4O1MA

Toxoplasma gondii enoyl acyl carrier protein reductase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
303
structure length
297
Chain Sequence
PIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYPLDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAISFIDYAIDYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-acyl carrier reductase
publication title The benzimidazole based drugs show good activity against T. gondii but poor activity against its proposed enoyl reductase enzyme target
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 107
structure length 297
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4o1mA00
3QWHA 1ARZA 3PGXA 3ZW8A 2C7VA 3FNGA 3DZGA 4RJTA 1WPQA 1EE9A 1R6DA 3PIIA 3ZDFA 3ZWBA 4R69A 3B1FA 1NWHA 3W6UA 4CMEC 2BHLA 4CMKA 2YHIB 4HNHA 5A5EA 3HNPA 4CMHA 4GSLA 4A27A 4C7JA 4WECA 5I9NA 3F4BA 3WTCA 1RYEA 2VHVA 3GVIA 5DNAA 4BKRA 3HJAA 4GVLA 3VPSA 5ITVA 1PS8A 3FSRA 3WGGA 1YOVA 2J5KA 4L8VA 1YJ8A 4YWJA 3ZHXA 2CVQA 4ITUA 3TL2A 5TRTA 4YAJA 1BGVA 1A71A 2BI7A 3ZWWA 4AICA 3GMDA 3KM0A 3UOGA 3GEDA 2BFMA 3JQBC 5JO0A 4LCEA 4WE3A 2X86A 4PIVA 3VPXA 5G0SA 4YT4A 4JROA 4FFMA 4H16A 1HXHA 3PHLA 3ZWNA 2ZTLA 1KEUA 1CF2O 1ENYA 3IIEA 3S2EA 1W73A 3FBGA 5B4TA 3ONEA 3NGLA 4LN1A 1UZLA 3GVXA 4BNGA 3WIDA 2WE7A 3UAGA 5I7FA 2IZZA 4A10A 1NVTA 2PKQO 1H9BA 1WNTA 5T67A 4LMPA 1FF9A 2V7PA 3I9OA 3OMLA 2VNAA 1QORA 2I3GA 2Q1TA 1PEDA 4R16A 4BGIA 3PYLA 3QQPA 3F6YA 3GPDG 3SXPA 1FK8A 2OL4A 5BNFA 1PJ3A 3AOEC 5L40A 4FS3A 2YQ5A 3I1JA 4AFNA 3O4RA 1P33A 4CQLB 4NBUA 3DMTA 3AM5A 4Q3EA 3WG9A 4TSKA 2RAFA 5A02A 1N2SA 4ESOA 2B4TO 1DLIA 1KBZA 1OBFO 1TXGA 2VYVD 1PR9A 1HTBA 2VYVA 1ZK4A 1HDCA 1ISGA 1ZH8A 5L7WA 3KETA 4DRYA 1NFQA 2D1YA 2VHZA 4XGKA 3WQRA 2V6MA 2YHIA 1QV6A 3GQVA 3I9LA 5JC8A 2BGKA 2C29D 2HMWA 1E1NA 4JLWA 3RROA 1DJNA 3QA9A 5B4VA 2PD3A 2PTGA 1V9LA 2CFCA 2O3JA 3ENKA 1XR3A 1KEPA 4A73A 2Q45A 3AW9A 4BNMA 4DPLA 1ZIDA 1J6UA 2HMTA 4PLTA 2HKIA 3Q11A 3C8MA 5AXDA 4YRBA 1GYRA 4NJMB 7MDHA 2PZKA 1HT0A 3KV3O 5JDCA 1VLLA 1A72A 3CZRA 3VZSA 1HYEA 3ZN2A 2Z1MA 2P91A 4JJGA 1K6XA 2Q2VA 4XRRA 4RF3A 4CUZA 3QW2A 3IJRA 3CZMA 1E3WB 2W8ZA 5CG2A 5DBIA 3VKUA 1KERA 1HLPA 1W4ZA 4YTEA 4B4UA 1SB9A 4OJNA 5ILGA 3CMCO 3GNQA 1T24A 4CM1A 3DAPA 4E31A 3T4EA 1K6JA 2PGJA 3HG7A 1DC5A 4OHUA 4MVJG 4R3WA 2YJZA 3AFNA 4KWIA 3A1NA 4B3JA 1HDZA 5DF1A 3TFQA 1O8CA 1FDTA 4I5DA 1ISHA 4E3ZA 4CMAA 1W0CA 1U4SA 4CQLA 2NQ8A 5F21A 4YAGA 4FFPA 1GPJA 4NFYA 4IXTA 4DPKA 1KY5A 1HDYA 3P2OA 4AJKA 1UZNA 1PX0A 4BMSA 5BR7A 4YR9A 4YDRA 2C7GA 2X9NA 2GSDA 3WJ7A 1GEGA 4KUHA 2J3HA 4FGWA 3W8FA 3IP3A 3L77A 3EDMA 3G49A 4FC7A 4IDCA 4RCVA 1LLUA 4FCCA 4YBZA 3TZCA 5JCJD 4UUNA 3PHHA 1HDXA 3A14A 5JCJA 4LISA 2EW8A 4GKBA 1PS9A 2XF8A 1ID1A 3QRWA 4DIBA 3G3EA 4W4TA 1Z7BA 3SC6A 5L51A 5F1OA 4DUPA 4BO4A 4J0EA 3JQEA 4CPDA 2H9IA 3LYLA 1LXCA 2VZ0A 3R1IA 4LSMA 4F46A 4G2NA 4YT8A 2JCVA 1E3WA 4DGSA 1U28A 4PG6A 5AXAA 3W8DA 1K6IA 1QMGA 3HE3A 2BKAA 1WVGA 4WOJA 3BMQA 5ER9A 4CR7A 1QLHA 1YQXA 1U5CA 4CR6A 4MDHA 1EVJA 1SC6A 4OSOA 3ZZNA 5CDUA 2Y1CA 2D5CA 1LEHA 2EG9A 4UEJA 1Z7EA 1AHIA 4CV1A 1M75A 1JTVA 4I9HA 1PJQA 1V6AA 4IDDA 4JBGA 2ZQZA 4IZHA 4BHTA 3SBOA 4NMHA 1OI7A 5FI5A 3W4JA 2EV9A 3H65A 5TC4A 2Q49A 1S6YA 4BS9A 4DA9A 4M54A 3OIFA 5KVSA 4QFDA 5KJCA 3DC2A 5KJ6A 2W2KB 4OH1A 4E5NA 5BSHA 4FFOA 4XYGA 1U3VA 2H5LA 4YRDA 1DBVO 4IGEA 1PZGA 3PHJA 2ET6A 3IQDB 4ZQHA 1HEUA 2LDXA 5T57A 2QQ5A 4WLOA 3FN4A 4PG5A 3JQDA 4IINA 3AU8A 3GVHA 4CV0A 2EF1A 3KXDA 4IDAA 4J4BA 1AGNA 1VL0A 2HK7A 4HY3A 5F5LA 4W9NC 1ONPA 1EK5A 1H2BA 3BMNB 3M2TA 4MIOA 1H2HA 3I9MA 2AG5A 3S1LA 5KJFA 5L9AA 1LC0A 1P1KA 2E4AA 1R37A 3BZUA 4U6QA 3JTMA 4FOSA 4WJZA 5EIOA 4XYEA 3R0IA 5EINA 1RWBA 4B4WA 3CIFA 1P0CA 3QHAA 3OETA 2ZQYA 1QXSA 1IZ9A 2GN9A 1UXKA 4XQEA 1V0JA 4II2A 5G4KB 2FZWA 1E7RA 1FMCA 2AMFA 1Z73A 3LK7A 3MJVA 1H93A 1LDYA 1XCBA 1IE3A 2V65A 3MTGA 4JGBA 4P4LA 5TJ9A 2AQIA 2GYYA 5FWNA 3T7EA 2VQ3A 1R0KA 4BNUA 5I9LA 1NPTO 4BOYA 4A26A 4CMEA 5L53A 4PLVA 2OO5A 3CUKA 1LSJA 1O6ZA 1C3VA 4NR0A 4PVDA 3ZU2A 1R15A 3L4SO 4HFNA 2PFGA 3L6OO 4L4SA 4GX5A 2ZTMA 2CF6A 3JCZA 5L7YA 4ZQEA 1ORRA 2D2IA 4ONEA 1H6DA 1J49A 3K92A 3U3XA 2W2KA 3U09A 1E1LA 4QO7A 2RCYA 5CEJA 3JQBA 4JIGA 1I0ZA 3K30A 2IE0A 5T8KC 3DTTA 4KUEA 1JU9A 1DDOA 5A3JA 3WQSB 3ZV4A 1MXHA 2AEFA 1XU9A 1MFZA 4ALMA 3NTOA 1QYDA 1C0IA 1PR3A 2WYUA 3R6DA 2YV3A 1KC3A 3A06A 2FRDA 1ZZEA 3LDHA 4GI2A 1GV0A 1UDAA 2GN8A 4N5LA 1DAPA 4KQXA 5CEFA 3I9KA 1E77A 3HDQA 4JQCA 1XSEA 5CPBA 3HB5X 3U49A 4XQGA 3GVCA 1UR5A 5JO9A 3GG2A 3TN7A 1GCUA 5TT1A 3ITDA 2VWPA 4MIEA 4E12A 3UHAA 3FPLA 4BV8A 3PTZA 1JVBA 1BDMA 3G17A 5G4KA 1E6UA 3F1KA 4IGFA 2GN6A 5MDHA 3QIVA 4NBRA 1ULSA 4QTZA 1LDGA 2I99A 3CEAA 4ZRNA 4EJ0A 2EHDA 4IS3A 3UGKA 1PZHA 3GDGA 1NHWA 3OJFA 3RSHA 1HE4A 4BO1A 3ICCA 5F3RA 3GF4A 1AXGA 4GX2A 1KVTA 4AJLA 2UYYA 3H9UA 3C24A 3QV1A 2ZIZA 2ZYAA 3ZHYA 1EVZA 2YFHA 3QY9A 3E82A 3FR8A 4MVJI 3VVBA 4XR9A 1N5DA 1AE1A 3I5MA 4G65A 4WCFC 4CMBA 3BMOB 3LT0A 2D5AA 3DB2A 4CJXA 3DFZA 2NUAA 4N5MA 1TT7A 3RIHA 4DMMA 4Z9YA 3GUCA 2NSDA 1BW9B 3DBHB 4NU6A 4EDFA 4O1MA 4RPGA 4RVHA 4RVDA 2POQX 4G5HA 4PG7A 2BLLA 4P4NA 1SO8A 4O63O 5ENVA 