4O1MA

Toxoplasma gondii enoyl acyl carrier protein reductase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
303
structure length
297
Chain Sequence
b'PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAISFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title The benzimidazole based drugs show good activity against T. gondii but poor activity against its proposed enoyl reductase enzyme target
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 107
structure length 297
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4o1mA00
1M66A 1JKIA 4BO8A 1RM5A 3IAHA 3S2IA 1Q0HA 3VH4A 4B3HA 3FD8A 2Y1EA 4OQZA 1GEGA 1E1LA 5C3MA 1LNQA 2D59A 5DULA 3C3XA 2YY7A 2CZCA 4JJIA 3ZW8A 3IP1A 2BRUA 4AJEA 2BMAA 4CM6A 1EDOA 1LDNA 1MA0A 2W8ZA 3GEGA 2VTEA 4URFA 5DZSA 3GMSA 4YAIA 4ND2A 2PD3A 3L4BA 3GAZA 3CMCO 5J23A 4FOSA 4FR5A 5A02A 1PL6A 2ZCVA 4WLEA 4RDIA 5CEEA 1AXGA 2WM3A 5JSFA 4PGFA 5G0VA 3VTFA 1EFKA 3TZKA 5JFOA 3MZ0A 3QHAA 1F06A 2HJRA 2Y1CA 5LC1A 4XIYA 4PVCA 3FNFA 3W6UA 3DEYX 2IZ1A 3NGXA 3SJ7A 2X1HA 5JCJD 4GI2A 4ROSA 1AN9A 3I9NA 1VKNA 3K31A 1KVRA 2DTXA 4ZRMA 2X58A 1IPFA 3VH3A 3RC7A 1IHYA 1LQUA 3JD4A 4II3A 4NU6A 4LRSB 2Q2QA 4XZ3A 1T4BA 1YONA 2UAGA 5CFZA 1XG5A 4WEOA 3BYZA 4BNFA 1EDZA 4FPXA 2VWGA 1WDKA 3DR3A 3AOGA 5I9MA 3W1VA 4PLTA 2PWZA 4BNHA 1JAYA 2VHZA 2WMDA 3CZMA 5EQDA 3WQQA 2AG8A 1DIGA 1PQWA 3WYBA 3TQHA 1CEQA 1PS9A 1BDMA 5EINA 3JQDA 3KXDA 4JROA 4XDYA 4BNLA 3DZIA 4BHTA 4BIIA 1ML3A 3PLNA 3LYLA 4GSKA 2CF6A 2LDBA 3UW3A 4PIVA 2PK3A 3KSZO 1B0AA 3HWRA 3TFQA 3JYPA 5THKA 3GN2A 1KY5A 2XPCA 3ASVA 4S3MA 4FQ8A 8ADHA 4E3ZA 2EW2A 2HAEA 3ZDFA 1M6HA 1DBVO 3H7AA 4EEZA 1DIHA 4NMHA 4KUGA 2FMUA 4EZBA 3WNQA 4IS3A 2C54A 2ZIZA 3KEQA 4ZHSA 1QR6A 1KEVA 3N58A 3QWBA 3ZU5A 4BKUA 5ICMA 1G0NA 1U3VA 4MIEA 2EJVA 5KKAA 2WD7A 1N1GA 2O48X 1UDBA 3R0IA 3ZWOA 1XGKA 4NU5A 1ORRA 1Y81A 3OQ6A 3DBRB 3QSGA 4YWJA 3R1IA 4ZQGA 2B4TO 4PLCA 1IULA 3P2YA 4E5KA 4GLOA 4M1QA 4QXMA 4YQYA 2CY0A 4KQWA 4JCOA 4BGVA 4E2WA 2NV6A 1I24A 3DBLA 4YDRA 4HY3A 2JFFA 4PLGA 4YR9A 1R37A 2X0RA 5A06A 5I9NA 1Z82A 2BD0A 3FBGA 1HYEA 1LRLA 3RKRA 4I8XA 2EHDA 1LDMA 3I1JA 3DB2A 1P45A 4HBGA 4OXKA 3DHNA 4QUKA 5DBGA 1PQUA 5MGBA 4EJ0A 5JCJA 3DBHA 1R4MA 4AFNA 1DEHA 2WYUA 4RPKA 4FGWA 4OH1A 2EGGA 5CAEA 4AJLA 3OP4A 1DC4A 2NU9A 3RUHA 4MINA 4FFOA 2BI8A 1C14A 3WICA 4MPDA 1G0OA 3ZWNA 4I08A 4BNWA 3A1NA 1ZEMA 1V0JA 5LDGA 2WEKA 4EI2A 4IQ0A 4AG3A 4KOAA 4A2CA 3AI2A 2Z95A 2DM6A 3LF1A 5TX7A 4CM1A 1K6IA 3RD5A 1BHSA 4ESOA 4XYBA 3T7CA 5JMPA 1C0PA 2CNBA 3QJ5A 4I5GA 2QZ9A 1ZK1A 2YJZA 3NAQA 1E3WA 1LLCA 3OM9A 4IQGA 2VHXA 1D1TA 2PR2A 1LC3A 1EBUA 1X1TA 3EK2A 1ID1A 1KERA 4F3YA 4G81A 4IS2A 4B3JA 3RSHA 4XR4A 2A94A 4CLRA 4EITA 4XA8A 4OOFA 4R51A 4Q3NA 2V6BA 5BQFA 3INRA 4HADA 3DMTC 3O8QB 3F47A 1HZZA 1TI7A 2HLPA 4DBZA 4D3FA 2WD7B 1QYVA 5BR7A 2YV3A 5B4UA 3SC4A 4RVHA 1HRDA 4CLDA 5G4LA 4L76A 3PTZA 4IJVA 5CEJA 1YDEA 3NDIA 1NPDA 4L8VA 4I9UA 3DMTA 1H2BA 3HDHA 4IPTA 1O0SA 5A3JA 3LC2O 1DC5A 3UGKA 1O95A 3DBLB 4IDFA 4M8SA 1A71A 3H9GA 2DLDA 4L4SA 5COQA 3U4CA 1GUZA 4L0QA 4PG7A 3F9IA 3PZBA 5T5QA 5IN4A 1VL6A 4DBVO 1EEHA 4WKGA 3AM5A 4LCJA 4TKMA 2W2LD 1EVIA 1QXSA 1T2DA 2I3AA 1WVGA 8LDHA 5IZ4A 3DBHB 3VDQA 1SEVA 4YVFA 1V3TA 5EJ2A 2AQKA 3UXYA 1P1FA 1MG5A 1QORA 1BVRA 2GZ1A 3ZNOA 4DWVA 4R5HA 4ZQHA 1P44A 1HSZA 3O26A 3OMLA 5HTOA 1SCUA 1S6YA 3JQBA 2Y0CA 3QA9A 4Q39A 1BTOA 3ZWWA 4CV1A 5DNAA 2PFGA 3AFMA 1L7DA 3CMMA 3RUIA 3KO8A 2D3TA 1UDAA 4MVJD 4IDDA 4BNNA 2O3JA 2VT3A 5HWSA 2J3HA 3EDMA 3UVEA 4DVJA 3ENNA 3ZNPA 1A7AA 1E3WB 2IZZA 3RBVA 4CMCA 3NT4A 5JY6A 1H93A 4DLLA 5JPIA 1DHTA 3VPGA 4GBJA 5BSFA 5IAAA 5L45A 3U49A 1BVUA 1P1KA 3S1LA 4MVJE 3QVTA 4CLRB 3PEFA 3OETA 1BMDA 1DLJA 2F1KA 2V6FA 5CPFA 1GCUA 3W8EA 1W6UA 3CH6A 3JYLA 4R68A 3T7EA 4D3SA 3VKUA 1WXDA 3IS3A 3W4KA 4WGGA 3GVXA 2DC1A 2BFMA 1GTMA 3BMCA 3VHRA 1C1XB 1ZBQA 1O6ZA 3HSKA 4OM8A 5DT9A 4EJMA 4CQLA 1JKJA 2IE0A 4NNJA 3PWKA 2Q49A 3S55A 3WOHA 3D0OA 4JN6B 4N18A 5JE8A 4NFSA 3D7LA 4GQAA 4YT8A 3H9QA 1B14A 5TT1A 1B7GO 2OGUA 5TC4A 4A73A 3F5SA 3F1LA 3DOJA 4TZKA 3S2FA 3AUTA 3OICA 1PJLA 1PS0A 2QX7A 3DZKA 3X2EA 5JAZA 5HBRA 1JAXA 1VJ1A 3FR7A 4DUPA 3UHAA 3KEOA 1FDTA 3GFGA 4CMEC 3AU9A 1KETA 3L6EA 1FDSA 4R4JA 1NYTA 3UUWA 4TKLA 4D0RA 1T25A 6ADHA 3GVCA 2BFPA 3OEWA 1NQ5A 3AUAA 5EMHA 4CMBA 5TLSA 1A7KA 2W2LA 3LVFO 1BDBA 2Y0DA 3E5MA 3LK7A 4FBGA 3ONFA 1YOVA 1GZ4A 4ZJUA 3QIVA 4PZCA 4BNKA 5G0UA 4YPOA 1K6XA 1NQOA 4GVLA 5KVCA 3V1TC 4BO1A 3PFWO 4ONEA 4FS3A 3GDFA 2DUUA 4D44A 1ENOA 5FF9A 2YW9A 2NU7A 3Q2KA 4EUHA 3LT4A 1EUZA 1QLJA 4BO7A 1UP7A 3G0OA 1RKXA 5KVVA 4R9SA 5ER6A 3B70A 2JFHA 3F3SA 4OAQA 1UP6A 4WCDA 1B8PA 2B0JA 3TPCA 5F1PA 4MVJA 3RAJA 2P2SA 5FI5A 1H9BA 3D64A 3HE3A 4RVUA 4AL4A 1M76A 4NIMA 4BMSA 3PYLA 2BHLA 3A28A 1BXZA 1JTVA 4XQCA 2FPGA 1ZZEA 3BMCB 5IDYA 1X0VA 1E92A 3RUEA 2NVBA 5I7SA 4QT0A 1OAAA 5BSHA 2YQ5A 3B20A 1KYQA 1JLLA 3JQAD 4L73A 3RBZA 3VPHA 4RZIA 2GCGA 2FSSA 4CQLB 2X23A 3GC6A 4E33A 5JNLA 4PRKA 1GCOA 1ULSA 5KJ6A 3OJOA 1C0KA 3GVIA 1TLTA 3IKTA 4WCFC 2EEZA 3G79A 1BG6A 3JQ8A 4E32A 4P8RA 3GR6A 1HE4A 4BNMA 3RASA 1Y8RA 1DHRA 1OZAA 4KZPA 4HNHA 2AEMA 3HQ4O 