4O1MA

Toxoplasma gondii enoyl acyl carrier protein reductase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
303
structure length
297
Chain Sequence
b'PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAISFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title The benzimidazole based drugs show good activity against T. gondii but poor activity against its proposed enoyl reductase enzyme target
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 107
structure length 297
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4o1mA00
1T2EA 3L07A 2CVQA 5L4SA 2FHSA 1T25A 4ID9A 4MVJF 2PH3A 1BW9A 3OP4A 4IDDA 1IYZA 4YB8A 3DBRA 4MVJM 4KQWA 1I33A 4E4YA 2RCYA 3KLPX 3PJFA 4IQ8A 5JYEA 4XB1A 2IZZA 4XIYA 4EJMA 3MZ0A 3UCXA 1CF2O 4E5PA 2FOIA 3PDJA 4FOSA 4JP3A 4RLHA 5EN4A 1V3UA 3TL2A 3IIEA 2B5VA 5AXCA 4TRMA 3C24A 1U7HA 1HF3A 3DBVO 4A7PA 1G0OA 3QVSA 1HYEA 3ABIA 2FPPA 3N58A 1T2AA 2Q50A 3IQDB 5JCJA 2W8ZA 1E5QA 4PVCA 1ISMA 3JQFA 4RZHA 4G5HA 3TZ6A 4B7CA 3O8QB 3O9ZA 3AI3A 2OL4A 2IZ0A 1P77A 3WGGA 2RBEA 3S2EA 4BKOA 3MJEA 5KTKA 3COSA 2O7QA 1JLLA 2CDCA 1DIBA 4TVBA 4TRRA 1ADFA 1YH3A 3PHJA 3QSGA 1ISJA 3ROQA 1I2CA 1PEDA 4PVDA 4YRAA 4RPJA 4YA6A 4XDYA 1UXIA 1Y9EA 3FBGA 2BELA 2DM6A 3RI3A 3ZV5A 4ALIA 1ADBA 1LTHR 1TA4A 3EVNA 3GH3A 4JP2A 3V2GA 3JYQA 4YAJA 1TT5B 3JTMA 3UW3A 1Y5MA 5AVOA 1R4NA 4Q3CA 2VZ9A 3ZH2A 4PLHA 3UF0A 2E37A 3JCZA 3KSUA 4BGEA 4D42A 2YFQA 4U6SA 1YL6A 1G1AA 4AJOA 4O1MA 2ZB4A 1W8DA 4KDFA 2FSVA 4IMPA 4NBVA 1NQ5A 4BO7A 3UVEA 1ZCJA 4D44A 2X9NA 4HNHA 1LRKA 2O4UX 1OI7A 1GPDG 4WLFA 5F3RA 1LU9A 1VPDA 4AJHA 1RM0A 4E12A 3Q0EA 1QR6A 1GYRA 5DF1A 1XSEA 4XGNA 1LLDA 2IXAA 3CEAA 4W9NC 1LSUA 3AY6A 3W8DA 5FFFA 2JFFA 3PGXA 4K9DA 4AICA 1PJ4A 1OMOA 2WEKA 4MINA 4B4VA 2NTNA 3TZQA 3AUTA 4IY1A 4XQCA 3ZV3A 3GR6A 2X5OA 1LI4A 4IS2A 3OEYA 1EVJA 1MFZA 4TKMA 2AEFA 4MKXA 5TNXA 4QTZA 1ZJYA 4A10A 4BL5A 4FW8A 1NR1A 4YR9A 4FFLA 5KVQA 1ENZA 3IMFA 3WGIA 4Q3AA 2G5CA 2V6FA 3FNHA 2C20A 5K6AC 5TT1A 3GC6A 5LCXA 3EYWA 3WB9A 2WD7A 1SOWA 4U5QA 4BB6A 3NDRA 4M8SA 1BG6A 3NV9A 4NK4A 4LMPA 2QRKA 3RBZA 3RQSA 1P3DA 2PGLA 3FCOA 4E5KA 3STHA 2C2YA 3ETDA 3RC2A 3N74A 3RKUA 2PZMA 5JCJD 4GMFA 3TRIA 4D3FA 4J3FA 3RIHA 3DOOA 5EESA 4L0QA 5JDCA 2OMEA 6LDHA 3K96A 4NMHA 4DPKA 1KY5A 3OJ0A 4RZIA 4E2YA 1XIVA 2XXJA 5THKA 3O03A 4ZHSA 3OICA 2NU8A 5B1YA 1AHIA 3AJRA 1U9JA 3TSCA 2OZPA 4ZICA 5CEFA 2QRJA 1B8UA 3ICPA 2B4QA 3RUFA 3HDHA 3U4DA 1X7HA 3VPGA 5A1TA 1E0DA 3PK0A 1J4AA 1PZEA 2FP4A 3H9JA 3GFBA 3KSDO 5CP8A 2POQX 2VCYA 4CQLA 1ZBQA 3RC1A 3LVFO 1P0FA 1OZAA 2R2GA 2EKQA 3HSKA 2AA3A 1I32A 3I9OA 1E7WA 5A04A 1XDWA 3PFWO 3ZWWA 4NIMA 1NWCA 4QX6A 4M89A 3ONEA 3A28A 1DAPA 1BVRA 2DUWA 2EIHA 1PZFA 5TGDA 5IDWA 4NBRA 4DPLA 3IKTA 3JQBC 1LLQA 1PQPA 1U3WA 1R66A 3NAQA 4J1TA 5KIAA 1D8AA 4UEKA 3SJUA 4K1LA 4E6PA 2VRCD 2ZJ0A 1Y8QA 3NJ8A 3CTMA 4OKNA 2FN7A 4UUMA 3UCEA 4PG7A 2A4KA 3AY3A 3H4VA 3ZWPA 3A1NA 3EUWA 2EG9A 5L7TA 5TRTA 2PLAA 1SOVA 1LDBA 1H2HA 2ET6A 2B69A 1XELA 1QLJA 5IZ4A 3C7DB 3U0BA 4BNFA 3RUAA 3K30A 2NVUA 3LU1A 3BIOA 4UREA 1NWHA 3RUIA 5ILOA 4KQXA 1H6AA 4TRNA 4B4UA 5L95A 4CMBA 3GVIA 1U3TA 1MFPA 2P9CA 5DZSA 1JA9A 4HBGA 2J3JA 4IQGA 3GGOA 3PTZA 3ZWXA 5IXYA 1LDMA 2HDHA 5A3VA 4B3JA 3C1TA 1E3WB 4AJEA 2HK9A 4YJGB 4DC0A 5C7LO 1QORA 2AHRA 4D3DA 5L4NA 1GCOA 1NXQA 1YDWA 2PKQO 2P4QA 2VYVD 3HQ4O 4O0LA 4YJFA 5HA5A 1YBAA 4OQZA 4RF4A 3ZHXA 3CE6A 4PZDA 3FTPA 1E3EA 1YOVA 1LDGA 3IJPA 4BHTA 2AXQA 2YYYA 4XDZA 2BGKA 4JLWA 2NQTA 4MP8A 1EZ4A 4L8VA 4S3MA 1PJ3A 1LRJA 2CD9A 4GH5A 2TMDA 2YDXA 1EE2A 4PLVA 3SX2A 5TJHA 2VUUA 1EEHA 4Z9FA 4N18A 3INRA 4E2XA 3P7MA 2GCGA 5IN5A 4J4TA 1IPEA 2J5KA 3IUPA 2Q2QA 3OM9A 3WX0A 3K73O 1T2CA 1HDCA 3ONFA 4BNZA 1GEEA 4ZQHA 1LSJA 3PDUA 1OOEA 3BMOB 1NASA 2Q1SA 3CZMA 3WTBA 3WYBA 1JDJA 2Z1MA 1KVUA 4LW8A 4BO9A 3I23A 1DFHA 4ALJA 1YXMA 3QWIA 1IHXA 3GPIA 4B7UA 2GSDA 2J3HA 5DCUA 3I9MA 3JD2A 5CAEA 4M1QA 3GN2A 4JJGA 1YB5A 3MTJA 3LDHA 3C8MA 4UEOA 4BNVA 4NH4A 1Y8RB 5ADHA 1N2SA 1N7HA 2C7GA 3ITKA 2H1SA 2C59A 4MVJH 2JCVA 3JV7A 4BNMA 1Y81A 2Z5LA 1ZUD1 4ZU3A 1YGYA 2AQKA 4U0KA 1QMGA 2CNBA 3AU9A 3LT1A 1A9ZA 5EMHA 1VJ0A 3DC2A 4J4BA 4BNIA 3DWFA 4CLHA 1F8GA 1BDMA 2E49A 1QSGA 5BT9A 3V2HA 4J0EA 5CG2A 4JIGA 4WCFA 1MV8A 3VVBA 1PWZA 1EVZA 5FF9A 2RHCA 4U6QA 4XRRA 3RC7A 5CEEA 1GQQA 2R00C 1ID1A 4AJ1A 1EUDA 1A4IA 1EBUA 3V2UA 6ADHA 1OAAA 2P5UA 2I3GA 1H0KA 2NU7A 4UULA 4ALNA 4IGFA 1MP0A 4D45A 5G0TA 3JQ7A 4NNJA 3VZRA 1F0YA 2D59A 4MIYA 4MDHA 2O23A 3KYCB 3LC7O 5DCWA 1P31A 1V0JA 1HZZA 2EXXA 1NVGA 2HMWA 8LDHA 2GERA 4FDAA 1ZXBA 3H9EO 4CUKA 5B4TA 1HXHA 2DTEA 4KDEA 3GVHA 2NADA 2AMFA 4XR9A 3FWZA 3W4KA 5DBGA 2PGDA 5B4UA 5TIIA 3H6KA 5L45A 4BQRA 1XKQA 3OJLA 1PQUA 1KIFA 1X15A 2VHVA 1NPDA 2BLLA 1ENYA 5EINA 1KVRA 3ONDA 1GUYA 1F14A 1DOHA 1JAXA 1QYWA 3GA0A 2O3JA 4KUEA 4D0RA 4R3NA 1Z74A 1P1FA 4BNXA 5TLSA 2X6TA 4CLRA 1W4ZA 3ZWVA 2X22A 3HFSA 4J9VA 1WWKA 4ZA2A 5F5LA 4CL3A 4QEDA 3RC9A 4F45A 3HDQA 3UKOA 1G0NA 1L7EA 4Z3DA 3BMNB 1PGOA 3ZU4A 3K9QO 4AJJA 5AXBA 2W2LD 1AXEA 2NLOA 4YQYA 3ZN2A 4E5NA 1K5HA 2G1UA 3D1LA 3PHGA 3DTTA 4QO7A 4CV1A 4DRYA 1XEAA 3WBFA 1NBOA 3OQBA 4YWJA 1O95A 2Y1OA 