HA 3MFSA 1M2QA 3E93A 3S4QA 3HDMA 3V5PA 1OIRA 3NEWA 5BVOA 1H25A 1PY5A 4PNKA 3I5NA 4F6SA 3CD8A 4M68A 4CYJA 3Q6WA 5CASA 3F5UA 1KE5A 4QYYA 2J50A 3LLAA 1FVTA 5A14A 4FKGA 4H39A 4GJ3A 5AIKA 2BZJA 3DBQA 5EM5A 4B6LA 1A9UA 3MH3A 3UIUA 5HZNA 3VUGA 4N6YA 4IX3A 3TZ9A 2WMRA 4BGHA 1U54A 4FSTA 5IA4A 3SKCA 5M44A 3LQ3A 3ZTXA 3ZBXA 1SM2A 3LJ2A 4FSWA 5AM7A 3LFCA 4ZTLA 4CCUA 1OBGA 4B8LA 1UKIA 2I1MA 1ZMWA 2O0UA 2F7XE 3GFEA 3WYYA 5IEYA 4BVUA 3V5TA 4EHVA 3QLGA 1RW8A 3FUPA 1OIYA 5CVGA 1TQIA 5GIPE 3HMOA 4D1XA 5TE0A 3A8XA 5HICA 4CZUA 3UNJA 2BVAA 1OM1A 2G1TA 1ZYLA 5KZIA 3W2CA 4AOIA 4EWQA 4Z7HA 5JQ8A 2LAVA 3SXFA 3MH0A 3CBLA 3QQKA 1H27A 4PL5A 5TOZA 3CJGA 3BV3A 2IZUA 4FTRA 4OTIA 4II5A 4MD9E 4USFA 3HYHA 5KMOA 2ITTA 2QLUA 3AC2A 4QRCA 2RSVA 4F9YA 4CT1A 3HGKA 4GSBA 2R3KA 4O7TA 4A9TA 2C3KA 4QQCA 3OG7A 4KBKA 2YLFA 4ZP5A 4PQNA 5HBHA 2HZIA 3ZLYA 2QO2A 4DC2A 2YM8A 2X9FA 3VUIA 2CLXA 2R3NA 3ANQA 5AR4A 5LWNA 5HI2A 2A2AA 5HEZA 4DEHA 4RIOA 5EKOA 3KXMA 4ZSLA 2WTCA 3UDBA 2GQSA 4KKHA 4O2ZA 2VWUA 5C9CA 1OITA 2R3RA 3MJ2A 1L3RE 3H0ZA 4YMJA 2OW3A 2P55A 2VWVA 3HNGA 3I7CA 5JFWA 3MFUA 5D41A 4GK3A 4UYAA 3BWFA 2WFYA 4YR8A 5HE2A 4J53A 2C1BA 2O2UA 4EC8A 5JT2A 3HAVA 4EJNA 4XYFA 3EN5A 3ZSIA 4FF8A 1Q8YA 2J51A 3CKXA 2ZMCA 2IZRA 3OF0A 4JBOA 3VF9A 5IA3A 3V8WA 3ZONA 4FZ7A 3OWKA 3OEFX 2VX3A 1ZRZA 5LMAA 3A7GA 1EH4A 3EQFA 4AE6A 4DBNA 4RA5A 4H58A 3DGKA 4M12A 3SC1A 1YDRE 4OTFA 2C5VA 4L7FA 2WAJA 4C2VA 3ACKA 2WMBA 4MVFA 5HG5A 1W8CA 2F2UA 2OH4A 4MXCA 1G5SA 2DWBA 2VWBA 4PPAA 4HCVA 4ACHA 4BCJA 5HO8A 5BVDA 1M52A 2ETKA 2I0EA 5TR6A 3V5JA 5KKRC 3W33A 4JT3A 5L8KA 2I40A 2YERA 5KNJA 3CS9A 4PTEA 5HE3A 4XG2A 3V8TA 3D5UA 3F2AA 4DBXA 1FGKA 4FKVA 4Y85A 3U6IA 5HNBA 5L6WL 3Q9YA 5HD7A 3F61A 4FKJA 5J7BA 2XP2A 3LJ1A 4U5JA 2F49A 5ANDA 2ZM1A 3WZJA 3ZZWA 5FP6A 5L8LA 5LMKA 5I9UA 3K3JA 4AQCA 3KFAA 3VHEA 3VRZA 2CCIA 2WTIA 2OFVA 4S33A 1YXSA 4IM2A 2NNWB 4H3PA 4LI5A 2XM8A 5EDPA 4I6FA 2Z60A 3BLRA 5DPVA 5CEPA 4UN0C 2XIKA 2CGXA 2NRYA 4AZEA 4ACMA 2B52A 4EOLA 4QMXA 4D9UA 4UWBA 1Y57A 5CANA 2OO8X 4CYIA 4D0XA 1NY3A 2YM3A 4XG9A 3EHAA 4FTMA 4ITJA 3RK9A 3LOKA 5HG7A 3F7WA 4IAZA 2IVVA 4GFGA 1J7UA 4AACA 3TN8A 3MVHA 4YZ9A 1JAMA 2F4JA 2QG5A 2WTWA 4YJVA 4GW8A 2EU9A 3R1NA 3UG2A 2VTIA 4QP3A 5DT3A 3RWPA 5FDPA 2CKOA 4XMOA 1K9AA 4YSMA 5DRDA 5HOAA 4ZLZA 2V7OA 2VTAA 3DZOA 1YXVA 3ODYX 4FNYA 4HGSA 4L3LA 3UTOA 1RQQA 4LM5A 2W06A 3LHJA 1KE6A 4EQMA 3VJNA 4O7SA 3F3ZA 4F64A 3BGQA 5AV1A 2W1CA 3MTFA 3OVVA 2QURA 5GHVA 5JKGA 3F7ZA 3NYVA 3E5AA 3VW6A 4ACCA 3O96A 5TO8A 3UE4A 2PUNA 2W1EA 2W5AA 3RCDA 4KSQA 4AOTA 3UBDA 4Y5QA 2HENA 3F88A 1PYEA 4CXAA 4F9CA 5E9EA 2QKRA 3FZOA 4PWNA 5DG5A 2XEYA 2WTJA 4LOOA 5DRBA 4N57A 4CV8A 3AC4A 1X8BA 5JZNA 4ZLYA 2XK7A 5GJDA 4G1WA 3NYOA 4H05A 4JX7A 2E2BA 2Y6OA 4EHEA 4EYJA 1CSNA 4BCFA 3BIZA 2VO6A 4W9XA 1V0PA 3CCNA 3ZUVA 4NL0A 4YJUA 4L6QA 3PZHA 3OCSA 2VX1A 3C50A 3EOCA 2F57A 5AAEA 3FHRA 5I9VA 5BNJA 2IN6A 4QTBA 5KHWA 4BL1A 4O0UA 4M69B 4MEDA 5A4TA 4GKIA 4JRVA 4NSTA 4EH5A 3P1AA 2R5TA 2X0GA 3SLSA 2QOCA 5AUWA 2YJSA 5J79A 4DCEA 5EI2A 4YLKA 5M08A 4GKHA 3QX4A 3FAAA 4BWXA 2BTRA 4IX4A 4GEOA 4RX7A 5EQYA 2WTVA 4HOKA 3E92A 4F99A 2PMLX 5T3QA 3MPMA 1JOWB 1GIJA 3OFMA 1PRYA 4C36A 4A4XA 5CU2A 4AT4A 5CAOA 3IOKA 4KIKB 1NVRA 4H1JA 1BMKA 3S3IA 2HXQA 2PTKA 4WSYA 1SVEA 2RFEA 2BRHA 3R73A 4G3EA 2X2MA 3O17A 4I6HA 4YO6A 5DVRA 3DNDA 4BDEA 4W4XA 2VUWA 4XRLA 5D7AA 2J0MB 3DNEA 2YLEA 3EKNA 3ZOSA 3I4BA 3FKLA 3BPRA 4U97A 3EN6A 3FSKA 