3UICA 4KUEA 3VAZA 4LSWA 2C0CA 5L3ZA 3BMNB 3MJ4A 2QYSA 4LISA 4WCFA 4ZVVA 1VL0A 1MGOA 1X15A 3KYDB 3RUFA 2Q46A 4LK3A 1ISMA 2CSUA 4EUFA 4RZHA 3H5RA 4OHUA 5CG2A 3DWFA 1V3VA 3MTJA 3P7MA 1D7OA 2YFHA 4HX5A 3PK0A 4CUKA 1YOVB 1RM0A 1I3LA 1KC3A 3QWFA 2Y66A 4ZQBA 3WBFA 3P5SA 2EXXA 4YT4A 5T67A 3STHA 1KC1A 1LA2A 2CVQA 3FWZA 2HDHA 4OJNA 1I8TA 2D5AA 3NJ8A 4U5QA 4BV8A 7MDHA 5U9CA 4MKZA 3C7CB 3OH8A 3UCEA 4AVYA 2QG4A 4IIUA 1F17A 3SJUA 4CODB 3A9WA 4UVDA 1P3DA 3DHEA 1HYHA 3ICPA 4Y8VA 1IZ9A 2FSVA 3AY6A 1N9GA 2CMDA 3GEMA 4G2NA 5EESA 3FPCA 5A5FA 1ZJYA 1KS9A 1MFPA 1SO8A 1U4SA 2YQ4A 4Q9NA 1E6UA 5G0TA 4B8ZA 3UOGA 4EGFA 5BNTA 4FW8A 1H6AA 4RCVA 2Q1WA 2VHWA 1I5RA 2VOJA 2FY8A 4I9NA 1IOLA 3VPXA 1T1RA 3ULKA 1MXHA 1NTOA 3SVTA 4D45A 2NU8A 4ID9A 2P9CA 2WYVA 3GFBA 5JAQA 3MOIA 4GSLA 1GYRA 3KLMX 2B37A 2BGLA 2VNSA 1JN0A 4AJ2A 1X13A 3JQ8B 2I9PA 2DBZA 4YYZA 3G17A 4CR8A 1XELA 2TMDA 1Y8RB 4KWHA 3RKUA 4DTIA 3JQAA 1OOEA 5B4VA 2D5CA 3EYWA 3ZWPA 4ZRNA 3ANLA 4JP3A 4IDEA 1JWAB 4OXYA 3VTZA 4NJOA 1MB4A 2GO1A 4WCFB 3GDOA 2CVZA 3BTUA 2NVUB 3L77A 3M6IA 5HS6A 1BGVA 2CDBA 4F45A 2JJYA 4OO3A 1B8VA 4CUJA 4UREA 2V65A 3FI9A 4XGIA 4XKJA 3FHLA 2VUSA 1QV7A 3I9KA 3WSVA 4S1VA 3QY9A 3VH1A 1A4UA 1NFFA 2PGLA 2FPPA 3AI1A 4Y6PA 4YA6A 2HO5A 4I9HA 3AOEA 3IIEA 4DC1A 1FMCA 2O3QA 4GMGA 2R00A 1OI7A 2VCYA 3LDHA 5KJ1A 3RCBA 2PKQO 4W82A 1PJ3A 2DFDA 3VKVA 4MKXA 4J4TA 4NQZA 1Z75A 3OEYA 1MX3A 4Y98A 5TJHA 1ZKMA 1TT7A 3M2PA 2GGSA 1LU9A 1E6EA 3BHMA 1UUFA 4RGBA 4JXKA 5COBA 1V8BA 4P4LA 3B1JA 3T4EA 5HS4A 1E5QA 4J6FA 4J1QA 2DBVO 4CJXA 4GL4A 3EZLA 3H6KA 4Z9XA 3ZU2A 2GERA 3RIHA 1P0FA 4Q3CA 2FWMX 2IXBA 3NRCA 4E2XA 4F6LA 1DJNA 2AQIA 4JJGA 3GHHA 1QKIA 4TRRA 3FF4A 3GZNA 4IDBA 1ZJZA 1CDOA 3JQGA 3L07A 2UUOA 4J0FA 4IQ8A 5A4DA 2PZMA 2YFQA 1ISIA 3JQAB 4WLUA 4BOYA 1U8XX 4HFNA 3JQFC 4GH5A 2JFGA 3AK4A 2AEJA 2GF2A 3HB5X 4LSMA 4PVDA 1TB4A 2X8LA 2J3IA 1R15A 4AJKA 1O94A 4NR0A 1TEHA 1P1JA 1PR9A 1J4AA 4XJSA 4B3IA 1MV8A 4P22A 3WGYA 3JQFA 4PLPA 1NWHA 1K3TA 2HCTA 3JQ9C 4FOOA 1GAEO 4IM7A 4E6PA 1NM5A 2AE1A 1M6WA 3OSUA 2NM0A 4WASA 4HV4A 3QVSA 4PZDA 4MP8A 3GG9A 1JVBA 3HN2A 1LDYA 2E48A 3F4BA 3G1UA 2VZ9A 2GLXA 3OA2A 3H8VA 5BNIA 3JQ9A 2YV2A 3I4CA 4JX8A 4R1UA 3C1OA 3GUCA 2NNLD 2PGJA 3OHSX 4HFMA 3A4VA 3IUSA 3V5NA 4FFLA 3GEDA 4CM5A 5AQ1A 4YJHB 5ER9A 3EHEA 3RC9A 4GKVA 3ZU4A 3MJVA 4LN1A 3EC7A 5JCXA 3AUUA 2C5EA 2P9GA 3AM4A 4XYLA 2XF8A 1U7HA 4E13A 1HDZA 3CEAA 1KEPA 1ZO8A 2OORA 2GZ2A 1O9BA 4K1LA 3GZNB 4CM3A 1B26A 1CERA 1U28A 1F8GA 4BUCA 1N7GA 4FIZA 3JQGB 2GN4A 3TJRA 5KKCA 2LDXA 3E82A 3IJPA 1YQXA 3JD1A 2GNAA 3GDGA 1GUYA 4NBWA 2EW8A 1UZLA 3ROKA 1U5AA 3TOXA 2OHXA 4DL9A 4K6FA 4DC0A 1VC2A 3H9EO 4RDHA 4BKOA 1HLPA 5COAA 1IY8A 4ALKA 2D8AA 2ET6A 2O3RA 2X0NA 5KJCA 3P2OA 1B3RA 4DLAA 3BHIA 5K6AC 1C1DA 4ALJA 5BT9A 5C37A 4ALMA 4WK6A 3R3JA 4IMRA 4H3VA 1Q0QA 2OOSA 2Q45A 5CDTA 4Z3DA 4RVSA 3ADPA 3OFSA 4Q3AA 3WIDA 4R01A 5L95A 3DAPA 1WW8A 1XCBA 1FDVA 1FJHA 1NPYA 3DZFA 5K6AA 2VYVD 1JW9B 4BO5A 4UUPA 1K2WA 3INTA 3RBXA 1DAPA 1WDLA 1BRMA 3CZRA 5TIIA 1XWFA 2NU6A 5EPOA 3ZCXA 2GN8A 1T1SA 1HE5A 4WEQA 4R9RA 4OKIA 5DBIA 3I5MA 4GKBA 1DB3A 3V8BA 2C20A 1E3LA 2NUAA 3HG7A 4A27A 2PD4A 2CFCA 2FR0A 3BMOA 5F21A 4A0SA 3DZGA 3U4IA 1QYWA 4GX1A 4PG4A 4BV9A 4Z0HO 3U9LA 5DP2A 4CPDA 1NFRA 2P9EA 2NQTA 3ITDA 5JYEA 2ZTVA 5AXDA 3MJSA 4E21A 3PHHA 3TZCA 2GSDA 4HFRA 4RL6A 3FN4A 4JBIA 4RPHA 3IKVA 2AQ8A 1I01A 4MP3A 3WS7A 4QX6A 2RCYA 3AM3A 4MVJP 3HZZA 4BO2A 3RU9A 4BGUA 3D5TA 3LZ6A 1CF2O 1WLYA 1I3KA 3GGOA 2BGMA 1TT5A 1HDYA 1ARZA 4CM9A 1WZEA 1E3JA 4OMUA 5H81A 2PLAA 1BWSA 4PZEA 1VI2A 2ZATA 2EKQA 3HUDA 3ZNNA 4Y9DA 4L75A 4YRBA 1I2ZA 4GX5A 5L7YA 5TJ9A 3RI3A 3ETDA 1L1FA 5EN4A 5K9ZA 1SBYA 1C1DB 4F6CA 3WGIA 3E18A 4XYGA 4YRDA 1DIBA 2VHVA 1Q2XA 4GPD1 3KYCA 1P77A 4J9UE 1PGPA 1GFSA 1YE3A 1NPTO 1A9ZA 1CJCA 1QV6A 2F00A 5IN5A 5ILOA 4WLVA 4JP2A 2AG5A 1U2DA 2HJSA 4B8WA 3X2FA 1YB4A 4CLHA 1SC6A 1I36A 2VWPA 3ON5A 4L9RA 4M87A 1G1AA 2C2YA 4WLNA 5G4KA 5JW6A 3FRJA 3SLGA 3C1TA 3VZRA 2PZLA 4AJNA 4X54A 3TNLA 5ICSA 3V2UA 2GPTA 4WECA 2CDAA 1C0LA 3W6ZA 3K2EA 4YQZA 5L53A 3WBBA 1EE2A 2YV1A 3NDJA 2VZ8A 2BGKA 2X4GA 3E9QA 1EVYA 2YUTA 5IDQA 3IDSA 2VYVA 3ASUA 2YDYA 2Q1TA 4FDAA 1VL8A 1LLUA 1GD1O 5JDCC 4P4GA 4RJTA 1MC4A 2AQHA 4DRYA 2Q50A 2WJPA 1CQIA 2CUKA 4PFJA 2Y67A 2HMTA 1HYGA 2EERA 1ADGA 1CRWG 1R0KA 3C1AA 3Q6IA 2P68A 1DSSG 1M67A 2JAHA 4W6ZA 2QHXA 4G5HA 3W8DA 1JQBA 3GG2A 3O03A 3D4OA 3GT0A 1LLDA 1IUKA 5IXYA 4A26A 2ZJ0A 3DDNA 3MEQA 4J2HA 5GZ6A 5JDCA 4CLEA 1PGOA 2YYYA 5CEFA 4H15A 3TFOA 4TSKA 2EP5A 4UUNA 5IXSA 3TZHA 1DJQA 2X22A 1N1EA 4YJFA 1NHWA 2C59A 2X7HA 2AHRA 3U0BA 4F46A 3H3FA 1PZHA 4E5YA 3FTPA 4JQCA 3IOYA 3VC7A 1DFGA 1JVSA 1CETA 2NTVA 3G49A 1D3AA 1KBZA 1SOWA 3Q1LA 3ZN2A 3DZBA 1LDBA 2Y1DA 1AUPA 3A14A 1UXGA 1UJMA 1P31A 4P4NA 1M75A 5KIAA 1PL8A 2FR8A 4RQUA 1C0IA 3HHPA 3LT2A 4IIVA 2GZ3A 4RQTA 4BGIA 1UXJA 4I5EA 4DPLA 1B16A 1PJCA 5TS3A 2OP1A 3IJRA 4GAEA 5THQA 2Y1GA 3TDKA 1R4MB 4FSHA 2NTNA 1T24A 3VVBA 4JJFA 5I9LA 1TA4A 2EJWA 2HSDA 4XQ9A 1W0CA 5G4KB 5JAIA 2PH3A 2O4CA 4D7AA 2W90A 2NWQA 2VRCD 4CL3A 1M2WA 3OJEA 2PH5A 1KEWA 3NT2A 3VDRA 3VH2A 3WNVA 2HU2A 3ITKA 