4PG6A 3VKUA 3LSYA 4KTVE 4JBHA 1UDAA 5AQ1A 3MOGA 2DLDA 3NDIA 5JAMA 4OM8A 1JAYA 4DLBA 2Y0CA 5A5FA 3VKVA 4O63O 3DEYX 4E2WA 4BMNA 5KKCA 2RH4A 3GRKA 3DZHA 4B4OA 1QP8A 2EP5A 4LSWA 4PLZA 3WS7A 4CQMB 4GMGA 1AHHA 5GMOA 1EQUA 4Z9YA 4GLLA 2X0NA 2VWGA 3EZYA 4D0SA 1ISHA 4W99A 3GZNB 3QHAA 3ROKA 4XWYA 4CM8B 3BYZA 4HADA 1JKIA 1KS9A 2PKQP 4QXMA 1GQYA 2AE2A 4I5FA 2GZ2A 5FI5A 1VM6A 1DIRA 4J1QA 3O38A 4YT8A 3H5AA 1MX3A 4WUVA 1AXGA 1RYDA 3BA1A 4Y6PA 3DAFA 2PD6A 1KVQA 5GY7A 1PJSA 3AOEC 2C5EA 2O3RA 4G81A 5EL0A 5GZ6A 1LDEA 1HDRA 4CMGA 4CR6A 3M2TA 5JXWA 2O3QA 2YHIA 1Z6ZA 1W0CA 4FFNA 1LLUA 3OJOA 3M2PA 4JCOA 2P5YA 3WIDA 5L7YA 3WYCA 4CM6A 3GG2A 3JYOA 1NYTA 4J2OA 4OHUA 4BNJA 4JBIA 3HZZA 4BO3A 1GR0A 4XZ3A 1YQGA 3UUWA 3RVDA 2PR2A 2OP1A 4A5OA 4WOKA 4Z0PA 3EC7A 1JKJA 1F12A 1UDBA 4G65A 2YQ4A 3DBLA 4IINA 4JBGA 4Z3KA 2V6BA 3WYEA 1B3RA 1JWBB 4E5MA 3OIFA 4E2ZA 2JL1A 1DAOA 2GF2A 5ICSA 2WTBA 4ESOA 1E7RA 4YAEA 5I7FA 1KVSA 1SB8A 3LT4A 2NVWA 1XG5A 1B3BA 1DHTA 1Y7TA 3A06A 2PTGA 5T57A 4HUJA 4IDEA 1B26A 5BQFA 2VYNA 3I9LA 1DSSG 2C82A 4XR4A 1GEGA 1RPNA 1K2WA 3B20A 5B12A 1F06A 1UH5A 4UVDA 2C2XA 1IB6A 5KOIA 3CIFA 2R6JA 4CM9D 2RH8A 4RPHA 5COBA 1BHSA 3DDNA 4ONEA 4CQMD 2AE1A 1MXFA 5DOVA 4YDRA 3G49A 4EEZA 1QYVA 3MWEB 2PK3A 2GN4A 2I3AA 4CLDA 3JYNA 1BGVA 1NTOA 3GQVA 5KWEA 1RKXA 4B4WA 1SC6A 4QFDA 1F8FA 1HSZA 4RGBA 5TF4A 4J4HA 2NNLD 1VL0A 4OAQA 3LLVA 1C1DA 1SPXA 3TNLA 3W8FA 1ONOA 1C3VA 3AM4A 4CM5A 2GD1O 4RQUA 3TOZA 5ITWA 1BXZA 2UVDA 4IJUA 3EY4A 5AXDA 5F1KA 1N9GB 1DC5A 5U1PA 1O9BA 2Q99A 1QYCA 2GRAA 4RQTA 1WW8A 2UV8A 3EAGA 1A9YA 2HMTA 4H7PA 1T26A 4RPLA 2CDBA 3S1LA 3ST7A 3JQ6A 4P8RA 4XA8A 3LT0A 3RU9A 2ZTMA 3PP8A 1R4MA 4D46A 1DFGA 5G4KB 4CLOB 2Q45A 1RM5A 2HMSA 5KJEA 3DBHA 3W4JA 4CLEA 3F4BA 1QV6A 1Q0QA 4OKIA 4ND4A 5ICMA 4GL4A 3W1VA 2HU2A 4YRBA 3VPHA 4YYZA 2DQ4A 5IDYA 1ZFNA 1SO8A 3JD3A 1Q7GA 4M49A 5EIOA 1VL8A 1X0VA 5T6BA 3S8MA 3JQAA 3LF2A 3L6OO 2RHRA 1B8PA 5G0VA 4I5DA 3AY7A 5JW6A 4D3SA 1XA0A 4TQGA 9LDTA 3DBHB 3PWZA 1U5CA 5H82A 3MCVA 4YPOA 1CQIA 4L9RA 3SEFA 3F1KA 3ZWCA 2DU8A 2DT5A 2JHFA 3RBXA 2WJPA 3ENKA 1HKUA 1Y1PA 3H3FA 3Q9UA 4MVJA 1JVBA 1BRMA 3U4IA 4J43A 4HY3A 1QV7A 4D7AA 5KVVA 3JQCA 4JJIA 4PLYA 2Y1DA 2BF7A 5L9AA 3U3XA 2QW8A 1WMAA 1Z7BA 2Q1UA 1Z7EA 4LN1A 1P45A 3GHHA 1MUUA 3S2GA 3FD8A 4ROSA 5KKAA 4EUHA 1JW9B 2YQ5A 3KUXA 4XYBA 2IODA 1P33A 3CXRA 2D8AA 3E9QA 1E7QA 1KC3A 4I9NA 4A0SA 4WLUA 1GADO 1E3LA 3GF4A 1PGJA 3KTDA 4E33A 5BR7A 2I6TA 3KB6A 2W90A 1B7GO 3MOIA 1ISFA 1B14A 1X0XA 4FR5A 2E4AA 2EW8A 3R0IA 3BMQA 3ETEA 4AJNA 4DBZA 1LSSA 5TSDA 3CUKA 2CMDA 4IS3A 3DOCA 4MVJI 2BFOA 1HE3A 3WNVA 2WE7A 1XU7A 2ZYDA 3IAHA 1L7DA 3PYMA 3DMTC 2HUNA 3ZNPA 3ZU5A 2ZB3A 1IULA 2C54A 2FWMX 2YV1A 2O4CA 1XCBA 3WOHA 3BMCA 4BNHA 4IDGA 3S2IA 1DHRA 1CETA 1SMKA 3LF1A 4J91A 4C7KA 2DFVA 3GUCA 5JFOA 1BW9B 2EGHA 5ENVA 1ONNA 3DBRB 4ZN6A 3ZZNA 3QA9A 5L7WA 4XIJA 4KOAA 5T64A 1KC1A 2RIRA 1VI2A 1EK6A 1U4SA 3B70A 2HCTA 3TN7A 3G3EA 3E03A 3H5NA 3Q2KA 3UN1A 3F5SA 1E7YA 4FGWA 1V3VA 3OQ6A 2WMDA 4F6LA 1WXDA 3P2YA 3OBBA 2NQ8A 3IJRA 2VOJA 3AK4A 3M6IA 1D1TA 1RYEA 1O5IA 2IRWA 1SEVA 4IBOA 4OGWA 2HMVA 3UAGA 4KUGA 3EMKA 2EV9A 5JAIA 2FR0A 1FDSA 3FPLA 4B7XA 2QX7A 3N7UA 4OOFA 1I3MA 5MGBA 1E6UA 5JBIA 2CVOA 4GLOA 5EPOA 3QWHA 5I8WA 3GT0A 4QSMA 1PJTA 3NGXA 1C0LA 2H9IA 2Y67A 4ZQFA 3JQBA 4EJ6A 4KTTE 3L4SO 1ZH8A 3D5QA 2OOSA 2WYUA 3GAZA 3NKLA 1FDVA 3TJRA 3D3WA 4DIBA 3JD4A 5LC1A 1O89A 1ZXLA 4W6ZA 2QG4A 3ZNQA 3QIVA 1R4NB 4DLLA 3D7LA 3P5SA 3MEQA 5JS6A 2OORA 1PS9A 3PLNA 3AFNA 2XF8A 3CINA 3WTCA 2PFGA 1X14A 4BO5A 4PFJA 1HDZA 1UJMA 2OO5A 1W6UA 4WK6A 3KHUA 5CDUA 2GDZA 3I6IA 4J49A 1YBVA 3GGGA 4F3YA 3KEQA 4XYLA 4R5HA 2NM0A 1IY8A 1E3SA 5IN4A 1HTBA 4FD3A 2WD8A 5DBFA 1E1MA 4ALKA 1ISGA 2BFPA 1UZLA 2Q46A 1LNQA 3U5TA 5JPIA 1ENOA 1V8BA 3I1JA 2VHZA 3RFTA 3ZNNA 3VDRA 3MJ4A 1N92A 3ASVA 4IDCA 4YACA 4RDHA 4YCAA 1O94A 9LDBA 3RUEA 3F4LA 3WXBA 1RM4A 2Y1FA 3AI2A 4Q3NA 3RFXA 1JWAB 3ENNA 2YHUA 3K5PA 3PJDA 5COAA 3V1TC 3WBBA 5IFLA 1HL3A 2Q2WA 4F46A 3GNSA 3QLJA 3VTFA 3ZNOA 3JQ8A 3OIDA 1PGNA 1DB3A 3JQGA 4HXYA 4L4XA 2D3TA 3F3SA 4XEHA 3OECA 3I5MA 4W82A 2WD7B 4KWIA 1T1RA 4R01A 4RV9A 2CUKA 5H81A 3ZDFA 5I9NA 3WGHA 4TRJA 5AOVA 5I9LA 5JYDA 4OXYA 4Z0HO 5G2OA 5DCYA 5TT0A 1N7GA 3G79A 1XHLA 4CMCA 1YS4A 2FZWA 3HG7A 1YB4A 1W73A 4JX8A 4PIVA 4ALMA 3JQFC 1C1XA 4IDFA 3WWZA 3DR3A 1FF9A 3GDGA 1FK8A 3F46A 4DGSA 5JLAA 1T24A 4DBVO 3BTSA 4RJTA 3GVCA 1ZSNA 5G0UA 3AM5A 1ZK2A 2C07A 4AJ4A 3FF4A 1K6JA 2EW2A 4E0BA 1UXGA 3U49A 2F1KA 4PCVA 3OIGA 3KSZO 2YUTA 5ILGA 5TX7A 4CQLB 2NTVA 1OC4A 1U5AA 5EERA 4BO1A 1ULUA 3CH6A 4XYEA 1I2ZA 2DUUA 3HWRA 3PQFA 4IPTA 4O59O 1LEHA 1E6EA 3OMLA 4GSKA 3WJAA 2DFDA 3B1JA 4MP3A 5EQFA 1NQOA 3BHMA 3HHPA 4DA9A 5IF3A 3TDKA 1RM3A 4NQZA 4PLWA 5DP1A 5C7IO 4BNYA 4EDFA 4R1UA 3JSAA 2OP0A 3Q9NA 1OFGA 3KZVA 4RF5A 1Q0LA 3L4BA 4ZD6A 1U2DA 4QFCA 3PRJA 2GN8A 4R1NA 1NHWA 4OIMA 1AGNA 2FRDA 4BO8A 5A02A 1ULSA 3IS3A 2PWZA 4Y8VA 1Y8QB 2FY8A 1ML3A 3CKYA 4O5OA 3ZU3A 1M6HA 3WR5A 1LX6A 2D5CA 5LDHA 3ANMA 3RROA 1T4BA 2R00A 1R37A 3U9LA 3TF5A 5A9SA 1N8KA 1TVEA 1P1IA 4CMAA 3S55A 1I30A 1DFIA 3ANLA 1C0KA 1WDMA 3GDOA 2Q4BA 4KZPA 