2NV6A 3ABIA 2VHXA 1H9AA 4PLYA 1A7KA 4ALLA 1BXGB 1NFFA 1K0UA 1XYGA 1I36A 4HBGA 4HFRA 5F1KA 4UVGA 4CODB 1LQTA 3O03A 3DMTC 3KSUA 1NAHA 5U4QA 1LSSA 3AFMA 3ZI0A 2Y1EA 2DKNA 3AUSA 5AVOA 3GDOA 2DBVO 3OJOA 1EBFA 4BQRA 1BSVA 4HUJA 1ADFA 3WWYA 4RDIA 1Z45A 1MGOA 1DRVA 1YDEA 2YZ7A 5K9ZA 2Z95A 4Q39A 4BO7A 1NFRA 3HUDA 3QVOA 4W7IA 3WGQA 4D7AA 2VT2A 1ZEMA 4OO3A 5JNLA 2JD2A 3GC6A 4ZVVA 4RF2A 1EQUA 3JYQA 3M6IA 3MWEB 3WB9A 3ANNA 4GKVA 1OMOA 1N1GA 3D5QA 4M55A 3NEPX 4JP3A 5FF9A 4DIOA 5CDGA 1DHRA 2VUUA 2G5CA 3ADOA 2Y67A 2CY0A 4RVGA 3FCOA 4ZJUA 1HSZA 1KIFA 5EN4A 3PJGA 4B4OA 4WLUA 4MVJH 3Q9UA 3ASUA 3S2IA 5JDCC 2X5JO 4R1NA 2FZEA 1O95A 3TSCA 2AE2A 3CMMA 1K5HA 4CMGA 4WEQA 2E49A 4AJJA 3BMOA 1MG5A 4JBIA 4DWVA 1PGQA 3WGIA 1Z82A 4JCOA 4Z3KA 4FFLA 4NBWA 1L7DA 3F5QA 5HTOA 5EESA 3DBHA 3QWAA 4AL4A 1P31A 3PZRA 2YYYA 2VRBA 4ZU3A 1EQ2A 3ST7A 4XQCA 4W6ZA 4D3DA 3AM3A 1LJ8A 1X1EA 1IOLA 1BMDA 1RPNA 1B14A 4UEOA 4CLOB 1BXGA 3KSDO 1FDVA 1GQ2A 5DP2A 2JCYA 3DOCA 2PH5A 3PWZA 4XYMA 1QYCA 2EKQA 2HDHA 1M67A 2EP7A 3AUUA 2VCYA 3DOOA 3RFXA 2HJSA 1LX6A 4MVJP 4L0QA 1DRUA 4J4TA 1AN9A 1ADCA 1UDCA 5HS6A 5A04A 3RUDA 1X7DA 4PCVA 4BQPA 1XLTA 1HF3A 2YQ4A 4P38A 2QRJA 4HWKA 1YQDA 1JDJA 1EBUA 4B3IA 3ZWPA 2JFGA 3JQ6A 5A9TA 3GEMA 4BNTA 3KYDB 1YWGO 1MFPA 3ZWCA 5BSFA 4Z9XA 5IDYA 4PZDA 5BNIA 4FFNA 3TZHA 4NQZA 1MP0A 3VH2A 4YJFB 3VZPA 2RHCA 3WGTA 1TI7A 1CEQA 5JW6A 5MGBA 1KVSA 3WIEA 1V3TA 4LSWA 4AG3A 4D3FA 4YJGB 2PGDA 1JA9A 5HRUA 3BHJA 1HDOA 1VC2A 1ENOA 2RIRA 3V8BA 4CMJA 1ZSNA 2Q2QA 1B3BA 2O7SA 4DLAA 2GGSA 3B20A 3AU9A 3BTUA 4IMPA 3OA2A 4NIMA 1HE2A 4TVBA 4YAEA 4J7XA 3UN1A 3TOZA 4KWHA 1C1DB 2DU8A 4R1SA 3W8EA 5B1YA 4RVFA 2RH8A 5LCXA 5IXSA 1I8TA 5I9MA 1GUYA 1PJTA 1ZNQO 5C7IO 4OKNA 2G0TA 1C1XB 1PWXA 4RL6A 1R0SA 4FB5A 4CLOA 1NR7A 4FIZA 1JQBA 4GWKA 2NACA 3Q6IA 5CFZA 3GRKA 3RBXA 3GH3A 2ILTA 2CSUA 2YFQA 3E03A 5IJZA 5LDHA 4GSKA 4JJFA 1PGNA 3BTOA 5ITWA 1ISMA 3U4IA 2IDZA 4WLFA 3S8MA 4EITA 1CQIA 3RU7A 4I5EA 3WGHA 5COAA 1QYVA 3FPCA 4EUFA 3LZ6A 3F5SA 2IEDA 4LK3A 4KDFA 1XG5A 2XOXA 4PG4A 3WLEA 4CLHA 2NU7A 3QVWA 4WCFB 3S55A 3E18A 1LDEA 4J0FA 3F4LA 2VWHA 1VJ0A 1HYHA 3D1LA 4BKQA 4RV9A 4ILKA 1QV7A 3KYDA 2FMUA 2Z1NA 1B0AA 5A9SB 2J3KA 1KOLA 3GMSA 2ZB4A 2P68A 4L73A 4NNJA 4R51A 2TMGA 5T8KA 1PWZA 2VZ8A 4YJFA 2Y1OA 4BNNA 1U3TA 1P1RA 2ZTVA 3L4BC 4IJVA 4PZEA 3SEFA 4YJGA 3TL3A 1BXZA 2GRAA 4CQMB 2QIOA 2FSVA 4BNHA 1F0YA 3EYWA 4JP2A 3NAQA 3NT5A 4EJ6A 4IPTA 1LU9A 3QWFA 4CM4B 1UH5A 5L4LA 4FJ0A 3L6DA 4S3MA 1H6AA 3SLKA 4M87A 2ZB7A 3O8QB 4R9SA 2CDCA 1C1DA 3GR6A 4FD3A 1VJTA 4RORA 5EMHA 3QLJA 1YL7A 3F9IA 1C1XA 2I5PO 2I66A 4RPKA 3DZFA 4KP7A 1X0VA 3WSVA 1HDRA 4J1SA 5COBA 3K31A 2C07A 2Y05A 4FGSA 4OIMA 3X2EA 2QYSA 3JSAA 3PXXA 4I5FA 4CUKA 3I52A 4LRTB 3ZHBA 4L76A 1UUFA 3MOGA 3G1UA 4HKTA 3AOGA 2OORA 1IZ0A 1X0XA 2E48A 3KEQA 3WWZA 2OGUA 4DBZA 5JDIA 3JD3A 3AM4A 4BL5A 4CM9D 4ZD6A 5B12A 2FWMX 2W98A 3DQPA 4BNIA 4CM9A 4KTTE 3V2GA 1L7EA 3VHRA 4O0LA 3WICA 3C7CB 1GFSA 1E6EA 2DTXA 2P9CA 3NDRA 3PJFA 4IM7A 4PRLA 4WCFA 3WBFA 4UUPA 5TLSA 5TSDA 5TGDA 3ULKA 3IMFA 1CERA 1XEAA 4RO0A 5L3ZA 1A5ZA 1J0XO 3RUFA 5A9SA 4QQRA 3GY0A 1FDUA 3WGYA 3E9NA 3QVTA 2JKVA 5DOVA 2FP4A 1I24A 4GBJA 1Y9EA 5CEEA 3Q9NA 4CQMD 2NU9A 3PLNA 4CQMA 1YB4A 2P9EA 1I3NA 4HFJA 3JQCA 1UDBA 4GGPA 4Z0HO 1T26A 1GYQA 1YH3A 3IS3A 2NVWA 1YBVA 3O8QA 1S7CA 2C5AA 1VKNA 1WWKA 5B4UA 1SEVA 1KEWA 4ZGWA 1NPDA 4OL9A 1I01A 3JQ8B 3OHSX 2HQ1A 3SVTA 3F47A 3ON5A 4ND3A 4XB2A 1KETA 1Y5RA 3FR7A 1UXIA 1KC1A 2O3RA 1ZBQA 2PA3A 1MV8A 1TB4A 4IXWA 4INAA 2VYND 2X5KO 2P2SA 1LLDA 2VYNA 3CKYA 3TWOA 4BO2A 5U9CA 2QHXA 2JFFA 3MCVA 1H0KA 2OP1A 2W90A 3GHYA 3KLPX 3QJ5A 1IY8A 1UP6A 4MO2A 3CXRA 1YO6A 4XB1A 4K9DA 2WTBA 4JBHA 4TRMA 3GAZA 2J3JA 3ZU4A 4TMFA 2D8AA 1P1FA 1E5QA 3EVTA 3O9ZA 4AJ2A 2GO1A 2P9GA 2NVBA 3NKLA 4F6LA 3DTYA 2I3AA 3NDIA 4E5KA 1NQAO 3ZHZA 4TVOA 4J3FA 3VZRA 5AOVA 3DFUA 3HDHA 2UAGA 1YB1A 5G4LA 1ONNA 1GZ3A 1HSOA 5EERA 1XDWA 1JAXA 1GPDG 1P1IA 2B0JA 1JAYA 3AJRA 1PJCA 1U3WA 3RVDA 1TT5B 3WQQA 3AWDA 2ZKLA 3VC7A 1UXHA 5JY1A 3R3JA 4NG5A 3EGOA 2BFPA 5TX7A 3BYZA 3KHUA 1CRWG 1R4NB 1WP4A 1R0LA 1PJ4A 3Q0EA 3IJPA 1DFHA 5K0ZA 3MTJA 3V1TC 3RFTA 3K5PA 1ZMOA 1NVMB 2IYOA 1QSGA 5ES3A 1UJMA 3VPGA 5JC1A 1IUKA 2YDYA 5F1PA 2ZJ0A 4OOEA 1WLYA 1O89A 3JQFC 3OJ0A 4QECA 3RUEA 3WS7A 4UULA 3IKVA 2QRLA 1R16A 2NTNA 2Q1UA 3ANLA 4GVXA 4BUCA 1HRDA 1D1SA 4Q3BA 2Y93A 3PFFA 3UVEA 3V2UA 4R1UA 5JLAA 4DQVA 3IOYA 3C7DB 3NYWA 3HB4X 5IFLA 5C7OO 5FFFA 4UEKA 4NJMA 1HZJA 1QYWA 3E5MA 4YVFA 2P4HX 2ZCUA 2Z5LA 3M1LA 1RYDA 2IZ0A 4HX5A 4WNCA 3M1AA 3ZGYA 3ZH2A 3LT2A 4RF4A 1RM4A 4BMVA 4NBVA 4DYDA 3DMYA 1P74A 3D3WB 4CM8B 3D4OA 4MJLA 1RJWA 1DIGA 3VH4A 2GPTA 4XDYA 1EUDA 3GUYA 4WGGA 4IDBA 1UAGA 5GZ6A 1PJSA 3MJSA 1ZO8A 3C1TA 1M76A 1I3LA 4ALKA 1XHLA 4PRKA 1O94A 3PJDA 3PZBA 3ASVA 2PD6A 3HQ4O 2AHRA 2HO5A 1TT5A 3TJRA 2A35A 1W6UA 3KSZO 4HP8A 2BH9A 1ISFA 1JW9B 4QSMA 5KVCA 4YJHB 2WM3A 3M2PA 2O4UX 3ONDA 2EERA 1R4NA 1ZUD1 2DPHA 2V6GA 4WCDA 4MOWA 1Z6ZA 1YONA 3GZNB 2JFHA 2D3TA 2HMVA 4EYEA 2IXAA 3LT4A 4AJIA 4XQ9A 1E92A 2PKQP 3A9WA 1P44A 3OBBA 1RM3A 3T4XA 1GV1A 5DDIP 4A5OA 5IAAA 3OFSA 2UUOA 4NFSA 1VSUA 5IDWA 