4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
5M7EA 5LYJA 4XCQA 5CA1A 4FFBB 5IYZB 5MN4A 1W5FA 5C8YA 4O4LA 1W581 4X20A 3RYFB 5IJ0A 5J2TA 3RYIA 4IHJA 1TVKA 5GONA 4DRXB 3WGKA 3ZIDA 3HKDB 4ZI7A 5EIBC 5CB4A 3HKEB 5MN6A 3WGNA 5CA1B 4IIJA 5LYJB 5JQGB 4YJ2A 4YJ2B 1FFXA 2BTQB 2VAWA 3JASB 5ITZA 4F6RA 4IIJB 5CB4B 4ZHQA 1FFXB 4M8IA 2BTOA 4HNAB 5KMGB 2VAMA 3HKBA 4LNUB 2RHOA 3RYFA 3E22A 4ZI7B 5LOVB 4I4TB 5LOVA 4E6EA 5IJ9A 3WGJA 1SA0A 2VXYA 5JCOC 4IHJB 4TV8B 5LP6B 5KX5A 4O4LB 4ZHQB 2GVIA 4O2BA 5LXTA 3RYCA 1W5BA 3RYHB 1RLUA 3JAWA 5JVDA 4B46A 4DXDA 4TUYA 4X1IA 4O2AA 1JFFB 5JQGA 4O4IA 4WBNA 1W59A 5IJ9B 3C8LA 4O4JB 1W5AA 4X1YB 4I4TA 1RQ2A 5JH7A 2XKAA 3HKDA 2RHLA 2RHJA 1TUBA 3JATB 4U3JA 3HKBB 5FNVA 3RB8A 4TV9B 1JFFA 5JCOA 3VOAA 1RQ7A 3M89A 4I50A 5BMVB 3RYHA 3N2GA 5LA6B 4O4IB 2XKBA 3JARB 5KX5B 4TUYB 4I50B 2RHHA 2Q1YA 3JAWB 5JVDB 3WGLA 4I55A 4EI7A 4ZOLA 1TUBB 4O2BB 4O4HB 5LP6C 3RYCB 5MN5A 3HKCA 3JALA 5EZYB 3N2KA 4KWEA 4X1YA 3JATA 4O4JA 4U3JB 4O4HA 5FNVB 5EYPA 5J2UB 3CB2A 5EYPB 5J2UA 3R4VA 2Q1XA 5EIBD 5JH7B 4X20B 3VOBA 3N2KB 3M8KA 4X1KA 4FFBA 5IYZA 3JARA 4LNUA 3UT5A 4EB6B 4YJ3A 4I55B 2BTQA 5LXTB 4EI9A 5CA0A 5CA0B 1OFUA 4EI8A 3V3TA 1FSZA 2VAPA 4EB6A 4F6RB 3VO9A 1SA0B 3JASA 3N2GB 5LA6A 5BMVA 4X1KB 1Z5WA 5LP6A 4B45A 1W5EA 4TV9A 3RYIB 3VPAA 3HKEA 4WBNB 3ZBPA 3E22B 4O2AB 4X1IB 4U39A 5EZYA 3HKCB 3JALB 4DRXA 2R751 3WGMA 1TVKB 5GONB 2R6R1 3ZBQA 4ZOLB 5IJ0B 5J2TB 3VO8A 5ITZB 4HNAA 5KMGA 3JAKA 3JAKB 5C8YB 4TV8A 4YJ3B 1Z5VA 3UT5B
chains in the Genus database with same CATH superfamily