5CDSA 4DREA 1ENPA 5DULA 4CMIA 2HKIA 4WEOA 2Y68A 4C7JA 2YV3A 2NVUB 1WZEA 3Q3CA 2IEDA 4I1IA 4RORA 1HETA 5DNAA 5C3MA 4LSMA 4NFSA 1CYDA 3JQ9C 4R4JA 4J7CA 1LRLA 1I36A 3L9WA 4PN3A 3QWBA 3WSWA 3PFFA 4KWHA 1QYDA 3H2SA 3ZW8A 1Y6JA 4J1SA 2EP7A 2JKVA 2OFPA 2JJYA 4FGSA 4J7XA 2UAGA 3TFOA 1O0SA 4YVFA 2A35A 4K26A 4DVJA 1NQTA 5CFZA 2E82A 3I9NA 2QRLA 5DOZA 4RLSA 1VJTA 4YJFB 4BNNA 3E18A 4U0JA 2W2KA 3RSHA 3ZWYA 4RVUA 1BVUA 1PIWA 4CMHA 5MDHA 4X54A 1YOVB 4CMKA 3RUCA 4KMSA 4XKJA 5JY1A 2JCYA 1J5PA 1ZIDA 4ZVVA 3GVPA 3PI7A 2HJSA 1IOLA 1AE1A 4YBZA 2BFAA 1CQJA 2X9VA 1VRWA 3VH1A 3MJVA 4E21A 1DJNA 3DTYA 4W4TA 3T7CA 1HEUA 1H6CA 3OJEA 1YL7A 4DMLA 2ZTUA 4J7UA 1DRUA 2X0JA 3PYLA 3D4OA 3E8XA 4R54A 4AJLA 4DPMA 2Y0EA 4TWRA 3HN2A 1PJLA 2V65A 3EGOA 2FR8A 5ER6A 3FTNA 2X58A 2JAHA 1TI7A 3PLRA 4XJSA 3H7AA 4R51A 1L1FA 4FB5A 1LQTA 5A4DA 2YV2A 3ASUA 3PPIA 3HB5X 3I3OA 4HFMA 4L4RA 1LXCA 3C1AA 1ZK3A 2B36A 1V6AA 2QIOA 4HWKA 1UZMA 3BXXA 2ZATA 3VTZA 1U4OA 3WGOA 1VSVA 3QWFA 5T67A 2ZJ1A 1EMDA 4BO4A 2Q4EA 3NUGA 3LYLA 4YAGA 2VUTA 3E6AA 2H63A 1GUZA 2O3SA 3UOGA 3ZHBA 5JSFA 3DFUA 4J0FA 2BD0A 2EJVA 5ER9A 2D1YA 4QUKA 4Q3DA 3I9KA 4GKBA 2GUGA 2Y66A 3QW2A 2V6GA 3DHNA 4MKZA 2H5LA 1XR3A 1Q2XA 2C7VA 4WNIA 5JE8A 2ZYAA 4J2HA 4FCCA 1XLTA 3AOEA 4WOJA 3PQDA 4CMEC 3EDMA 4R1SA 3F47A 3GNTA 1SZJG 3BHIA 4D41A 1P44A 4YTEA 1BMDA 1HDOA 4TVOA 1DPGA 4DQVA 3B1KA 1ZK0A 3CSDA 4WCFB 1BTOA 2CF5A 5BNTA 1UXKA 2GO1A 4IQ0A 2ZTVA 2X4GA 1RJWA 3TOXA 4DQUA 4BKRA 4IM7A 1GD1O 1I3KA 2VWHA 3F6YA 3I4CA 1T1SA 3RUHA 3T7EA 2GN9A 3OSUA 2X86A 4TZKA 1BXGA 4LCEA 5FEUA 1J0XO 1KETA 3JQ7B 4RCVA 4CV2A 2P2SA 2VT3A 1GU7A 4IDBA 2YW9A 3D3EA 2XPCA 4LMRA 1CRWG 3KM0A 1H9AA 4PGFA 1YKFA 3IP3A 4NI5A 5L53A 3DZKA 3PEFA 3HDYA 4R9RA 4NJMA 3GRPA 3TPCA 3DAPA 3AUUA 4CM4A 4NZ9A 3E5RA 4GX5A 3Q11A 1EUCA 4PLTA 4J6FA 1EQ2A 4LK3A 4WE3A 1NFQA 1VSUA 3V1UA 2NU9A 3WDSA 1H6DA 4FS3A 4I9UA 5CDYA 3B6ZA 3AM3A 3BTUA 4HP8A 4MPDA 1YQXA 4CLRB 1DIGA 1TXGA 4NJMB 3SC6A 2BMAA 3OF2A 1Y5RA 4K6CA 4NPCA 3TL3A 4IJVA 2RAFA 4BNUA 1HZJA 2J5QA 3L9XA 3QVWA 2YY7A 4FSHA 4ND3A 2XOXA 5GZ3A 3AOGA 3U62A 5BSGA 1R15A 1BXKA 1E1NA 5KJFA 4P22A 4BO0A 3L6DA 4AJKA 5A06A 5CEJA 5G0WA 4AFNA 4RVGA 1GY8A 1NFFA 2E6UX 4OMUA 4YRDA 1Q7CA 3NTOA 1B16A 1DJQA 4BNWA 4EZBA 1PWXA 5G0SA 3IL2A 2G82A 5BNIA 4K28A 4BMSA 5IZCA 1KEVA 2NSDA 2VRBA 3HADA 2WDZA 4PRKA 1MC4A 2LDBA 3VZPA 3VH2A 5JY6A 3JQEA 1OC2A 1JVSA 3GGPA 4N5NA 4YT4A 3E1KA 3WG9A 1IUKA 5A9TA 1BSVA 5DDIP 4BV8A 3BZUA 5AXAA 5I7EA 1PR9A 3OH8A 1VJ1A 3WQSB 4RVDA 4B3IA 5ITVA 4RPKA 4XX0A 2IYOA 1O6ZA 3RAJA 5JDIC 4OL9A 3TZHA 5TQVA 1P9LA 2HQ1A 2TMGA 5CHEA 3MWDB 2I9PA 5H83A 4LCJA 5CPBA 3WIEA 3KEOA 1LBEA 2GASA 4WCFC 4ND1A 2BFMA 5DN9A 1KERA 3G0OA 2H6EA 4TSKA 1JU9A 5JC1A 4EW6A 1E1KA 3PHIA 4M87A 3T4EA 1DEHA 4EEXA 1ZK4A 2AQHA 3ADOA 1WNTA 1NX6A 3ADPA 1U28A 3SLGA 2YHIB 1UDCA 2D2IA 3DL2A 3WJ7A 4GGPA 1CWUA 1GV1A 1PJ2A 4JNKA 5IXSA 4Y67A 3OEWA 5FYDA 1QG6A 3JQDA 1HDYA 2BGMA 3R3SA 2C0CA 3QV1A 3AI1A 2UUPA 4Y6SA 1H5QA 2I99A 4KUHA 3KBOA 4I5GA 4WECA 4URFA 5COQA 4ITUA 3WGYA 2CF6A 4NG5A 4AJ2A 2BI8A 1NPTO 2J8ZA 3WMXA 2UUOA 3DBLB 4MIOA 4XYMA 1GZ3A 2HK7A 2P9EA 2ZCVA 5AYVA 1PS0A 2YZ7A 3ZWBA 4W7IA 3W4IA 4Y98A 5ENDA 5F1PA 4BNGA 3H8VA 4CV0A 4P4GA 2FZEA 1PL7A 3GMSA 5U9CA 1SNYA 3GOHA 2IE0A 2VOEA 2PD4A 1T4DA 4Q3EA 2PV7A 1I5RA 4OJNA 2Y93A 4QQRA 1G6KA 4J16A 1NR7A 3HDJA 4TZTA 3RCBA 2B37A 4GKVA 1HWYA 4FFRA 5C37A 1ORRA 3PIDA 4ZGWA 1EVYA 2JAPA 3QWAA 4HV4A 4AVYA 3NTRA 3ZGYA 3SBOA 5I7SA 4Z6KA 1PX0A 4FJ2A 1GCUA 1PZHA 4XQ9A 3HUDA 3ORFA 3VZSA 1PGQA 1WAMA 2D5AA 4XGIA 2FR1A 3DMTA 5LDGA 1E7SA 4A2CA 2C29D 2AQIA 1B0AA 5CDGA 5CPFA 2NVBA 4B8ZA 5CDTA 1SEPA 3GZ4A 3H3JA 4BKUA 2G17A 4DUPA 3ICCA 5JAZA 3WICA 1C1DB 2GZ3A 3UHAA 3B1FA 1PR3A 2PH5A 3KV3O 1NAIA 2P4HX 3A4VA 3H65A 1ZZEA 1EK5A 3G1UA 3C7CB 3VPSA 3PZBA 4YAIA 5HTOA 3GN1A 2B0JA 4CPDA 1CDOA 1U2GA 2ZK7A 3AFMA 1NM5A 2DC1A 2BKAA 1HYGA 1P1KA 1R4MB 1QXSA 4M86A 3NEPX 4DIFA 5JO0A 1DLJA 4ILKA 4AG3A 1J49A 1FDUA 3C3XA 2O2YA 3Q1LA 2BHLA 3ZHYA 4EUFA 1PS8A 7ADHA 2LDXA 1KOLA 3NT4A 2DBZA 1FDTA 4FC7A 2I66A 3H9QA 3GY0A 4QT0A 3E9MA 3OHSX 1SBYA 4H16A 4WPGA 4DTIA 3DQPA 3P19A 3JQAB 2Y05A 3W6ZA 1UAYA 1KBZA 1V3TA 3GPDG 1CERA 1K6IA 1WVGA 2PA3A 4JXKA 3WFIA 2WWRA 3G1TA 2VYND 2P68A 2X5KO 1AN9A 4ALLA 1M67A 4DYDA 3G17A 3EK2A 1PGPA 2IZ1A 2PNFA 4W9NA 2V6MA 1ZKMA 4ZQGA 2OHXA 4FBGA 1VLLA 1I8TA 1E3JA 4GI2A 2IXBA 3VZQA 2Y1GA 2O3TA 4XQGA 5GZ1A 1XGKA 3KRTA 4JQCA 1FXSA 4MIEA 2B4RO 3V8BA 4UUPA 2VHYA 1E5LA 4UVIA 2B83A 1P0CA 2X9GA 2VQ3A 3IUSA 4DYVA 5JO9A 1Z73A 3WQQA 2OXIA 1EFLA 2CZCA 2NTJA 5K6AA 1HLPA 1DIHA 4IIVA 1ONPA 3DMYA 3ZW9A 2VNSA 3FNGA 4IGEA 3WSVA 4CJXA 4GWGA 1MGOA 1I3LA 4D79A 3BMQB 1N1EA 5K0ZA 3LT2A 1BWSA 5C5IA 1KEUA 4WCDA 4FFOA 3C7AA 1VE9A 5I8ZA 4BNKA 3VH4A 4FQ8A 3Q6IA 3O8QA 3D4NA 4YT5A 3NT2A 3PYXA 4Z9XA 2J3IA 3GHYA 4E31A 1Z82A 3QQPA 4FJ0A 3C85A 4J9UE 3LZ6A 3BMCB 3WQRA 5HRUA 1SB9A 2Y1EA 4CLXA 3WLEA 1ADGA 1KVTA 3ZWAA 1HT0A 4TMFA 2I67A 1H94A 3JQAD 5T8KC 3GFGA 3S2FA 1A7AA 2JFHA 4R16A 4XGKA 4MOWA 2CDAA 4II2A 5JAQA 5EJ2A 3LC2O 1NQAO 4BVAA 3HE3A 5I9MA 1EVIA 1TT5A 1FJHA 3KVOA 3NDJA 5IJZA 3VC7A 1DC4A 3PWKA 4NDNE 