1HZZA 3QE3A 1DFIA 2R00A 3GGPA 5DCWA 3GRPA 2VTEA 1I10A 1DIRA 1KVUA 1SPXA 2PWZA 5TJHA 4AJOA 2FN7A 3DWFA 4CR8A 2EP5A 2C20A 3GG9A 2BRUA 1WW8A 1F8GA 4KUGA 3RUCA 4GLOA 5JBIA 4RLHA 3DBVO 2IZ1A 1YQGA 4BNYA 3JQ9A 4FBGA 3L4BA 4ALJA 5GMOA 1B3RA 3K8ZA 3BAZA 1DXYA 3JQGB 3ZWYA 1O5IA 5CPFA 2ZCVA 1BRMA 2JHGA 1I3KA 1WDMA 1D4FA 2I9PA 1KS9A 1NP3A 2W2LD 2A92A 3D3WA 3I23A 5LC1A 4CM8A 4D46A 5JAZA 1V3VA 3CTMA 3JD2A 3OJLA 3IAHA 5IF3A 2HJRA 3PPIA 3GNSA 5DCYA 5IN5A 1NXQA 2YV2A 3LF1A 5TT0A 1BDBA 4R41A 1BG6A 1MA0A 2XPCA 4OXYA 4GQAA 3H4VA 4JN6B 3TNLA 4IQ0A 1WDLA 2HLPA 4R68A 2HK9A 4Q3NA 2LDBA 1BTOA 3UKOA 1DIHA 1K3TA 1SMKA 4YJHA 3TDKA 4P4GA 3WFIA 4ND1A 3SJUA 3WBBA 3RUHA 3GZNA 1EE2A 5EQDA 2C82A 3DHEA 3EZYA 4S1VA 3IUSA 3VPHA 1I30A 4B4VA 4R3NA 8ADHA 4D3SA 4DPMA 2R2GA 4EGFA 5JAIA 2IRWA 3H8VA 1E3LA 3VH3A 3FRJA 2WMDA 1B8VA 1F06A 1YJQA 3DZBA 1H6CA 3ROMA 1OOEA 1R4MB 2AEMA 4PFJA 3D0OA 3WJAA 1DC4A 3INGA 5K6AC 3BMNA 3DDNA 4LCJA 4CLXA 3GOHA 1GU7A 3IL2A 4UVDA 1IPEA 3INRA 4ZQGA 5A06A 1HETA 2DM6A 3KVOA 1XU7A 4FPXA 1U4OA 1JKJA 2CDAA 5A3VA 4GL4A 2V6BA 3FD8A 4WLVA 1I33A 4GPD1 3MWDB 2YDXA 4TKMA 3C3XA 4BO6A 2X8LA 3E9MA 4IDFA 4RZIA 1Y81A 4D43A 5B37A 2B4RO 1NYTA 5ICMA 2FR8A 3PVZA 2QZ9A 1B8PA 3U4HA 3GNTA 3LVFO 4BNVA 4P22A 3JYOA 1T1RA 2H1SA 4L74A 3SC4A 1O9BA 1U1IA 3TZQA 1YXMA 3AUTA 2DUWA 1XIVA 2NADA 2QX7A 4RPLA 5C5IA 4IS2A 5JDIC 1GUFA 4BNWA 2AA3A 1YBMA 4GLLA 2RBEA 3BIOA 1HL3A 3DZKA 1DEHA 1DJQA 3MJEA 4OGWA 1NVGA 1TEHA 3RC2A 4IIUA 1M66A 5HA5A 4FR5A 5C3MA 4R5MA 3GZ4A 4Z9FA 1VPDA 4B79A 2GZ3A 5J23A 4PLFA 3RCBA 1GADO 4WK6A 2JD0A 2CVOA 4D79A 4IMRA 1E7SA 4DQXA 3WYBA 1R4MA 1BVUA 1M6WA 4W99A 2DBZA 4E6PA 5IZ4A 4GMGA 3B6ZA 3JV7A 4FDAA 3EHEA 3NJ4A 1N92A 4GMFA 2DVMA 1LSUA 1WZEA 3LU1A 4PN3A 1GCOA 1E3IA 1YKFA 2VNSA 1HE5A 1KEVA 4CLRB 1GUZA 4DMLA 1EDOA 3FTNA 5DULA 3EAGA 3RBZA 1ZMTA 3ZU3A 1H6BA 1P45A 1YE3A 1ML3A 1U2GA 4L4XA 4N7RA 2GF2A 5GZ3A 4TZKA 4AJ1A 1EVIA 1E1KA 1GD1O 5CHEA 1P0FA 3OECA 1V8BA 3K2BA 1GL3A 3IKTA 3ETGA 4OXNA 3VDRA 4OM8A 3NDJA 3C85A 4DLLA 4FN4A 3FNEA 3GGOA 3K6JA 3RU9A 1F12A 5GZ1A 5DBFA 2X5OA 1WAMA 4M86A 4TRJA 3PDJA 3ANMA 4HADA 2EIHA 1G0OA 3JQFA 4E2WA 2GZ1A 1A27A 4IJKA 2Y66A 3PHGA 3PQDA 4DC0A 2EWMA 3ONFA 1Y6JA 4BIIA 4M89A 1D7OA 2B36A 4JX8A 1QRRA 5ICSA 3B1JA 4LMRA 5BQFA 1DFGA 1YDWA 3OP4A 1E3EA 3L9WA 4EW6A 3PLRA 2AW5A 5H82A 2SCUA 3GFBA 4IDGA 1T4DA 1BW9A 1E7QA 1NBOA 1AUPA 5IDXA 1ZXBA 5KTKA 4IJWA 4ALIA 1PL7A 1A9ZA 4XZ3A 4YA6A 4PLHA 3WR5A 5I7VA 3KTDA 4BKPA 5JSFA 1KYQA 3D4PA 4QUKA 4BO0A 4XYBA 5DOZA 3U62A 2OHXA 1LRKA 4GX0A 2GUGA 3W6ZA 4RPHA 4EUEA 3EMKA 2NTVA 3DOJA 1JKFA 2AG8A 4CLRA 1U2DA 2HUNA 1GY8A 1MUUA 1Q0HA 2UUPA 2C2XA 4RZHA 2B4QA 2CDBA 5BT9A 3UF0A 4CM5A 9LDBA 4CV2A 3S2FA 4DL9A 4PLGA 2PR2A 4PGFA 3HZZA 2NU8A 2BMAA 4RQUA 2PZJA 5KJEA 2GDZA 2EKLA 4XEHA 2X9GA 3VDQA 5L45A 4NPCA 2WYWA 1ZK1A 4J2HA 4J7CA 2O3TA 4RPJA 3R3SA 5EL0A 5KIAA 1P3DA 1LDNA 2AQ8A 1DIBA 2X0RA 4OQYA 5HBRA 4QX6A 4B3HA 4XRGA 2B5VA 1PZEA 4HFMA 3OIDA 3G1TA 4N5NA 4NDNE 2AQKA 4AVYA 1ISJA 1QG6A 4EJMA 5JS6A 1HDGO 1HE3A 3ZV3A 5CDSA 3DXFA 1ENPA 2DAPA 4NU5A 2O2YA 1QYXA 3ICPA 1AXEA 3JQAB 1DC6A 1ZVMA 2B5WA 2YHUA 3OQBA 1GR0A 1FDSA 3VTFA 3PJEA 1E3SA 1PSDA 2DFVA 1W8DA 3ENNA 5L95A 2E37A 1YGYA 2NU6A 4I9UA 2CUKA 5A9RA 1J4AA 4C7KA 2EJVA 1KVRA 1IYZA 2C54A 3KYCB 4XD2A 1CYDA 5KKAA 1IPFA 3AUAA 2O50A 2XXJA 5L4NA 3CSDA 3D4NA 4JXKA 4B7XA 4Y6RA 5L4SA 2O3SA 3FF4A 1D8AA 3LC2O 5DCUA 4HNGA 3O26A 3JYPA 3LC1O 4YQZA 4ZHSA 5JCXA 3ETDA 5KKCA 5HWSA 2O2SA 3W4KA 2X6TA 4UUOA 4BV9A 1XQ1A 1D3AA 1EUCA 1Z74A 1C14A 1PGPA 4CM3A 1PQPA 2JL1A 2WSBA 1SOWA 4TRRA 1R66A 4YEDA 3SJ7A 4J2OA 2HAEA 1PJBA 1JVSA 2PNFA 4NK5A 2R00C 2X0NA 3AI2A 4AJHA 4FJ1A 4J1NA 3COSA 3EK2A 1EMDA 3H5NA 3RC9A 2ZB3A 5TIIA 3QWIA 1YOVB 2ZTUA 1WZIA 4Z6KA 4W82A 4ZQBA 2PGLA 4KDEA 3ROKA 3P19A 1DAOA 4EZBA 3C7AA 4W7HA 1X15A 4LVCA 1Q2XA 3JQ9C 1LRJA 3ZNOA 4XIJA 2HCTA 1N7HA 4IQGA 5I7EA 4Z0TA 1DB3A 1G1AA 2WWRA 2ZJ1A 1I5RA 2PZMA 3DAFA 3GDFA 4MKRA 4Y8VA 3JQAD 5KVQA 1ZSVA 5ER6A 3RD5A 4BB6A 5K6AA 1WDKA 3OA0A 3TZKA 5BNTA 1EDZA 5H83A 1E7MA 1GZ4A 1ENZA 1I2ZA 4FFRA 1NR1A 4O59O 2VUTA 3PP8A 5IDQA 2AEJA 8LDHA 3NTQA 2J8ZA 2CVZA 3G79A 4RF5A 2I65A 4YYZA 1B16A 1T2EA 3HDYA 4C4OA 4UREA 5I7SA 4H3VA 4NZ9A 3KYCA 4Q3CA 4JJIA 3RASA 4OMUA 1PZFA 3WYCA 1VL6A 5EQFA 4IJUA 3TZ6A 2DQ4A 3KEOA 4R01A 2WEKA 4FJ2A 1CJCA 4EUHA 1ULUA 3IP1A 2IEBA 3PEFA 3U4DA 4J9VA 3H9GA 4BO8A 1DOHA 4URFA 1RM5A 1A9YA 5L7TA 4E30A 1T4BA 3KYBA 4XGIA 4YT5A 2NTJA 2Y0EA 4AJEA 5HS4A 1UZMA 2PD4A 2XAAA 2DLDA 4WOKA 2WJPA 5T64A 2BI8A 3N74A 4LRSB 4YPOA 3VOSA 3CE6A 3PK0A 3ZNQA 4PG8A 3P5SA 1GEEA 3ZWOA 3NRCA 4HV4A 3NUGA 2IXBA 1ZXLA 1FXSA 3Q2KA 3LLSA 4WEOA 4U0JA 3H2SA 3TRIA 3D5TA 4M49A 3LC7O 1U8FO 3RJ9A 3H9JA 4IIVA 1B2LA 4I08A 2FSSA 3OSUA 4J1TA 2AE1A 3JYNA 2FPIA 3PDUA 3PQFA 1NNUA 4MP8A 4YXFA 1T25A 2CZCA 2Y1FA 4CM4A 4K28A 4DIFA 2GCGA 1EZ4A 1SNYA 2VHYA 3VKVA 3V1UA 1Y8RB 3OIGA 2JCXA 4EBFA 1BXKA 3ZNPA 1L1FA 2O4CA 4OXKA 3GGGA 1ADGA 1E3JA 3V2HA 2NNLD 4GX1A 1KY4A 2C2YA 1RM0A 3FI9A 4ID9A 4IQ8A 3ORFA 3FBTA 1PL6A 4RQTA 2NWQA 3B70A 4B8ZA 1TVEA 1P9LA 4MINA 4U6SA 4O5OA 4Y67A 3NT4A 3OJEA 1FDWA 4BVAA 2F00A 2PH3A 2Q1SA 