2G9IA 5EAZA 1WJZA 1I10A 2AN5A 4HDKB 3TEFA 3C3DA 3SY8A 1ADJA 3HS3A 3AF4A 2PGGA 1IUKA 5DOZA 5EUQB 5HDQA 3UYKA 4DXAA 1VF5B 5KUMA 5BSTA 3LSUA 3WFVA 1D9XA 5I45A 1V5EA 4M7PA 4PTYA 4QU0A 2Q5LA 4RY0A 3UXYA 1SM4A 2BEJA 4EF6A 1UBTS 1UJBA 1YRWA 2PUDA 5IVIA 3NHAA 3A37A 3DTNA 4YPFA 3ZWOA 4CF7A 3TOSA 5COBA 1GUAA 3D64A 2B35A 4YRGA 4DYHA 1DDOA 5IT4A 2XE8A 2ZDHA 4OU5A 1UK9A 5FAXA 3ZWQA 4LYAA 4P7BA 2Q2NA 4PC2A 2IU6A 4JI3O 3GFPA 3AFMA 1FQOA 4QX6A 3DWFA 4RZXA 1T5BA 2J0EA 4XM2A 3RRMA 1T2DA 3VGJA 3I2FA 2CDRA 2IXTA 5ERXA 3CCVV 1GEGA 2YC2C 2FPGA 4YMWA 3SC4A 1JB9A 1HL3A 3V2GA 5I4KA 2HIGA 3VIUA 4MVJM 1MO5A 4ZCRA 1PKXA 1K7FB 1I32A 1NFQA 4MVJF 4S0ZA 2VPYA 1T2AA 2F1JA 3H8VA 1L7BA 4Q16A 1DUVG 1MX9A 4QPPA 4BBAA 3HADA 3VV3A 2PH7A 4K88A 3ZJ4A 3HI4A 5I8ZA 1BDIA 3NLLA 3QX3A 2AG1A 1EWVA 3WNCA 3SZLA 1GNSA 2FXIA 4MUKA 2JFBA 4RMHA 5L3SA 2QENA 4DLRA 5H8WA 3O5AA 1Y4UA 4JELA 4M0MA 1X3SA 4UVIA 3LNMB 2NN4A 2G09A 4MTCA 1TTPB 2ECQA 2F1HA 3O31A 5T3YA 2OA0A 1P4AA 5A7GA 3COVA 5AO9A 3CYQA 2CHVA 4BFVA 1BS3A 4H7HA 1OLSB 2OCCB 1J90A 1PNVA 2GLZA 2AHOA 3U4QA 3HKDA 3H18A 1VECA 4MRMA 5GGYA 5K3EA 3U1BA 1I94B 1CQJA 1OFGA 4TV9B 5SZJA 5JCOA 4NDZA 4DCVA 4GKBA 3F67A 2ILMA 1A9SA 3IX7A 1LI7A 5E9QA 3DPIA 3SQNA 1RWKA 1P3DA 2G88A 2GYUA 4YA6A 4EITA 5KTYA 3ER9A 1U97A 5IAEA 4DJDC 5FL7A 3IIMA 2JHGA 3NTXA 2YVQA 4QXRA 3DJFA 3OOJA 1PJBA 3GLHB 4R8CA 2P5YA 3A4LA 3IOMA 4E6PA 4ZVLA 5BOSA 5C5DA 2AHYA 4QBIA 1G17A 2ODTX 3KKMA 2ODNA 4X7RA 4XR4A 5A03A 2V6MA 5C35A 3GLGE 4WJZA 1AKEA 2X8JB 1ES9A 1C2TA 2UYYA 1JWBB 1L3BA 4RHEA 3UJ3X 4H0LB 3L7MA 3TJMA 5I01A 4IINA 4D3SA 5H5JA 4DWJA 1MOZA 1RHRA 5L3DA 1XELA 1YIJV 2CYCA 2QV0A 1GPYA 4G9BA 4ODIA 1SU7A 2QX7A 4LXYA 4NH0A 2AXPA 4TS9A 5ILQA 2OPHA 5LJIA 4YCDA 1UFKA 1N32B 1EUCB 1E60A 5L4NA 4IVPA 3U44A 1TUEA 3KD3A 1BOOA 1YIOA 1E99A 