4OSPA 3FHLA 3GNQA 4XD2A 2F00A 1Q0HA 3ZWOA 3QRWA 5JC8A 1MLDA 4N5MA 3AUSA 3AU8A 3K2EA 4XB2A 3RBVA 4NJOA 1YRLA 1DRWA 2J3KA 1GTMA 3VVCA 4MVJD 4OSOA 2Y0DA 4MVJG 2JHGA 3FR7A 3GAFA 4OXNA 1R0LA 2DAPA 5EQDA 1P1HA 4MVJP 1HE5A 1ZMTA 2Y99A 4JROA 2VT2A 5L51A 2Q3EA 4GSLA 3E5MA 3GMDA 3QVTA 4GQAA 4JK3A 4M54A 4BV9A 1YB1A 1U3UA 3JD0A 1Y9AA 4IMRA 1GL3A 4R9SA 3RD5A 3KO8A 4K6FA 1GZ4A 4YJDA 4A73A 3GEDA 3IKVA 1PTJA 2VRCA 3D3WB 2X8LA 3NRCA 1X7GA 4XCVA 5JMPA 1KEWA 4B79A 4B8WA 2JD2A 2HLPA 1EUZA 3LLSA 4CR8A 2CY0A 4BGIA 1PSDA 4JGBA 4LRTB 3UXYA 2VZ8A 3V1YA 5KCZA 4M55A 3E82A 2FPIA 3I9JA 3KLMX 1NNUA 2WM3A 1KY4A 1YONA 1PL6A 3JD1A 2ZQZA 4XJTA 3UCFA 1WDLA 3RASA 4HFNA 3WGTA 1D3AA 3KYBA 4LVCA 4WLOA 4AJPA 2AG5A 4BB5A 1LQUA 5C7OO 3JQ9A 5JNLA 1XYGA 2GYYA 4OQYA 1P1RA 3GLQA 1ZVMA 3ZCXA 1B15A 3OQ1A 4DC1A 4PLFA 4HFJA 2PY6A 2Y1CA 2ZQYA 1IE3A 3K31A 3FRJA 3H2ZA 3BTOA 3H9UA 4OO3A 1WP4A 4HFRA 2QQ5A 3D4PA 2FSSA 4U8GA 4PG8A 2DKNA 4FPXA 4N54A 2VYVA 4AL4A 1M66A 3OA2A 1XQ1A 4WNCA 2CFCA 2VTEA 3PGJA 1ZMOA 4PZCA 4XQEA 4AJIA 1M6WA 2OGUA 3JQ8B 5B4VA 3CMMA 4I08A 4NHEA 3JQGB 4PLPA 3GEMA 4PRLA 4MP6A 4YQZA 4PG5A 4DWVA 4E5YA 5TS3A 1RWBA 1YJQA 1U1IA 1N1GA 2UDPA 4OXKA 2AW5A 1QKIA 7MDHA 5BSEA 3T4XA 1ADCA 1AUPA 4R69A 1V9LA 2PKRA 3ZV6A 5F1OA 1UZNA 2CSUA 4G2NA 4RVHA 2VUSA 2X1HA 2VN8A 3NT5A 4I5EA 1D1SA 3TZCA 5HWSA 1C1XB 2X5JO 4L4SA 3WMWA 1EFKA 1K3TA 1LUAA 1NVMB 4UUOA 1JQBA 3VDQA 4R1TA 2UYYA 1MXHA 4IDAA 2GGSA 4NBWA 5T5QA 1GYPA 2ZB7A 1ZO8A 2BRUA 3DFZA 4BKPA 2DPGA 3F1LA 4L76A 3UH1A 4NBUA 2WYWA 3E9NA 1GFSA 4IJKA 3DZFA 3DOJA 2NWQA 1FDWA 1LDNA 1EDZA 3M1AA 4WLNA 3U4HA 5DBIA 4LGVA 3RU7A 3ZWNA 1H9BA 5BSFA 1GPJA 3A14A 4UUNA 5ES3A 4E13A 1IPFA 1UP4A 3JYLA 1E77A 2VZ0A 4Q9NA 4CMEA 3FSRA 3GEGA 1E3IA 3DONA 4N5LA 3D64A 4EBFA 1P1JA 1UR5A 1VC2A 1E3WA 3FPCA 4YJGA 2EF1A 3KETA 4GPD1 1O8CA 5TJ9A 3I83A 4L75A 1T2FA 2ZCUA 2Q1WA 4ZQEA 2QYSA 1UXHA 3OA0A 4CUJA 5A9SB 2OUIA 2O2SA 1M75A 2J5RA 2JD1A 2NU6A 3PJGA 4H15A 4WASA 1ZSVA 3HFGA 3VH3A 4CMIB 5L40A 1V35A 2V7PA 1A5ZA 3OJFA 1C14A 3O26A 5DT9A 2Q2VA 5K9ZA 1EE9A 2JCXA 3SXPA 1SCUA 2BI7A 4A03A 2BH9A 3VAZA 4EI2A 3K6JA 2EGGA 3L0DA 5FI3A 5IAAA 1I0ZA 2PD3A 1GAEO 1TEHA 2VNAA 1LDYA 5JDCC 3RJ5A 3X2EA 1R0SA 5DP2A 3BMOA 4OH1A 5KJ6A 1A72A 1IZ9A 3M1LA 3R3JA 3WGQA 4DL9A 1YL5A 2A94A 2W2KB 3VPFA 2B35A 4R5MA 1R12A 1SAYA 3F9IA 4BS9A 3INGA 3FI9A 4MVJE 3VHRA 3EHEA 3AUAA 5TC4A 4RDIA 3TFQA 1Y8RA 2DBVO 1B8VA 2DTDA 3KYDA 1F17A 1LLCA 4ZQBA 2W2LA 4HKTA 3BHJA 4TROA 4C4OA 4RVSA 4XYGA 1ISIA 4DLAA 5THQA 1MA0A 3L77A 3QY9A 1K6XA 4BOYA 2HRZA 1YVEI 2DBRA 1LJ8A 2GNAA 3GG9A 4D43A 2QHXA 2VHXA 2JFGA 2XXBA 1YE3A 1KYQA 4H3VA 3KYDB 4RL6A 2HSDA 2GPTA 3IOYA 4FFPA 5A05A 1A4UA 3D5TA 1S6YA 3FWNA 1U3VA 3DZBA 4JN6B 4FOOA 4IXWA 1FMCA 4R3WA 3TQHA 3LK7A 4INAA 1TT7A 2VHWA 4EITA 1X7DA 3GK3A 2HO5A 2W4QA 2Q1TA 4UVHA 4HNGA 2P9GA 2QYTA 3LQFA 5BNFA 1A71A 5J23A 1R16A 3FR8A 1P74A 3L4BC 5JDIA 1WMBA 3GVXA 1IL0A 5A03A 3FNFA 3KYCA 4BMVA 1A7KA 2IYPA 3IC5A 1S7CA 2EERA 3DZIA 1R6DA 3ZHZA 1I24A 4WLVA 3MTGA 2Z95A 4JJFA 4CL8A 5KVSA 1YQDA 2GR9A 2AEMA 4L74A 3HN7A 4IIUA 3SLKA 3PIIA 4O6VA 4ND2A 4FFMA 1M76A 1PJQA 2DBQA 2NACA 1B2LA 2W98A 2ZKLA 3W8EA 3RKRA 2IEBA 1HRDA 4FJ1A 4CODB 1Q7BA 1ZEMA 4BO2A 4PLCA 1E1LA 3IDSA 4UEJA 4CM7A 4CM3A 1X13A 1MG0A 2X23A 3ZWMA 1XU9A 3ZI0A 2GN6A 4GWKA 3V5NA 1BXGB 3ULKA 1NPYA 3I4FA 2DTXA 5KJ1A 3BMNA 5HM8A 1PU2A 1GQ2A 5A9RA 5IDQA 3ON5A 3DXFA 3BTVA 4UVGA 2E48A 1M2WA 4Y9DA 3AWDA 3K8ZA 1UUFA 4QECA 2D0IA 1JN0A 2I5PO 2YJZA 4LISA 4CM4B 3PHLA 2FMUA 3DHYA 4FC6A 3X2FA 3DAGA 3BAZA 3PXXA 4UAGA 4WLEA 1U8FO 3CZRA 1H93A 2EJWA 1C0PA 3DB2A 3FN4A 1H2BA 4MKRA 1IHYA 3WWYA 1MG5A 3TZKA 4CM9A 1MC5A 4F6CA 4YT2A 1YJ8A 5KNLA 3H9GA 3MJCA 1NHGA 3ANNA 3W6UA 4CQMA 5I7VA 2CVZA 1UP7A 2PZLA 3ZU2A 1K0UA 4YXFA 2YDYA 5F21A 3PZRA 2ZB8A 1WDKA 3D0OA 3EW7A 3GZNA 1DO8A 2HK8A 4ZRMA 4CM8A 4DQXA 4P38A 1DIAA 1QLHA 4N7RA 1PL8A 1YO6A 1HE4A 4FN4A 2DPHA 3O4RA 2Z1NA 4YJHA 1GDHA 4GVLA 1J6UA 3PWSA 4RO0A 4OYRA 2J6IA 1WZIA 1HDGO 3OFSA 1NP3A 2NUAA 3CPSA 4CMJA 2HJRA 1VKNA 1LC0A 4HX5A 2B4TO 4YAKA 4XRGA 1DDOA 1ZNQO 3K92A 2IDZA 4DXHA 3ROPA 1YDEA 1X1TA 1U7TA 4BNTA 1HSOA 3GUYA 2SCUA 4EJ0A 4YJHB 5A5EA 1T2DA 3A9WA 2BGLA 4BO6A 2X0IA 3NTQA 4II3A 3F5QA 4YEDA 1I2BA 4BUCA 3CMCO 2EEZA 1C0IA 4RVFA 3MJSA 3Q2IA 5JMWA 2O50A 1WPQA 2A9FA 1U8XX 1PZGA 5BSHA 2B5WA 4BKQA 3HNPA 4LRSB 1D4FA 1X1EA 4ND5A 3PHHA 1TLTA 1ZEJA 4WJZA 2OBYA 3SVTA 3ROMA 3MJTA 4FIZA 1DXYA 1DRVA 1K89A 1HYHA 3NJ4A 4IZHA 3KXDA 1PJCA 2WYVA 1Z45A 3HB4X 4EUEA 1CJCA 3DZJA 1VL6A 2OBNA 2QZZA 2P91A 4I8XA 4RF2A 3INTA 3RUDA 4E3ZA 4CM1A 2G0TA 4L73A 4IZIA 4MO2A 1UXJA 4UVEA 1ZK1A 4Q3BA 4QO8A 4WGGA 1JKFA 5U4QA 3RWBA 4R41A 3R6DA 1D7OA 4U7WA 3GDFA 3LC1O 3WGZA 4GGOA 3U09A 4GX1A 3L6EA 2GLXA 1DC6A 4GX2A 4J90A 4BNLA 1BDBA 1XWFA 2EWMA 1KEPA 3RFVA 3JYPA 4Y6RA 1LC3A 3DHEA 5IG2A 4IUYA 1UAGA 3RJ9A 3SC4A 2O3UA 1E92A 2Q49A 1N9GA 2X0RA 4J1NA 1H6BA 2HAEA 3EVTA 1NVTA 1PJBA 4GX0A 2X7HA 2AEJA 3P2OA 1YBMA 4BGVA 2AG8A 3AW9A 5HS4A 2VWQA 5KJCA 4W7HA 8ADHA 4RPGA 3WLFA 4NFYA 5FWNA 3VPXA 1IZ0A 1DLIA 1HDXA 4P4LA 3NGLA 3VOSA 3TWOA 1ZSYA 1GYQA 4LVUA 5IDXA 2O48X 4E30A 5G4KA 