2EEZA 4YJDA 3DBLB 1B7GO 4E2XA 3PYXA 1MC5A 5A4DA 3UH1A 1SCUA 2BELA 1BHSA 3JD0A 2G82A 1DPGA 3JD1A 3U0BA 3K73O 2WDZA 1DIAA 2VWGA 3H3JA 4MVJF 4QFCA 4UUMA 4Z0PA 1ZEJA 3DBRB 4D45A 4L4RA 4FW8A 3DEYX 2DFDA 5A03A 3I3OA 3QVSA 1K2WA 2O48X 4E21A 1JWBB 4J43A 5TNXA 4CM6A 3OEYA 2AQHA 2IYPA 3LQFA 1X7GA 4NJOA 4E33A 2EGGA 2VRCD 4MPDA 4BB5A 1E0DA 3AY6A 2VRCA 3GVPA 4QEDA 1SEPA 1ADBA 4F3YA 3HFGA 2BGMA 1QR6A 4WPGA 4II3A 1OC4A 4U5QA 3Q1LA 4XGNA 2HU2A 4IUYA 5I8WA 4PVCA 1WXDA 4B8WA 3U9LA 3RC7A 1ZFNA 4XJSA 4ZQFA 5KJ1A 3FWZA 1YVEI 3FHLA 4BGUA 4AJ4A 3ZWVA 2IODA 1VKOA 4I9NA 4XJTA 4E4YA 4CMCA 1XKQA 1XGKA 2D4AA 1PIWA 3GN2A 4ND5A 2X4GA 3RJ5A 2O3UA 2J5RA 1JN0A 2VOJA 3H5RA 3PQEA 4OQZA 4DC1A 4GWGA 1MG0A 2EW2A 3E8XA 1SAYA 4LVUA 5JY6A 2B83A 2OBNA 3BMQB 3E9QA 4B7UA 4XKJA 3RKUA 4BNKA 4MIYA 2X7HA 2WE8A 1Y8RA 3L6EA 4BKOA 2ZATA 1SZJG 4J16A 3I83A 4Q9NA 3DZIA 2Q2WA 5IG2A 1T2CA 5H81A 2O23A 2VUSA 3JQ8A 3OQ6A 1BWSA 2BGLA 3IDSA 5HM8A 1GZ6A 1E1MA 4JNKA 1XQ6A 5JFOA 3PRJA 3TF5A 2OUIA 2DTEA 4BNJA 3P2YA 4A2CA 3DBLA 1XELA 3E5RA 4D44A 3D64A 3UFXA 4GGOA 3O38A 3U4CA 4D41A 1KVQA 2OFPA 2FY8A 3DZJA 1DC3A 2FPPA 4R54A 3WGOA 1J5PA 1IB6A 2Q4BA 5I8ZA 4BNLA 3DBRA 4NFHA 4Q3DA 5ENDA 4D42A 4E2ZA 1JWAB 1X14A 5THKA 4UVEA 2QRKA 3N7UA 2PK3A 1GQQA 2QZZA 6ADHA 3B1KA 1LI4A 2BF7A 3VZQA 4XX0A 3NT2A 3D3EA 1IULA 3DL2A 5G2OA 1OC2A 4YQYA 3EC7A 2X58A 3VVCA 1RKXA 4TROA 5IN4A 4AJNA 4M1QA 3OQ1A 4FC6A 2HMSA 3WNVA 3W4IA 3OM9A 5A1TA 5JPIA 1G0NA 4MKXA 3ZV6A 3H9QA 1Q7CA 1A4UA 2XXBA 3ZWAA 3RWBA 4PZCA 1LTHR 3FTPA 3WSWA 1ZK3A 5FYDA 4E5MA 2EKPA 4WUVA 1B8UA 3JQ7B 2BFAA 2OBYA 3WFJA 5DBGA 5DT9A 1IL0A 1AHHA 2PKRA 2C5EA 2W4QA 3PIDA 4K6CA 2G76A 4KOAA 4U7WA 3OH8A 1YRLA 5JE8A 2JAPA 2ZB8A 4EEXA 3GA0A 1HWYA 1C0KA 4YAIA 2AXQA 2WYVA 4OOFA 5KVVA 4R4JA 5AXBA 3OICA 3WOHA 4MKZA 4E32A 3ZCXA 5JXWA 3KOUA 4IDEA 4J4HA 4ZRMA 3RKRA 3ROQA 1F14A 2X0IA 4ZICA 2I67A 3I4FA 3STHA 1NQTA 1U8XX 2RHRA 1ZSYA 1Y8QB 2PY6A 4R5HA 5IZCA 3KO8A 1LLCA 3RFVA 2J5QA 1GTMA 2Y1DA 1GQYA 2DPGA 1ZCJA 3DZHA 1ZJYA 1R12A 3DR3A 5G0WA 1EVYA 2CD9A 3UUWA 4DREA 3MOIA 4EEZA 1T2AA 1M6HA 2W2LA 1EFKA 1HLDA 1UXJA 3E1KA 1MXFA 3T7CA 4H7PA 3WYEA 4BO5A 1EEHA 1QP8A 3VPFA 2HRBA 3H5AA 2JHFA 3SLGA 3GEGA 1NQ5A 4NI5A 1NQOA 2JAHA 5JYEA 5KNLA 2GN4A 2VT3A 3MJCA 1FJHA 3DAGA 3ZW9A 4DTIA 4IBOA 1PTJA 5JYDA 1YL6A 1U7TA 3H2ZA 5CP8A 5DZSA 5CDYA 3JQ7A 4XR4A 4PLZA 2O3QA 3AY3A 1QKIA 3BTVA 3INTA 2CNBA 1E6WA 1Y7TA 3L9XA 3HWRA 4BO9A 5CDTA 2Q50A 2VZ9A 4L75A 1MLDA 4NK4A 1LSOA 1UAYA 2V6FA 4DQUA 3PFWO 4LGVA 5G0TA 3PYMA 4PLPA 3ZV5A 2YV1A 1Y1PA 2BFOA 3UICA 1Z75A 1LNQA 3C1OA 4U0KA 4M8SA 3NJ8A 4DVJA 4TQGA 3I4CA 4P8RA 1UP7A 2G1UA 4ZA2A 3VH1A 4I5GA 5JMWA 1N9GB 2EGHA 5GY7A 3LT1A 4N18A 5DP1A 1DO8A 1LLQA 3JYLA 3S2GA 1A7AA 3WLFA 5FI3A 1Y8QA 3EW7A 3UW3A 1D1TA 1PU2A 1CWUA 3Q2IA 2H6EA 4E2YA 3TOXA 1YBAA 2GNAA 2BD0A 4U8GA 2JJYA 2YY7A 3JQGA 2E82A 1SBYA 1EK6A 2GASA 3ZU5A 5JMPA 4XDZA 4E5PA 3K96A 3OEWA 2B69A 4YACA 1UP4A 3H6KA 4IY1A 3RAJA 1P77A 4OKIA 4J7UA 4R9RA 2OMEA 4YAKA 4A7PA 1TLTA 3DHNA 3IUPA 5FEUA 4RVUA 5TS3A 3LSYA 4O6VA 3VTZA 1Y5MA 3GHHA 1LC3A 1N7GA 2X22A 3AOEA 4QO8A 2QW8A 5TF4A 2WD7B 5KOIA 2OOSA 1NWCA 2X9VA 1DRWA 4WNIA 5A5FA 2HK8A 3C1AA 5BSEA 4K1LA 1P1JA 4OYRA 4DLBA 4Y9DA 4E0BA 5IXYA 3L0DA 1LBEA 5AXCA 1LUAA 1NAIA 3KB6A 3MJTA 4XIYA 1U7HA 2YUTA 3DO5A 3N58A 3P7MA 4ALNA 4TZTA 3PGJA 1BVRA 4BNFA 4BKUA 3WDSA 1P1HA 2JD1A 2CF5A 1NX6A 2E6UX 2FPGA 4GAEA 4DYVA 2H63A 3HN7A 1N9GA 5THQA 1LA2A 3HHPA 4NH4A 4WLEA 1T1SA 4MP6A 3K2EA 2QYTA 4RDHA 2NQTA 1ZK2A 2PLAA 3QSGA 4F6CA 3ZWXA 5KCZA 5EJ2A 3NTRA 1ZKMA 1ZW1A 3BXXA 4J90A 3CH6A 4KMSA 3LF2A 1PS0A 1UXGA 2DBRA 3CINA 2FR1A 3HSKA 2F1KA 2NM0A 3I9NA 1NASA 3QWBA 1SOVA 1JLLA 4QT0A 1Q0LA 1O0SA 5ADHA 1PGJA 4KQWA 2P4QA 4FSHA 4UVIA 3ITKA 4DXHA 1YB5A 3F1LA 1LQUA 4UVHA 1WMBA 4WASA 2X23A 4J9UE 1NHGA 1XWFA 3EUWA 3WMXA 6LDHA 1JKIA 1NTOA 4KTVE 4K6FA 1Q0QA 4CUJA 1DSSG 1HYGA 2J6IA 2FR0A 2Y0CA 4L9RA 2VOEA 4Y98A 2D59A 5DN9A 1I32A 1I2BA 1U5AA 2WD7A 1Q7GA 3KRTA 3L07A 1OFGA 2VWQA 3RC1A 5KWEA 1QLJA 1XA0A 5AQ1A 2YW9A 2X1HA 2X0JA 4HXYA 4J49A 4PLWA 2C59A 3SX2A 3VAZA 2B35A 3GAFA 1LDMA 2Q4EA 2Q1WA 4RGBA 4BO3A 5C37A 4MP3A 1C0LA 3A28A 1Y9AA 3BHIA 1VL8A 3QVXA 3AY7A 4FOOA 4YT2A 3AI1A 3FNHA 4AJPA 3FNFA 2C0CA 2TMDA 3KLMX 3NV9A 1MC4A 3BA1A 4TRNA 1EUZA 4XWYA 7ADHA 1GYPA 3BTSA 4G81A 1X13A 5G0VA 4I1IA 5C7LO 3Q3CA 2I6TA 4CLEA 2ZK7A 2HMUA 3KUXA 1V3UA 3WXBA 4CLDA 2VHWA 3HADA 3A4VA 3TQHA 3WMWA 1CIVA 2A94A 3DHYA 2HRZA 2I76A 2NVUB 3NGXA 3V1YA 4BGEA 4N54A 4FQ8A 3I9JA 2GR9A 3UCEA 5U1PA 1NPYA 1MB4A 3KBOA 4IZIA 4I8XA 1VJ1A 1V35A 2G17A 3AI3A 3H9EO 2Y68A 1Q1NA 4D0SA 3BHMA 1B26A 3ZNNA 5EPOA 2OP0A 4Z3DA 4ND4A 3JD4A 2Q99A 5LDGA 1GAEO 1G6KA 1OAAA 3MEQA 1PJ2A 2Y0DA 1LRLA 1X1TA 2GD1O 5CAEA 3RQSA 5JAMA 4MVJD 4LW8A 4MVJA 4Y6SA 1TA4A 3AK4A 2O7QA 4OSPA 4BNXA 1T2DA 3LLVA 1YS4A 1M2WA 4K26A 2OXIA 1E5LA 2Y1GA 3NX4A 4Y6PA 3RBVA 2GERA 1PGOA 3IC5A 4RVSA 1H5QA 3GN1A 1ZK0A 1I3MA 3FWNA 1H94A 4ND2A 1U9JA 2FOIA 3HDJA 2P5YA 1A4IA 1F17A 4CMIB 2DUUA 4MVJM 1N1EA 3G0OA 3E6AA 1E7WA 2GLXA 4CL3A 4EI2A 4XYLA 3MJ4A 2PV7A 2UVDA 3BMCB 1N8KA 3TPCA 2A4KA 4B7CA 5G0UA 2HSDA 4F45A 2VN8A 1GDHA 4A0SA 