3PPKA 4GFMA 4EOPA 3FMMA 4ZZNA 5F9EA 3PA5A 4RIYA 1UNHA 3BV2A 3D94A 4YUQA 3ZM9A 2ITOA 4WUNA 3PWDA 4QT1A 2B54A 5A6OA 4BCGA 2YCFA 3KXHA 1UVRA 3EFKA 3MV5A 1YOMA 3UZTA 2RG5A 3PG1A 4QMUA 1JKTA 4J97A 4BDAA 3Q4UA 1GZNA 3ID6C 3WARA 3C0IA 3CGOA 1MP8A 3OP5A 2BDWA 5JEBA 5AV0A 2JGZA 3LIJA 4ANBA 3ZMMA 4L42A 1FPUA 4O1PA 3LZBA 3FC1X 3MWUA 4HYHA 4AA5A 1G3NA 3KY2A 5FBNC 5BVFA 4PMSA 2HIWA 3BYMA 1IG1A 1HCLA 3UOKA 3RK5A 4CMTA 3CIKA 2R7IA 3F5GA 3UNZA 2Z7QA 3I0OA 4FG9A 3TEIA 5FQDC 4YC3A 2VTNA 4JRNA 1PKGA 3KRXA 5EQEA 2CN8A 4RVMA 3ENMA 3MYGA 4LG4A 4JS8A 4XV3A 5CU3A 3SRVA 4HVDA 2R7BA 3FQHA 2WIPA 4HGTA 2J0KA 3EL8A 4FUXA 2YITA 3TNIA 4LFIA 3G2FA 4F0GA 3F3UA 3L8VA 4J7BA 5DT0A 5I9XA 4AU8A 4CZYB 4D4RA 4GCJA 3LMIA 4FZAB 3NNUA 5FXSA 2PPQA 4EOQA 4R3CA 5E8TA 5HHWA 3QD4A 4Y73A 5IF1A 5IQFA 5DYJA 3OROA 4AA0A 5HCYA 5FXQA 4K33A 2QD9A 2QOHA 2XEZA 4GU9A 3ZLWA 4C34A 5L3AA 3BWJA 1SZMA 2IZSA 3PTGA 4IM0A 4OBPA 2VWXA 4C57A 2V55A 3IG7A 4I5HA 2A27A 2QLQA 4YGAA 1Y8YA 1VYZA 2DS1A 4IACA 4AP7A 5J5SA 4RFYA 1DAWA 3IW8A 4RC3A 4ZAUA 5IH5A 1P4OA 4XOYA 4GK4A 3FMKA 3H4JA 3WIGA 4BN1A 4PMPA 3B2TA 3ZU7A 2FSTX 4RFZA 3IOPA 3IW7A 3EQBA 4FKQA 4EH6A 2WMVA 2OIQA 4IZ7A 1RDQE 3HEGA 1SYKA 2OZAB 5AUVA 4ZTNA 2OU7A 2ZV9A 1JSUA 1OI9A 3ORMA 3KK9A 4G5PA 2JBPA 3QHWA 3UC3A 4A9SA 4F4PA 2BDFA 2UVYA 3DDPA 3WF7A 2EWAA 3TUCA 3A61A 3EYHA 2OBJA 3NNWA 4AAAA 4IWOA 5D7VA 3ZO2A 4JNWA 3ETAA 3UVRA 5LVPA 4EOSA 2Z7RA 2DUVA 5FEEA 4A9YA 4R1YA 3BU3A 3JS2A 2HCKA 4EH9A 5IQCA 4EKKA 5J1WA 5LVNA 5A6NA 1H0WA 4ITIA 4EUTA 4NW5A 5DHJA 1O6LA 4PP7A 3NCGA 4TTHB 3ZSGA 5HU3A 1DI9A 3Q53A 2PMIA 4BI1A 4FBXA 4RJ8A 4ZK5A 5AR5A 2P2HA 5ANJA 3RPSA 2ITVA 5CEKA 2GTMA 3NGAA 2JD5A 1BI8A 4CFNA 2R3JA 4FTQA 2WMTA 3OWPA 3R7YA 2PVKA 4E3CA 3DDQA 3V6RA 3GCSA 1XBAA 3GP0A 4C4FA 4DF3A 3R71A 3CTJA 2VGOA 2GHMA 2UZLA 3NIZA 3O0GA 4K1BA 4NTTA 4S32A 4YZDA 2W1ZA 5CF5A 5E90A 2WELA 4HGEA 5EYKA 5DEWA 4EK6A 4R8QA 3HAMA 4O0RA 1YQJA 3IECA 4G3CA 4NM3A 3AC3A 3G5DA 3AMAA 4L46A 4W8EA 3UC4A 1PMEA 3PXZA 4CFUA 4DFBA 1DAYA 2RFSA 4AN9A 3R04A 3QTXA 3JVRA 5D11A 4F09A 2JFMA 2VTSA 1R0EA 3L8PA 2NRUA 2VWZA 2XS0A 5M51A 5IQBA 2Z02A 2WIHA 4KS8A 4QYEA 1LPUA 4NM0A 4ZJIA 3RI1A 4ZEGA 3VUKA 3DAKA 4R78A 3KMWA 1YI6A 3R2YA 4A9UA 4F9WA 3QFVA 2OGVA 3VNTA 1J91A 3QCSA 4TNDA 2B9JA 4PV0A 4UZDA 3P9JA 3VIDA 2WB8A 3FMDA 4QD6A 4FL2A 4PP9A 5CSXA 3NNVA 3QCQA 5DI1A 5C8NA 3E64A 1H1RA 4IXPA 1YHWA 4XG7A 3TUBA 1B6CB 3FC2A 3PJCA 4V01A 1U5QA 1IR3A 3KVWA 3FEGA 4BHNA 2WU6A 3DBDA 3JUHA 4QMQA 1PYXA 4F9BA 3I6UA 2VV9A 2PVYA 3HA6A 4KA3A 1JVPP 2XVDA 4FV5A 3ZUTA 4FGRA 4LV8A 1AQ1A 2XUUA 1Q97A 3VBWA 3O7LB 3PVWA 4NT4A 4Y46A 5HLWA 4M67A 3B8QA 3C4ZA 5AADA 3F66A 4MAOA 4I6BA 1WBWA 1ZYDA 4TPTA 3R7EA 1ZYJA 3HP2A 4DEBA 2VTMA 3U9NA 3DS6A 2A19B 5FEQA 4FTCA 2CDZA 4M7IA 2OJIA 4CG8A 4FSMA 3RNIA 2QVSE 3PXRA 3NDMA 3P4KA 5J8IA 4I6QA 3VRYA 3ATTA 3AMYA 5FTGA 4C35A 4AN2A 5IUGA 1Y8GA 3GC7A 3ZS5A 4ZTSA 4F63A 3QUPA 4J99A 3QWJA 3OTVA 1W83A 1H1PA 4FTOA 4QYHA 5B7VA 3MI9A 2C6IA 1REJA 2ZB0A 4DCAA 3LFNA 1ZMVA 4YC6A 3JVSA 3ZDIA 4PL3A 4D28A 2XNMA 3FL4A 3HMIA 3FPQA 4AW5A 2X8IA 4NK9A 3DT1A 3OY1A 4RMZA 1KOAA 4C0TA 2ZB1A 5BUJA 3DU8A 1BYGA 2BDJA 3OT8A 4XP3A 3PE2A 4EUUA 4YURA 4CKJA 1U5RA 4QP8A 3RHKA 3CKWA 4BCNA 3H9OA 1K3AA 2JAVA 4A9RA 5J9YA 3L8XA 2QO9A 4K18A 3FLSA 5L6PA 3CD3A 3TDWA 3QXOA 3N9XA 4IZYA 2BUJA 1PXJA 3AGMA 3FKNA 4FSQA 2XNGA 3UP2A 2V5QA 2ZMDA 4WBOA 3E63A 4DINA 1Q61A 3IONA 3CQWA 2GTNA 3IDBA 5KMKA 4G31A 3MB6A 3SW4A 