4FCCA 3SC6A 1DRWA 3JD0A 4PLZA 1G6KA 1SNYA 2HMVA 4R41A 2VYND 2W2KA 5L7WA 1I33A 1ZSNA 4FFRA 4BB5A 2I6TA 1PZGA 1KVTA 2QRLA 2GASA 5CDGA 2G5CA 2Q4BA 1BW9A 4FJ1A 4Y67A 2OL4A 1XA0A 2OMEA 1I3NA 1B15A 5IFLA 2ZJ1A 3BA1A 2E49A 1UR5A 4XJTA 1GY8A 5ILGA 4DMLA 1HXHA 3H9UA 4BQPA 2YZ7A 4QO7A 3KBOA 3VOSA 1A5ZA 3GQVA 3ZV5A 5G2OA 3QW2A 1OMOA 4GLLA 2H5LA 1O89A 3QVOA 1H0KA 3LQFA 1QRRA 4MVJG 2R6JA 1PIWA 4YJFB 1UXIA 1ZK0A 4IXTA 5BNFA 1JA9A 1WP4A 3PQFA 3DL2A 4YAGA 1MG0A 4UULA 2J5RA 1TXGA 3OQ1A 3ZWBA 4ZQEA 1FDUA 1UP4A 1S7CA 5I8ZA 2WTBA 1J6UA 2ZYDA 2A35A 2D2IA 2P91A 3BAZA 2ZQZA 5IDXA 3NYWA 2Q1UA 4FJ2A 4NZ9A 1R6DA 4QTZA 3FR8A 4Z9YA 4N5LA 1E7WA 3KSUA 5EQFA 3NX4A 4DIOA 2ZB8A 3GOHA 4BO3A 5MDHA 4XEHA 4OSPA 3ZV3A 4BKRA 1DDOA 1HE2A 3WGOA 1P9LA 3V2GA 3MJEA 1LDGA 5EIOA 1DXYA 1PJSA 1ZFNA 3GUYA 1XQ1A 3K6JA 3BHJA 4ITUA 4E5NA 1MUUA 5ITVA 4N7RA 3WJ7A 1ZXBA 1E3EA 4OIMA 1E1NA 2IXAA 2Z1MA 2X9NA 4CMEA 1UAGA 2I67A 5I7EA 2X5OA 1VJTA 2EF1A 5FFFA 3ZWMA 2A9FA 1H5QA 2C5AA 2A92A 4JNKA 2C7VA 3Q11A 4IUYA 3E9NA 3JD3A 2VRCA 1BW9B 3K30A 4Z0TA 2EP7A 1YBMA 2E4AA 3RQSA 2VWQA 3I9LA 4PLHA 4B4VA 1DOHA 1U3UA 3FNGA 2VYNA 4W9NC 5F5NA 2I5PO 4NK5A 3WTBA 4M86A 3RC2A 7ADHA 1HF3A 4ZQFA 3O4RA 3QWAA 5G0WA 3A06A 4TROA 3EVNA 3TN7A 4Q3DA 2CD9A 3PXXA 1UDCA 1NR1A 1ZW1A 1UAYA 3IQDB 3I6QA 4TWRA 1W4ZA 4R69A 5ES3A 3WMXA 1PJ2A 4M89A 4W9NA 2B36A 5KJEA 1PJ4A 2UYYA 2G17A 1DRUA 4CM4A 5TF4A 1Y5MA 1DAOA 2BFAA 3DC2A 3LT0A 4ZD6A 1DFHA 2HQ1A 4A7PA 2YHIA 3KYBA 1UXHA 2BELA 2I99A 3RVDA 4C4OA 4J3FA 1T4DA 3DOCA 1GR0A 4CR7A 5B12A 4LMRA 4RVGA 4UAGA 3R6DA 3JYQA 3KUXA 3RC1A 4RF2A 1VJ0A 3RROA 3L0DA 1Y9EA 3OECA 3IMFA 1VSUA 2OBYA 2HMSA 5CHEA 4AICA 2G1UA 5TT0A 4YEDA 1Y6JA 5L7TA 5FYDA 3WQSB 1H6BA 1YQDA 4FFPA 5L4NA 1NVTA 3G3EA 2B83A 2J3JA 1WNTA 3AI3A 3FPLA 4EJ6A 1GYPA 1XIVA 1DC3A 1HLDA 4UEKA 5JC8A 4RLSA 4AJOA 4DA9A 1LDEA 3HDYA 1YDWA 2DAPA 4MVJM 4IDCA 1ISFA 4NDNE 3TWOA 1EVJA 1E0DA 1NVGA 1HDGO 3TZ6A 1OC4A 4BNTA 2NSDA 4B4WA 2PZJA 5JAMA 2GD1O 2NADA 3QV1A 1E5LA 1JDJA 5CP8A 2B69A 4II2A 1E6WA 1E1MA 3DZHA 1W8DA 3OJ0A 1D1SA 1IHXA 3I9JA 4K6CA 3GNQA 4KP7A 4WOJA 4E12A 1HKUA 4O63O 4U7WA 3EVTA 4HP8A 3I9OA 3VVCA 1U7TA 1AE1A 3K9QO 1YJQA 5JY1A 3DXFA 4WUVA 4ND4A 1L7EA 5TQVA 1YWGO 3QQPA 5KJFA 4CLOA 2GR9A 3KRTA 1N7HA 1R0LA 2RH8A 2FRDA 2Z1NA 3JSAA 1Z6ZA 1YBAA 4EEXA 4E2YA 4PCVA 4U6SA 5A9RA 2DPHA 3PQDA 4J0EA 4KUHA 2O3UA 4R54A 2C82A 2DTEA 1R16A 2BKAA 1Y8QA 4NBVA 1ISHA 3UN1A 1YXMA 2IODA 2FHSA 3VPFA 1OC2A 1V3UA 1F14A 2FZEA 1N5DA 4RLHA 4YAEA 4A5OA 3MWEB 3DBVO 3NUGA 4MKRA 1KVQA 4D0SA 4CV0A 4EDFA 5C7LO 4M54A 2VNAA 1DIRA 4E5PA 4BMNA 3WR5A 3WB9A 1EFLA 6LDHA 1GQQA 4J1NA 3ROPA 3BXXA 4GGPA 1XKQA 4B7UA 4RVDA 3DFZA 1HZJA 5A5EA 4AJHA 3L6OO 4TVBA 1J5PA 5KVSA 1NVMB 4BB6A 5F1OA 3CE6A 3H65A 4RF3A 4KTTE 4HXYA 4NHEA 4CMJA 1X14A 4I5DA 3DTYA 4NBRA 3AJRA 4WLFA 1N2SA 3HDQA 4BS9A 4OQYA 4Q3EA 1GEEA 2H9IA 4UVIA 4ZICA 4N5NA 9LDBA 5KWEA 1SB8A 1NQAO 2I76A 4RPLA 1SAYA 3KLPX 4O59O 4CUZA 1XU7A 4XQEA 3RUCA 4ZU3A 2PA3A 4LMPA 3T4XA 5IJZA 3F1KA 1X1EA 3PDUA 3LC1O 2H1SA 3VZPA 3GNTA 2GRAA 1RM4A 2C2XA 4D3DA 4PG8A 3WGZA 3UFXA 1AHIA 1O5IA 3RFTA 1VPDA 3C7DB 4TMFA 2JL1A 1NWCA 4H16A 4OXNA 4DQUA 3QRWA 1BXKA 2AXQA 2JCYA 3EW7A 1DPGA 3NEPX 2OO5A 1N9GB 4HNGA 3P19A 5FI3A 4J4HA 4KDEA 2DQ4A 3M2TA 5AXAA 1ADCA 2JAPA 4UVHA 4CMGA 3ANMA 4TVOA 2WD8A 1SEPA 3FNHA 4K26A 3S2EA 5I7VA 4QFCA 1PJQA 1WMAA 2XOXA 3OIGA 1PWZA 2Y99A 2AW5A 1E7YA 1E7SA 4QECA 1V35A 1UZNA 3C8MA 1K0UA 3I23A 4RORA 2QZZA 3H3JA 4XIJA 4PRLA 4U6QA 3KETA 1WPQA 2ZK7A 2ZTUA 1FK8A 4DYVA 4KMSA 2JD0A 1P1IA 3B1KA 5U1PA 4BO6A 1EBFA 1P1RA 5DCYA 3C7AA 2ZYAA 4NBUA 3PGXA 3WYCA 4ALNA 1ZK3A 5FWNA 1IZ0A 4IZIA 1I3MA 5GMOA 2ZQYA 3ZZNA 2AA3A 4IBOA 1P33A 1U4OA 1EMDA 3AY7A 4D42A 1PTJA 2EKLA 1D4FA 4R3NA 1ISJA 2OZPA 2HUNA 1YVEI 4I5FA 4E2ZA 4E5MA 4PLWA 2JCXA 4XQGA 3GPIA 4XRGA 1ULUA 2HKIA 1EUCA 1KVSA 3PJFA 2QRKA 1A27A 3JQ7A 4EW6A 3HDJA 5IF3A 2DPGA 2DBRA 3H5NA 4QQRA 4XB2A 3WLFA 1KY4A 1LEHA 2HMUA 2CF5A 3BIOA 2O2YA 4WOKA 4OL9A 2VT2A 1PU2A 1U3TA 1X7GA 3D5QA 4OYRA 5AYVA 2X6TA 3ZWXA 4CV3A 1YO6A 2EWMA 4J9VA 3SLKA 4NI5A 5CDYA 1ZVMA 3L4SO 1PWXA 3M1LA 4CM7A 4BNVA 1F12A 4RV9A 5DCUA 5TRTA 1PX0A 2ZKLA 1T2CA 1EUDA 4LVCA 4MOWA 3ABIA 1LTHR 2POQX 2O3SA 9LDTA 2OBNA 3E1KA 2PNFA 4Z3KA 2EKPA 3HADA 1P0CA 1ZNQO 2NQ8A 3AFNA 4UEOA 1NAIA 1V6AA 2FZWA 3GK3A 2DFVA 1PR3A 1T2EA 3CINA 1GL3A 1XYGA 2G76A 4CM9D 3W4IA 4BNXA 3U3XA 3L4BC 2VQ3A 3JTMA 2FN7A 3WMWA 4HWKA 4XYEA 3WXBA 4J49A 2WE8A 1E7MA 1RYDA 4I1IA 3COSA 4JK3A 2WDZA 4XD2A 5A3VA 1PGNA 2O23A 2X0IA 4GWKA 1DRVA 1Q7BA 2GUGA 3U09A 4ND5A 4XGKA 1IB6A 3RFVA 4ZN6A 1DIAA 4UEJA 3EAGA 4XCVA 1K6JA 5TNXA 2P4HX 3ONDA 2B4QA 4Z9FA 2RBEA 5F5LA 3ZWVA 1IPEA 3QWIA 5TGDA 4B4UA 3DBRA 2O7SA 4J2OA 1PJBA 3FCOA 3JQCA 3PWZA 3WGGA 4E4YA 5JBIA 2NVWA 4QEDA 2ZTMA 2I3GA 1Z7EA 3PWSA 4GGOA 2HRBA 3DHYA 3ETGA 1E3SA 4DREA 3JQ7B 3UKOA 3ROMA 4UUOA 3MOGA 3WGTA 2JD1A 4IJKA 3GHYA 4RF4A 4DQVA 5A04A 2DBQA 4KQXA 1MLDA 3KM0A 4K28A 2AMFA 3WFIA 1ZMTA 3CKYA 3SXPA 2D4AA 3E5RA 3JD2A 2DKNA 2EGHA 3PJDA 5CPBA 4YBZA 3KZVA 1B8UA 1A4IA 2BI7A 3DOOA 3OJLA 4JGBA 1ZIDA 4ND1A 3RFXA 5GZ1A 2P5UA 2PY6A 4PLFA 3PHJA 4A03A 