3E48A 4A03A 1MX3A 3HFSA 2GZ2A 4YB8A 2D0IA 1EFLA 4W9NA 3ZWMA 5CG1A 1VM6A 4CM7A 4UAGA 3GK3A 5T5QA 4BMNA 2ZYGA 3MZ0A 3I6QA 3X2FA 3OF2A 1NM5A 2P5UA 1IHXA 2FHSA 2NVUA 4NBTA 2DT5A 1PQWA 1U3UA 1ZJZA 4ZN6A 1PQUA 2NLOA 4X54A 3D7LA 5A05A 3QP9A 2VTDA 4ROSA 3EZLA 2DBQA 4BGVA 1CDOA 2B37A 4DBVO 3PHIA 3RUIA 2ZYDA 4NHEA 3PWKA 2Y99A 4RLSA 2DC1A 2R6JA 3WTBA 1WMAA 5ILOA 1VSVA 3KZVA 1DHTA 1X7HA 4XCVA 5COQA 2EJWA 1VRWA 4TKLA 3W1VA 5T6BA 1LDBA 4GH5A 2A9FA 3GFGA 5TQVA 3WX0A 3GT0A 9LDTA 4MVJE 4TWRA 1CETA 1ONOA 3UXYA 1YL5A 1E7YA 4XA8A 3GPIA 1VI2A 3WGZA 4CV3A 4BNZA 2DTDA 1CQJA 4H15A 1K89A 3WNQA 4CL8A 4JK3A 4YCAA 1T2FA 3PWSA 5IZCC 2WD8A 1Q7BA 1VE9A 4R1TA 2J3IA 2OZPA 3I6IA 3EY4A 3V5NA 2UDPA 5AYVA 3PI7A 2PZLA 1SB8A 3EVNA 1F8FA 3GLQA 1B15A 1PL8A 3JQAA 4CMIA 3K9QO 3H7AA 3F46A 1HKUA 3ADPA 1C0PA 4WKGA 2CMDA 4J6FA 3ROPA 3BMCA 1PJLA 3CPSA 3UCFA 4PLCA 1IHYA 4J1QA 3RUAA 3U5TA 4OAQA 2RH4A 5JAQA 3DONA 4KZPA 4YRAA 2Q3EA 4J91A 4D0RA 4E5YA 3HN2A 3UCXA 2UV8A 3RI3A 2Q46A 5F5NA 5BSGA 1OZAA 3F3SA 1ISIA 3TFOA 2QG4A 2EXXA 1I2CA 3ETEA 3H3FA 4WLNA 4QXMA 4Q3AA 1DLJA 4E13A
chains in the Genus database with same CATH superfamily
3G2LA 3ADKA 4NRDA 2YNMD 5AOBA 3PGXA 3ZW8A 1GRRA 3DZGA 1RHQA 2EBUA 1EG7A 4RJTA 1R6DA 5BSWA 3ZDFA 4RX1A 1B2RA 1OBHA 3EDQA 3L0PA 2FZLA 1JHRA 1AF7A 3BEOA 5F23A 4XWWA 4MQBA 5JUWA 5AH0A 1EWVA 1OIVA 4HATA 4LXYA 2X7JA 3GJ6A 1VRVA 2OHIA 3DVQX 4C7JA 1PCXA 5I9NA 1JDNA 1RYEA 4BKRA 1YZHA 1CUGA 1JDBC 3O95A 4GVLA 2YMLA 5FI1B 2HB6A 1PS8A 3VDNB 4RTMA 5C4MA 3WJ2A 4FVTA 1YJ8A 2QAGB 4CWAA 2P9ZA 3R5KA 3ZHXA 4ITUA 1L5LA 1E4OA 1BGVA 2BI7A 1YQQA 4XDGA 3GMDA 3UOGA 4F93B 3GEDA 2BFMA 2H1VA 3HJHA 2IYWA 4G56A 3RREA 1TM1E 3TSZA 2H85A 4LCEA 1I2MA 1NJ2A 4PIVA 4DJAA 1BA3A 3VX3A 2FWPA 3G2NA 3QXJA 3GFSA 1JYFA 4C4YA 2QM0A 2QN8A 4FFMA 2JK0A 2N1MA 2ZJ3A 3PL5A 5HXAA 3PHLA 3OZ7A 3E4CA 4CKWA 4YS6A 1ENYA 1ZNWA 2I7CA 3HMQA 4IWYA 5AQEA 3FBGA 3D8RA 3RSGA 2XUZA 1JR3D 1RVDA 1YZFA 1T0JB 1XCLA 1UZLA 2ZUVA 3AG5A 5ALXA 1B0UA 1TLLA 2FW0A 1Z4LA 3T41A 5I7FA 1XOIA 2XI4A 1JXQA 2PUTA 3W9SA 2ZBEA 4B80A 5AK4A 1NVTA 2PKQO 4F4HA 5J4HA 2AK3A 5BV0A 5T67A 1S9DA 4WK2B 2VDRB 1FF9A 2V7PA 2QLLA 3OJCA 3UJCA 1EFCA 3CGWA 1NV8A 1P6QA 2VNAA 1SQGA 1PEDA 2BGJA 3QQPA 2ID7A 3F6YA 3WA6A 5KSWB 3FOEC 1UKZA 5L40A 1RQRA 13PKA 2W2VA 1MH1A 2YQ5A 3I2FA 4P35A 2VH2A 2IIPA 4ARIA 3L7CA 5B3KA 1LI5A 3DMTA 1QH1B 4MZDA 4BQFA 2BUAA 3GP3A 3N6XA 4TSKA 1GSIA 1YS9A 1HEIA 1R10A 2WUVA 2YWJA 1XO1A 3KQHA 1UXOA 5F76A 4WOCA 5A02A 4ESOA 1DKMA 1TKAA 3B7GA 1OBFO 1VECA 5CFPA 1ESNA 1PR9A 1TIKA 2KBEA 4Y6GB 1Z26A 1TJNA 1PF7E 2PRSA 1LV8A 5L7WA 1NFQA 2D1YA 2WD9A 1EXVA 1C3EA 1ML4A 3R20A 5TEWA 1R5NA 3GQVA 3I9LA 2FRXA 2PUJA 3WBKA 1BO6A 2PTGA 1E9RA 1LWOA 2A5LA 4H1TA 5IS2A 1V9LA 1B43A 4WQMA 4Y1EA 5AW6A 1CUYA 1IY0A 1XN1A 2QUZA 1E9AA 2WIGA 4XTCS 3PXBA 3F98A 3AW9A 3L7IA 4KMOA 4BNMA 2QV7A 1IM5A 2MOKA 2HKIA 4FZJA 4EZIA 4JAVC 4ZK2A 3N9IA 4M1OA 4YRBA 3ORHA 3KLOA 3CSUA 4M0LA 3ZYCA 3ICQB 4IOLA 7MDHA 2CLKB 1HT0A 3GZJA 1OLSA 2VEOA 4LYEA 3WRWA 4K03A 2BTQA 2P91A 1UKEA 5T3YA 1E2NA 3C3YA 4RF3A 3GJ7A 4CUZA 3GQBB 1GL9B 2QP4A 4AKGA 1XDGA 4C4ZA 3A9UA 2WTMA 4HDQB 4LG1A 1CW2B 1W4ZA 1SU6A 4IG4A 4JOBA 2E5FA 3TTWA 2CHQA 5HOQA 3BFVA 3AY0A 3G5LA 2P4UA 3D8TA 1U8UA 1CB0A 4OJNA 1O96A 2BIFA 2F8MA 4PW0A 4HH3C 5ILGA 5KHAA 5KNDA 3HVRA 3GT4A 3GNQA 4CM1A 2ACEA 2FWAA 4TXMA 4CRWB 2PGJA 5JRZA 3HG7A 4HDOB 1OFVA 1CUUA 2JFPA 2XA9A 5CFRA 2YJZA 2WKPA 3AFNA 4WN3A 2HBYA 4MR9A 2DR0A 1U2RA 2VQ6A 4MNTA 4B3JA 5JQWA 1O8CA 1FDTA 3OM1A 4OQMA 1PFUA 3JWPA 4UAUA 4F1WA 5AM5A 5GONB 5IU6A 1Z4PX 4CMAA 1A9SA 5FV7A 4CQLA 2NQ8A 5KYNA 4Q9HA 4ZAXA 2P5SA 5F21A 4YAGA 5JWOA 2W2PA 1U3CA 1SG6A 4FFPA 1Z7WA 1AGPA 1GPJA 4IXTA 1KY5A 2IW1A 4KWEA 4NATA 1W88B 2ZUTA 3B6JA 3C48A 4CG3A 4BMSA 3Q8MA 1XAHA 3T9FA 2XB2A 5B6PA 2HHHB 2GN0A 5SV2A 1BHJA 1RMQA 1USVA 3ND6A 4C7OB 3OI7A 4R9VA 2QD2A 3WJ7A 2C3OA 1E2UA 1L5SA 4GYYA 4JFAA 4G36A 2J3HA 3W8FA 5IXJA 3KXPA 3IBSA 5DGTA 1TK2A 2RGGA 3FAKA 4G0MA 3REFA 3EDMA 4IDCA 3U3DA 3LDUA 3ZJ5A 3L7LA 1IN8A 1G291 1P2VA 4J0HA 1HTWA 1HDXA 1LX7A 1SQ6A 3A14A 3PHHA 4FMDB 3UMGA 1RJGA 4TT8A 1L7MA 5JSYA 1EHCA 5JNTA 4M9CA 1IRXA 2ON6A 4X61A 3S40A 3SEAA 1WHTA 3EZ6A 1ZP6A 3SKXA 4JKOA 3V1MA 4DIBA 2A59A 3NQ41 2PZBA 2D2FA 1Z7BA 2A9KA 4DDMA 1DEXA 1UDRA 3KWLA 1VL2A 5F1OA 4DUPA 5AVXA 4HAWA 2O7RA 4HGZA 4CPDA 1NIPA 4H60A 3LYLA 1N6PA 3ZGNA 4HZIA 3S1AA 5IEJA 2K6GA 3QE4A 4J3JA 5F4BA 2JGMA 4G2NA 4G4SO 1IN7A 1EEXB 1V4VA 4RSHA 2FF7A 2VHUA 4XUEA 4JI5B 2JLZA 1VPLA 5JH7F 1QMGA 2FQQA 1RI4A 1JFVA 1WVGA 4X45A 2CMKA 1XLWA 4LNAA 3G88A 3HACA 4AY3A 4CR7A 1OIWA 1KJIA 4HGYA 1PAUA 1YVDA 1ZR4A 1EVJA 1SC6A 1SCAA 1WCV1 1MD9A 1X38A 2FE1A 4JI0B 4UEJA 1Z7EA 3QJGA 4KRGA 1Z0FA 2XEXA 3OT1A 2H3HA 5DM0A 5EUMA 4D9HA 4YCMA 4EQ6B 2BMVA 2QQ0A 2JI8A 1RIFA 3OY7A 5T4EA 4GSYA 1HO3A 4IDDA 4YMHA 2NO9A 1IUNA 2XNDA 3ACBA 5FWDA 3T1OA 3ZBTA 3OTWA 4PHTA 1BAPA 5HUQA 4KFRA 3OEHA 3RF7A 1J07A 2A86A 5FI5A 3SM9A 2ZIFA 2EV9A 2O2DA 4Z4EA 3DPSA 4DA9A 2H18A 4M54A 1EP1B 1EWYA 2DLNA 4QFDA 4CGYA 4RK7A 3TTTA 5KJCA 1VZ3A 3DC2A 5KYYA 1U0EA 4G4JA 1KGDA 2Z98A 4FFBB 3WK4A 3VMMA 2QSZA 4I19A 1DBVO 3B2NA 2I9KA 3PHJA 