1XQZA 1URCA 3COIA 2RG6A 4AXAA 4BZDA 5CAUA 2PE1A 3U55A 5C4KA 4O27B 4DYMA 4BKYA 3I79A 3D14A 3FSFA 2GS6A 1S9IA 3PXFA 5EI8A 3ZRMA 5HIDA 2AC5A 2O64A 3KN5A 3LMHA 1URWA 4BWKA 1UNLA 4FTUA 5FP5A 3UO5A 1FINA 4FT7A 4LGDA 4DFZE 4IZAA 4RX5A 4FEWA 4BZNA 3AC5A 4C7TA 2PHKA 3EZRA 4MBJA 2WQMA 4X2GA 4LOQA 4YBJA 5HKMA 2XM9A 1M2RA 3NUYA 3R1SA 5AEPA 4ANNA 5IA0A 2PZIA 4K8AA 4DT8A 3R8VA 3FLZA 3WF9A 4X2JA 3Q5IA 5KBRA 4MTAA 4FEVA 5ITAA 2WQNA 1Z9XA 5E91A 3DQWA 4J1RA 4J96A 4DA5A 3DLSA 4FG7A 4IC8A 2OKRA 4CKIA 4AZVA 4CQEA 2C3JA 2BHEA 2E9OA 2GSFA 2PULA 1JWHA 1WVWA 4FNXA 5M4IA 4YPDA 2IW8A 2EXEA 3M1SA 5CAVA 1IAJA 3AT2A 1PW2A 4N6ZA 1P14A 4AZWA 4DEDA 4M15A 4NUSA 4C58A 5FDXA 4I22A 3NW7A 5I9ZA 4RVTA 4TYHA 4M69A 4IC7A 4BDCA 2OXXA 4E5AX 3HRFA 3PE1A 1KWPA 4UMPA 3C51A 3TKUA 4IFCA 3U4WA 1OB3A 1WVXA 4DN5A 5FBOA 1OGUA 1UV5A 5CU0A 4IAIA 4Q9SA 4ZTRA 5FM2A 5C4LA 1WBPA 3GUBA 5AM6A 3EKKA 3CXWA 4FKOA 3KREA 5F4NA 4OTQA 5K9IA 3SW7A 4QMMA 4O7NA 4EHZA 2W5BA 3BE9A 1XBBA 3UZRA 2OJFE 5LMKC 2RFNA 4CFXA 3PRFA 4WOVA 4JJRA 4ID7A 4X3FA 4X3FC 5GJGA 2UZTA 3NAYA 3TXOA 3V5WA 3R83A 2QU5A 3UVQA 2QOKA 4A4OA 1QPEA 4YO4A 2UZEA 4LV5A 3LFEA 3RAIA 1I44A 2W4JA 5D9HA 5I9YA 1BL6A 1R39A 4GT3A 3UQCA 3ANRA 3CJFA 3NUSA 5IMEA 4TYGA 5EQPA 1ZZ2A 2WZJA 3VS3A 4I1ZA 1XH6A 3TACA 4IWPA 2F7EE 3Q9WA 4IAFA 3SX9A 4I0SA 4X21A 3VS1A 4IJ9A 4IH8A 5HBJA 4BTJA 3BBWA 4I41A 4FIGA 2C30A 4PNIA 4D4YA 5H2UA 4E4LA 3K5VA 4EQCA 2ITYA 2VTRA 4K11A 5AR7A 3W1FA 2PU8A 4CTCA 5HLNA 1A48A 3QRUA 3RPOA 3FQSA 4YJQA 3F3WA 4C8BA 4U0IA 5LMBA 3KXGA 3SXRA 3N4TA 4D1SA 2B1PA 5CSVA 5F94A 4I4FA 2CGWA 3LXNA 4O7LA 3DB8A 3WE8A 4BGQA 4DAWA 2SRCA 4BIBA 5IDNA 2WXVA 3A7HA 2ETMA 2QOOA 2CNUA 5IQAA 2VO3A 4FODA 5EFQA 4E5WA 5CSWA 4L68A 4U81A 2GFSA 2V22A 4BDJA 3OZ6A 4OTRA 4UZHA 1Y6BA 2GNFA 3NYNA 5JGAA 4IJPA 3S0OA 4JDKA 4WD5A 5LVLA 4E73A 4DH7A 5D10A 5L4QA 3VS0A 5JH6A 4O7ZA 2P3GX 2YHVA 1KE9A 5AX3A 3G6HA 2FB8A 4FV8A 4MCVA 2Y4PA 2PUPA 1OL2A 4R77A 4IDTA 3A4PA 5J1VA 3TNPC 2QOLA 5EW8A 4FICA 4G17A 2PMNX 1H1WA 4IADA 4C3RA 4RFMA 4D5KA 4KBAA 3ORPA 4ZMEA 4H3BA 4L45A 2CPKE 2C68A 4PTGA 3E8CA 4E26A 5EOLA 3DCVA 3POOA 3DV3A 4O7WA 3F69A 2R3LA 2UZDA 2ZJWA 5AP6A 4AG8A 4BICA 4NJ3A 3KA0A 4W8DA 4AGCA 4C4GA 3KVXA 4ZZOA 1OL5A 5JN2A 3C5IA 5M06A 2Y8OA 4LGHA 2GHLA 1XH4A 2A1AB 3L8SA 5HNGA 2YISA 3G9NA 1ZARA 5BUIA 5CQWA 2WOUA 3MBLA 5AR8A 3ZC5A 3TNWA 1JLUE 2BFXA 4NU1A 5EM6A 3VULA 5E8UA 2VTQA 3FLWA 3PVBA 1NVQA 1R1WA 5CVHA 5CENA 2JDOA 4L52A 2W99B 4KBCA 3E88A 5I5ZA 2R2PA 4DE4A 4JXFA 5EKNA 4ZSGA 2PVMA 1YVJA 3AT4A 5IQGA 3DJ6A 1OPJA 1Q8WA 4M97A 3NWWA 2C3LA 5HIEA 4NCTC 3BYOA 2UZUE 1IA9A 1XR1A 1E1VA 2WMXA 3QYZA 5HCXA 4ZY6A 5KMMA 5DR6A 4JQEA 3RJCA 4BI2A 3QLFA 4FSZA 4H36A 4UXQA 2WQEA 4FTNA 3CQUA 4C33A 4C4IA 3E8EA 4EYMA 3E3BX 4HW7A 4LL0A 4MXOA 4P4CA 4EK5A 3AC1A 2UW9A 3L9MA 2OXYA 5IH4A 3NMUF 4JQ7A 1XBCA 4TWNA 2JDVA 2YM6A 5E8XA 3RMFA 3BU6A 3CC6A 3ZRLA 5LXMA 4G6NA 5C01A 2BRNA 5EOBA 3FXZA 2XK3A 3S2PA 1JSTA 2I6LA 3QTUA 4ASDA 5FM3A 3PPJA 2FUMA 2EB2A 3B2WA 1BI7A 5AR3A 1MQ4A 4JAJA 4MWHA 3PPZA 4PDOA 2OK1A 2OIDA 5E8WA 3VS6A 4ALVA 3IW5A 4FNWA 4L8MA 3ROYA 3KXXA 2XCKA 3HMNA 4QNAA 3FBVA 4XHKB 4BDDA 5IISA 3KF7A 2C6DA 4FZDB 2O5KA 4B99A 1ND4A 3P86A 2Y6MA 5AA8A 3UIMA 2VD5A 1H8FA 4IZ5A 2C6MA 2VZ6A 4FV6A 4YU2A 3SRVB 2VU3A 2PZRA 4E7WA 4E93A 3OWLA 2XNEA 3H9RA 3Q52A 2BZKB 1F0QA 3RALA 2WMWA 4AW1A 2XZSA 3HV6A 4UEUA 3ORXA 2G2HA 3RZFA 4QTCA 5B2LA 4RX9A 1GZ8A 3R8MA 5CEMA 4GU6A 3NNXA 4WG5A 3R9RA 