4WJZA 2V6MA 3JCZA 4PG6A 5IG2A 4BNIA 3JYNA 4AJJA 1LRKA 1Z45A 2Y68A 4PLVA 3KSDO 3FWNA 1VM6A 3GF4A 5T6BA 4BO0A 5L40A 1GZ3A 1LSUA 4U8GA 1LSOA 1WWKA 3HB4X 4XRRA 1U8FO 1SOVA 3PIIA 1WAMA 3EMKA 3PJEA 1PJTA 3F6YA 1T2FA 2J6IA 1NX6A 4CM8A 1T26A 4PG5A 1EVZA 3ZW9A 3UCXA 2OFPA 2PV7A 3ZNQA 1HDXA 3GN1A 5A03A 5B4TA 3E03A 5L4SA 2WSBA 4ZA2A 5HA5A 3CSDA 2Z5LA 3H5AA 3O8QA 2V6GA 4IY1A 1ZEJA 2BFOA 3GPDG 3K5PA 4FD3A 3H2ZA 4CL8A 4RPGA 1Q7GA 2VUTA 2E82A 2VOEA 1OBFO 3NTOA 1K5HA 3GAFA 4MP6A 5KNLA 2NACA 3GRKA 1HE3A 1ZK2A 1J0XO 2JD2A 1ZXLA 4JLWA 2BH9A 4Y6RA 4TRMA 2Q4EA 4IDAA 1KOLA 5LCXA 3MTGA 3JV7A 1NAHA 4O6VA 3CPSA 3E6AA 3IC5A 1X7DA 1LJ8A 4G65A 3IP3A 3RUDA 4U0JA 1YJ8A 1GQ2A 3ZWYA 5CG1A 4XWYA 5IDWA 4DIBA 3Q0EA 5ADHA 4WNIA 3KOUA 4H7PA 1B2LA 2QQ5A 2YDXA 1LSSA 4D43A 1Y5RA 3ZHXA 4AJ4A 4D79A 3AUSA 5DBFA 4CMKA 3WQRA 1PS8A 1HL3A 1LSJA 1YH3A 1X7HA 4CMAA 5JMWA 3PJGA 3B6ZA 2PKRA 3BMOB 1U2GA 2EG9A 2IYOA 2OXIA 4D41A 2JCVA 3I83A 5LDHA 4BKQA 1N8KA 2ZB4A 4DLBA 4IDGA 4QFDA 3Q9NA 1HDOA 5DOVA 4J91A 2C07A 3PYXA 1AHHA 4BQRA 1I0ZA 4INAA 4DXHA 4BNYA 4YAJA 4D46A 3GZ4A 3KV3O 4DPMA 4HUJA 4YT5A 3DQPA 4N5MA 1GV0A 5F3RA 3OF2A 4CM8B 1RWBA 4LRTB 4FN4A 3FSRA 4J43A 1E7RA 2O2SA 3AU8A 3WWZA 3NGLA 1TT5B 3WIEA 3O9ZA 3D3WA 1NASA 3ZHZA 2WE7A 3PHGA 3Q3CA 2E6UX 1UH5A 2HK8A 2AEFA 2I66A 4GVXA 3GVPA 3H9JA 1K89A 3FNEA 1R0SA 1IYZA 3U4HA 4OSOA 3PIDA 3LLVA 1CQJA 2XXJA 4HFJA 1GV1A 2FR1A 1C1XA 1HSOA 3ONEA 1XR3A 5DDIP 3MWDB 1U5CA 1XU9A 3GMDA 4FFMA 3KYCB 3LT1A 1Q0LA 4CMIA 2H6EA 1SZJG 4IINA 4IMPA 3ZWCA 4FC7A 1XLTA 3GY0A 1SB9A 3PLRA 4U0KA 2WWRA 2HMWA 4YB8A 1H9AA 3Q2IA 1DFIA 4GMFA 3QE3A 3RU7A 3WLEA 4BNJA 3NTQA 1D8AA 5L51A 5KVQA 3V1YA 5GZ3A 1HDCA 1YRLA 2QYTA 2Y1FA 4MO2A 1HDRA 4WPGA 4XYMA 4K9DA 4YAKA 5JC1A 1HT0A 2VWHA 3PYMA 3JQBC 3OIFA 1P74A 5TSDA 2J3KA 3F46A 4Y6SA 2Y05A 4DQXA 1QYCA 3C24A 4XR9A 1UZMA 2G0TA 5DP1A 1EK5A 3F5QA 2PGDA 4HKTA 4EBFA 1HEUA 1Y7TA 3SX2A 1ISGA 4LVUA 5KOIA 3PVZA 2RHCA 3OBBA 2ZB3A 1PGJA 3U62A 1Q1NA 3H4VA 5DF1A 4B4OA 1O8CA 3UH1A 3HN7A 5DOZA 1PEDA 3WDSA 3LLSA 1E7QA 4QO8A 1YS4A 3QLJA 3K2BA 2GYYA 2IZ0A 3KHUA 1T2AA 3ZH2A 4CLXA 3U4DA 3WGHA 2O4UX 4ZGWA 2DVMA 1VLLA 2FPIA 3EUWA 4R3WA 3I3OA 1FDWA 4UUMA 2IEBA 4E31A 1E77A 5AXCA 4RF5A 1ZUD1 3I52A 3OA0A 1PQPA 1ZH8A 3DAGA 3DO5A 4ALIA 3D3WB 3ORFA 1HETA 1ZK4A 1J49A 3G1TA 3FTNA 1YGYA 5G0SA 3E8XA 3MCVA 4TRJA 1E3IA 4Z6KA 4R16A 3OQBA 3BTVA 4RPJA 2DTDA 1DO8A 1Q7CA 2J5QA 3NV9A 5DCWA 1GDHA 4IJUA 2CDCA 5AVOA 3W4JA 3BTSA 1PL7A 3PZRA 1PZEA 5IZCC 1VSVA 4TZTA 4CMIB 4EUEA 1H2HA 3QVXA 3GVHA 4J1TA 3D4NA 3N7UA 2DUWA 5CDUA 4JBGA 3AW9A 3AWDA 1FF9A 4GX2A 4AJIA 3CXRA 3ANNA 3GH3A 3S2GA 1XEAA 3BMQA 1FXSA 4BO9A 4GX0A 5HRUA 1GUFA 5JS6A 2EV9A 1VE9A 1NFQA 2Y1OA 3BZUA 4IGEA 3NT5A 5IZCA 3K96A 4E0BA 1PGQA 2X5JO 3DTTA 1JWBB 2ZB7A 2FP4A 3ZHYA 3UF0A 3WYEA 1VKOA 3BMNA 3W8FA 4MIOA 2W2KB 3GGGA 2O3TA 2RHRA 2IYPA 3HFGA 3KYDA 1GPJA 1SMKA 5T64A 4CQMD 2JHGA 3F4LA 2QRJA 4BVAA 1SPXA 4FGSA 4ALLA 1ENZA 3AY3A 2ZTLA 2JKVA 2PD6A 2VN8A 1KIFA 4MJLA 3R3SA 4CMHA 2VUUA 1N92A 5C7OO 1R4NA 4J1SA 1AGNA 1RJWA 3NDRA 1BXGA 1EZ4A 1VRWA 2Q99A 5ITWA 1GADO 2UUPA 1HWYA 5A05A 1YL7A 2R2GA 1TVEA 4Q3BA 3ZV6A 3GRPA 2PTGA 1QYDA 3ST7A 1GYQA 4TRNA 4IZHA 1LBEA 2ZYGA 3LC7O 5U4QA 1ZMOA 4A10A 4ND3A 1WMBA 3E48A 3TRIA 4J16A 3UAGA 4MIYA 1XSEA 1EQUA 1YB5A 3WJAA 2VHYA 1EK6A 1LQTA 4YTEA 1LC0A 1I2CA 5L4LA 3WTCA 1ADBA 3LU1A 3ENKA 1I30A 3UCFA 4BNGA 4QSMA 4XB1A 2UVDA 3L6DA 1ONNA 3KTDA 4AJPA 1I2BA 2D1YA 2PZKA 1XDWA 5ENVA 4M49A 1ONOA 4LCEA 3TL2A 4J7XA 2UV8A 1JKFA 5T8KC 1YBVA 3GLQA 4TQGA 2HRZA 1NHGA 3PP8A 4NH4A 1LX6A 1V9LA 3BMQB 2I65A 2EIHA 2Q3EA 5C7IO 3O38A 3LF2A 4J7UA 3V2HA 4YT2A 1IE3A 4ILKA 4NBTA 3MJTA 5ENDA 3N74A 2X9VA 4MVJH 1Y9AA 4UVGA 3I9MA 4W4TA 5A9SA 5T8KA 4XGNA 1ONPA 1DLIA 2NVUA 1CWUA 3PQEA 2B5WA 3GGPA 1NBOA 3WSWA 1CYDA 1E1KA 5KTKA 1LXCA 4MDHA 5JYDA 1EE9A 4LGVA 4YACA 2X5KO 3PPIA 4PLYA 2FOIA 4W7HA 5I8WA 2HK7A 1P1HA 1ZSYA 4WE3A 4DIFA 1GQYA 4XDZA 2VTDA 1R4NB 4CV2A 1A72A 4DPKA 4CQMA 4JIGA 2TMGA 1H6DA 3K8ZA 1BXGB 3TL3A 3PFFA 4J90A 4BKPA 1CIVA 3DONA 4R1TA 4DYDA 3WGQA 1F0YA 1YKFA 1LI4A 2D0IA 1LRJA 3M1AA 3EGOA 3ZV4A 4B7XA 1Y1PA 5B1YA 1MXFA 1RPNA 1R12A 2B5VA 1I32A 3KVOA 4BNUA 3CIFA 1F8FA 3OIDA 4L4XA 4L4RA 2DT5A 1I10A 4W99A 3ZU3A 4CM4B 2B4RO 3JQEA 2YHUA 4R5MA 1LUAA 1KVUA 3PRJA 3RUAA 4C7KA 4E30A 5K0ZA 2GDZA 1QP8A 1WDMA 3WWYA 4LW8A 2YHIB 2Y0EA 4NFYA 4NFHA 5A9TA 4BL5A 1PSDA 4P38A 4KWIA 5BSEA 4UVEA 3ZGYA 3H2SA 3IL2A 1A9YA 4KDFA 5H82A 3DAFA 4BO4A 5L9AA 2J5KA 3TF5A 1RM3A 4C7JA 4AJ1A 1NNUA 4YJGA 3TOZA 3GA0A 3I6IA 3GNSA 2X9GA 1GZ6A 2RAFA 1ZCJA 3LSYA 2OUIA 4NJMA 3VZSA 4O0LA 3D4PA 2Q2VA 1BSVA 1UXKA 1MFZA 3K73O 2OP0A 4J7CA 3ZHBA 2Q2WA 1H94A 1Z7BA 5JO0A 4JBHA 5GY7A 4YJDA 2A4KA 1YB1A 2V7PA 5H83A 3VPSA 5A9SB 1NP3A 5JLAA 4M55A 5A1TA 2IEDA 4Z0PA 3AOEC 3KB6A 4B79A 3MJCA 2O50A 3V1UA 4O5OA 2R00C 4FB5A 3CUKA 4IGFA 1WZIA 3HNPA 2W98A 4BMVA 4MVJF 1Z73A 1PZFA 1X0XA 2UDPA 2X86A 3EZYA 3FBTA 1C3VA 1YL5A 3C85A 2GN9A 3QVWA 3PGJA 4CR6A 1QLHA 3D1LA 4PN3A 1R66A 2BF7A 3ROQA 4CQMB 2E37A 5HM8A 2VZ0A 2QIOA 3CTMA 2NLOA 3DFUA 1IL0A 3I4FA 4RVFA 4YXFA 3WFJA 1YL6A 2X0JA 4CLOB 4FFNA 