3PJEA 4NBTA 4CLOA 3OETA 3KOUA 4ZJUA 1I10A 4BGUA 5IZCC 1E6WA 3FBTA 4NK5A 4EYEA 1ZW1A 4EGFA 3WFJA 1Z75A 5B37A 3DO5A 2AQ8A 3HJAA 4GBJA 3UICA 2A92A 5JCXA 3QE3A 2HMUA 1Q1NA 4P4NA 2ZTLA 1UP6A 3QVOA 4Z0TA 1MB4A 3PVZA 4PLGA 2DVMA 2JD0A 2PZKA 5T8KA 4R68A 3WNQA 4PZEA 4NR0A 1GZ6A 3NX4A 2PGJA 2HRBA 4B3HA 1HE2A 2WSBA 4DIOA 1QRRA 1HLDA 4A27A 2GZ1A 3H5RA 5HS6A 2VWPA 4GVXA 2QZ9A 4KP7A 3U4CA 2YFHA 4S1VA 2ILTA 1QYXA 3FNEA 4PG4A 2ZIZA 3C1OA 4BIIA 1R0KA 3ZV4A 2O7SA 5L4LA 2EKPA 1JTVA 1LA2A 2VTDA 1VKOA 3ETGA 1CEQA 4WKGA 4CV3A 4ZRNA 2EHDA 3UFXA 1OBFO 3NYWA 2G76A 4NU5A 3SJ7A 5CG1A 4MJLA 5F5NA 3UGKA 2PZJA 3R1IA 4GAEA 1N5DA 2I65A 5A3JA 3I6QA 1DBVO 1I01A 4IJWA 2XAAA 5G4LA 3IP1A 1XQ6A 1YWGO 3PQEA 3ITDA 1TB4A 1GUFA 1ZJZA 5L3ZA 4DMMA 1NFRA 3DZGA 4OOEA 1DC3A 3EZLA 3QP9A 4E32A 3K2BA 2ZYGA 2EKLA 3E48A 1WLYA 4WEQA 1ARZA 4RF3A 4CUZA 4NU6A 5KVCA 1NAHA 1GV0A 2WE8A 1E7MA 2C5AA 2FPGA 3I52A 4BQPA 3QJ5A 1EDOA 1EBFA 4I9HA 2D4AA 1A27A 4TKLA 5HBRA 4A26A 4IXTA 4Q39A 2NV6A 1LSOA 4CR7A 4NFHA 3QVXA 1I3NA 2I76A 1PQWA 1CIVA
chains in the Genus database with same CATH superfamily
2C42A 2FHSA 1EIZA 1CR0A 5G41A 2PH3A 1BW9A 3EQ7A 1XRSB 3BWYA 4MWZA 2QLNA 2PSHA 2WU1A 4IQ8A 5JYEA 1AU9A 1EI9A 1E4OA 4EA9A 1DCMA 2V74B 3EVZA 1ZUIA 5I5EA 4E5PA 3PDJA 3K4QA 2BR5A 3NOQA 4FOSA 4H1UA 4Z2YA 3A6LA 1V3UA 2BFWA 4G9EA 3E5NA 2ZE5A 1U7HA 1PE0A 1JALA 3OAAA 1JIVA 1HYEA 3ABIA 6REQA 4MS3A 1P9RA 1T2AA 2Q50A 1RXYA 3IQDB 5HKLA 5JCJA 3S40A 3HA5A 5ESDA 4DV1B 1NBME 3VU9A 3C8HA 1GLNA 4ZKEA 1JDBC 1XQVA 1JEDA 1P2VA 4GMKA 1H1TA 1YDMA 4V02A 4E14A 2RI6A 3RS9A 3MS2A 3WGGA 1ULAA 2JHAA 2RBEA 2VXOA 2ZLBA 1K7XB 3HCFA 3MJEA 1L5WA 1QYRA 1RRMA 2O1WA 3DZCA 3OTQA 1JLLA 1G2OA 2ZVPX 5CTAA 3TLGB 4CCWA 4IIJB 4NOLA 4JLOA 1NV9A 4M98A 1SIWA 2JF0A 3EGCA 3AVVA 1GHTA 4ZDIA 1XNHA 2HV8A 3O2SB 1M34A 4TRRA 4TVBA 3LCMA 1ADFA 1QPGA 1YH3A 2E6KA 1QQ6A 2QR2A 1SVNA 3PHJA 1I2CA 1PEDA 2IEGA 3BZBA 4NYMQ 1KQOA 3V1LA 1QCDA 2HCFA 4XDYA 4Z9BA 3GRFA 3UK0A 1JDZA 3IAAA 5CUQA 3GLGE 4L0MA 3H11B 1LTHR 3I2GA 1TA4A 1QH8B 2Y76A 2L18A 2NYVA 1NKSA 1NTRA 2R5FA 2WDPA 3E9CA 4HO1X 3WDLA 4C2UA 3JTMA 1Y7IA 1XTRA 4ZHQF 3BD8A 4Q6BA 3N2GB 4U2KA 4YAFA 4X20B 4ZK6A 4FUQA 2FKAA 4TLCA 3NAMA 4V0MA 4D2IA 2ATXA 3UF0A 1Z18A 3KSUA 2NN3C 2YFQA 3BXPA 5AHKA 3UANA 5CH5A 4MSUA 1N32B 1VHTA 2J7PD 1ORHA 1C29B 1OX4B 1NMSA 1W8DA 2G4LA 2FSVA 2WKWA 3MPUA 4NBVA 3RU3A 1NQ5A 1ZCJA 4LXIA 4D44A 4HNHA 2YH2A 2OV8A 5F3RA 3N2KB 4NP6A 1G6Q1 5L3SA 1VPDA 3C6YA 2W71A 4P4UA 1QR6A 3T5DA 3OQVA 4KIJA 5B1IA 3BRCA 1M8FA 3S5UA 1RE1A 1LSUA 4C4RA 1OXVA 4MWSA 3R3WA 4X65B 4L3WA 5AJUA 5EOVA 2DT8A 2XQVA 5NULA 1GKKA 3V8NA 2Z6VA 4F5WA 1TGYA 1THMA 4JXJA 4NBSA 4OM7A 3TZQA 3A58B 3IR7A 4CI0B 3IMGA 1A82A 3G2HA 4HWGA 3EEOA 2HLHA 2F4NA 1ATZA 1KU6A 1T1JA 2BFFB 3ET4A 3GR6A 1LI4A 3MOSA 3OEYA 4IS2A 2H1WA 4KK3A 5A7GA 5HUHA 1EVJA 4TM7A 4TKMA 2AEFA 1U8UA 4MKXA 4YI5A 1ZJYA 2ZUDA 1OWPA 2Z30A 4BL5A 1NR1A 2EYUA 1XMPA 1KSFX 4YR9A 5HVNA 4FFLA 5LBTA 4EG8A 2YWJA 4UFOA 3WGIA 1H2ZA 1T8RA 2BAGA 2G5CA 4QULA 4I1OA 3QU7A 3GC6A 4QJBA 3EYWA 1R9GA 4U5QA 4V3BA 3PPXA 1YRBA 1GKIA 4FBMA 1ZUNB 3KZKA 2CEKA 3NV9A 1BYIA 5JSZA 4WINA 2O6HA 1PTKA 1WB6A 3THYB 3WYFA 5IBRA 4FCTA 3RQSA 1SUFA 4ROTA 1BYUA 1P3DA 2P90A 4FW9A 4ZYTA 4Q4JA 3FROA 1RI4A 2WKSA 3ETDA 5JH7F 2D2FA 3MINB 1MW9X 3O8CA 4TKUB 1NATA 4E7OA 1M6EX 1RQLA 4YDHB 1CCWA 4FNGA 5EESA 4JXZA 3K96A 2GEVA 1MAWA 3A6ZA 3HP1A 1T8YA 4HN9A 2RGAA 5DSXA 4RZIA 5AI5A 1JR3A 2WFZA 5IWCA 2W37A 1H2XA 2FWNA 2IW3A 3O03A 4G5XA 1BAPA 4QU0A 2C58A 5B1YA 2C8LA 2IFTA 2OZPA 1XE3A 4RE5A 4ZVMA 2FMHA 3ICPA 1B8UA 3RUFA 1W4BA 3ZDXB 3ZY5A 1IXZA 3LI2A 2WYOA 4YRNA 3PK0A 5CP8A 4KMMA 2B1IA 5K6RA 2QJWA 4UEQA 1H4SA 4JJ8A 4CQLA 1ZBQA 2XUFA 3Q9SA 2FSUA 2JZOA 2BDTA 2CCJA 1IFXA 2YJ6A 4P6VF 1J2UA 2BEUA 2BFCB 2BMJA 2IPLA 2JFUA 2AA3A 3I9OA 4J0KA 4Q34A 1E7WA 2QUBA 1XDWA 2R8XA 3PFWO 4P3YA 4ZOLB 3UMFA 3ZWWA 5EXTA 1NLUA 3SX4A 2WFMA 3PRYA 4QX6A 4XVUA 3DE0X 2QW1A 3ONEA 4NZYA 5TPZD 3VNSA 2CUNA 1BQ4A 4AT1A 3CRW1 3D54D 2D2VA 4TZ6A 2EJBA 1V9SA 1GNLA 1DZIA 2EIHA 1T0BA 5IDWA 3OLYA 4D3YA 3AONB 1SXJB 3WGLA 4C2AA 2H57A 3N5CA 1YHYA 4Q9JA 3NAQA 3HK2A 1YJBA 2YMLA 4M83A 4FDVA 4U02A 4KFRA 1PT7A 1D8AA 1EFPB 2VF5X 1Z5OA 4K1LA 4PYIA 4B7ZA 2AJBA 2QUIA 4RZQA 3DUFB 3NJ8A 1THZA 4RTPA 4UUMA 4PG7A 4EGAA 3IAEA 4PSKA 3RO7A 1B41A 2FUNB 2P9QA 2OORC 2ZVQX 3OZGA 3BRQA 3A1NA 4PICA 1F0PA 1C30B 4M0UA 3W5JA 3EUWA 1FFXB 2EG9A 5TRTA 1W4AA 4EO4A 3TG8A 2XMRA 2B69A 1XELA 3MAJA 2IY9A 4FBLA 3U0BA 2XXAA 1QZXA 4R8RA 4X1OA 3IT2A 1SQ6A 4RNCA 3DR5A 4I7EA 3OD5A 2JDIA 3G0IA 3B6MA 5DHUA 3RTEA 1M7GA 3WKAA 2RI0A 3RUIA 3A4YA 4EQ6B 1H6AA 1JT2A 4O4IB 4CDGA 3IDQA 4H1VA 2HBRA 3GVIA 2FQYA 4I2NA 4YP9A 4CMBA 2P9CA 1GFZA 1WV1A 3HN6A 4IQGA 3NIDB 5AVQA 2CT8A 3PTZA 2Z2JA 3QPCA 4TQAA 1L6IA 4C78A 5IXYA 2ZYHA 2QLFA 2BHNA 1Y63A 2VL7A 2IEAA 1G8AA 3IHWA 4IKEA 4K2AA 5DHPA 5J59A 4Q47A 5A3QA 1E3WB 3T38A 2HK9A 4C4SA 2KSQA 1Q1GA 3URKA 4DC0A 2IXEA 1BMFD 3QF7A 1GPUA 4M8KA 5EXPA 1SHLA 3C3AA 2HA5A 4D5GA 1W36B 3NAZA 1FJGB 3BGSA 5AKLA 5SY6A 1NP6A 2PKQO 4O0LA 3KAQA 5JAPA 5AJHA 5EIBC 4LY0A 1TMYA 3FMVA 4PZDA 4YI3A 2JLAA 3FTPA 4RA9B 4GQIA 1YOVA 