2W1GA 4FIJA 3UYTA 2BAJA 3B8RA 4J8NA 4AFJA 3TZ8A 4H1MA 2BMCA 4CZTA 3KQ7A 3Q9ZA 4ZSEA 4BRXA 4CFWA 3CSVA 3ZYAA 4PDPA 3PFQA 4JIAA 4M13A 5AA9A 2IZTA 2UW4A 2XKEA 3WZEA 2G2FA 3EQIA 3W55A 2C6KA 2H9VA 4IB3A 3FZ1A 4XLIA 2W9FB 1JPAA 3QA0A 4ZOGA 5AWMA 2H8HA 3I0QA 3VUTA 3WIKA 4DTKA 3E7OA 5K3YA 4JOAA 3UG1A 3JYAA 5DN3A 4EH4A 4ZY5A 5C1QB 4X2NA 2XKDA 3H9FA 3GI3A 3D5XA 3IDCA 4DEIA 3A62A 4WA9A 5CF8A 2YWVA 2UVXA 3VS4A 2RF9A 2ZDUA 1UU8A 1OKWA 3G90X 5CAQA 4FOCA 2XKFA 4Q2AA 3NX8A 4TNBA 2C3IB 4RPVA 3QU0A 4MKCA 3OOGA 1OUKA 3R1YA 4GJ2A 5ETAA 3U87A 3VBVA 4BDHA 4C59A 4U7ZA 5HGIA 5IU2A 4MXXA 3BLHA 2O8YA 3QQJA 4G6OA 4FZFB 4W4YA 1P4FA 2WMAA 4L43A 5K4JA 3BYSA 4BTFA 3KCKA 4D2PA 4JAIA 2NO3A 4UXLA 5DLSA 1YXUA 2Y9QA 5A4EA 4TT7A 3C4EA 2W7XA 2HK5A 3Q2JA 4C62A 4ZS4A 5CAPA 2YIQA 2QHNA 5I9WA 3R00A 4L00A 4QP2A 2PE0A 5ANEA 4GFOA 4UMQA 2I0VA 5A54A 3DBFA 2VO7A 4JLCA 4Z9LA 5J95A 3LFAA 4FEQA 4H3QA 1Q4LA 1SMHA 2C69A 4I23A 1Q24A 4XV1A 5IG1A 3QTIA 2H96A 1QCFA 4FKIA 2QR8A 4QMYA 4HVIA 2XRUA 3AQVA 2X7GA 3LE6A 5AUXA 4BTKA 1H08A 2AYPA 4OW8A 4G5JA 3EN4A 4KINA 4HNIA 1YI4A 2UZNA 3COMA 3O71A 4TXCA 3QRJA 4RLKA 3VBYA 5JK3A 4B0GA 2I7QA 2Q0NA 4PDSA 3HX4A 5FRIA 4CNHA 4YJPA 2YCRA 2FYSA 3C1XA 2XBAA 1ZWSA 4IVCA 5J7HA 1VZOA 3PYYA 4YHFA 1Q99A 3EYGA 1G8SA 4FV1A 3VQHA 3OT3A 1YXTA 2PE2A 4KABA 3PLAE 2PVFA 3G0EA 3QHRA 3MESA 2G01A 3NR9A 5HX6A 1JKLA 2YDJA 2A4LA 3AOXA 2XF0A 3LXKA 4NW6A 4BCHA 4E6DA 5CT0A 5GJFA 4EKLA 2HYYA 3QL8A 4CVAA 3Q96A 2BILB 2YWPA 3ZFXA 3U6HA 1MQBA 2C6EA 2JDRA 4Z7GA 2J4ZA 3N4VA 2X6DA 1GZOA 4KIPA 4XX9A 3P08A 4XBUA 3ZO1A 4GYGA 3NUUA 3MFTA 4CD0A 4J95A 2VTLA 4GVAA 4QPAA 4D1ZA 5J5TA 4YZMA 4CT2A 3F5PA 3HKOA 5B0XA 3FLQA 3UGCA 4BKZA 4GK2A 4D0WA 1Q8ZA 4U9AA 3LXPA 5EHLA 2CSNA 3DOGA 2B53A 3FMHA 1M7NA 4MBIA 2ITUA 3MVMA 4QOXA 1AGWA 4ZXTA 4P5QA 3W10A 1R0PA 4FT5A 1FMKA 5E1SA 3TZ7A 4QYFA 4D4SA 4HPUE 3U54A 1AD5A 4MF1A 3ZZEA 2RL5A 2G9XA 4S2ZA 2G15A 5IH6A 3QA8A 4KSPA 4KIOA 2XYUA 4LMUA 4QTAA 1UKHA 1WMKA 5HG9A 3JY0A 3JXWA 4PRJA 5BX0A 4FOBA 2YAKA 5IPJA 1PMUA 3D7ZA 4CQGA 3Q04A 4GG7A 4DTBA 3R01A 3CQEA 4WNOA 5EHOA 1QMZA 4V0GA 4W4VA 3DPKA 4RQVA 3RCJA 3ZEPA 4MF0A 3DTCA 5JRQA 4DG2E 2BHHA 3GCVA 4F9AA 3C9WA 3WF8A 3ORTA 3EN9A 5B2KA 4CMOA 3A7IA 5JRSA 2YCQA 4YC8A 2PZYA 4MNFA 4FTJA 5BYZA 4DLJA 3UJGA 1H28A 2GQGA 5CX9A 2CNVA 1PXLA 4IVAA 2GU8A 1IA8A 2QOQA 4XP0A 3V6SA 4BFMA 5LQFA 3NYXA 4M84A 4R5YA 5D12A 2X7FA 1NT2A 1KE8A 2C6LA 3EFLA 1XO2B 4TKSA 3MTLA 2CNQA 5LWMA 1OPLA 2VNWA 1ATPE 1LEZA 4K0YA 3TT0A 4C4JA 5DR2A 3RPYA 2BKZA 1GZKA 4XBRA 4O0VA 5CTPA 4ANMA 3GC8A 4FEUA 4NYEA 4RIWB 4E4MA 4EC9A 4O0SA 3Q32A 4YHJA 2J5FA 4P7EA 3MY0A 4FE2A 3V5QA 2XB7A 2BKKA 2IG7A 1ZLTA 2CMWA 4HJOA 5AUTA 4ZY4A 2WEIA 2WTKC 2X1NA 1V0OA 3C4WA 4FKRA 4WG3A 4BDKA 4GIIA 3NPCA 5DMZA 3KC3A 3D5WA 4L3JA 3ELJA 5KO1A 1XH7A 5M4FA 3REPA 4BCIA 5AAFA 2JITA 5EH0A 3TWJA 3ZLSA 2FH9A 3GQIA 2AC3A 3D0EA 4HCTA 4ONAA 1Q3DA 2R3IA 5AUZA 1DM2A 4BCQA 4C3FA 1OL1A 1WVYA 4AGDA 4B8MA 5IA1A 2ZV2A 2YN8A 3T3UA 4EI4A 5DIAA 2XK9A 4UY9A 5I3OA 4UMRA 4YLLA 2IO6A 2ITQA 2XK4A 4U79A 4RT7A 3BELA 1ZOHA 4YJOA 2Y0AA 3G0FA 2BRMA 2UVZA 4KKEA 5AR2A 4F1TA 2PWLA 2YFXA 3Q4TA 3I81A 3T8OA 5HTIA 2JLDA 5KZ0A 4IB0A 1UWHA 4P2KA 3GC0A 3QX2A 3SOAA 2WEVA 5I3RA 4LOPA 1B39A 2YABA 4YNOA 3UOJA 1FGIA 2BIKB 1OUYA 2YM7A 5AP5A 4JI9A 5DOSA 4LYNA 4JG7A 5HO6A 3KL8A 3UNKA
chains in the Genus database with same CATH superfamily