1VI6A 2HJWA 2MTBA 2PA0A 2H57A 3A05A 3ET4A 3N2KA 5KC8A 3ZVLA 5IUNC 2LDXA 1RAAA 3H0CA 5T57A 4M0DA 3PNLA 2H16A 3KQSA 1VHLA 2HQSA 2QQ5A 3NBQA 3JQDA 2YIMA 4GI1A 2FUNB 4MULA 4LJ6A 3GVHA 1XLVA 4O2AF 3TQTA 4CV0A 3RTEA 4E4RA 4IDAA 2BGIA 1NNEA 2HK7A 2FWBA 2OCGA 4C1BA 1VSBA 1LNSA 1AM4D 1FNDA 1D5CA 2VDQB 2REQB 4MAFA 4RVNA 2V7VA 1E2JA 1PLLA 2Q5JA 4B09A 3MBOA 2VI5A 1POWA 5H4GA 3BEDA 1DWQA 4Q18A 3EUEA 4ZOCA 2E4AA 5HKOA 2Y9PB 4ZODA 1V1RB 1YB2A 3JTMA 4FOSA 5EIOA 4C2AA 5ADUS 1UWKA 2VAPA 3R0IA 1U7OA 1ZJ4A 3O8OA 4P32A 5EINA 4AIIA 3CIFA 4B4WA 4DWOA 4E51A 4MKHA 3OETA 5EE9A 3QMWA 2NZXA 2WYHA 2VQDA 4C06A 1IONA 4GYJA 2IL1A 5LQNA 5DPMA 5G4KB 4WOBA 1YB7A 2CYBA 1L5KA 4BCBA 4ZOLF 1E7RA 2G1AA 3CS3A 3FX2A 4DY4A 5LKRA 5CBKA 2AMFA 4K5QA 1RZRA 2V65A 5JQGF 1IE3A 2IH4A 4JGBA 1SQSA 2HGSA 2V97A 3TBKA 2OY0A 2GK3A 3SQOA 2JFOA 3F7NA 5FWNA 1KI9A 2ECOA 2MMCA 1R0KA 3EVZA 5EZYA 5HJ2A 1V5FA 4BNUA 5A4FS 5LJIA 1J9ZA 3LHKA 3I12A 2PYDA 3IHKA 1IZ8A 4L57A 2HRRA 3WFZA 1O6ZA 2JATA 2C99A 4YMUA 2PU5A 3TOVA 1R15A 4HFNA 4QFBA 4AP6A 3KQUA 5EJMA 1M1NB 2FG6C 2QXYA 1OPRA 1USIA 3TAUA 1OAOC 2I7DA 4XARA 1G20B 1E99A 1MTOA 1ORRA 4ZQEA 4ADSG 1QIFA 2AFHE 1J49A 3K7EA 3D54D 3EDCA 5IYZB 1JR2A 2W2KA 4KG7A 4X63A 1FNSA 3B6IA 2NUAB 5CEJA 3EAFA 4ZARA 4X1KA 2A9QA 2IGBA 1G8FA 2G25A 4LRYA 1IBLB 3Q87B 5HM6A 1Z4JA 5AJUA 5AVSA 3SK0A 1YI1A 3KB2A 4Q34A 2ATVA 3DTTA 2Q6VA 3EXFA 4HQKA 4KUEA 2HV8A 1CY1A 2MIIA 1OI4A 2VP4A 4DDHA 5JHHB 1OJLA 2RGNA 4RZXA 1T9GR 1VSQA 4LYGA 3KZMA 1Y4UA 2O7VA 3ISTA 4K0RA 3T3HA 4CKCA 1QIIA 1QYDA 2FV8A 4RM3A 3T38A 5KS2A 1F2DA 2QNIA 4FYVA 3UPDA 4BDTA 1MAWA 2BEUB 4TX1A 2W48A 5CVTA 3G2JA 5CNMA 1UDAA 1EVQA 1PNQA 3OUZA 4FU0A 5A0TA 4G1BA 4WJLA 1KWGA 3HDQA 4DSOA 1RPAA 2EFJA 1R0CA 1XSEA 2FWRA 2Q3CA 3U49A 3AT1A 4I1YA 2YZMA 3Q88A 4UTRA 2XH8A 3DT6A 4QPNA 5JO9A 5TT1A 4MUEA 3UPTA 3WIVA 2OZEA 1RKUA 1SRQA 2D0PB 1FEZA 1MF7A 4Q5IA 5JSQA 2JASA 5DH9A 3PE3A 3FPLA 5CDFA 1BYUA 1P7WA 2VAXA 3JATB 4BZXA 3LUKA 1E6UA 1P4JA 1HUQA 4KLAA 1DAKA 2H4HA 2Q5QA 1O97D 3A9SA 3QIVA 5GTDA 1ULSA 1KAOA 4QTZA 3T9BA 5FA5A 2I99A 1A8SA 4L5JA 3UGKA 1PZHA 3OJWA 3RSHA 1NGSA 3IQXA 2AI1A 3ABZA 2HEGA 4YRCA 3R0VA 1QBGA 4JUDX 2VATA 5F3RA 4EZEA 1AXGA 2RFLA 3JARB 1KVTA 1WB5A 3KTAB 1U2TA 4PU0A 1ZICA 2HBZA 5C4IA 1Z0DA 5CTJA 3QKRB 5FUQA 3ZHYA 3ED5A 5HKBA 2BGRA 2CW5A 3JZDA 2GETA 3QY9A 3EA4A 4DF3A 2L82A 3A6EA 1HNNA 4MCIA 2CNDA 5JNRA 3VVBA 2PLWA 1J20A 4XR9A 1QCYA 1UADA 3CG4A 1YA4A 1V9CA 4LZJA 1JXOA 3SSAA 3W05A 2HW8A 1TIBA 1FYDA 1T3LA 4V39A 3DB2A 4CJXA 2CBZA 2WIAA 5HK8A 1OXXK 2A9OA 4Z9YA 5EJGA 4N01A 3ZY3A 1EBBA 1ZGJA 5E4TA 2V0NA 4PQEA 3G7UA 3OM8A 1IK4A 3C45A 4D1YA 3FOCA 4B44A 2EL7A 2WLSA 3MD0A 1WU8A 2BLLA 1CFZA 2JLBA 2ZI9A 4P4NA 5AW4A 3RAEC 3N5CA 2N1BA 3K6SB 1T9ZA 4E88A 2P6UA 2XJ9A 2NV6A 5F7ZA 4YRRA 4WTOA 2DUJA 3PFBA 3TX6A 3UA3A 4LOLA 4DS3A 1LPNA 2ZSUA 1LVUA 3MVEA 3UHOA 4A82A 1CEEA 3TJMA 1BXGB 2G72A 3WDMA 1XYGA 2XXAB 3TH5A 4OHWA 4UVGA 2V3WA 1Z12A 3R3HA 3MWFA 3O03A 3RSLA 4TWIA 2C4VA 3DMTC 1NAHA 3KJFA 2HZ7A 1LSSA 5FLEX 2FH5B 4ZVSA 2Y1EA 3R75A 3TW0A 3URKA 3PUHA 2DBVO 2Q1YA 2QM7A 1BSVA 4HUJA 5IJ9A 2GM3A 1QTNA 4OXQA 1TA9A 1YR6A 1Z45A 1MGOA 2YZ7A 1NXXA 3BWCA 3D6VA 2LKDA 2LUOA 4BO7A 1O57A 4D7AA 3HUDA 1EM8B 1E79A 3KR2A 4H3HB 4C4TA 1N7IA 3O2JA 2R6R1 2W0MA 3PPYA 4RF2A 1A7UA 1CCWA 3V3TA 2OWEA 4LSZA 4Q3KA 5IBPA 1QK4A 4DM3A 3C6QA 4DIEA 3PFKA 4DIOA 4E7OA 5MFZA 3ADOA 2G5CA 3TVDA 3BH0A 4BQQA 3REQA 4KXWA 1XRQA 3ZIAD 4MUFA 3ZZ1A 3LO5A 5EN4A 4B5KA 1RFLA 3DEHA 4MVJH 3Q9UA 3GJZA 3ASUA 4MLZA 4F2GA 2J45A 3RSQA 1ZA1A 1O95D 1JQJC 1N32B 2HA7A 1G20E 4ZHQB 2AE2A 2OUKA 4AZ0B 2Q3DA 2C9ZA 4NENA 4PYKA 3T0FA 1K5HA 2E49A 4NYIQ 5AKJA 3EPJA 1PGQA 1O1YA 1ZXXA 3WGIA 4DGSA 1Z82A 2XYGA 4NV3A 3BIWA 4EVRA 4RTPA 4LUCA 3CW8X 3PS9A 3L8ZA 2C88A 3BXZA 5FBWB 4HTAA 3F3YA 1P31A 5I51A 2VRBA 4R84A 4ZU3A 1C81A 1OT3A 1CJVC 4W6ZA 1QDLB 4D3DA 1Z8NA 2X1VA 5FJIA 5BYJA 3U16A 1JAIA 2GS9A 3HGMA 1X1EA 1IDOA 4A8JB 3EQ8A 4PCAA 2ZT5A 3SIRA 5LQKA 2XB4A 4CG2A 4AG6A 1QTRA 3OCCA 3DA8A 1M8FA 1FDVA 1GQ2A 1HOXA 2X3YA 2JCYA 1VYUA 3FPGA 1X7WA 1FMTA 3QXGA 5B1IA 3VR4A 4E94A 4OP3A 1R5JA 2HDHA 3MTQA 2BSXA 3O2SB 4Y6LA 2J0UB 3G02A 4YPFA 2VCYA 1WKBA 1X1QA 4MVJP 1LD3A 3B8EA 4NYMQ 4H27A 5AJVB 4AURA 4MS3B 1ADCA 1G64A 2AW3A 1C7EA 2BEKA 1TKRA 4C4RA 1PEKE 1D0IA 1UDCA 2J3DA 2VHEA 3AV3A 5CVDA 2G4VA 4EX7A 1DQSA 1BCRA 4FHCA 2ZWVA 3FYDA 4EBBA 1X7DA 4GC5A 4PCVA 4E70A 4CDRA 1HFKA 5J2TB 4BQPA 1XLTA 3GBVA 1HF3A 5C8YB 1H4SA 1EQAA 4OHKA 1GQSA 1L3CA 1JDJA 1EBUA 5CW2A 4BX8A 5K0EA 2BISA 2I91A 1GAWA 1TJYA 4Z8YA 4BNTA 2WFMA 1KAQA 3DKKA 1MO6A 3H5LA 1J2JA 4V0LA 1R8SA 2C3PA 4OI4A 5IDYA 3HRIA 2GTPA 4KJZA 4AZ3A 1II8B 1VMAA 4FFNA 5EJFA 3KHSA 5K09A 1I3CA 4NQZA 1MP0A 1M73E 3AEKB 3FUVA 4YJFB 2JGFA 2YV4A 3MXOA 4B5LA 5JW6A 2RD2A 1KVSA 3T0IA 1SZCA 3Q5DA 2J9YB 2G28A 4CQJA 2IY9A 4FR0A 1JA9A 1FRQA 2W22A 3BHJA 5HRUA 3UMYA 1X1SA 2RIRA 4CMJA 1CVIA 3K16A 5IBRA 4IHQA 1B3BA 1L7VC 1LNZA 1NUTA 3WRYA 2QV0A 1X7XA 1HMPA 2FN9A 4OYYA 1NZDA 4J7XA 2BTOA 2BBOA 4DRXA 1MENA 3EGWA 1ZW6A 2FP3A 2AYYA 3O4FA 4G25A 4U2DA 4HS4A 1YFKA 4RGVA 4DZRA 3H84A 2YYAA 1R4AA 2X6QA 4JZYA 2IKSA 3MJFA 1U9YA 3DVAA 3PDIA 