2AKAB 1D8TA 3ZRVA 3TLEA 4D6YA 3U7HB 1G2QA 2QZJA 1Y4SA 2QN7A 2P62A 1JJAA 2EIJB 3CZ5A 3OR6C 4FIZA 2H1CA 4EI2A 1X77A 3DDNA 4Q9AA 3NANA 2DY1A 1XXLA 3M1AA 4M9SA 2B99A 2EYQA 1NBMD 3G1WA 1OFUX 3QJYA 4B2YA 3PL1A 3ZWAA 3H7IA 3JRNA 3QFHA 4GM4A 3ZDFA 4JU9A 5SICE 5KAIZ 1R0YA 2AR7A 3FFQA 1A8HA 4NFHA 2IM9A 1NFRA 1WN7A 1AHHA 2I4MA 1OC2A 2IZ5A 1JLLB 3E9DA 4KDFA 3KXPA 5HTKA 4B08A 4WK0B 2X0JA 4IDBA 5MF6A 1NVAA 4Q3OA 4KQGA 1V9PA 1J2RA 1ESZA 4R3UC 1W5FA 3UC5A 1JHQA 4D8WA 5JRDS 1PS9A 3K8QA 5L3VA 1GRQA 4DBLC 1BCSB 1YDFA 2VTDA 4DDUA 1G5PA 1NU6A 2WOOA 3ZU5A 5LVAA 3WY9A 4DY6A 2OCXA 1S0VA 3UN1A 2YJ4A 3PNSA 3RHFA 1RWOA 5DK4A 1JQDA 5A9GA 2IHJA 3RC7A 4EAQA 2QI2A 2YXBA 1FU7A 5JRJA 3HCDA 2YXZA 3OMNB 1O94C 5F2OA 5EKXA 2VUSA 4DQDA 4X64O 1SB9A 3JASB 2EZOA 1RMTA 4C8EA 3LVFO 4MR7B 4MVRA 2DGDA 2QR2A 3X3HA 5KNCH 3TIGA 1NTRA 2H00A 1DAGA 1EI9A 4UCOA 1YQEA 2VSYA 1VPEA 5AVUA 5LL6Y 1YHQV 1PT9A 5ECYA 5EJ6A 1SEPA 1U8FO 3KZ1E 4IVRA 3IHKA 2CW5A 5JWRA 3LS2A 1AGXA 1MJ5A 4LSWA 5UKDA 1R9MA 1H6CA 1EIWA 1PJQA 1K3EA 3LP6A 5TEVA 3T95A 4L2IB 4FINA 5AKIA 1VP7A 3WGJA 4YUYA 1P81A 5JJEB 4TLAA 5BSHA 4IJUA 4OHMA 3PDIB 4FYKA 5IF9A 2XXBA 1QH8B 1MGPA 3M82A 3MWDA 2GVIA 1O03A 3HUDA 4LWZA 1QVFF 1LEHA 1RSOB 3AR7A 1GGJA 2JB9A 1I0HA 1PEKE 4H7FA 3CPQA 2PRSA 2IYLD 4XCXA 2HNAA 3LWNA 5DXJA 2QMOA 2RI6A 4QOFA 2XNJA 3A36A 3SX0A 4BYMA 2H3OA 4WBNA 1IJBA 2X42A 5FR2A 4CCWA 4WL0A 2FEPA 1LDBA 5JY6A 3IUQA 3N6XA 4LSZA 5D84A 5DM6V 1U2RA 3Q11A 3R7BA 3U0VA 3WJ1A 2R4UA 3LDAA 1Y0BA 3T41A 3HP1A 4CW7A 1V95A 2CJWA 5SV2A 3HO1A 2GK4A 5EGNA 4K8RB 1CQZA 4CF3A 2PGLA 4X44A 1XUQA 3A4YA 2BDUA 5DISB 5C93A 1IBMO 4Q1EA 2WSIA 4BVAA 4EY6A 3ZPXA 3ZRSA 2OGZA 3PSAA 2YWDA 4KTVE 