4CRLA 2JDTA 5M07A 3M11A 3Q5ZA 4Q5HA 2QOIA 2GCDA 4R1VA 4FG8A 5EDRA 4DGLC 4BF2A 5KE0A 3R9NA 3FY2A 4ZTMA 5E92A 2FA2A 5AUYA 2JKKA 2OXDA 2R0IA 5EYDA 3AMBA 2R3GA 5T6KA 5TF9A 4GMYA 3RTPA 4X6RA 2VWIA 5L2IA 4JR3A 3SXSA 1SNXA 5IZFA 4YPSA 4AZFA 5KUPA 3NW5A 4YTFA 4WSQA 1QL6A 3NAXA 4X7QA 4RGJA 5FG8A 1FVRA 3BEGA 1M7QA 2E9UA 4RJ5A 3G51A 4DGMA 3AD6A 4AX8A 4ZSJA 4BDIA 4LDTA 2RKUA 3NSZA 4U41A 4F7JA 4JDHA 4O81A 3F82A 4EZ5A 4Q9ZA 2XIXA 5IQIA 3EQGA 3WZUA 3ML1A 2GS2A 4L3PA 4FK6A 2OJJA 3I7BA 4FV9A 4TYJA 3BHTA 4WT6A 4HYUA 4BY9E 3LW0A 5IUIA 2HXLA 2GNIA 5HBEA 3R8LA 1FBNA 3ET7A 3KKVA 3D2IA 3BRBA 4OUCA 3CPCA 2GMXA 3PY0A 3HV4A 5BUEA 4IWDA 4KRDA 4KIQA 2X81A 3UPXA 2B4SB 3PXQA 3KU2A 1WAKA 1W0XC 4FKUA 4RIYB 4J98A 4WNPA 5ETFA 3IGOA 4D9TA 3MDYA 3OS3A 1RE8A 3PIZA 2R3MA 4TY1A 3QXPA 4FT0A 3Q4ZA 4YJRA 3QQUA 4U42A 4E8AA 3IDPA 5AV3A 4PF4A 4E6QA 5KMLA 1KUTA 3EQPA 4QMSA 3NFFB 3ACJA 2YEXA 4N0SA 1JQHA 4WG4A 2BAQA 4R7HA 3RPRA 3U8WA 4QQTA 5L2SA 2YIYA 3Q60A 2WU7A 3TI1A 4FMQA 2PSQA 4RJ4A 2GNHA 2V7AA 3PXYA 2ZV7A 2JIIA 1GAGA 1OMWA 1ZOGA 3GBZA 3OW3A 4IX6A 3TIZA 1LUFA 5BPYA 4RWLA 4FR4A 3C5UA 4IWQA 4F1OA 2W96B 3PVUA 4ERKA 2PYWA 3R7GA 5BVKA 5AAGA 4EK3A 2WMSA 5C8KA 3KEXA 4RIXB 5AIRA 1E1XA 4NIFA 1ST4A 3AXWA 2XJ1A 4OGRA 4IMYA 5H8BA 3UODA 2UW5A 5L2TA 1VJYA 1XH9A 4JVGA 3EQDA 3VBXA 2PUIA 4DG0E 3MVJA 1PMNA 4IB1A 2C5NA 4ACGA 3KXZA 5LJJA 4DH3A 2VO0A 4ZLOA 2UZVA 1P5EA 4O86A 4LUEA 4CLIA 5LARA 4L9IA 3LJ0A 4Y5HA 5EM8A 2CCHA 3NVKI 1MUOA 3QRKA 2QOFA 3THBA 1E9HA 3DLZA 1XH8A 3ZO4A 2NPQA 3GCUA 4FX3A 5HQ0A 3V01A 4JDIA 4CG9A 3WOWA 3F9NA 4APCA 2XJ0A 1IEPA 3GU6A 1R3CA 1NVSA 5KMNA 3LM0A 3VUHA 5JZJA 1OIUA 3VBQA 2FSMX 1OKVA 4DFNA 1SNUA 5JMSA 3HRBA 4YZBA 3AD4A 2VNYA 2OH0E 3Q3BA 3TV7A 3FDNA 4UALA 2X8EA 3HMPA 3MA3A 2XCHA 2Y4IC 4D2TA 3MVLA 5DFPA 5A4QA 1A06A 2PVRA 4QQJA 1YDTE 3ZXZA 1GJOA 4Z3VA 4QTEA 2XKCA 3R21A 3NUAA 5E4HA 3LPBA 3SGCA 5HLPA 4U6RA 2BPMA 2DQ7X 4A4LA 3QRTA 3F3VA 4C38A 4XV2A 1ZY5A 3D83A 4C2WA 4EOOA 2ETRA 5BVNA 4X3FB 1H00A 4FEXA 4JG6A 4TYIA 4PL4A 5EYMA 4CFMA 2CLQA 3R6XA 4EBWA 3WZDA 1CKPA 3QQHA 3NUXA 4I21A 2BTSA 2VTPA 3QGYA 5BMMA 3DK3A 3W2RA 2WKMA 5BVEA 5CZHA 4O84A 3VQUA 3CP9A 4MUQA 2C0TA 3R8ZA 3OUNB 2JIUA 4O4EA 2QI8A 4PMMA 4EORA 4I24A 4MXYA 3HV5A 4QPMA 4BBFA 3GXLA 3E8NA 3QTZA 5IKWA 4FYNA 3WE4A 3MIAA 2X2LA 5AV4A 4IVBA 3FJQE 3KB7A 5KHXA 3DFAA 3FV8A 2RGPA 3QC9A 2EXCX 5DR9A 3UO4A 4ALUA 3EL7A 4BDBA 2WOTA 3HA8A 2ZM3A 2WTDA 3PIYA 5DWRA 3BE2A 3UQFA 5CNNA 4XCUA 3BQRA 3ROCA 3W2PA 1KV1A 1W2CA 3KCFA 1ZAOA 3D5VA 2GNGA 5HE1A 2OICA 3AGLA 2B9IA 2HWOA 1XMMA 1PXNA 1PXIA 2X7OA 3NLBA 4LL5A 4NEUA 3NW6A 4IDVA 3SQQA 4CGAA 1NA7A 3Q4CA 3HMMA 3R02A 2CKEA 4GL9A 1H1SA 3VS7A 1UU7A 2Q83A 4AUAA 2W9ZB 2X4ZA 3EH9A 4JX3A 4ASXA 3T9TA 3DAEA 3RZBA 3BZ3A 3P5JC 5JGBA 4NTSA 1YWRA 4ANOA 4D5HA 4LRMA 4BC6A 4ERWA 3V51A 2JKQA 2R3QA 2VTTA 3P5KA 2IVUA 2GS7A 3FL5A 2ERKA 4GS6A 2BALA 5F20A 4FC0A 3WBLA 1ZYSA 3QUEA 3A60A 3VVHA 3EN7A 3HL7A 4MQ1A 1OGYA 2VGPA 3FMJA 4M3QA 5CXZA 4ANQA 2CN5A 5K0XA 3JR1A 2YIXA 2E9VA 5AP2A 5EI6A 2PVLA 3VWAA 1VLRA 5BMSA 1YDSE 2REIA 2WQOA 1JKKA 1OVEA 1SVHA 2FO0A 2VX0A 3HRCA 4BYJA 1STCE 3UPZA 4DEAA 4AXCA 2YJRA 3IS5A 4HZSA 3QF9A 2HAKA 3TJDA 3ERKA 2XBJA 4MXZA 3PP1A 2WGJA 3QRIA 5AP1A 4ZTQA 3RM7A 2ZAZA 3LVPA 2OF2A 2Y4IB 4YJSA 3PZEA 3QUDA 4DDGA 2ONLA 3QTSA 5CEQA 3TUDA 3VS5A 3L9NA 1IAHA 3JPVA 2P4IA 1FQ1B 4EWHA 5IUHA 4XLVA 3TCPA 4U3ZA 4EONA 5CVFA 3QTWA 4CRSA 4O7RA 3FHIA 3FMEA 3GCQA 4X2FA 2WMQA 4BI0A 1WBNA 1JSVA 4U44A 5DE2A 1IRKA 1WBOA 5A4CA 3CTQA 4QO9A 