2W4QA 2P4QA 5JO9A 4R1SA 4BGEA 3DMYA 1H6CA 1ENPA 3L9WA 5AOVA 3WG9A 3PDJA 2RH4A 1GU7A 1QG6A 2IDZA 3ETEA 1QMGA 5T57A 5EL0A 4NG5A 3JYOA 4FJ0A 4W7IA 5AXBA 4BNZA 1NQTA 3U5TA 5BSGA 3DZJA 1EQ2A 3ZI0A 4DGSA 2VRBA 2J8ZA 1QSGA 1Y8QB 1OFGA 2ZCUA 5FEUA 4J4BA 2QW8A 3RWBA 1KEUA 4YJHA 4EYEA 2AE2A 3BTOA 5CDSA 5KCZA 4N54A 1W73A 3SEFA 2G82A 4GWGA 4XX0A 2GN6A 2Y93A 3ADOA 2DU8A 5F1KA 3RJ9A 1XQ6A 2B35A 4IXWA 3WX0A 4L74A 4WNCA 4YRAA 4YJGB 3QWHA 4O1MA 1HTBA 1MP0A 1GPDG 1YQGA 3PHIA 3VZQA 2P5YA 5JXWA 3E9MA 1AXEA 1RYEA 5I7FA 4NJMB 2BLLA 1ADFA 1Z74A 3EY4A 3OJFA 5JDIC 2H63A 1JU9A 1NXQA 2SCUA 2IRWA 2JHFA 4OOEA 2O7QA 2PKQP 3INGA 4FC6A 1U3WA 1U1IA 4OGWA 2Q1SA 3NKLA 3HFSA 3PI7A 4DMMA 3ICCA 5JDIA 5EERA 2NTJA 3S8MA 3TSCA 4NPCA 1U9JA 4OKNA 4R1NA 1MC5A 3QP9A 4YCAA 3K92A 4NK4A 4IJWA 1LLQA 3IUPA 2ILTA 4RO0A 1QYXA 4B7CA 2C29D 3NTRA 2RIRA 2XAAA 5B37A 3NJ4A 1ENYA 2WYWA 4MVJI 3ZWAA 5C5IA 3SBOA 2HK9A 3L9XA 2CVOA 3HJAA 1NR7A 3D3EA 3Q9UA 4WLOA 4KTVE 1DC6A 2XXBA 3RJ5A 2C7GA 3B1FA 3PHLA 5DN9A 1XHLA 1B3BA 1ZSVA 3JQ6A 3TZQA
chains in the Genus database with same CATH superfamily
5B30A 1Q5PA 1RM5A 1KJNA 1QAQA 1KJZA 4JYBA 1OIVA 4HDMA 4ZHQA 1M2JA 4OQZA 2XQKA 3LVQE 1GEGA 3ZVRA 5C3MA 1BDIA 1E20A 1LNQA 3WLMA 1EPUA 3G2OA 3B89A 3HKEB 2V7VA 4R1MA 1IOVA 1KOGA 3PLAE 4IHJA 4JJIA 3DV0A 2XD9A 3R5XA 4CM6A 4ER5A 1LDNA 1GCGA 2X42A 1IY0A 1W30A 2A33A 1DT3A 4JMPA 3DOHA 4N0MA 3KEMA 5ICGA 1VLJA 2PZEA 4CVNA 3BJEA 3BD6A 4DLTA 4IIEA 1TO6A 5IVPA 2CCJA 2PD3A 4I7EA 3NATA 2ID8A 4FOSA 5FFNA 3D4BA 3AVOA 5C1IA 1DMRA 4WLEA 2YJ3A 1E3MA 2QVLA 1VIVA 2PZFA 1PT7A 1GPUA 2W48A 2CXPA 3CN9A 1C50A 1ULHA 3NTLA 5C4GB 2BL4A 5CT9A 3ZZ1A 2QT1A 5CEEA 3UXMA 2GETA 3WZ2A 3QFFA 5IF9A 3GLIA 4TWAA 4AWBA 3MZ0A 4ZCIA 3D0RA 3QU5A 2FFBA 3D8BA 1DKOA 4DA7A 2VDLB 3RS8A 4BASA 1L5ZA 3CF0A 3LO5A 1O1YA 3QUBA 2RGXA 1UT5A 2XNJA 3K32A 3TSAA 2IXFA 4ENUA 3RR2A 1MCZA 5DXJA 5J58A 5JCJD 4Z9BA 3M0EA 4ROSA 3SZUA 3KTAB 3HJUA 3SI7A 1OI3A 2G25A 1FYEA 1IPFA 4GMKA 4TOIA 3RC7A 1TLFA 2HN9A 4II3A 3E4CA 2FLKA 2YN0A 4HLUC 4RDXA 5H1YA 5IPFA 5LOVB 2N1BA 2Q2QA 1TM5E 1F4VA 4HVTA 3KOYA 1VMDA 4L85A 4FPXA 4N0PA 3N07A 4PTZA 2VWGA 2J1LA 3OM1A 1KI1A 3R20A 4BPRA 1ZI9A 2I4MA 3AOGA 4Q3KA 4UM7A 4F12A 1EIWA 2W6JA 4OYYA 3DL7A 1JAYA 2WMDA 2X76A 3MT8A 3P9NA 4GPZA 4PZLA 5IDVA 1OI2A 5C7YA 1QIIA 3LDGA 1PQWA 1DTEA 1IC6A 4YHHB 3UBTA 4EJFA 1G2IA 2FG7C 3V1KA 3T35A 2J67A 1PS9A 1BDMA 1SBIA 4FINA 1ZWKA 4FXPA 4XDYA 4BNLA 4F1JA 1A8IA 1RJ9A 2Z8YM 1ML3A 3ZXUB 3PLNA 1NLYA 2ZBUA 5EIBD 2XVMA 2EYQA 4PIVA 1H2XA 1S7GA 3K9FC 3K35A 4RJKA 4D97A 1V8ZA 1RAGA 2BHTA 2A4MA 2HWWA 1RHQA 4S3MA 1Z0ZA 2L18A 3EHDA 4EHNA 8ADHA 4MUBA 2OD9A 5JNWA 3FSGD 2Q0XA 1UK9A 3H7AA 3OLCX 1KAHA 4GI3A 4EEZA 1GTZA 1EI9A 4MPTA 1DO0A 3P97A 3QKTA 3IEUA 4NMHA 4EZBA 4MV9A 4ZV7A 2QA5A 2ZIZA 1WUJS 4N82A 4DCTA 2AL7A 3ZU5A 5HMMA 1YAHA 2A1UB 3DAYA 4NCIA 2VRWA 1TO1E 4WKPA 2FX3A 2Z8ZA 4C6SA 2P9QA 2XUIA 3R0IA 1ISPA 3QU9A 1XGKA 2ATVA 2CXSA 3GJRA 1XROA 4CKZA 3OQ6A 2UUAB 2ID9A 4FWIB 1SM4A 3R1IA 2X0KA 1T8TA 4ZQGA 4V1CI 1RQNA 2FH5B 4WFJA 4M1QA 1L5SA 1VLQA 1GFIA 3DFIA 1Q83A 6YASA 2L2QA 2CY0A 2JIZA 5JANA 1AS2A 2VHQA 1QVAA 4PX2A 3ZCUA 4CF5A 4D3ZA 2CB0A 4BGVA 1OV6A 4AO6A 1MZPA 3I5XA 2GTPA 1R0BA 3GIDA 4C1BA 3VNUA 4PINA 3OLXA 2PGIA 3O92A 1Z2NX 4L6AA 2FEOA 5AW0A 5KKNB 2VDRB 4HBGA 3T9FA 3DHNA 4QUKA 1UAAA 2VAVA 3KB1A 1TUGA 5T4FA 2H16A 5MGBA 3DBHA 4R98A 1WUKS 4GOMD 4AFNA 1UBRS 4F7DA 4FGWA 2VI5A 2EGGA 3CVWA 3I32A 1H0HA 1RWQA 2IP4A 4JC4A 1J90A 2EFHB 4GR9A 4LTNA 3RUHA 2JS7A 3TAXA 2QE7D 3NO4A 1C14A 3L5KA 4ZOAA 1O6FA 1UFVA 3MK31 3EC2A 3CPJB 1V0JA 2JLAA 2FUCA 2VPWA 1Z2EA 4IQ0A 4OPMA 1YU6A 4ZT7A 4X91A 5BVGB 3AI2A 5H5JA 2VDVE 3O1HB 2JJ1D 3COJA 3G1WA 1DWQA 2ZJ6A 3MBIA 5JMPA 1L5FA 3KJHA 1RI5A 2PPLA 3ORQA 4BLUA 4U2GA 3W5SA 4DR5B 4MPJA 3OM9A 2P7HA 4N03A 4E3WA 2IEIA 1D1TA 2PR2A 4IMIB 1LC3A 3L1VA 1NDUA 3L8MA 3DE1X 4N12A 1I6WA 3EK2A 1ID1A 4U9IS 5TQ0B 1KERA 2WIFA 3ENQA 3SIXA 3UIEA 2WFLA 4YV1A 2R6ZA 3CGWA 4IS2A 4GW3A 2F4VB 3FYSA 3N8NA 1VG0B 4XR4A 5AI4A 1YB2A 1ZX1A 2AFIA 3ZVKA 4BAGA 4EITA 4OX9B 5LM3A 4R51A 4Q3NA 4H1WA 5BQFA 2DPYA 3ICVA 1EFAA 4KB5A 1XMVA 4GSYA 4YHBA 3FTQA 3SU8A 5AKGA 2FWBA 1QS0B 4D3FA 1NN1A 5JZMA 521PA 2XB4A 4C4AA 1TADA 5B4UA 1SUSA 3JATA 2CDRA 2H4FA 1WE2A 4HSEA 3OTOB 1L4MA 3FRIA 1Q11A 5G4LA 4GKKB 1M1NA 4IJVA 2YWXA 1IQUA 4FFBA 2X77A 1TGYA 1VIYA 4YO8A 2LCFA 3ST7A 1P4RA 4IPTA 1WCXA 4RS4A 1O0SA 5A3JA 3PX2A 1U7XA 2RJNA 5DI3B 1XEWX 1XMIA 1EGQA 3BCSA 4H27A 3KHKA 1O95A 4NYJQ 1KZYC 1U2PA 3HTXA 4B83A 1KH1A 1IBRA 1REQB 1VZ2A 3HYLA 5COQA 4L0QA 3HR4A 3CURA 1DJPA 4P35A 3TKYA 4TKZA 1VL6A 5C81A 3AM5A 2IYQA 2O1XA 4LZAA 1NQVA 3TW0A 2X2PA 4AZSA 3EXG1 1F9AA 2BEWB 1XDZA 1EVIA 2ECKA 2H1LA 2ON6A 2XNDD 3MCWA 1CYEA 1L7NA 4NENB 4GP7A 5KYUA 1T2NA 3DEFA 3O84A 4FU0A 5FUMA 2AQKA 2LNDA 1P1FA 3UXYA 1QORA 2IPAB 4G0ZA 1BVRA 4HZUB 2J4DA 4EF6A 2A9KA 2JLRA 3PWTA 4R5HA 5HGXA 2H9YA 2HMYB 1KPHA 2P9ZA 2QEQA 5L3SB 3UB3A 3CR3C 5HTOA 1JHPA 1AQLA 3R5TA 4EJ2A 3JQBA 3BKWA 5JNTA 5KOYA 5AVVA 821PA 5LMNB 3DDOA 2Z09A 1S4MA 1KKMA 1U9ZA 2J85A 4Q39A 3ZWWA 3EPHA 2ZJAA 1RQGA 3DTNA 4O4HB 1E9CA 4LV5B 4PZ0A 1NUPA 3RU3A 