2JCVA 3PC4A 3QEBZ 4REQB 1E1QA 4N39A 4XX1A 3TW4A 4AT1A 3A70A 4HR7A 5KHLB 2E4ZA 1ULTA 4P8RA 3ZEDA 1HG0A 1S0UA 2KJQA 5EKDA 1CXZB 4ERNA 4N5IX 1FS6A 2L2QA 2XODA 5F5XA 4LQLA 3FCAA 1OIWA 4B6JA 1NULA 1UT8A 4C0SA 3L7LA 3AF5A 1N92A 5I7SA 4CFZA 3CE9A 4RV9A 3JARA 2Y77A 1ARZA 4NKRA 3W2TA 3N8NA 4H60A 3IR9A 1QANA 1SD1A 2UU9B 1WCWA 2O3QA 2O3UA 2O19A 2PJZA 4MMXB 4NR0A 2J6CA 3RH0A 3OZBA 4NCJA 3W5SA 4V1CA 1H2MA 1PL8A 4GOKA 4J90A 1JDBC 1E0SA 3KYCB 1RHMA 2HWKA 1CLUA 3H2ZA 2AW9A 3TSZA 3CU5A 3S40A 1DBQA 1NPDA 3BRCA 3CCBA 4RGQA 5CFPA 3C97A 5KNDD 3V8QA 2KMLA 4US0R 3W5BA 1P4RA 4QLAA 1A95A 4KO8A 1MB2A 5ALRA 4CHTA 2XCSB 3HKCB 1X7HA 5ECDA 3PEYA 5HY2A 5A71A 1PI3A 1TTQB 2EZ4A 3FPKA 4QWWA 5J5CA 4Q20A 4QGPA 2CZGA 4UCTA 1QVFU 1CUSA 2DPXA 5AW9A 4DEVA 3KEQA 4J0JA 1K4YA 4C07A 2BM8A 4UHKA 5JO9A 1SXJD 4GT1A 2P8SA 1R9NA 1NLFA 4DA0A 1E8NA 2V97A 1W9HA 2HDNB 4NCXA 4QDOA 2GX6A 4Y2HA 3UW1A 4NQZA 2BEWA 3M6XA 3DZ8A 1XNQO 3HWUA 5A7HA 3CCVF 2BD0A 2WMYA 5EJAA 3ZK8A 1EWQA 1NKDA 2A5GA 1PK8A 2OFOA 2BJVA 3PX2A 4Y9DA 4AMGA 3TZEA 2IZ1A 2D74A 2WQZA 1Y1TA 4OB6A 4PINA 1DAOA 4YRBA 2BHNA 4DN6A 3IFSA 3TL6A 2A7QA 3W5HA 4PDLA 3N0VA 2X4DA 4KRXA 4NVRA 3WYBA 2GHRA 4C4OA 1TYDE 2EQAA 5K5EA 2PD3A 1J6UA 4YXWA 4L4YA 2FSFA 3O1IC 1MQSA 5IHPA 4RA9B 1CSEE 3W2IA 3CVUA 5DGDA 5C32A 1Q6HA 3GEHA 2WPDG 2G5CA 1PV4A 3HBFA 1PVOA 2Q4OA 2Q8QA 4W5WA 3DBLB 5GANK 4AZSA 4U7WA 2I4TA 3DWGA 3QPAA 4CHGA 2B9VA 4P54A 4F2GA 3MBIA 1CUGA 1NL3A 1SG6A 3HLYA 6NULA 2BMDA 3NTOA 4JQOA 2VL7A 4MX8A 4C43A 2OXTA 2I4NA 3AL0C 1L5OA 1OROA 2CUZA 2EG9A 2UV8A 4J42A 5DCYA 2QTNA 5CT9A 5GPBA 1F5SA 4G28B 2X77A 1PR4A 2BMWA 1GLGA 3DZBA 3IQZA 4JXJA 3OKFA 1SIUA 4AF6A 2ZWIA 2Z43A 1WHTB 2Q7XA 