3R7VA 1CKIA 2R9SA 2V62A 3FI2A 3OOMA 3ZC6A 4B7TA 3M2WA 4OT6A 3O23A 4U40A 3EMGA 3MA6A 3NZ0A 3OXIA 3TNHA 4F7LA 5IEXA 3N4UA 2C5OA 4L44A 3FZRA 2HZ4A 1KSWA 2W5HA 2EXMA 4CLJA 5J9LA 3DJ5A 3GOKA 3MJ1A 4N4SA 4CCBA 4E6AA 5A46A 5HD4A 3SVVA 4O38A 1YHVA 2C0OA 1DS5A 3BGZA 1O9UA 3HV3A 2JBOA 4C3PA 4LUDA 4NFNA 5GZ8A 4IBMA 3TL8A 4BCMA 3W18A 3D2KA 2QR7A 2WQBA 4V05A 1ZYCA 4M14A 4QMVA 5A9UA 1R78A 2IJMA 3PUPA 4PX6A 4R5SA 3LMGA 3MB7A 3KMMA 4FKPA 4QMPA 3W2SA 4FV0A 5DT4A 3II5A 5G6VA 5E1EA 4UMUA 3DBEA 4EZ3A 4EEVA 4FVRA 4DT9A 5AP7A 2YZAA 4O0XA 3QYWA 5HVJA 3LFDA 2JDSA 3MH1A 3WILA 3NVMB 5LVMA 5A4LA 3NUPA 1YRPA 3KK8A 4R6VA 1XH5A 4GV1A 4WKQA 3BYUA 4FKTA 1U54B 4BCOA 1CTPE 2A0CX 2I0HA 3A8WA 4RZVA 5I0BA 3GGFA 5M55A 1UA2A 3UMWA 4ENYA 3D7TB 2G2IA 3PXKA 2WNTA 4ZS0A 2Z7LA 4HVSA 4F6UA 3ALOA 2JFLA 5K0KA 4UV0A 5CEOA 3R7UA 2BCJA 5G1XA 4BHZA 2GNJA 3RAWA 2R0UA 4W9WA 3W2QA 1YHSA 2HY81 3OUKA 2W1IA 2WPAA 3GT8A 4L01A 3F6XA 2YA9A 2C0IA 5ACBC 2HY0A 3KRLA 5M4UA 2Z8CA 2J90A 5HIBA 1OL7A 3DKFA 4QYGA 2HZNA 4KD1A 5JFSA 1Y6AA 4UB7A 4D4VA 2UZOA 4U8ZA 5IQHA 1GOLA 3MIYA 4J8MA 5AV2A 4RVKA 2ONLC 4RZWA 5HVYA 2JAMA 5E8SA 2BZIB 3ZBFA 2WMUA 4AZSA 3R2BA 1HOWA 3IPHA 4C02A 2X8DA 4DHZA 3CY2A 3R9DA 3ZRKA 4C4EA 1OBDA 3KULA 4G2FA 2EB3A 5IQDA 5ANIA 4NM7A 3IW4A 4OAVB 2VN9A 1TQMA 1YOLA 4TYEA 4ENXA 4TZRA 3WF5A 4ACDA 4BTMA 4YLJA 1PKDA 1PF8A 3T9IA 2UW8A 4AW0A 3GU5A 4FV2A 3CLYA 4RC2A 2OIBA 3C4CA 3PY1A 3EQHA 3KGAA 1H4LA 3MSSA 5C27A 4EQUA 2R3OA 3QZHA 4OBQA 4FTLA 1XWSA 2ZV8A 3OCTA 2OFUA 3IK3A 3AG9A 3NFGB 3QGWA 4IFGA 4IEBA 4F7NA 5IQEA 3SDJA 3K3IA 3BHYA 4XG4A 3UIXA 4O7VA 4QNYA 3FZTA 5GINE 4LQMA 2W0JA 3HECA 2QU6A 1W82A 4QMZA 4C37A 3GFWA 3R22A 3TM0A 2OLCA 5D1JA 4MYGA 2WTKB 3GU7A 4YTCA 4FZ6A 1VR2A 5AP4A 3C7QA 3LLTA 2J9MA 3LCDA 4AWIA 1FMOE 2KTYA 4W4WA 1REKA 2Z7SA 3AD5A 4DFXE 2QG7A 4KUJA 3DY7A 4IB5A 1W2FA 4DG3E 5IA2A 3DZQA 2IEWA 4QTDA 3K5UA 3GC9A 2VWWA 4NIFB 4NKSA 2GFCA 3OXZA 4FIFA 2CHLA 3MGYA 5AX9A 3GB2A 3TKIA 1JNKA 2YACA 5ETCA 4CMUA 2FSOX 4WNMA 4EL9A 2J5EA 4I0TA 4Y8DA 4DHFA 2LGCA 4GIHA 2XRWA 3BEAA 4JL9A 4RQKA 4S30A 3R7OA 4K77A 5KMIA 3K2LA 2QC6A 5E8VA 2XJ2A 1LEWA 4ZTHA 1RJBA 5JQ5A 2XMYA 3W0NA 2J6MA 3A2CA 5CU6A 3P79A 4Q5EA 3RVGA 4K2RA 3TG1A 4KRCA 3QTRA 4I4EA 4XUFA 4D2SA 2BR1A 4G3FA 4RX8A 4Z55A 2HELA 2C6OA 1PXKA 2CKQA 3FPMA 4OT5A 4U45A 3CTHA 1PMVA 3BYVA 3WYXA 4BWPA 3BI6A 1CKJA 2XNNA 4XS2A 4ANSA 4D2WA 4EH3A 3PJ2A 1G8KA 3FI4A 3RKBA 4HZRA 1F3MC 5FUTA 2XAOA 4IAAA 3DK7A 4FK3A 4IVDA 3HDNA 5EDQA 4FUYA 4DH5A 2QKWB 3SA0A 2VTHA 2F2CB 3BHHA 5FLFA 3GU8A 3BHVA 3PSDA 4GUBA 4F0FA 3SG9A 4RSSA 4TN6A 2OJ9A 2C1AA 4O82A 3SAYA 4Y95A 3G15A 4MWIA 4OLIA 4HPTE 3DXQA 4GH2A 4EOIA 5ETIA 3MY1A 3DK6A 1OL6A 1K2PA 1YWVA 3IGGA 1CM8A 3MPAA 3PLSA 1PXPA 3QC4A 4CTBA 4BR3A 1Q5KA 2YM5A 4TRLA 5HU9A 4AT5A 5H8EA 4ZJVA 3VHKA 2BZHB 4NJDA 1CDKA 1MRYA 3BX5A 3LCKA 4V04A 4O83A 4IW0A 2J2IB 3OW4A 1L8TA 4DEEA 1Y91A 2B7AA 5DNRA 3DXNA 4JR7A 1KV2A 3FWQA 4G16A 5AJQA 4DFYA 5FD2A 3TIYA 3TJCA 3A99A 2R3PA 1WBSA 3KN6A 3RM6A 5ICPA 3BL9A 3MH2A 2OF4A 5DH3A 2Y7JA 2W1HA 3R9HA 3O5AA 4V0GB 1M2PA 3IQ7A 4BCKA 4MNEB 1ZOEA 4N70A 4GVJA 2J0LA 2VRXA 3LCTA 5DGZA 5ANKA 3UQGA 4MQ2A 4DGNA 3DJ7A 2YAAA 3COHA 3OCBA 5FGKA 4LMNA 4U43A 1VYWA 5K5XA 3NCZA 4FSUA 4F6WA 2JC6A 3PA4A 2PVJA 4RVLA 4X6QC 5J87A 3ULIA 3DTWA 5CLPA 4PY1A 3KRRA 5BYYA 5HTBA 4O7YA 4AE9A 4NM5A 3RGFA 3RHXA 5GZ9A 2ZYBA 4I20A 3DB6A 1FOTA 2CGVA 3UYSA 5KKRB 4JIKA 2IWIA 4A06A 4MX9A 2YM4A 5AP0A 