5EIHA 2AXQA 4BN5A 4MQ6A 2RHGB 3K4PA 4L8VA 4NU0A 2VDMB 1BVHA 2BONA 5AUQA 2XTJA 2WIGA 2TMDA 4L22A 1M5TA 1U94A 1QV9A 1VG8A 3HVUA 5J3JA 3SY8A 3SYRA 5TJHA 3QVUA 1K6EA 3EFHA 4PHGA 4S1TA 4Z9FA 3DAYA 4N18A 4TTJA 4P82A 2AFIB 3O74A 2HU5A 5KWVA 1IPEA 2R8RA 4W1RA 3LYHA 5FPHA 2ZSKA 1ONBA 1Z26A 5TMDA 1M8JA 2NMVA 2GBIA 4LDZA 4MZDA 3RVSA 3L6UA 1PK7A 1YMVA 3ASZA 1SXJD 3GJ6A 3HV2A 3RG8A 1CUSA 4H6XA 4GOLD 3LSTA 1NASA 1SH7A 2Q1SA 3CZMA 3KKPA 1EAMA 1RLTA 2E85A 1L5HB 1YCGA 1KVUA 3G82C 2G09A 3EXHB 4EL5A 1QO7A 3I23A 3I76A 1Y1TA 3E3LA 5AHWA 1F0KA 3EWNA 3QI7A 4B7UA 1LPAB 1VE7A 4RSHA 2J3HA 2YY5A 4Q1AA 5DCUA 4XVRA 2CV2A 3JD2A 4WV3A 5CAEA 1E9DA 1P7PA 2GAAA 1G2IA 3MTJA 3LDHA 1GM5A 1R0CA 1YKSA 2XGMA 2ZSIA 5INTA 5EIXA 2CXNA 2Q0HA 1WF6A 1ZESA 3L1HA 4KI7A 5SZKB 1AKUA 3LUHA 3ITKA 3ZJ5A 2VHTA 5AW9A 2C7PA 4NWIA 4WAUA 3SF0A 4D1YA 3S29A 2VF4X 1Y81A 3SX0A 3PPWA 2OHGA 3E9ZA 4L5CA 4DV6B 4UW9A 3DAHA 1WU8A 5C1BA 1XJQA 4MQ4A 1E2MA 1QMGA 4EI7A 2F1IA 1SXGA 5KAPA 3KQHA 3LT1A 2A5YB 4Z86A 4Z7NB 2F3PA 4MMYB 3I61A 1A9ZA 5EMHA 3TLZA 1XMXA 1TM7E 3G9ZA 4BNIA 1CJMA 1ZX1A 4CLHA 4FKMA 1GFIA 1N4AA 4HTFA 3I01A 2IT1A 2VC2B 1CJVC 1NZJA 2FRDC 3E81A 4J0EA 5CDFA 4IYRA 1ZNZA 4D8YA 3VPDA 4JIGA 2FN4A 4OJMX 1E94E 1Z3CA 4O5AA 1MV8A 4RH1A 1QGED 3BIJA 4XFDA 1W36D 2OAGA 1VKZA 2CHVA 2D0OB 4G07A 2RHCA 5CEEA 1CV2A 2RMKA 3HKDA 4EB6B 1GQQA 5A4KA 1ID1A 1ZN7A 3KFVA 4M0KA 4YJ2B 4YECA 1A4IA 1TAGA 3EC1A 3LFTA 4KQ1A 1O6CA 2VA9A 2I3GA 1XXHB 3HXTA 4NYIR 4UULA 1T0IA 3U3MA 3GH1A 4IGFA 1PFUA 1T6ZA 1Z4KA 1CNMA 1F8UA 2ODNA 3QNWA 4KJZA 5G0TA 4D45A 1F0YA 2D59A 3Q7EA 5EIWA 4G23A 3A3PA 3VR2D 1P1CA 4J29A 1E60A 5JISA 4IFEA 4EHBA 1V47A 3O94A 2NW6A 4P4SA 8LDHA 2GERA 4P3KA 3RUPA 4FDAA 4CUKA 5B4TA 2UYHA 2O8FB 3RTAA 3MGKA 3GRRA 4OSEA 1Y6QA 1E2GA 3GVHA 2FW9A 1IMOA 1BD3A 2AMFA 5SZHB 1SC4A 4FHEA 4CCYA 4GP7A 5KTSA 1GXSA 4WBNA 3QLVC 3PJRA 2QSJA 4FMDF 5H70A 1OYOA 1UFKA 2C31A 1KZ9A 3OJLA 2XNDA 5CT9A 1JQ3A 1KIFA 1X15A 1XL1A 3BXOA 4GYJA 2BLLA 1A2BA 3N0WA 4TT3A 3GCZA 2AL7A 3BERA 1URPA 4C6TA 2JLYA 5ERYA 2XE7A 1DOHA 1QYWA 3IEPA 3IPYA 3CLVA 4KUEA 3V4FA 3B82A 4R3NA 3QXHA 1TX4B 1Z74A 1ECJA 2IZ5A 2P9ZA 2VNJA 3ZCUA 3ZWVA 4ZAWA 5B7QA 3HFSA 3USCS 5KTPA 1YE8A 1WWKA 5F5LA 4F45A 3RC9A 1J9GA 3TL6A 4NNPA 1A3CA 1Q74A 2B82A 3FDZA 1L7EA 3DVSX 2A1UA 3IPXA 3BMNB 1TJPB 1YNOA 3H0KA 3PG5A 4H7DA 4IXNA 4ZO7A 5FO1A 1V8DA 1COZA 1SBHA 5AXBA 3GLFE 2NLOA 4US2R 1BNCA 1BMTA 1K5HA 4ESEA 3M4JA 4QO7A 4DRYA 1XEAA 4BJ6A 3BSWA 4Q7EA 1Q1ZA 1RKUA 2W70A 1GT91 3A4LA 3OQBA 4OUKX 4P80A 3AUJB 4U3JA 1HORA 3VOBA 1VP9A 4I4NA 4K46A 4I55B 3VKUA 4BCBA 4OHBA 4UOQA 1JJVA 1VIVA 1ZM9A 2DLDA 3LX4A 4LHVA 2FR8C 3V8MA 2B78A 3D3QA 4RZXA 4ZPXA 5TV2A 2Q62A 3PU6A 2Q6TA 3RNOA 3TQRA 2RH4A 4TS9A 1MAUA 5CVUA 4JUCA 1QP8A 3EJWA 4ZWNA 4JUAA 4LSWA 5K6TA 1CZUA 4BDTA 1OXSC 4Y2SA 3JRNA 4EA7A 3WS7A 2YOFA 3ICQB 1RAIA 5IAOA 1AHHA 2OQ2A 2YVAA 4MTLA 1M2VA 1XZPA 4HPJB 4D0SA 2VWGA 4TWIA 3A70A 3BGWA 4W99A 3RFFA 1SHZA 4IAOA 1L7NA 1P0QA 1CY7A 5KNBH 3KQKA 1QFZA 2R11A 3NBXX 4ER6A 5IK2A 5LWQA 4NCBA 1T5HX 2H5JA 3TNFA 2PQMA 3C3MA 1AUOA 4GP6A 4QXMA 2B92A 4YCJA 5LIPA 2H0RA 2PPVA 1U7ZA 1YNSA 3CH5A 5TMPA 1DCFA 3X0DA 1SIOA 2IV3A 1GTG1 4DSAA 5BV7A 2Z09A 3BA1A 1Z63A 2JLBA 5JOQA 1JDSA 2PD6A 4G36A 4FQ7A 2CC2A 4U39A 1XLTC 2E4ZA 2GPWA 3GLHB 3IAM6 4ZEWA 1O54A 2JGDB 3TLKA 3WLAA 2OAQ1 1AD2A 4CR6A 1GGKA 1MGPA 3M2TA 7REQA 3G23A 5CGQB 2YHIA 4U9UA 5CB4B 3UUGA 1AO3A 3OJOA 3TOSA 2VS1A 2Z43A 1PVOA 2IUUA 1AH2A 4Q02A 4CM6A 3MWFA 3QBDA 4PCLA 2XSZD 5EKDA 5GV8A 2GZHA 5BWLA 4DIUA 1YZVA 2QORA 2FDCA 1O9GA 3HZZA 1RKBA 1YQGA 1Z5PA 4QPCA 1FNDA 2ZCJA 4WCVA 3RVDA 1K75A 1XZCA 1U3CA 3EC7A 4KHZA 2I1VB 3V55A 1F12A 1H66A 2NQ2C 4R8KA 3WKDA 1GSIA 1L9XA 2V6BA 2D5IA 5CBPA 5I8PA 3W1EA 1FEZA 2CE7A 4D8VA 4BGDA 3DP7A 4XAQA 3OIFA 1KY2A 2JL1A 4A1OA 2JB9A 1ILWA 3FZNA 1G5QA 2J0QA 1Z2NX 3ABRB 1P4AA 2QY9A 3STWA 1DHTA 1UKCA 5AJTA 3T35A 5BQFA 2PTGA 1ZJ5A 1RVDA 1MVOA 1B26A 4IDEA 4XSVA 4ARAA 4EVSA 5B6JA 2WZDA 4DIDA 4QT4A 1OLXB 1GEGA 1RPNA 2IOFK 4W5OA 1PYGA 1MC8A 5JNWA 3BE5A 3TR0A 1EK0A 3CZQA 1JG3A 4ERXA 2C2XA 4MWTA 4G5SA 5KOIA 3T5PA 4BX9A 4V03A 4LJAA 4RPHA 1GTSA 3B53X 4CGYA 2J48A 2HCJB 4RA6B 3ZE0B 4ZYXA 5J2TB 4WJLA 4Z8YA 2O8EA 4A3SA 2A67A 2WJIA 3MWEB 1QBKC 1RJEA 2I3AA 2B20A 4BLRA 3GQVA 1NTOA 2WHPA 1G7RA 1RKXA 4I8IA 3RSSA 1SC6A 4B4WA 1SUPA 1QHHB 3SAJA 3BEDA 5T4BA 3N2NA 4RGBA 4ACAA 4J4HA 4GM4A 1VL0A 3LQ1A 4B3XA 4L57A 4MCAA 1KFJB 1C1DA 1SPXA 3FB4A 3PCRB 4X97A 3SEQA 3COJA 2HYIC 1IVNA 2WHRA 3PQ6A 4HAWA 3AM4A 3LJKA 4OI4A 4PQRA 3RFCA 3U6BA 4EPYA 2OXTA 3TD6A 3LQRA 4RSMA 3MCZA 1BXZA 4PS1A 3TOZA 4LFBB 5F1KA 1NC3A 1K9VF 1N9GB 1C3OB 1DC5A 3VRHA 1ESNA 4ZDWA 5AWFC 3MMXA 3ZI4A 3JPYA 5JMOA 2H7YA 4JLUA 4RQTA 1Q83A 3TBFA 2UV8A 4ZEMA 3EAGA 2PU5A 3SKYA 1ODTC 1UPCA 3SS9X 5IT5A 3KXLA 5E0KB 5FNZA 1M2FA 1T6XA 2LXNA 4IILA 4EHDA 3FOCA 3SS7X 5K1ZA 3DVRX 2HXSA 1SVKA 1FLDA 4W5HA 4DY4A 1TKBA 1XK7A 4REOA 1DFGA 3SYLA 2NX2A 2OXEA 4H59A 1L2TA 5FBZA 4CLOB 3I5YA 2Q45A 3KR2A 4JJAA 5K3FA 2PX8A 1RM5A 5KJEA 2BFEA 4CLEA 5K2MA 4EWLA 1Q0QA 4QOIA 4PNHA 1KMIY 4G24A 5CNIA 4U2CA 4QGSA 2BGWA 4TXHA 3WL8A 2HU2A 3WMGA 5JD5A 