2A7XA 2ZBPA 1MQSA 2V7TA 3HK2A 4MVJD 4RHEA 4IDDA 2B1QA 1O96A 2HY7A 1KAOA 2O3JA 3EZGA 3PCXA 2XRYA 4Q19A 3UVEA 1JDBC 1A7AA 1E3WB 2HWXA 1ZVKA 3BXEA 3KR2A 3NT4A 3QEBZ 1H93A 2E4WA 1DHTA 3O8LA 1Z38A 4R2MA 2V7EA 2EL9A 2ZW9A 3TTWA 3VPGA 5AW1A 1P1KA 2IHVA 3NWOA 1ZG3A 3USCS 3QVTA 4CLRB 2QD3A 5HJ5A 3MJFA 1AKVA 3TMYA 4A2WA 1QIGA 2ZRCA 1KHHA 3D2CA 4RLFA 7GPBA 3AJDA 2AYZA 2V6FA 4HRXA 1GCUA 4R7ZA 4RYLA 1CS0A 1RXCA 2D62A 3PSHA 4R68A 3T7EA 3NONA 5K5EA 4FB4A 5FX2A 3NTUA 721PA 5SZIA 3PDIB 4E7OA 3GP3A 1F4LA 3GVXA 4PIMA 2GOYA 1VG1A 1GTMA 4IIFA 2XYHA 2X1MA 1C1XB 4EB6A 1ZBQA 3HSKA 4YCNA 1K6EA 1OA1A 1US8A 3K0BA 3IIIA 3IAS6 4XLLA 5CUQA 1B93A 4QRIA 3T38A 3FPJA 1U8CB 3T34A 2ZYIA 3BJIC 2WNIA 3HLYA 3OPNA 1SC1A 2WF7A 3S55A 4RZXA 4BX0A 3DMFA 1MDBA 1C30A 3AIMA 4ON9A 3T3HA 1JA1A 5F2NA 2WNSA 4B81A 1RR6A 2ID4A 1B7GO 2FVYA 3SM9A 2V45A 4A73A 1XZHA 3ZIDA 1KQ3A 3TX6A 3F1LA 1K63A 1M6NA 1N8SA 2AB0A 2BHNA 4PWYA 3IV6A 1PS0A 3EC1A 3GEIA 3NMUF 2QN6A 3X2EA 3OAAD 4RY8A 4TXJA 3RJTA 5E7JA 2G1PA 1EFVA 1E62A 4DUPA 2XDYA 1N6PA 3KEOA 1G21A 1FDTA 3GFGA 5IJXA 3GJSA 3R9XB 4JVLA 3AU9A 4EP1A 5JFTA 2YMLA 1CUSA 4R4JA 2WG0A 1T25A 4AP5A 2BFPA 1CUGA 5TQJA 1CW2B 3OEWA 4ITRC 3AUAA 4F71A 2W2LA 2D2EA 2RI6A 3AR4A 3GRUA 2WMOB 5J40A 3RLIA 4FBGA 4KPEC 3E5MA 2KQUA 4YDHB 1R5BA 1W5FA 3ONFA 3QIVA 4PZCA 1N2HA 3CTPA 3PQ2A 1QQ5A 4WN9B 4YPOA 2C4HA 4DMHA 1H22A 1IHOA 1F6BA 1DXHA 1JMKC 2XZTA 3AETB 3OQVA 4NKRA 4NVRA 4Q9DA 4X6XA 1ENOA 2W43A 4JLDA 2YW9A 4TSRA 5A7GA 2MYNA 3KPJA 3Q2KA 3GJ6A 5ICCA 4H1VA 1QLJA 3PC6A 2OAEA 1UP7A 5BMVA 5KVVA 3KAPA 1U1CA 3TOCA 4I55F 3MUEA 4W5OA 1K98A 4GOND 2YWGA 5CB4A 3E7WA 2O2DA 2VHCA 4WXYB 1HNZB 3P71T 2O8NA 2NUPB 4FZ3A 4HUQA 2WWVD 1CE8B 4Y9RA 3PU6A 1KMCA 1UP6A 4WCDA 3I6ZA 3WP0A 3ILHA 4O2RA 2P2SA 1YR8A 2Y6UA 1H9BA 3HE3A 3K4HA 3INNA 1PAUA 1NN3A 1QBGA 2HXYA 4ZXFA 5ESXA 3RSCA 4EHKA 2AH5A 4BMSA 2ZSDA 2OYSA 3PYLA 3CPHA 1UMKA 3AL0C 4XQCA 3N70A 2FPGA 1F6WA 1PNTA 3BMCB 3NOOA 2JAUA 1EDEA 1QCDA 1I51A 1P7ZA 4MROA 1GN8A 2J7PA 4DM7A 3DE4X 2NVBA 4YV2A 3OJWA 4QT0A 1T10A 3KE9A 5LLSA 1NNLA 2IELA 3AZPA 1ZD2P 3JQAD 3VPHA 1JLLA 4L73A 4CQLB 2XQIA 4WJLA 4RZIA 4ESHA 5KO2A 2BPOA 2X23A 4E33A 1OXXK 3EOZA 2CT8A 5JNLA 4ZC8A 3NBUA 3VR6A 3DD5A 4Q6WA 1ZP6A 5IUKC 1DL5A 2YVUA 4FOPA 2BGIA 2FWRA 5IT9A 1XKLA 2JH9A 4HAUA 1BG6A 3JQ8A 4YJKA 1GGFA 2QMEA 4XTCS 3ZE8A 2PUEA 4CCYA 1FZTA 3RASA 2XDQB 1Y8RA 4H6VA 1G8GA 2Q8QA 2Q3FA 3UOAB 1E1QA 4W7SA 2AEMA 1WV0A 3GA7A 2WU1A 3EGDB 3JALA 2ACKA 4KUEA 3IDZA 5C1PA 3CSUA 2C0CA 1XXHE 4QU5A 2O6LA 3MJ4A 2GBIA 3C6BA 2JATA 2PX5A 2A9OA 2P6UA 4YK7A 1V5FA 1VL0A 3KYDB 1VHJA 4MUFA 1QP4A 2C88A 2CSUA 3H5RA 2HHHB 5CG2A 4KGXA 4URVR 4BZWA 3LA6A 2C3OA 3P7MA 2OO7A 2H1RA 5HOEA 2DQSA 1W9MA 4OFWA 1Z6AA 3CX7A 5DYWA 3WHIA 3D4IA 2BKUA 2AG6A 3CUUA 5CLJA 5LR6A 1RRGA 3QWFA 2V7QA 5KSYA 3TUZC 4FQ5A 2EXXA 2DRIA 3L7YA 5T67A 2WKQA 3KLBA 1KC1A 4RACA 3FWZA 1XI2A 4BLRA 3H4TA 2WFZA 2HDHA 4JA0A 4JL8A 4LJYA 3FTDA 2DXIA 4KXVA 4BUZA 4O2LA 4R2WA 3GLFA 5U9CA 3I8XA 1GFZA 3C7CB 4KVZA 1JXOA 1IEWA 4AVYA 3FPKA 4IIUA 1TYCA 3ZHCA 4QJ5A 4QUJA 3QUQA 1JQEA 2CL7X 3DXZA 4MPRA 1YS9A 5KNBH 2JBAB 5K4HA 1P3DA 3DHEA 1HYHA 1L8AA 3ICPA 4E5PA 1E0AA 2IZ5A 1N9GA 1U2RA 2CMDA 3AY6A 3NBAA 4C3ZA 3RYHA 1EU1A 2VXYA 3DD1A 1YVRA 3G8DA 4JUIA 4L95C 1YQQA 1VCMA 3ILSA 2R5WA 1D2NA 4X95A 1AH2A 2Q5EA 4Q9NA 3VYSB 1CUZA 3UOGA 4EGFA 4FW8A 3CY6A 3AR2A 1DZIA 4EJSB 4OCZA 1IOLA 2A9JA 1TE2A 2B98A 1T1RA 4ZT2A 3PJRA 3ETNA 2NQ2C 1MXHA 1U7ZA 4I2NA 4DIBA 3HWX1 5HR5A 3C7TA 1TLLA 1JH8A 5J63A 5JAQA 4GSLA 3I42A 4L0CA 1CF4A 1XOIA 2B37A 1Z4MA 3UK1A 4AJ2A 2XWPA 5T4HA 1YZVA 1X13A 1NVEA 1W46A 2VUHB 4WN3A 4OLBA 3EFOB 3IUYA 5NLLA 3TW8B 4NY1A 2Q2OA 4JYCA 3RKUA 4IFEA 4FYMA 4DTIA 5B1IA 1OOEA 5LYYA 3FDXA 2J4CA 4FWTA 2QKYA 3P26A 1E1YA 2BY4A 2HRDA 2HPZA 1Z8HA 5FTNA 4MJXA 2C2BA 2XTMA 2P79A 3SHWA 4JP3A 2HOQA 3N2ZB 4IDEA 5BMVF 4NV3A 3VTZA 5ALMA 4WCFB 1F2UB 1SKAA 2GO1A 1KZHA 5CB4F 1KZGB 3GDOA 2NVUB 4DDUA 2WQ7A 2WWWA 4HDRA 1F60A 3NPAA 2BVNA 3UV6A 2BEVA 2CDBA 3IILA 4OO3A 3CNBA 4L4ZA 3ND6A 2V65A 2FU5C 4M8KA 2TMKA 2VUSA 1QV7A 4PYMA 3UT5B 3WSVA 4S1VA 1OLUB 3CUVA 1A4UA 2F8MA 2PGLA 2FPPA 1JMYA 1QPGA 2HO5A 4I9HA 3UTDA 4MI1A 3SS9X 5AW6A 3FAKA 4FLEA 3OZSA 1FFEA 1R88A 1LH0A 1W34A 4IKOA 1WTAA 2WUDA 3DE3X 3TUIC 4W82A 2RAUA 2OFOA 4RGQA 1JKMA 2DFDA 3G2PA 2ZVPX 4MKXA 1LK5A 4J4TA 1ECLA 2VZLA 3QI2A 1LD3A 5IEJA 4QOSA 4I14A 4EX6A 5JJ5A 1THZA 3RE1A 1IIBA 3B6EA 2X1LA 2XTJA 1KRXA 1LU9A 1CY7A 2H8GA 5J2TA 2VNKA 4B3XA 4TQ9A 3C3PA 1LWNA 4IR7A 4RGBA 2Y76A 4YCJA 3QKRB 2DUNA 3PHBE 5COBA 1HUQA 3G5AA 1E5QA 4BZPA 2UYCA 2DBVO 1OZFA 2NO6A 2PFKA 3AILA 2W9XA 2J7KA 2GERA 3RIHA 1W36B 3CH7A 4DAEA 1LPBB 3NRCA 5FO0A 4OREX 5AJZA 3U3JA 1CEXA 4F6LA 5CD1A 1PDWA 3Q3VA 2XUQA 3WI7A 4OHZA 1OX5A 1JSCA 2Z3ZA 2XCOA 1H2FA 2BFFA 2MDTA 4I8DA 1TQ8A 1KNQA 2PRIA 3IVMA 1BVYF 2Z2ZA 3D81A 1CDOA 3JQGA 3LLMA 3VU3A 1Q57A 3L07A 1D4ZA 2UUOA 5G1OA 4LDRA 3K9BA 4J0FA 3VR1A 5BUSA 2REOA 3R40A 5A4DA 1LWOA 3T61A 3WNCA 2I34A 5CH3A 3F7MA 3JQAB 1D2AA 2I6SA 4JU9A 1NLUA 1U8XX 1TEXA 5CMLA 3JQFC 5F77A 3RSGA 4GH5A 2YBDA 3SXUB 4C78A 5LWHA 5JS8A 3A4NA 4LWPA 4X3PA 2UYHA 2I8CA 