4I0RA 3TV6A 3DBCA 4RJ7A 3QKKA 4EOJA 3OC1A 3D7TA 3NUNA 4ZJJA 2OJGA 1H07A 4QPSA 4FRFA 3RAKA 3FI8A 3FXXA 3FLNC 5LCKA 4YTHA 2UW6A 4FIHA 3OEZA 3LFSA 2ZDTA 3QQGA 3VO3A 2WD1A 4FI1A 5DA3A 1GNGA 3LQ5A 1O6KA 4WBBB 4XG3A 4IANA 4NFMA 2X2KA 4D58A 2B9FA 4KWPA 4Z16A 4FV7A 2Q0BA 4FT3A 3DKCA 4KB8A 5B2MA 4RWKA 1GIHA 4WRGA 1XKKA 5ANGA 4XNEA 5GZAA 5HNIX 4C4HA 4RBLA 2W1DA 4FSRA 1I09A 2DYLA 4RWIA 3W32A 3VUDA 5HVKA 3QD2B 1J7IA 3FYJX 3LFQA 3P7CA 4XOZA 2QODA 1OKYA 4ITHA 2PK9A 3IW6A 4KKGA 4YHTA 2BRGA 3DQXA 3R63A 5L6OA 3DFCB 1NW1A 4E4NA 4OBOA 1MRUA 3RINA 4AGUA 4RRVA 3UZPA 4J52A 3M42A 3LQ8A 3QBNA 4ZIMA 3GVUA 5JFXA 4QP4A 2RFDA 4TL0A 4IHPA 3PFYA 3CEKA 1JKSA 1WBTA 3P7AA 3LXLA 5L2QA 4OTDA 4MD8E 4EHGA 5LOHA 2OSCA 4WRSA 5HCZA 4M66A 4GUEA 2UW7A 3POZA 2GDOA 3E87A 3PA3A 2QO7A 3HUCA 2GPHA 4JBPA 1ZZLA 3A7FA 3D15A 3FMNA 3IKAA 4FKWA 2IW9A 4DH1A 3OXTA 1PXMA 5AMNA 4KAOA 4ZMFA 1BX6A 2BAKA 1APME 2HWPA 2QNJA 4FTIA 4RG0A 5DBXA 3BKBA 3L9PA 1SVGA 3MY5A 4EZ7A 3KXNA 3QAME 1H0VA 1UNGA 3ZHPC 4MHAA 4G3DA 3S95A 3TNQB 1PJKA 4L53A 2UW0A 4FIEA 4QQ5A 4YBKA 4QP7A 4RC4A 4QMOA 4R7BA 3PSCA 2H6DA 3GNIB 3OWJA 3R9OA 4OTGA 5KMJA 4GYIA 4O6EA 3EZVA 5IEVA 3UO6A 3JY9A 4CKRA 5CF4A 3MFRA 5CT7A 4GRBA 1O6YA 2UV2A 4G9RA 4YP8A 1UU9A 2PZPA 3PJ3A 4FTTA 2OZAA 3ZUUA 3VW8A 3P0MA 4F7SA 3OY3A 5HO7A 1XMLA 4HCUA 3FXWA 4A07A 2CGUA 4NH1A 3OTUA 2OZOA 4CSVA 2XNBA 3U4UA 4PUZA 4QMTA 3RNYA 2XH5A 2XIRA 1FVVA 3EJ1A 3I5ZA 1TVOA 3LAUA 2FSLX 2VTOA 2ZOQA 4EBVA 5LCJA 4D2VA 3CY3A 2QCSA 1QPJA 3H3CA 3ORKA 1XJDA 2C5YA 4PMTA 3K54A 3QQLA 3V5LA 4YSJA 3BLQA 5CSHA 2BRBA 2PVHA 4EK4A 5DEYA 4HYIA 5IDPA 3P23A 3GOPA 3VN9A 4BZOA 1BKXA 5AUUA 3VUMA 5T68A 3KRWA 4DFLA 3OBJA 1BUHA 3UMXA 1Q8UA 2I0YA 4BBEA 4BIDA 3ORIA 1W84A 4JG8A 4CFFA 3DKGA 3CPBA 3FI3A 3U9CA 2FGIA 4E6CA 2X4FA 1T45A 1YWNA 4GT5A 2QQ7A 3ORNA 4AA4A 3QKMA 4AZTA 5JSMA 4TYHB 5HORA 2HW7A 3LFFA 5C26A 2J7TA 5BYLA 3SV0A 2E9NA 2OI4X 5GIOE 3FMLA 2C6TA 4DFUA 5E8YA 5CSPA 5JFVA 4KIKA 1J1CA 4I3ZA 3R8PA 2UZWE 3TDVA 3KULB 3Q2MA 4F08A 5HTCA 4LRKA 4BYIA 3LCSA 2NP8A 1J3HA 3SD0A 4I92A 3RP9A 2PMOX 3QWKA 5HX8A 2XIZA 4NWMA 2PUUA 4UBAA 4XEYA 1J7LA 3ZH8A 4ZZMA 2C4GA 3A7JA 4M0YA 3EFWA 3LM5A 4O96A 4FSYA 2H34A 4O4CA 2WHBA 4I93A 2JKOA 3GEQA 3A4OX 4R3PA 4DEGA 3AT3A 3EQCA 1Z5MA 2ZM4A 4HYSA 4I94A 5AP3A 2ERZE 4YJTA 4E5BA 3PWYA 4L7SA 1T46A 5EHYA 4WIHA 3HV7A 4ARKA 1WFCA 4RA4A 4UYNA 4B4LA 1UWJA 2ACXA 1TFFA 1QPDA 1WCCA 1H1QA 1V1KA 5M09A 2F9GA 5FEDA 5LVOA 4YZCA 2RIOA 4BDGA 3DXPA 4FV4A 4HGLA 3CR0A 3OHTA 4USDA 5FWKK 3TZMA 2YIWA 2PY3A 3FQEA 3QALE 1BL7A 5L2WA 1PHKA 4UX9A 2ZFYA 4DLIA 4FSNA 3HLLA 4QP1A 4O0TA 1TZDA 3ENHA 3R7IA 4AGWA 5I4NA 3ZFYA 5F95A 5FTOA 3PJ8A 2PVNA 4O0WA 5KX8A 2A98A 3EQRA 3CE3A 5CZIA 4DHIB 3PY3A 4YJNA 4EJ7A 3KRJA 4RWJA 2JEDA 4PDYA 4FYOA 3T3VA 2IVSA 3NRMA 2E9PA 3WZKA 3D4QA 2VTJA 5ACKA 1U46A 2AUHA 3TTJA 4LRJA 2XYNA 4F1MA 3PJ1A 4G34A 5TKDA 4BKJA 3HUBA 4G3GA 5C03A 3GCPA 3BQCA 3HZTA 3TKHA 4CFVA 1H01A 5C8MA 3LKMA 3AKLA 4ASEA 3O8UA 4XRJA 3PSBA 3WF6A 4Y72A 3MW1A 2B0QA 3R0TA 4RJ6A 4IAKA 1XHAA 4CEGA 5L8JA 4XH6A 4O0YA 3ORLA 5EM7A 5J9ZA 1YKRA 4GG5A 2PL0A 2XK6A 5A3XA 3L1SA 4FIIA 3ATSA 4JBQA 4K6ZA 4QMNA 4I5CA 3DAJA 4TWPA 2XK8A 3MS9A 3C0GA 2Z2WA 5HG8A 1UU3A 2ITPA 3GQLA 1W7HA 3OD6X 2OWBA 3VBTA 2B9HA 2X9EA 1HCKA 3PG3A 2GHGA 4XV9A 3V8SA 4AFEA 1OPKA 4WO5A 1JBPE 3CGFA 3PP0A 4OR5A 4F0IA 5KBQA 5M57A 3KF4A 4BCPA 4FV3A 2W17A 3N51A 4HNFA 1G8JA 4D2RA 2GQRA 4HVHA 4FVPA 3ZO3A 4IX5A 2EUFB 4BB4A 