3JS5A 1J07A 4CTMA 2DQ4A 5THXA 2JLVA 3A2NA 3HL4A 3PGA1 2NXWA 2WD9A 4H1TA 4BWGA 3MUEA 4B6FA 1WOYA 1E0KA 1J56A 2E89A 1I5OA 3JQAA 1G8HA 3L6OO 1B8PA 3P2EA 2QL9A 3GJ0A 1OE0A 4FLMA 4AMZA 5FBWB 1SUDA 3LPLA 3NQ41 4Z2AA 4TQGA 1U28C 1DQSA 3DBHB 9LDTA 2MCFA 1BJRE 1U5CA 2QROA 2WINI 4YPOA 1NLFA 2XUHA 3F1KA 3ZWCA 4QAJA 2WMNB 3RBXA 3IVGA 3RT1A 4ANFA 5HDBB 1MRSA 4M6WB 4MVJA 3PC8A 2F8SA 4ECAA 3KQQA 3LBHA 4AZ0B 1BRMA 1YD7A 4Q18A 2E0IA 1QV7A 5FOSA 2UXDB 2TMYA 5D3MA 2Q41A 5FI0B 5A2GA 3IVRA 3JQCA 1PO7A 2XOKD 4YJ3A 4QYXA 3ROXA 2O1SA 4QUJA 3G9QA 2VAWA 2CVHA 4NJEB 3N7AA 2G83A 2WVGA 5JS2A 3UFXB 4B6PA 4MV4A 1ATIA 1XF1A 1CQIB 2YIJA 2OVFA 1VRVA 2MSKA 2QSZA 3DT6A 3F8WA 4LN1A 4PZAA 4YGXB 4C3UA 1MUUA 2YWRA 3B3QA 4GMXA 1FPMA 1MEJA 2YJTD 1FA9A 2O9JA 2HC9A 3LCVB 1G20A 2YQ5A 4I9GA 1CJUC 2X7XA 1KJJA 2IODA 3KUXA 1Z4JA 4BTVA 1T1GA 3IESA 2D8AA 4I9NA 4MULA 1GLGA 2D1RA 3RRZA 1PHPA 1AN0A 2VCEA 4J16C 2GJ4A 4DV5B 1E3LA 1N2XA 1OD6A 2VT6A 1IM2A 1ZRSA 2W90A 4LKRA 1Z2DA 3L4EA 2EW8A 2O0JA 3MGGA 4KO3S 3FOEC 1H2AS 1JQ5A 3BMQA 3CX6A 3ETEA 4DLVA 1XCLA 2VPZA 3TNYA 4DBZA 1LSSA 4MW5A 4RY8A 4IS3A 3WNVA 2BFOA 1HE3A 1DTEA 3F4KA 3JU3A 2ZYDA 1VCHA 3I8XA 3O4JA 3TQTA 3SSAA 1ZD2P 3STTA 2Y1XA 4MUFA 3ZNPA 1ZVKA 4HQNA 2ZB3A 3L8GA 3GGJA 5BW5A 4RIHA 2FWMX 5E6RA 1YZQA 3LYAA 3W6OA 1RABA 1YU9A 5EKTA 1Z4QA 1ZN9A 1N2EA 3BMCA 3TX6A 5HFNA 3WOHA 1DHRA 1SMKA 1T4MA 2C2HA 1E2JA 3CZCA 4J91A 3KV1A 1T0UA 5GONF 3V4PB 4G8JA 3K6SB 1UKAA 5JFOA 2RGNA 4DQ0A 1M6VA 4FB4A 1ONNA 3DBRB 3IBGA 4QUKA 3R0QA 3ZZNA 5T41A 5HKKD 3QA9A 1ZHFA 3I34X 3PDCA 1NJ6A 4RACA 4WVFA 4I8DA 1QOQB 4MR7B 3M34A 5T64A 3GT3A 8AT1A 5I45A 1YR7A 2WG2A 4UHBA 3B70A 3U7QB 4E2ZA 2C1EA 4QPJC 3UN1A 5I48A 5JRJA 2XUZA 3T5AA 3I42A 4DAEA 2PGNA 3T3PB 2ZRJA 4F6LA 1YB7A 3ZBQA 1J99A 1I4OA 4GE3A 1W30A 1OR8A 1K08A 2VOJA 3BD7A 2RH5A 3AK4A 1UC5B 3P96A 3H5WA 4JQOA 1K7SN 5A5GA 3EZ2A 1D1TA 1R6TA 1PDVA 1VPVA 5DBOA 2HMVA 4LA4A 4KUGA 2H2HA 2EV9A 5JAIA 3KVNA 2H92A 2XA9A 4I4TB 3LBNA 2QX7A 3M0EA 3N7UA 1FBNA 5MGBA 1KI6B 2OHVA 2O6LA 3BFVA 1V45E 2GEJA 3CEPB 2BMVA 3HFRA 2RHLA 2QVCA 4X8HA 5BW6B 3TEJA 4GBMA 3U17A 2OOKA 3AR8A 4LYJA 3TRHA 1B74A 1LBQA 2X4LA 1C0LA 4RTOA 1JJIA 1KAHA 3DTVB 5I4CA 2K5UA 4HDKB 1XMQB 2GBGA 1SVSA 4KTTE 3L4SO 2OOSA 1VCNA 2ERCA 1R1DA 1YULA 4R7TA 1VECA 2XDQB 4KPUA 4RABA 1YHZA 2FWIA 3OZBA 2VNKA 3JD4A 5LC1A 2C4KA 4EGJA 2WT8A 1IBCA 1ZXLA 4W6ZA 3SF8B 2QG4A 1G9SA 4G1MB 4JP1A 1MO6A 3JALB 2ZBGA 4DLLA 2GILA 1T9KA 3D7LA 3MEQA 4JQYA 4L6CA 3R5HA 2VSFA 1OFIA 3EC2A 2VSOA 1PS9A 3MD0A 5FWDA 3PLNA 1AX9A 2P11A 1LW7A 2G7MC 3VUFA 1NSFA 4DG9A 1PSZA 1YR8A 4IRXA 3FFBA 3TGWA 3TIIA 1JHVA 2FW8A 4HH1A 3T1OA 1DP4A 1PFKA 3KSAC 1FNBA 4OLHA 5CCEA 3ZE6A 3ETNA 4WK6A 4DM7A 1WR8A 4BAGA 4KOEC 5CDUA 3BC1A 3X1KA 2FEKA 3GGGA 4R5HA 2WUWE 4QYIA 2F3TA 4FYXA 4D0GA 1E3SA 5IN4A 2ENWA 2WD8A 1ZCAA 1OF1A 5CMLA 5KJFA 3H0EA 3VR6H 5I7WA 5IBQA 3FLMA 4X6UA 3H2JA 1CUIA 3MELA 3N2ZB 2O0LA 1JDPA 3N86A 1IY2A 1OTXA 2QVBA 4QE3A 5ALQA 4B6QA 2ZE6A 4Q05A 3IUYA 4B83A 1N9KA 1POXA 3BZWA 9LDBA 1E96A 3ZS8A 2OCDA 2Y1FA 4Q3NA 3RFXA 4A0FA 1HV8A 1IWBB 3PJDA 3LMKA 4PC6A 3WIUA 5IFLA 4CEIA 1EA7A 3BE6A 3GT4A 1IEXA 5DM2A 2G70A 3TQSA 1BE6A 1C8BA 2Q2WA 2IYNA 1OU0A 3B7WA 3PC3A 4KN9S 3ZR4B 4EHAA 3SHQA 1TC1A 3A9VA 4H9GA 4QU5A 2IYAA 2FQXA 4H60A 2I7CA 2XT9A 1DB3A 1S2NA 3GDHA 5LBUA 3GGSA 1EA5A 5HDQA 2GPJA 3T7JA 2H7CA 2OC4A 3QE2A 2IEZA 3WLTA 2WD7B 1ZQ9A 4N76A 3EXIA 3ZDFA 4EF4A 2L42A 2PS1A 4HLUC 5D3KA 5SYAA 3CVYA 2HHCA 4PXAA 3CNQS 1EGAA 4ZVUA 5HOQA 4Z4HA 2XKAA 1K7YA 4OXYA 5G2OA 3NYRA 1Z29A 1KE1A 2XGJA 2C94A 1MC1A 2X6QA 1C7IA 1NXVA 2VBCA 3G79A 4CMCA 2H8GA 4KN6A 4DDUA 1M2NA 1Z0UA 3HG7A 3DTVD 3HUTA 4DA6A 4DDKA 4JX8A 5IM4F 2Q3FA 5K8CA 1FOEB 2QF7A 2WG0A 2XWQA 2F9MA 2WOOA 5LLSA 4X1YB 4WZAA 1C1XA 5HTKA 3AJ9A 4M60A 3MSXA 4B6SA 2N3ZA 2GZAA 4JYPA 1ABEA 1JFLA 2EZUA 3AERB 2NU8B 1M2GA 2C97A 4DARA 5G0UA 3HDTA 3FF4A 3F6PA 2HIHA 4EJSC 2EW2A 4IHQA 4E0BA 5KNDA 1C9EA 1JXOA 3U49A 4PCVA 3OIGA 2QRZA 2BT4A 2YUTA 5IJXA 1TC2A 2GK7A 5L8VA 3GIDA 1NW7A 5F4BA 1U5AA 1G5PA 1J1ZA 5EJ6A 3KWJA 5HIJA 3NHPA 2DHCA 1HT1E 2OB1A 3MFYA 3PQFA 1JPNA 4ML3A 1J0CA 4O59O 4R2MA 3U3RA 2JLWA 4Y2HA 1X92A 3R4VA 1WZ2A 5AI9A 4N5IX 1RM3A 4FM9A 5DP1A 1LBIA 1P9NA 1EZ1A 1R9MA 2QTLA 4BNYA 4EHJA 2L69A 2R4TA 3JSAA 4KH1A 1G2PA 4RF5A 5FLKA 3T9FA 1WRBA 4P7JA 4BB0A 3L4BA 3QF4B 4OYYA 1OI3A 1TQ8A 5B2ZA 3AVTA 3PRJA 1IEQA 1TYAE 1NHWA 3AWIA 1AGNA 2IYSA 4GXRA 1MKYA 4RADA 3IS3A 5A02A 2PWZA 4O5OA 4JGIA 3ZU3A 2AF3C 3CKYA 3L7DA 4Z1MA 1BH2A 1IRXA 1V6CA 2XTNA 2G67A 3Q72A 2QTGA 2ATVA 3H97A 4KLRA 3ANMA 4OP1A 3RROA 1JAIA 5LDHA 1X9GA 3U19A 9ABPA 3CA8A 2HTEA 3C74A 1N8KA 3FPKA 3TF5A 1CR4A 1C3XA 3M9WA 4QARA 2VH5R 4QGGA 1WDMA 3GDOA 1N0WA 3CV3A 1N0UA 3NIWA 5DULA 1HMYA 4K3UA 4RTKA 4WEOA 3VV3A 2R60A 2MJLA 5EMKA 2ZWVA 1Y9JA 2PO5A 3NR2A 5IABA 2HLDA 4YO7A 4I1IA 3E7FA 5C3MA 2HPZA 4MA4A 2ZJ8A 5ED4A 4N0EA 2FE1A 2J0UA 1HNZB 3MF4A 4RETA 3CURA 3ZDZB 4N40A 4BFTA 3H42B 3G9UA 4NOKA 2FV8A 2ZRKA 2J9XB 4XLTA 1XTVA 4IJMA 4PN3A 2LV8A 1TEVA 3RIGA 3WSWA 4KWHA 3PL1A 3R7DA 4QQNA 4J1SA 4LG1A 2PUJA 2EP7A 2YUIA 2OFPA 1T0PA 2WM8A 3FKJA 4O3FA 4J7XA 1K4KA 4LXQA 