3RSQA 1TB4A 2W6JD 2X0EA 1JYFA 1E5XA 1R15A 1GCIA 4YXWD 1O94A 2Q3LA 4ANFA 1TEHA 3ZQUA 3RVSA 4BBJA 4QVIA 2GK4A 5I7OA 3UK2A 1XCGB 1J4AA 2ETVA 3CEPB 1RWKA 4LI3X 4V1CB 2J87A 1S2LA 1ZHHA 4P22A 3RS0A 3DCIA 4PLPA 4BCCA 1KMQA 1Y7LA 4HAYA 1NWHA 4IMJB 5EMJA 3RDPA 1SBNE 2HCTA 4FOOA 1GAEO 4I1UA 4D9BA 3IQZA 2V59A 2H2FA 4DABA 3U4QB 3R9XA 1NM5A 3L1JA 2H5IA 2ORVA 4Y7CA 2BMFA 3AVWA 2NM0A 3EXHA 4HV4A 4MP8A 2B92A 3T0FA 3NHJA 2O8EB 2VDNB 4DR1B 3D0KA 3F97A 4O25A 1WU8A 1RKVA 2RC5A 4Y2HA 3G1UA 1K27A 3PT9A 3S4YA 3QLVC 2WM8A 5JMOA 1QOQB 3PIRA 3OQJA 1A8PA 5DKFA 4F92B 3IVGA 1D6NA 3L05A 4FYHA 4DW8A 2J32A 3GFOA 3JARA 1RYMA 2IX9A 3G89A 2H54A 4JX8A 4KQKA 2ZAGA 4RAOA 1GAQA 2F9MA 2WSSA 4R1UA 2NSHA 2PGJA 4OJTA 2QSJA 3X1WA 3R5JA 3TMAA 3MJDA 1SVUA 2B8WA 2JRLA 3CM0A 3GEDA 4QPDA 4UBMA 5AQ1A 3L46A 2QTZA 2R1UA 3EHEA 3RM3A 4UTZA 2X8JA 5K0CA 3CLSC 2KX7A 5AVZA 1OB2A 1XZDA 1I9GA 3AERA 3FGPA 4J3NA 1NN0A 4XX0B 4TKVA 2C5EA 2QTHA 2I03A 4LAFA 3DPIA 3PQ4A 4XYLA 2XF8A 3PEUA 2XDAA 2CNOA 1U7HA 4KQ1A 5BQ3A 1GPBA 3EJWA 3THXB 2J3EA 2O0MA 4X6YA 3A1CA 3F8TA 1W2WB 1KJJA 4HYQA 4K1LA 1FNBA 1HL7A 1DKMA 3GZNB 3L8FA 1EUQA 1B26A 1ESNA 4MJ3A 1CERA 1RRFA 2TSYB 1LBHA 1N7GA 2OCBA 1BQ3A 3F0TA 4FIZA 2GN4A 3AF4A 4HYTA 4LYJA 4QYTA 3R8XA 4BWVA 3CW8X 3E82A 2VBIA 4CT5A 1FXWF 1CK4A 3A32A 2YJTD 2I7TA 1GPKA 2OCYC 1BJRE 2D1FA 1SCKA 2W83A 3GDGA 3BL6A 4OK3A 3UV7A 1KJ8A 3A4YA 2VDUE 3KPWA 4WXPA 3SYNA 4DC0A 1VC2A 2H1CA 4LNUB 4BKOA 2AJTA 1ECCA 3NANA 4ALKA 3VRHA 5G1PA 5IVKA 3LQKA 2OV1A 4ZC1A 5KJCA 3A7DA 3O9VA 3CX8A 4DLAA 2CWWA 4LXQA 4ALJA 4QGSA 2IHNA 2DE0X 2B78A 5J2TF 4WK6A 3R3JA 1RZRA 4G5RA 2FSPA 3I0ZA 4JZYA 3V6LA 3OIWA 2OOSA 1P7YA 4ZRDA 2D0PB 2IZ7A 2VF2A 5L95A 3DAPA 2RAPA 3G8CA 1KQNA 2WVJA 3DO6A 1FDVA 1FJHA 5EMLA 3DZFA 4E5DA 5K6AA 3GJ4A 1JW9B 3DVLA 1G4HA 1U0TA 2B4KA 3PNVA 4KMOA 4R9NA 3M6AA 4UDOA 1K2WA 4UUPA 5LUAA 3G2MA 3QUSA 3A31A 5EQTA 2QI9C 3PKZA 4DDHA 3ZYZA 3CZRA 5BV1A 1Z5NA 4JODA 1UDRA 2GN8A 1QVRA 1FQWA 4YI3A 2CN1A 4WEQA 4DCNA 3WL5A 4XOUA 1BC5A 4PQEA 4FNAA 4ENWA 1QHEA 3E2MA 4A27A 2PD4A 2FR0A 3FWYA 2WA2A 1QK3A 3ISJA 1ECFA 4HPWA 4S1TA 5EKSA 1CY1A 3DBIA 5A1JA 5F21A 1M1XB 1H2RS 4LXGA 3UUEA 4A0SA 1XTRA 3U4IA 4GX1A 1SOMA 3WMEA 2NP7A 2ZRBA 3E0XA 4BV9A 1FDIA 1TK9A 2FSIA 4ZWNA 2VJCA 3UJ3X 3M9WA 3BH6A 2P9EA 2NQTA 3ITDA 3EPLA 5GADl 2ZTVA 2ZI6A 3WC4A 1AC5A 1K8QA 2ICAA 3PHHA 3TGPA 2V1XA 1QQBA 1W4BA 2VJKA 3FN4A 2RGUA 1OWPA 3K2IA 3LQ1A 4MP3A 4N7MA 4RL6A 3WS7A 3AR9A 4QX6A 2ZE5A 4OHCA 2XUKA 2XCLA 2BMDA 4MVJP 3CRVA 1L5LA 3BD9A 2WUGA 3NDPA 4QTTB 3E1GA 3KPVA 3OQHA 1UJ6A 1SHJA 2CCGA 4TN5A 4GBMA 3GGOA 1R10A 4RHTA 4K81B 1XMPA 1H8EA 2P75A 2B1IA 3D0QA 1UFQA 4MCHA 2WU8A 1JIVA 4OMUA 2PLAA 5DRYA 3HJCA 4XGQA 1QAOA 3RGGA 2OXFA 5E9AA 2DOKA 2EKQA 1KZ9A 2QMQA 3IKJA 4Q7LA 3SEQA 3UK6A 1RXSA 4HK4A 2JLXA 3I39X 1FMJA 2C9MA 3LWDA 4YRBA 1I2ZA 2O06A 4H7DA 2BEUA 5L7YA 1RHMA 5TJ9A 2H4ZA 2WHRA 4N7JA 5K9ZA 3D6FA 4ZT4A 1C1DB 2GN2A 2GILA 3QPBA 4H7JA 4ZOCA 4F6CA 5B3JC 3WGIA 4TMVA 2JHAA 1XVUA 1DIBA 3MWDA 1Q2XA 1QIJA 1M8PA 1P5FA 3BJMA 1SRRA 5T6MA 1A9ZA 5IN5A 4EHJA 5JNSA 1JEAA 4WLVA 2G77B 1M8KA 3HXOA 1SUDA 4RD3A 3RSFA 1TZ2A 3NC1C 3EODA 3MLBA 4K8RB 4JVSB 1NX9A 3WB0A 4EIWA 4B8WA 3X2FA 1YB4A 5KSOA 4CLHA 2V6IA 1GGMA 1TC2A 1F0PA 2VWPA 1SKYE 3GEBA 3ON5A 4M87A 4WLNA 2P3OA 4MRVA 4NE9A 3FRJA 1YZQA 5G4KA 5IVIA 2PZLA 5F78A 3WLNA 3TNLA 4F97A 1JDTA 1XE3A 1ZUWA 4DCSA 4N3NA 2JGDA 3O4HA 4PC7A 3HU2A 3E9DA 4HWTA 3WBBA 2YV1A 3QBVA 4BWYA 3IOMA 2X4GA 3QH4A 5HFAA 2XQVA 2YUTA 3A04A 3AT1A 3OX2A 2HWYA 3IDSA 3B5IA 4II7A 4FDAA 2Q1TA 1AMNA 2WQ6A 4JI7B 2NUAB 2O07A 5DV9A 3ZE1B 4Q9JA 2FZ4A 1DVRA 3UWPA 2ZANA 2ASVA 2QTRA 2A0WA 3LV8A 4IO1A 3N2LA 3T3EA 2WJPA 5EZSA 3UKJA 4PFJA 2CLLB 3KXIA 3OE5A 5LQMA 1OX4A 3OZUA 3TM5A 5CFQA 2Y67A 1HYGA 3ZWCA 3C1AA 1CRWG 3W8DA 3W5CA 5HPYB 2JAHA 1M67A 2VKQA 5JSHA 4G5HA 3PXUA 4MRMA 3A2KA 2JGEA 2YKGA 3NVMB 4KR3A 1O77A 4G97A 3KKEA 1W6RA 3MEQA 5GZ6A 2R1ZA 4UCXA 4LDJA 2YYYA 1Y3FE 2H07A 3U7GA 5J5AA 2WW8A 2GEJA 3HI4A 3TOSA 4TSKA 3TFOA 2EP5A 4DLXA 5BYKA 3TZHA 4DSAA 1DTWB 1NBMD 3I53A 4UXHA 3ADDA 4BE4A 1TDJA 2P77A 2JCBA 3WGLA 4LRYA 1ZGJA 1PZHA 5H59A 4G0UA 4OB6A 3KV1A 1WXQA 4MZDA 1G8YA 1MH1A 4RTLA 4OYLA 2QL7A 4EI7A 1BCSB 3HJNA 1JVSA 1CETA 3JZFA 3RV4A 4Z9AA 5BSWA 3QYAA 3VR4D 2HNBA 2TYSB 4BV2A 5HJEA 2HREA 2P1ZA 1UJMA 3H7IA 1NKSA 2KLBA 3AYZB 3QA3E 4P4NA 5A6SA 1M75A 5KIAA 1PL8A 3C3AA 5EGNA 2XW6A 5K99A 3KDSE 1XTJA 1ACLA 2ACVA 5KINB 5DE3A 4RQTA 1M8FA 3NIDB 4DPLA 2ZTHA 1B16A 1PJCA 5AH0A 2G4CA 2OP1A 1C1HA 3B3AA 4UNIA 1BIFA 1E4EB 4PPGA 1DI0A 3IJRA 3TLXA 5JWOA 4GAEA 5HCUA 3R6GA 1WBDA 2Y1GA 5IKOA 2BMWA 1LK0A 4FSHA 3KQQA 3AF0A 3SKXA 1T24A 4WZBB 4Y2UA 3CB4A 3L8YA 3R4CA 1P4AA 4OI2A 1GQRA 1L8LA 1MRSA 1JF8A 1W0CA 3H18A 5TMDA 3NKVA 3OU7A 4JP1A 1JU4A 2O4CA 2VAMA 4TWZA 1PEAA 1V71A 2CEKA 2RGRA 2RHGB 1PK9A 2XMPA 3OJEA 3VDRA 2HLDD 3TQQA 4IV0A 1XDUA 3QE2A 3ZD6A 1BH2A 3EUEA 3WHLA 4DILA 1GN9A 4X20A 3W1WA 4F4JA 1FYDA 3PEVA 1G6KA 4ZV9A 5E8RA 1NC3A 3VDMA 5ETJA 1TM2A 1G3QA 2HU8A 1UPXA 1OZGA 2X5NA 3G9TA 1IAQA 1ZSNA 3R3UA 1G98A 4BB5A 3G0CA 1MJ5A 5CB6A 1JIKA 2F3SA 3V33A 4LYEA 1BW9A 4FJ1A 3NXSA 2BWJA 2OL4A 