4DTAA 4FKLA 5F1ZA 4XP2A 4RIXA 2R3FA 4B9DA 2O65A 2ITZA 1U4DA 4MBLA 4R3RA 1H26A 5HESA 4IE9A 1OKZA 4FTAA 4EOKA 4AXDA 5TT7A 1TKIA 3HP5A 2F7ZE 2UUEA 1PXOA 1J1BA 1W98A 4AT3A 4I6LA 3VF8A 4EK8A 2W4OA 2R64A 4JMQA 2VWYA 3H10A 5BQ0A 3BHUA 4AW2A 3BBTB 2JKMA 4P90A 2YDIA 4WHZA 4Y83A 2YZLA 4NCTA 3VS2A 3QCYA 2XNOA 3I6WA 3U6JA 4NZWB 3EWHA 4MXAA 4DITA 1YW2A 2BIYA 2GNLA 3FLYA 4QP6A 1ZXEA 3QZIA 3I60A 5CXHA 5EYCA 4GT4A 3TTIA 4UMTA 4FKSA 4U80A 4MNEA 4BGGA 5M56A 3HVCA 4HVGA 4L67A 3O8PA 1TQPA 5K5NA 3AC8A 2ESMA 3QKLA 3E62A 4XJ0A 2IVTA 5EK7A 3W8QA 4BDFA 4MD7E 4OTWA 4M8TA 4WNKA 3R30A 1B38A 2IF8A 2R4BA 3QTQA 4I5PA 4PTCA 5CYIA 5EG3A 2W05A 4E1ZA 5FXRA 5CNOA 4UWCA 1ZMUA 4DH8A 3GU4A 3ZLXA 3PDTA 2P2IA 3D9VA 4OTPA 4UWYA 2QHMA 3KMUA 4JBVA 2YCSA 3DKOA 4ALWA 4EH8A 1OIQA 4O2PA 5EW9A 4FL3A 5E8ZA 3ODZX 2V0DA 5GNKA 5IMXA 3MPTA 3ZCLA 2XA4A 1BLXA 3OBGA 3EIDA 4IQ6A 3QCXA 3Q6UA 3QZGA 1VEBA 3RBWA 2BROA 4MH7A 4ORKA 4BBMA 3UOHA 4FT9A 4LGGA 3UIBA 3O2MA 1KOBA 3QD3A 2EVAA 2O3PA 2C5XA 3BU5A 4YTIA 4ASZA 5M53A 3S1HA 4CV9A 3FE3A 4QP9A 4TW9A 3O51A 2OG8A 1KE7A 2P33A 3G9LX 4IIRA 4YNEA 4O91A 3ZSHA 4U3YA 5K4IA 4USEA 3RK7A 1Q62A 2ITNA 2UW3A 3MN3A 1LR4A 2ITXA 3OMVA 4AAYA 4K9YA 5CF6A 4TWOA 1WZYA 4S34A 3BL7A 3G33A 3QD0A 4IAYA 5EW3A 4JDJA 4QMLA 3FYKX 4AN3A 3ULZA 3W0MA 3RWQA 2PZ5A 3LCOA 4EOMA 1ERKA 5KCVA 4S31A 4FA2A 4E20A 2W1FA 4AF3A 5HE0A 5JGDA 3O8TA 5BV3A 4O1OA 3ORZA 3PIXA 3DA6A 3G6GA 4OTHA 4YZNA 3IO7A 3SHEA 3VJOA 4MK0A 4RIWA 4FL1A 2KULA 3P78A 3U51A 1P2AA 2R3HA 2JIVA 3BCEA 1M14A 3PRIA 3QQFA 4XG8A 2UZBA 3OCGA 5FTQA 3W16A 5CU4A 4F65A 4EH2A 3C13A 3EFJA 3NS9A 2XARA 3R1QA 2ITWA 1ZY4A 5ANOA 4F70A 1DI8A 4O21A 2HW6A 4A7CA 3UDSA 5H9BA 1NXKA 3NIEA 1Z57A 4RJ3A 3ZEWA 4XG6A 3F3TA 4FVQA 3EB0A 2B55A 2YDKA 4FTKA 4G9CA 3UOLA 3VC4A 2FVDA 1YXXA 1CMKE 3ZFMA 1U59A 3ALNA 3P7BA 4FGBA 3F5XA 1YI3A 4IM3A 5CEIA 1QPCA 4PPCA 2C47A 4WUAA 4X2KA 3FY0A 4AS0A 1G8AA 2CKPA 3V04A 4RLLA 2J0IA 3F2NA 3R8UA 4EH7A 2X6EA 1Q3WA 2QONA 3E8DA 4I5MA 3KIOC 4PPBA 3BGPA 5CQUA 4ZSAA 3F2RA 5AFVA 4QMWA 1H24A 4C61A 4KNBA 3GENA 1OECA 2CJMA 3C4XA 5M4CA 1Q41A 2P0CA 3VAPA 4QDEA 3W8LA 1V0BA 3TV4A 5CALA 3V3VA 3COKA 2HOGA 2J0JA 3R28A 5E7RA 1LP4A 4DGGA 3LFBA 3E3PA 1IASA 1WBVA 3H0YA 4R7IA 5CI7A 3W2OA 4ANLA 4OAUC 2BFYA 2O63A 3H30A 4G6LA 3W0RA 3O50A 1GIIA 3SOCA 3FZSA 1GY3A 4KS7A 1Q8TA 2YIRA 4APPA 2XNPA 2XIYA 4X0MA 5CS6A 3ZXTA 4O22A 4M0ZA 3FKOA 3I1AA 3O7LD 4P5ZA 4E4XA 2QOBA 4JQ8A 4FNZA 2W4KA 3ZM4A 4TWCA 3WI6A 4D55A 3PVGA 2ZVAA 4O6LA 1S9JA 3QZFA 2HZ0A 2IW6A 3C4FA 1YOJA 2WO6A 3L9LA 5H8GA 5IA5A 3UVPA 3ITZA 1OZ1A 4BIEA 2IPXA 1MRVA 2VAGA 3Q9XA 4AOJA 1M17A 5CI6A 5BVWA 4NKAA 4J71A 5CY3A 3FZPA 1F5QA 2X39A 5CWZA 3RAHA 5H3QA 3S00A 3UP7A 3ZDUA 3E7VA 3RPVA 4DGOA 3SG8A 4X3JA 3C0HA 3MFSA 1M2QA 3E93A 3S4QA 3HDMA 3V5PA 1OIRA 3NEWA 5BVOA 1H25A 1PY5A 4PNKA 3I5NA 4F6SA 3CD8A 4M68A 4CYJA 3Q6WA 5CASA 3F5UA 1KE5A 4QYYA 2J50A 3LLAA 1FVTA 4BJJB 5A14A 4FKGA 4H39A 4GJ3A 5AIKA 2BZJA 3DBQA 5EM5A 4B6LA 1A9UA 3MH3A 3UIUA 5HZNA 3VUGA 4N6YA 4IX3A 3TZ9A 2WMRA 4BGHA 1U54A 4FSTA 5IA4A 3SKCA 5M44A 3LQ3A 3ZTXA 3ZBXA 1SM2A 3LJ2A 4FSWA 5AM7A 3LFCA 4ZTLA 4CCUA 1OBGA 4B8LA 1UKIA 2I1MA 1ZMWA 2O0UA 2F7XE 3GFEA 3WYYA 5IEYA 4BVUA 3V5TA 4EHVA 3QLGA 1RW8A 3FUPA 1OIYA 5CVGA 1TQIA 5GIPE 3HMOA 4D1XA 5TE0A 3A8XA 5HICA 4CZUA 3UNJA 2BVAA 1OM1A 2G1TA 1ZYLA 5KZIA 3W2CA 4AOIA 4EWQA 4Z7HA 5JQ8A 2LAVA 3SXFA 3MH0A 3CBLA 3QQKA 1H27A 4PL5A 5TOZA 3CJGA 3BV3A 2IZUA 4FTRA 4OTIA <