4EARA 1PJTA 4PIPA 4G0OA 5C7IO 3KEFA 2Q1XA 4KRXA 1QPZA 2APJA 1OX5A 1PWXA 3V7YA 2O8EA 3KG2A 3PUYA 3PFGA 1R0SA 1SVLA 4FIZA 2HDWA 3OZXA 4ZGGA 2F3TA 3NBFA 3Q6IA 2HTFA 3QY0A 4JUCA 4MPJA 4PSAA 1V8OA 1SUDA 2ILTA 2CSUA 2YFQA 4L4YA 4X8HA 4KV9A 4YQEA 3VVLA 4ZVPA 4KR9A 4QUHA 3K0SA 4QYSA 3E03A 4KQ1A 2PEZA 2KJQA 1SKMA 5LDHA 1WUKS 1QM5A 3M9LA 3WL4A 2WWWA 4P4UA 3F3KA 2JLSA 4KAJA 3WYFA 1JHMA 5ALGA 4WLFA 3S8MA 5KTYA 1KEKA 4A2PA 2L42A 3PCRB 2QD5A 1YASA 2LD4A 4PZPA 3WGHA 5COAA 1QYVA 1HI9A 2P2GA 1IXKA 3LZ6A 3F5SA 4JSRA 4LK3A 3VR5H 4RZ3A 5K3SA 2E4ZA 2IYSA 3WB2A 6PFKA 2WUWE 1M3SA 3PD0A 3K35A 4RSRA 2NU7A 1DBIA 5CLGA 3ROZA 1ECCA 4M3NA 4MV6A 2GLUA 1U8EA 2E1PA 3FNRA 3MYYA 1QQ5A 1VJ0A 2YS6A 4IXMA 1CUHA 1XKTA 4ZT4A 4YONB 4B75A 4AY2A 1VHDA 1P61B 2QTNA 2ZLBA 3PPVA 4FZRA 4JV5B 2F1OA 3K71B 2BRUC 2J3KA 3GMSA 1NX9A 1WY7A 2ZB4A 1IAVA 3FRHA 3S5UA 2R9VA 1YIOA 2TMGA 5T8KA 4YRQA 1ISRA 3N2GB 1OWNA 3NVKI 2FP4B 2OCYC 1P9WA 4UMDA 2Y1OA 4BNNA 2Q21A 4G8DA 1P1RA 1COWA 3L4BC 3SEFA 5BORA 3DZDA 1FIUA 1DJMA 1KSHA 4WZZA 3WLOA 5JH7A 4BNHA 3TNYA 3ECSA 3HHEA 3BXEA 1GO2A 3H2BA 1FS5A 1HH4A 3KOZA 1QX3A 1G42A 2ZM6B 3BBLA 1H9CA 1UH5A 4YHBA 4HZUB 5A6VA 4UBOA 1GGKA 2BEJA 3B1ZA 3E3LA 3A1TA 2YNMA 2DKFA 2ORVA 3IDOA 4RWZA 2RGRA 1JA1A 1VJTA 3GJ3A 2QZJA 5EMHA 1RWOA 2AXEA 1U80A 3OQIA 4C5AA 3U4QA 1W96A 2ZJZA 3L1KA 5J4KA 4OKSA 1C1XA 2AJTA 3H2KA 3U44A 4RPKA 3ZK9A 4F8EA 1X0VA 3RRBA 1IQUA 1L6RA 1GCGA 1SQ5A 2C07A 2Y05A 3JWJA 4I5FA 5F2OA 2PIAA 3H2GA 3LWBA 5FUVA 4BWYA 4L76A 2CV1A 3AESA 1GZ7A 3VSCA 3PBKA 5DO9A 5JYCA 3QFSA 4JJ8A 3RWOA 1E0SA 1U9ZA 2OORA 1MO5A 2E48A 3WGJA 1NU6A 3GYGA 1G8PA 4FTWA 4WADA 4P81A 3KUKA 5TQ2B 4O2AA 2FWMX 3DQPA 3V8PA 5AICA 4KTTE 2P6NA 3R23A 2VSYA 3A3KA 1L7EA 2X2FA 4YREA 3V2GA 2R65A 3WICA 3C7CB 3ZWDA 2DTXA 1E6EA 2P9HA 2OENG 3PJFA 5JOQA 4WCFA 4DILA 4JQZA 2IXGA 2YRWA 2ZUUA 2AXNA 4PYLA 5TGDA 4E6EA 3F71A 4N9WA 3QYAA 3IMFA 4IIDA 1CERA 3THYA 4NZOA 3F6RA 3COWA 1Z39A 5A9SA 2C9YA 2Q6TA 3ZVKA 1JR4A 2P30A 3P45A 3E9NA 3T61A 1KK3A 5EWLA 4DMCA 4KO3S 4Y2JA 1PSWA 4GBJA 4RD1A 1Y9EA 2DPLA 1A76A 4GEGA 2RGBA 1QZUA 4U7HA 1AQIA 1OCEA 2TMYA 4W9MC 4ZOLA 4Z0HO 4AI6A 4JHLA 1JG4A 3G8CA 4HAIA 1GYQA 1YH3A 4ZCTA 5JQGA 4MGHA 5ILQA 1JRLA 1Z4IA 3B1WA 4CCYB 3THXB 2VPPA 1S7CA 1T1IA 3QE2A 4CGZA 2OBBA 2YINC 1QIMA 4G23A 1H42A 4K7JA 5AD1A 2VJLA 1I13A 2GHRA 4F71A 5CX1B 3FDZB 5GV7A 1AQ6A 1H2ZA 2HYIC 4LYDA 1S01A 3ON5A 3AWIA 1C30A 4A6XA 1U8TA 1Y5RA 3FR7A 4LKRA 2DHQA 2XMPA 1T0PA 1UXIA 3G5MA 1IIBA 1UWVA 4UU8A 1ZBQA 4GD3Q 4DCGA 1MV8A 1ZGAA 3HB0A 2B7BA 3M9XA 2QX9A 4X94A 4Y1FA 5L3SB 3R5FA 2G5GX 2VYND 4ZKDA 4ER7A 4N49A 4N41A 3M6FA 1LLDA 4GOKA 4N6GA 4M98A 3TWOA 3PKZA 4PNHA 2ZBUA 3LHDA 1GGMA 3WL3A 1IY1A 3E3NA 4WNAB 4ZC8A 1J2TA 3RS8A 2WRZA 3Q9SA 2A1IA 2JBAB 3UT5B 4RLQA 4XUGB 3RYFB 4ESVA 2MDTA 4GZ5A 2RH9B 4BVEA 1W34A 2W90A 3R9XA 4YMVA 2XT0A 2P9JA 1SUCA 3HZRA 5FUWA 1UP6A 1FS4A 1MKYA 1Y3FE 4MO2A 4HXGA 4O4IB 3CXRA 2Y92A 1RZUA 4XB1A 1P6UA 4GYKA 1WSDA 3ET5A 3DV0A 1M2OA 4K9DA 1T4GA 4ZHQF 2QRNA 2XUJA 1FFEA 3IKLA 4R05A 1FSZA 2D8AA 1RADA 4QVGA 2HN9A 1NY5A 2WFLB 2P9GA 1CRZA 1GDTA 3EUAA 3ZI4A 2FF5A 4BJ6A 3R7WB 4EO9A 2HHJA 1T36A 1EUDB 2HLNA 4J3FA 2W93A 3T7KA 2C2KA 4V0NA 3VZRA 5AOVA 3VYRB 4PANA 3HDHA 1V71A 1ZAYA 1GZ3A 1HSOA 3CF2A 5EERA 4D6YA 1XDWA 3CG0A 1B6SA 2VIIA 2A0FA 1JI0A 4ZO6A 3ETCA 1TT5B 4EKGA 1U94A 4TPKA 4YLGA 2OHHA 1MRZA 2IOFA 2ZKLA 4KRYA 3IRVA 4L9WA 5JWRA 3HABA 1UOQA 1UBGA 3HDTA 2HLDA 2G71A 1WCWA 3C8UA 4B43A 3GT3A 3FOWA 5C1OA 4L9AA 2AOWA 4HC4A 3LZDA 3IJPA 2AFVA 5CUQA 4G63A 1SXHA 4EH1A 2CXOA 4AAYA 4DQDA 1KKLA 5J5AA 3CZ4A 2YWBA 1EUYA 3LPNA 3MERA 4OATA 4UMFA 5ES3A 2ZI4A 1KWKA 1TAGA 4QQ8A 4B35A 3INYA 1CULC 3PX2A 3LUGA 1H2EA 2D3WA 2CWDA 1NW8A 1V41E 2DWQA 1TF5A 2CK3D 2YDYA 2A0WA 3GW8A 4BV3A 3M81A 4IVQA 2HJ9A 4QUIA 4V0OA 4S1NA 2XMSA 3E1GA 2IYEA 4XE5A 2B4AA 2R5WA 2Q1UA 5FLXA 5C8YF 1LBIA 1BS1A 1HRDA 2PNJA 4DA0A 4DEXA 1USGA 3UAYA 1A9PA 2Y93A 3QG5A 3FY4A 2YIDA 3W2FA 2I33A 1A77A 2HO4A 4P3KA 3V4PB 2PS3A 1XZAA 2QJWA 4LEIA 3C7DB 2JLYA 3ZXYA 4O1HA 1F3OA 4UU7A 3LUHA 4UEKA 3OIUA 1HZJA 1P72A 3T4UA 2DWUA 4NPHA 2Z5LA 4B6FA 1GG8A 1GAJA 1V8PA 2AOVA 2IZ0A 2O14A 3ENVA 3IQWA 3QEOA 4AYWA 4BJ1A 1YQTA 3VUFA 4ARZA 1FW6A 4YECA 2BCJQ 4FHFA 3RB8A 3GQBA 3ZH2A 4RF4A 3AR8A 2AB0A 1TE2A 4G89A 3RAFC 5FBKA 4QLBA 1WB9A 4BB9A 1ODFA 2OGZA 3I5AA 4ASUD 10MHA 4DABA 4P54A 4CM8B 4F5ZA 5CB4F 3B9QA 4CIWA 1VPEA 1N2OA 1F6BA 4OFXA 2Y9MB 2FGJA 1XZCA 1DIGA 4PQFA 4JLJA 4Y3UA 5ADVA 1JMKC 1AK2A 1CUIA 3K0AA 2P40A 4NZNA 1A9XB 1XU4A 3COPA 3AHFA 4J7AA 4HH4A 4N5DA 5GZ6A 3MJSA 2WG0A 1QFSA 4UCWA 2Y77A 1YDGA 1O94D 3FTDA 3NC4A 5ETJA 1C9YA 1JL3A 1LBQA 2FZ4A 3D1VA 1OFTA 2YZNA 1VGVA 1CQZA 5DTQA 4F3CA 3TRHA 5FPHA 4FFDA 2BCEA 3NXSA 2ZUWA 3TJRA 3VU3A 3M4XA 4C0KA 4LOJA 5FPQA 2OO7A 5C80A 4YR7A 1PR1A 3ESCA 3IEVA 4DDWA 1FRZA 5EJ5A 1DV1A 5KVCA 2JARA 3VA7A 5B7GA 1XLTC 2WV7A 2WJJA 3M2PA 5EXDA 1I1OA 3ONDA 2GFHA 4EO7A 1GT91 4LS3A 2DPHA 5HJ7A 2ODPA 1NXOA 4QHTA 4MOWA 1Z6ZA 4KVAA 1W88A 1ZD4A 2YJTD 4NQRA 2AFHA 1KQFA 3PV0A 4RFVA 4L07A 1GSOA 1L5OA 3K9NA 2Y6VA 1JP7A 4KAXA 4BXOA 3A9WA 2BHRA 3B78A 1UIMA 3E0XA 1RM3A 3QFCA 2XYHA 3BQ9A 3C70A 