1I3NA 3GRVA 4L8GA 5IARA 1CQIB 2W2OA 3EIXA 4PFQA 1P0QA 4AS1A 1OX6A 3N8KA 5K6TA 4I0WB 2E0IA 3FCAA 4XJTA 2WPNA 1QQ6A 1HXHA 3H9UA 3QVLA 1J00A 3KKZA 4ICIA 4WV3A 1C2YA 3L7CA 5JLJA 4NSNA 5J5CA 3I76A 1GA1A 5JU6A 4GDFA 3K94A 4DV6B 1O89A 5FL7A 2ZSAA 4U7HA 4DA8A 3PA6A 4F2HA 1QRRA 2R5NA 5ALSA 3VI3B 1UJCA 1KQGA 2VQEB 3I0MA 2R6JA 3JATB 3NEYA 2QVZX 1UOOA 1B1AA 2A9RA 3BIXA 3CF4G 3PQ8A 2E1RA 2MSDB 1JX6A 4S1WA 2JCSA 5BNFA 3I12A 3PQFA 5BO5A 3DL2A 5JJBA 2IYLD 4YAGA 1MG0A 1OQAA 2J5RA 3LVRE 3T8YA 3FYCA 4J7AA 2I8LA 1DWUA 1F51E 2JAQA 1XKXA 2DPXA 2IPLA 1TW3A 3AJEA 3SNHA 2PUJA 2VDWA 4I55B 4Y6QA 1J6UA 3PKIA 3SMQA 2D2IA 2P91A 3QOXA 1J8DA 3UG7A 1QP7A 2Q4OA 3BZWA 1M5UA 3C39A 3DFKA 1BHQ1 4LKOA 4NZ9A 5TMBA 5H3CA 3ZJ4A 4KO2S 4I99A 1VGRA 4N5LA 5JYBA 1E7WA 2HV9A 4YP5A 1FJXA 3V8NA 1FRQA 2WAYA 4IH1A 3IJ5A 3ZDEA 4TYMA 4ATNA 3GOHA 4ZEWA 3P2IA 1JG1A 4K6KA 4E09A 4D0LB 4QGHA 4ZAFA 3BG5A 1HE2A 4YJ3F 5DEOA 3MJEA 1H3EA 5HSGA 4RQBA 1C3JA 2Q6VA 4GIBA 1N77A 2FUNB 2I7VA 1FDRA 5FBHA 1VJ5A 2QS9A 1Z63A 1U7UA 2EFYA 3AEZA 4QELA 2VAWA 1VLMA 2BUBA 1E3EA 3SNKA 4MKIA 3WJ7A 3HSYA 1JB9A 4OIMA 1E1NA 2IXAA 2Z1MA 5B58T 3RLFA 4B9EA 1IWBB 1ZYUA 1HLGA 1DBQA 2P4UA 5D51S 1FFDA 4P3XA 3LTNC 1FP7A 2NXNA 2X5OA 3ZWMA 3H11A 3EZ9A 3FFWA 3M4YA 3EXEA 4QUIA 4R9UC 3AESB 5D3MA 2A9FA 3IFSA 1CY6A 3IEPA 5I3ZA 5LQUA 1JU3A 2G5TA 3H5VA 2Q7XA 3K30A 4NAUA 1YUNA 4RKEA 2G40A 3RQSA 1ND6A 2JZNA 3V32A 3I9LA 1WTCA 1ZQ9A 3B6JA 4I81A 5CYOA 4B4VA 1U3UA 3FNGA 4OU4A 5J43A 3SIRA 4W9NC 2EBWA 5I9TA 1Q7RA 1Z0AA 3EQ7A 3RC2A 2VJOA 2ZRQA 1UWCA 2QU8A 4WD3A 4ZQFA 1CS0B 3D5EA 1AY0A 4DEYA 1Z16A 3VDXA 3FM9A 5J5VA 3QWAA 3NH9A 2H17A 2ZQ5A 3A06A 1WSBA 3TN7A 2SKEA 3U37A 5JASA 3D2BA 4QXOA 3HJBA 3LBHA 1ZW1A 4EATA 4QBKA 3WV4A 3IERA 4YY3B 3IQDB 4LRWA 3MA0A 5ES3A 4BN0A 2FA9A 3RVBA 2HSJA 3EZ6A 4DIMA 1P4SA 4N5IX 5KJEA 4YBRA 3B2NA 2YHBA 3PPYA 1RDFA 4YRSA 5TF4A 1Y5MA 3I2JA 3DCNA 2PUVA 2IX3A 2JFOA 1C30B 1Y1TA 2WLTA 3GFQA 3PQ3A 4OAPA 2FQQA 1XALA 5ALOA 4ZD6A 2HQ1A 3S29A 2IT1A 1XF1A 2ZT7A 4EYQA 2QVGA 3KYBA 5KYNA 1GL9B 3GH1A 4MKHA 4C89A 3ZVMA 1DXQA 1CUEA 1SHTX 2QX6A 1T4DA 4PYRA 5BN1A 1Y5LA 3DOCA 1GPAA 3CZAA 2RHDA 4M4SA 3EY9A 4MARA 4LMRA 2FQWA 3NJRA 3NBFA 3DAHA 4UAGA 2A7QA 4C14A 4A15A 1HY3A 2FB9A 4QDZA 3IT1A 4JBXA 3USZA 3FFTA 2IUTA 3C16C 1V1RA 1IZZA 1FRVA 1CQWA 2G1UA 4YEDA 5EP1A 1AQNA 1CUFA 1Y6JA 3E81A 2H4YA 3MRTA 3VV2A 1H6BA 3G0GA 3WQSB 2B5OA 2W00A 2O5EA 3F3MA 1E3TA 2R4TA 1QHNA 3G3EA 4LE2A 1CZOA 2QMYA 4L8FA 4U2KA 3P27A 1HLDA 2JLQA 3RVOA 3IT0A 1WP9A 2MINA 4NDZA 4EECA 2O9JA 4CE6A 4I3FA 2BBTA 2COUA 4BFCA 5ARCA 4K9PA 4TL8A 1YDWA 1U2ZA 2DAPA 3H8WA 4EG5A 4TTJA 3H87A 3FDJA 2I62A 4NDNE 4OI1A 3CRMA 3KR0A 3TWOA 1ADYA 1SUBA 4N47A 3UMRA 1KMIY 1NMYA 1QDUA 4MYRA 1OC4A 1U81A 3FSJX 4BX3A 4B4WA 5IKPA 5KU1A 1X7YA 2ZITA 4G86A 2VJBA 4D3YA 1OFUX 4FE4A 4MKGA 4H08A 5IEBA 5JAMA 2EQ5A 3QV1A 5BMVB 1AF7A 1NDQA 4L0MA 3DSRA 1OKKA 2EFCB 4LDZA 2WT8A 4MI6A 3ZWDA 2A9QA 4KR2A 4EW1A 5CB4B 4IW3B 1E1MA 2FTKE 4Q4LA 4U2DA 3GLVA 5EKUA 4FLFA 5DHSA 2H1HA 3I9JA 4KP7A 5IH3A 4WOJA 4QTYA 2XKKA 2XVZA 2P6RA 4HS4A 2ODAA 1QZUA 2Y77A 2AZ4A 4HP8A 3D9QX 3I9OA 4JJEA 3S2SA 2CWDA 3T3PB 1D6SA 1TECE 2Q0QA 1AE1A 1XNGA 3SZLA 3HA2A 4B7AA 2WAAA 1TMYA 2EAUA 4KW7A 4M1WA 1P8JA 3AR3A 2IV7A 1RBZA 3M70A 1E5DA 4EYKA 4G4IA 1N7HA 1PJ8A 1R0LA 3HKCA 2RH8A 5BORA 1S4QA 3NGMA 2DF8A 3WWOA 1KI7A 3TLMA 4AO8A 3HABA 4EEXA 1S2OA 1JLLB 4PQFA 4YGYA 3LFUA 5FV7A 4RE5A 2PL5A 1WPGA 2I22A 4KUHA 4MRSA 5AKKA 3VNRA 2C82A 2YJ4A 5CVTA 1EJ0A 1I2MA 3QMPA 2RH5A 4PBSA 1GRQA 3EPPA 4UNQA 1O94D 3Q7RA 4OLJA 4PNPA 1N5DA 4CCYB 4RLHA 3LP5A 1R2QA 4LY3A 3FFAA 5ESRA 1N8NA 4MKRA 3R7AA 4A5OA 4HJRA 4D0SA 1YCHA 4CV0A 2BFCB 4MVWA 4YRJA 1CDZA 3ICEA 3NPMA 2NO9A 2ZWIA 4P80A 3JALB 4LYAA 4BMXA 3E5NA 2PX3A 3WR5A 2P2GA 5DK6A 1P73A 1Q92A 1RE0A 1J2YA 5ALUA 3O0TA 4KQ6A 4PSAA 1RWVA 1A9PA 4GGPA 2QN9A 3EWSA 4O4JF 4JOCA 1C7IA 1TMKA 1U2QA 5A5EA 1KKUA 1UBUS 3BK2A 3L6OO 1RMTA 1J5PA 2YMQA 4FHCA 4O4LB 1S3SA 2O2XA 1EX1A 3EDQA 4YLEA 5F12A 4BB6A 5AICA 4QC2A 2WI8A 4RF3A 1R6TA 4DQLA 2H51A 3O3MB 2P4SA 2GXUA 3K8QA 3NU1A 3DTYA 4N0DA 1CTQA 3HDQA 4BS9A 5JOQA 3BWCA 4OQYA 5CLQA 4ZICA 1JR3E 4GQIA 4N5NA 5KWEA 3DDHA 3A3OA 2ZRPA 2B9VA 2WSSD 3T95A 4CEJB 2QPLA 4V0OA 4O59O 3JVEA 1MTZA 3K0AA 3L0ZA 3VU9A 2PA3A 3CU5A 1QVVA 3WRXC 3V34A 3PDUA 4LZPA 3QG1A 4ZO8A 3W05A 4B43A 1COWA 3GNTA 1SQSA 4EY6A 1AU9A 4LOIA 1YAJA 1NXWA 3LDUA 4DQKA 4K9QA 1Z47A 3U3KA 3RT9A 1CB0A 4OXNA 5FJIA 3CNLA 3LL4A 1BXKA 3QRWA 4XIGS 5YASA 3NEPX 5EVJA 2OO5A 3HMQA 4PC1A 1N9GB 1HE8B 2WF8A 4RIHA 2VF5X 3RARA 1N2BA 2BUAA 3ZGNA 3R8FA 2D7JA 1N2CA 3P2JA 3EB9A 2EHJA 5L8VA 4KDEA 2DQ4A 3M2TA 4YASA 5AXAA 2IYFA 1JI3A 1V48A 1SURA 2GD6A 4F1KA 5E3HA 4HD8A 1IBKB 2WD8A 3VSEA 4AY6A 2WU4A 4G23A 4P81A 3OIGA 2XUFA 1W2HA 2Y99A 2J48A 1T3ZA 5EXPA 8AT1A 10MHA 1V9SA 1L5OA 3KIPA 2ZETA 1CJTC 2HXSA 4N7BA 4Y2YA 2JW5A 1CNFA 1JYSA 1KAEA 4RVNA 1RLJA 3CS3A 3GJ7A 3MBKA 1RKQA 1X87A 5J4YA 2QTLA 5F35A 1WPQA 2ZK7A 1FK8A 1WF3A 4DNOA 4KMSA 4Z1MA 3B1KA 3DMHA 1U0NA 3GDHA 2EZTA 3KOXA 3H19A 4BO6A 3PGXA 1R6BX 1AURA 1G5TA 1KSHA 1QV9A 1VMAA 2OD2A 2YASA 1DARA 3L6UA 4IZIA 1I3MA 5GMOA 5LXTA