1HFEL 3LOPA 3TFOA 2AIRA 2Q3LA 5HF8A 3G8YA 1II8B 3CNLA 1M72A 4JBLA 1HLFA 2RHHA 3R41A 4BNNA 2LIPA 1WL8A 3BB1A 3W6NA 3WZLA 4P31A 1KPGA 3TSWA 1AS2A 1GSAA 1S02A 4X54A 5MDHA 1KMMA 1J8QA 3EPLA 2XCQA 2Q1YA 4ZVVA 2NPIA 1XQ9A 2HJSA 1AE1A 4YBZA 1IN1A 3JVDA 1DXQA 1CDZA 2JPDA 1CQJA 2ZRPA 3RRBA 1RYYA 1VRWA 2NZXA 1W2HA 3UZUA 3VH1A 1MNAA 5CFNA 4R2LA 4AWAA 2C2KA 3B36A 4WZBE 4BMDA 3TTWA 4W4TA 2OAEA 3RAEC 3PUHA 3OJEA 1H6CA 2IYVA 4Z1OA 2OLKA 1CB0A 1YL7A 2J41A 3C5WP 4V0OA 4DMLA 5IYZA 4YX9A 4B6GA 5FTLA 1J2YA 3D4OA 4DPMA 5F23A 4GPTA 5J4YA 3HN2A 1PJLA 4U9IS 3DCNA 3IBTA 3W79A 2FZVA 4MCJA 2X58A 2Q27A 1TI7A 3EF1A 1K7EB 4HLCA 4HTAA 4O8ZA 4FB5A 1T0HB 3ASUA 4AKIA 5E9QA 2YTZA 1LXCA 1QHYA 1ZK3A 3C1AA 3DFKA 1RRGA 2QIOA 1ODJA 2EFJA 1UZMA 1MW8X 2DLNA 3AB8A 5ARDA 4CT5A 1H1LB 4BRSA 4U5XA 4DCUA 5DRTA 2PMDA 2HGSA 3GZJA 3SVLA 1C7FA 5IARA 1VSVA 4R9VA 5T67A 4P93A 3RYIA 4BO4A 4B6RA 2Q4EA 4M0LA 5IMSA 3NUGA 2AK3A 1R6VA 4YAGA 2DGDA 3JTEA 2GN1A 3QHQA 1GTVA 3W5HA 3BCHA 4BZZA 1GUZA 3W7VA 4DA4A 3DFUA 3CHYA 3ECAA 3ND8A 4J0FA 4AWXA 3VYSB 5BN1A 4GKBA 1HNXB 2EBFX 2ZZMA 1SQ0A 3D6UA 1CY1A 3TAXA 3RV3A 1RQ2A 4LOAA 4MKZA 1OASA 3HB7A 2HWYA 3PFBA 2PUWA 4OHOA 4TL6A 1DUSA 2P62A 4F3RA 4P4TA 2ZT7A 1EGVB 1FTNA 1ULTA 1BQ3A 4J76A 3L7MA 3OWXA 3AOEA 1X7ZA 1EM8A 2C8JA 3PQDA 1T6BY 1ZGHA 4OQQA 4FDTA 1TVKB 4K0RA 2Z57A 4NZPA 1SCQA 4RELA 4YTEA 4TVOA 4BB9A 1IZ8A 1YCHA 4DQVA 5C35A 1D6SA 2ONZA 4NVRA 3EVAA 1K6MA 1WD7A 4WCFB 3DOUA 3WZ2A 4KR6A 5BNTA 1XN1A 5HIIA 2JH9A 4IQ0A 1XFAA 2QJTA 3GRCA 4JU9A 1J20A 1VA5A 2XHZA 4NENA 1FTQA 4K9PA 4KMOA 4BKRA 3GLUA 4IM7A 3HXOA 4YYEA 2VF2A 2YBEA 1V1RB 2VWHA 1O1YA 3I4CA 1T1SA 3QI2A 4MQLA 4DCSA 4FT2A 2VPXA 4C0BA 2GN9A 1I3CA 2V03A 3ECCA 4M0EA 2QIPA 3IAM1 2QRVB 1KI1A 1J0XO 1E4YA 3JQ7B 4RCVA 4D82A 2P2SA 2VT3A 1QFXA 3I0MA 1F4LA 1YDFA 3CCCA 2A2ZA 3KM0A 4O2AF 4XCXA 1MH9A 2R1TB 5E3IA 1BCRA 5UKDA 3U37A 3ZTYA 4D9KA 4P7GA 1Z28A 3WNZA 3ERCA 1M34E 1PKEA 5HMMA 4WFKA 4G0PA 3TPCA 3QPWA 3BULA 4I19A 4B46A 5IANA 4FI3C 2ZEJA 4ZVPA 3D81A 5IDVA 5JSKA 4RVOA 5TQ2B 4IV0A 2PRYA 1IUNA 4ZGBA 4NS1A 4O1IA 3QJGA 4PLTA 3Q40A 1O2DA 4J6FA 5BT8A 1VKJA 1L7BA 3QLTA 4OK5A 1B76A 2NU9A 4TN5A 1FUUA 3WDSA 1BKDR 3TW6A 4M1EA 1CS0B 5CDYA 4PRZA 4DE5A 2J59A 4RM3A 4UFPA 5KTTA 4XUCA 3BTUA 1E2IA 2D74A 3I45A 4MPDA 4C7MA 4IRUB 2PL3A 1YQXA 2VPWA 2BEWA 4FXOA 2XYHA 4NS4A 4NJMB 5NLLA 3TE7A 3EIQA 3WL6A 3WLPA 2BMAA 1Z47A 1EGMB 4MDFA 3ZVLA 4NPCA 4DTCA 3TL3A 3HB9A 3ENVA 1UEIA 2FEOA 3O0DA 1D07A 2ZRFA 3Q88A 4JSTA 5KSOA 3VR0A 5ECDA 2BUCA 1G3IA 1PR4A 3E2MA 1R15A 3LOUA 4X3PA 3F7TA 1KQNA 2A0UA 4ARCA 1Z6QA 3KOXA 4DUGD 1U02A 3G5MA 3SZ3A 1P91A 4B3DA 4C6SA 2GCOA 2XUIA 3OOJA 4XFJA 5JCOA 4ZMBA 3QOFA 1GLVA 1GY8A 1NFFA 4YRDA 5IUJC 5JS8A 4UTRA 4KPYA 5BRNA 3NTOA 1DJQA 4EZBA 2B6NA 2OFXA 2RG1A 3D8NA 3K0CA 1VFNA 2G82A 2HSWA 3IL2A 4L2IA 4IIBA 2Q9AA 3NWJA 3ITEA 2A9KA 2TECE 3AUFA 4KW7A 4I6EA 1O96A 3C43A 3KB2A 4P35A 4URXR 1KMHA 1FU4A 3R6WA 4TUYF 3K9BA 5FHQA 2HHAA 3FYSA 3FRHA 1CW2B 3VSAA 1M1XB 5ADWA 3QBJA 4LHYA 5JZ9A 1VXRA 5T3YA 3R8CA 3FUCA 4DDHA 1IUKA 5A9TA 3N2LA 1XMSA 3OOHA 3NIBA 3GQBA 1GRCA 5ITVA 3IB3A 2IOQA 3FGZA 1AKWA 4Z4GA 4XX0A 1JFTA 3MYYA 2IYOA 1TFRA 5JDIC 3RAJA 3OO0A 4PYLA 5CJJA 5JSHA 4BQFA 5AW7A 4LV5B 2HQ1A 5H83A 5CHEA 4YP0A 3U7EB 4WA7A 4LCJA 3AUKA 3UXMA 1XVIA 2XY4A 3IQFA 4FYMA 4BCCA 4CKWA 2AW3A 2WJAA 4MW2A 4ND1A 4TV8A 4UTXA 3CRMA 1N6PA 3FYUB 5HF5A 3IGFA 4RYLA 5DH9A 1NVXQ 1WQ3A 2ERYA 2E4UA 1JU9A 2IHTA 2WILA 4QUDA 3IUBA 4DKXA 1KQGA 2ZJ2A 3UGQA 4EEXA 4YAOA 2CBZA 1ZK4A 1T9HA 1NURA 1WNTA 1NX6A 2WM9B 2ABWA 3R75A 1JR3E 2P4EA 4G9GA 4GPAA 4RHXA 2AG6A 4ZI2A 5AUNB 1UBGA 1S2OA 2CNWD 2WP8J 3FMPB 5TF0A 1FRNA 4MDEA 1VB5A 1WNFA 3R7BA 1PJ2A 2IHYA 3D8UA 3I9FA 4I1YA 3OEWA 1B8NA 1O87A 1TIPA 1QG6A 1RD4A 2JJ1A 1HDYA 2C03A 2O2JA 3LWZA 4P32A 2P2DA 2PRKA 1VE6A 4Y6SA 1Q84A 2IITA 3NTUA 4X44A 4ZAYA 4DM4A 3ABSB 4NBKA 2HOQA 3CLHA 4I5GA 7ABPA 1Z33A 2DR3A 3T7SA 4HYYA 2CHEA 3LPMA 4AJ2A 4KX3A 2J8ZA 2AYZA 3QVKA 2QTFA 3HKCA 5DPMA 2H1LA 1GZ3A 1D2HA 2KMLA 2QP9X 4CETA 1EYZA 3QQ5A 4QBKA 2WQZA 5FT9A 1DX9A 3BL8A 2BGIA 3B7GA 3H8VA 3P2JA 5EMLA 4G8DA 1KOFA 3GMSA 2ZE7A 5FP0A 1U3GA 5K7SA 1GL6A 1AQNA 2PD4A 3I30X 1T4DA 3OX4A 1I5RA 1W0JA 4OJNA 2Y93A 4YONB 5JAQA 2G72A 4RMHA 4LMAA 3NFYA 3RW9A 1ZRMA 1NR7A 4RQAA 4TZTA 3JRWA 2B37A 4GKVA 4FFRA 4K05A 9MHTA 3D6NB 4DV0B 1SRQA 2GI4A 1E6MA 1E2PA 4JI0B 3ONNA 4C07A 3JWPA 1GITA 5ES4B 2HNAA 2JIOA 4ZGWA 1NBHA 2P6MA 2JG3A 1YIDA 2PSEA 4F04A 3NTRA 3ZGYA 5DGHA 1TJYA 3KQNA 1UQUA 1PZHA 2GKSA 5HE8A 5AVJA 2QPOA 1N77A 4C0XA 1G7CA 2WUGA 4WNYA 5DISB 1MV5A 3EG9A 3OZSA 4RPIA 5LDGA 2AQIA 2VAVA 2ZI4A 1ZR4A 5CDTA 3JQQA 2V54A 4H08A 2J3EA 2G17A 4N8EA 1TTHA 3ICCA 4KQEA 3FLBA 3HYLA 4B35A 2LZ0A 1TYCA 3CBQA 4ZODA 5E6UA 3WICA 5ELXA 3CPHA 2QTZA 3PGLA 2F55A 5CR9A 1UEJA 1T3TA 1NAIA 1EFRD 2O8DB 4J3JA 2W43A 2VFAA 4B76A 4Q4HB 5DYYA 1IDOA 2YWEA 3C7CB 2Z5GA 4CIDA 2YYSA 3E9EA 2GM4A 3PZBA 1XRJA 2V6JA 3GN1A 2QN9A 3PS9A 4QBTA 4B40A 1P6XA 4P3OA 4MGKR 4U2FA 4CPDA 3D6FA 4KACA 2V0GA 3TXYA 3K9FC 4L08A 3P9YA 4TKVA 3HZHA 5HK9A 3MHPA 1U2GA 1D2CA 4UD2A 1OGYA 3LUBA 4HDAA 5FTJA 1CY6A 1HYGA 1JDBB 1P1KA 2LCIA