5DDIP 3OFSA 2UUOA 1FW8A 1MJ5A 3JWEA 3T35A 1NDUA 1SZDA 4C76A 3V4LA 4A0QA 5DCWA 4PFQA 1POXA 2WMYA 3IO5A 1SPXA 2PWZA 4L8GA 3JAKB 1E6MA 4Z9BA 2W8BA 1K8RA 4H0CA 3ILVA 3WRYC 4CR8A 2EP5A 3DNMA 3GLGB 2XGMA 2BR5A 4TLEA 1DO2A 3H16A 2FEWB 3A26A 3BE8A 4HAXA 3A1DA 3PPWA 3R6GA 4GLOA 3PWTA 4RNCA 2P78A 4EF4A 1WW2A 2E7ZA 2V7QA 2P2CA 3QF7A 3VJMA 3JQRA 4EW3A 1B3RA 1GPNA 3BAZA 3EA5A 1DXYA 3JQGB 3K8ZA 5B7PA 4WXRA 4JYPA 4YRFA 5JFTA 1L5MA 1NUQA 4D0NA 1FMFA 5LLDA 1WDMA 1KS9A 1Y63A 2A92A 2FPSA 4LMAA 1SUPA 3I23A 4FKZA 3CTMA 1XMSA 2F43B 2OCIA 3JD2A 3OJLA 3KFXA 1KMIY 5IF3A 5IN5A 3GNSA 1HG1A 1UJ6A 3UC9A 2KM1A 3LF1A 4URZR 2GAFA 4MDFA 1GQFA 1EFVB 2IHTA 1BDBA 1MN6A 2GBCA 1BG6A 1MA0A 4R41A 2XPCA 3A27A 3I39X 1RYYA 3R09A 4DV3B 1NXPA 2FGKA 1L4LA 3EPRA 3W3ZB 1AMNA 2MSNA 1ZKDA 3E8MA 5E9QA 3RVKA 3TD2A 4DLNA 3F6SA 2HLPA 4MW5A 2GB4A 5KVAA 1T8SA 1BTOA 1V16B 1NE7A 3IBYA 1DIHA 2UYHA 1K3TA 3L0IB 4U3JB 4YJHA 3GP5A 2CFSA 3NI2A 2YY6A 4QJBA 4QWWA 4ND1A 4NTZA 2GESA 3BERA 1X19A 1E1RD 3FCUB 3PNVA 2BEWA 3GZNA 2ZTSA 2WU4A 4FFBA 1NQWA 3LFUA 3WK5A 4B4VA 3V4FA 2YVLA 2W37A 5BNWA 4AG5A 1N6RA 3K72B 1JHYA 3VHXA 4F5WA 2CSXA 1I4DD 1J42A 2CV0A 5DRTA 2H1WA 3KLBA 2QN7A 4P4TA 5JWHA 3IFSA 2PAFA 1FLDA 1B8VA 3FROA 1DBSA 2K5UA 2Q0SA 2PZGA 2ST1A 3DGEC 4KXFB 3OP1A 2AEMA 1SXPA 3DF9A 3LAWA 3D0OA 1M2VB 3LCVB 3OF3A 2XCQA 1T1JA 3DKVA 1XMQB 2AX4A 2RG1A 5FUXA 5BWLA 3GOQA 2DCMA 4U2FA 1G3RA 2V5UA 2Z3VA 1Y4ZA 1GU7A 3BRQA 2Z2YA 3KK0A 4NZYA 3UMRA 2H8GA 3NFYA 3R3ZA 4TLCA 4DV7B 2VA9A 5IT0A 4FPXA 4AG3A 3DKIA 5HE8A 1BROA 1JKJA 5A3VA 1V1RA 5E4JA 2V6BA 2ZBQA 3HUEA 3O4IA 1RABA 2BBSA 4GZLA 1QC5A 3A2KA 4TWAA 3DCIA 3M82A 5BT8A 2BEVA 2EP8A 1W9HA 2RHOA 2X8LA 3AYXB 2XLCA 3AF5A 3ESAA 4BO6A 4IDFA 3W5JA 3OT4A 1ZOSA 4HAZA 2C5HA 3IAM6 4LV8B 1Y81A 4IYRA 3GJTA 4D43A 1SHKA 1HFJA 4MK4A 1EGAA 2JGKA 3PVZA 2MSDB 3QVGB 4G5QA 4CI0B 3LVFO 3DH0A 3DEFA 3JYOA 1KSFX 4JITA 4YX9A 4J0GA 1T1RA 1YBFA 3BGVA 3JZMA 4L74A 5AK5A 4HX9A 2BKVA 5I9TA 3CKMA 5C5IA 1KZ7B 4RPLA 4IS2A 1M2KA 3P9PA 2V1XA 4LKOA 2FEKA 2XDYA 1N2HA 4FQ5A 4H17A 4BNWA 4Z7NB 1K7EB 1C3OB 4GLLA 3MRVA 4RE6A 2NZWA 3G1WA 1I6MA 1CC1S 1ZONA 4ENRA 5H0IA 3AF3A 3FKQA 2VYQA 3PNYA 3LPAA 1UL1X 3OCYA 1CT9A 1M66A 2ZSHA 4LHSA 1IWOA 1TUBB 4M7OA 4BMCA 4DCCA 4K9NA 3DE5X 2JLQA 4ZK6A 3ZLJA 5A2GA 3LUBA 2V03A 4R5MA 4W8GA 4M6WA 1JE1A 5HCUA 1MNQA 1G3IA 1N2CB 2SCUB 5FLYA 2GZ3A 5A4MS 4PLFA 4DJTA 5JJLA 4V0QA 4YFVA 5IJXA 5I6DA 3KPJA 1KFBB 2YJGA 1CZRA 2ZJ8A 2JD0A 3T1VA 5LQAA 4P3OA 1P0MA 3BRWD 4BZPA 2JEZA 3EMDA 4E09A 1OA1A 2AMLA 3LWDA 4U8HA 1R4MA 1BVUA 4K87A 3OFJA 4OM7A 2OYCA 5IZ4A 1L9KA 5E0OA 4GMGA 1X94A 3IR7A 4YAWA 4FDAA 4Z5XA 3EHEA 1RYZA 2Q3MA 1JEEA 5B64A 5CITA 2HF8A 1QYRA 2BMJA 4F11A 1KRHA 4P82A 3HB7A 2QN1A 5LNK6 1F48A 4JYMA 4PF1A 1QJCA 3J7AC 1FX0A 2PGOA 3KE8A 2PR7A 1CJUC 5I3ZA 5ERXA 4CLRB 1PWEA 5ALOA 1VFPA 3FTNA 1LCIA 3WHLA 3MWDA 3MMSA 1MT3A 3RBZA 4Q4JB 1RWWA 2WHXA 4N12A 4S0XA 1EIWA 2ZIVB 3LWNA 1YE3A 4OI2A 1ML3A 4MRNA 1MJHA 2HHCA 4TZKA 5J5VA 3IEMA 2Z6QA 4ZCPA 1U5BB 3ZDXB 3UWOA 3ZDZB 2QP3A 2QVBA 3CWQA 3E5NA 4Q03A 4RHUA 2GDJA 3K2BA 5ERGB 1G4UR 1SFRA 2VSQA 4D4KA 2QM8A 1PNRA 1QE5A 2X40A 2OM2A 4OM8A 1VLMA 4K9KA 3K8QA 2YR0A 3T7AA 1HYBA 1OTYA 2VPIA 3RU9A 3ETJA 3G13A 4HN4B 5I9SA 3TSOA 5DBFA 1WBJB 2X5OA 5ALJA 4B76A 4BWGA 3ZIAA 3PDJA 3WYDA 5KWJA 4QQKA 3TI7A 2M6SA 1NUAA 2CMGA 4C03A 4OEHA 4AS2A 1T5HX 3JQFA 2YX1A 1NMXA 1MA3A 2ZRHA 3PHGA 4LWOA 5FTNA 2HPVA 1VLQA 2JA1A 2QT0A 3MT8A 4GS5A 1V48A 4DC0A 2Z58A 4M89A 4DFDA 2B36A 4JX8A 1KQPA 1YRWA 1DFGA 1YDWA 4LMRA 3RPEA 4CEHB 1TM2A 2QD1A 3GLSA 5HGJA 4EMBA 5H82A 1RKVA 4P5DA 4P5EA 1KDOA 2A0KA 5ALSA 1T4DA 3UGTA 4UTXA 1SVOA 4LVNA 3U1VA 3V6LA 1EG2A 2IT1A 4IJWA 3NEAA 5CVVA 3TUIC 4Q4HA 4WAUA 3D4PA 4PSDA 1AT1A 4QUKA 3G82C 3I1FA 3I04A 5ALQA 3QKUA 4BO0A 2F48A 4MLPA 4MARA 1MIOA 1X9GA 1BOFA 5E7JA 4ZCLA 5DB4A 1NMZA 1QHHA 4OLBA 4EUEA 2YW2A 5BUZA 2CL7X 1Z83A 1PEYA 3OEEA 4IILA 4JYCA 2WAYA 4KC0A 4LDPA 3VNBA 5LVAA 1WUHS 1G2OA 3LXRA 4DV0B 4FZVA 4JUFA 3WZ2A 5DT2A 1MUUA 4BY9E 2YXPX 3VFDA 2B4QA 5BT9A 4HB3A 4G1VA 1TTTA 2JIPA 5IW8A 3DD1A 5CJPA 3WKDA 4DL9A 3RYCA 3TXYA 2OA0A 2R8ZA 2NU8A 4DSTA 1U2SA 2BMAA 2M6RA 1RHMA 3JVUA 3DFKA 1G6HA 3C5HA 1GNTA 3N8GA 5BN4A 2X9GA 4CF7A 5L45A 1P81A 2WYWA 3WA7A 1ZK1A 4EY8A 1WOMA 3DPIA 4RZUA 4QRIA 2R86A 3M34A 4QM6A 2PWAA 2EEPA 1LDNA 3PVSA 1HE8B 1N3BA 3ROGA 1F5NA 3H1GA 1DIBA 2HA3A 4OQYA 5DGDA 3H8WA 4QX6A 3EVEA 4Z4FA 4XRGA 2E5WA 2GJ8A 4DR4B 5E0KB 3IDZA 3N2LA 3OX2A 4YUXA 4N5NA 3A0UA 5E1MA 3UK7A 2O2IA 5B58T 3K0EA 1KDYA 1A7JA 3SDBA 3A36A 3WNCA 1CQPA 3TW8B 2BGWA 3TAHA 1HE3A 5DGXA 3U56A 1XNGA 4ZHQA 2CLFB 3DXFA 4LJYA 2XRZA 1P4AA 1RYFA 2DAPA 3FG9A 3C6ZA 1C8BA 1W0JD 1QYXA 1EWRA 4CT4B 1X7YA 2RMKA 3O3MB 2ECQA 1DC6A 4DN6A 3LRPA 2DX7A 2AS0A 1FDSA 1QG0A 4N39A 3VTFA 5KWVA 4O8ZA 2RAPA 5JS2A 4JUAA 3DB1A 1JZQA 2ATCA 3QLUA 4P58A 1RXEA 2JB9A 4QPPA 5L95A 2FFAA 1AS2A 4S12A 5JRJA 4GP7A 4KO4S 2RCNA 1VBKA 1NT2A 5KYKA 2Z8YA 1A5AB 2WPNA 4WDQA 2WW8A 1KVRA 3K0FA 3KYCB 4AUNA 3I2YX 5G41A 3A7DA 4P53A 3WGMA 1OXBB 2W2MA 3O4GA 5KKAA 5J63A 4HWOA 3CSDA 3U7EB 1G3UA 4JXKA 4BP1A 3ESQA 3FF4A 2FQYA 2WIJA 4JVSB 3LC2O 1Z36A 4HNGA 3JYPA