3J81N 4FM1A 4EX6A 3PITA 3ICXA 4DV5O 2DQZA 1UBHS 2ZSJA 4KN5A 3CMEF 1JPVA 2WJJA 3L0DA 3ZNQA 3ABTA 2XUJA 3LQQA 4FC7A 1V2HE 2J5RA 5GZ3A 1WUYA 1X7YA 4B46A 3CLTD 3T61A 1F9EA 4P86A 1G1AA 1ZL8B 2HZ7A 4HRAA 2OG1A 3BF8A 3QUBA 1G4HA 4WNCA 3IYLW 3VHLB 1I3NA 2XNDD 2FXVA 2OUIA 4CKBA 2G8LA 3EEIA 4WUTA 3NOOA 5E0KB 3UT0A 2OPBA 4Z9AA 3BGOS 1YONA 1DARA 2GHTA 1Z0DA 4FZ3A 4B7ZA 1GT6A 4Q9KA 2JH3A 3FWYA 4Q3EA 4BQEA 3LC0A 1Q91A 1ND5A 1UOPA 3AEQA 3QVNA 3GAAA 2PV7A 3BFPA 3HEBA 3N2GA 1FC0A 5G53C 4E21A 4QPZA 4HAUA 4YRMA 1E5VA 1BE3H 3KDSE 1JVMA 1V9SA 1VKZA 1VDMA 5A3JA 2HR1A 3IEMA 4AI6A 4L4UA 4GECA 2GZDA 2QLNA 3NC1C 1CKEA 4ITUA 4G5QA 2ACEA 4E2YA 2BEKA 2AI2A 1HORA 4PONA 5DI3A 4DR1B 3CKKA 3DAHA 1ZIXA 1NV8A 4KDEA 1F4LA 3BMOA 2Z0AA 4P98A 2DOKA 2W90A 3GG2A 3V8BA 4RH3A 2FHSA 1ZGHA 3MT8A 3W3AA 4M8KA 4XYLA 3K6RA 1YTFB 3D1LA 4K46A 1XHZA 4DLUA 5BQFA 1T35A 3IL2A 4WLUA 3AIMA 1YFKA 2E4UA 3SBXA 4EF4A 5BW8A 3L7IA 5F7ZA 3B1ZA 5IMBA 2W71A 3D7NA 1NVVR 2GILA 5EKSA 1QOZA 3SS8A 1Q2UA 2BGMA 1GQ2A 3FUCA 3A31A 4CCYB 4JXZA 1R6KA 3CONA 3AEYA 4Q4DA 1RAAA 3CXCF 1GLNA 2C9ZA 4GS5A 1IXKA 5GP1A 1NBMA 4BUZA 2R8XA 2A0UA 3I1FA 8ABPA 1B73A 1ZGAA 3K2XA 2GRUA 3I09A 1XCOA 2VQFB 2A9RA 2I1VB 1NXTA 4JUBA 4NLLA 3SEQA 2R8EA 5ADHA 3ADCA 1L0NH 3NETA 1SXJB 3ER6A 3FVVA 3MBOA 1RCUA 3OEHA 4DANA 2QT0A 2OCLA 4DUYB 2BM0A 3CEPB 3IJRA 4KQKA 4REOA 3ADKA 2PRZA 3HTXA 2BEVB 3CN9A 1ZCJA 4QPJA 2ICAA 4I1PA 3E2EA 1K3TA 1YHNA 2MW2B 3JAKB 1ZONA 2NNUA 4HAOA 2GJ4A 3VI3B 1KVTA 3UAVA 1TM1E 3OCVA 4I6EA 1YK1A 2B4KA 5FDFA 2W6IG 3TLAA 4EG5A 1G291 1O9HA 3QG1A 4TKUA 3KQTA 1CY8A 4W8OA 4OI1A 4JOSA 3RG8A 4BLTA 5AWFC 4X9QA 1HDOA 2X8JA 3AK4A 3LXRA 4BAUA 1B6QA 2GCPA 1FU4A 2ZS8A 2X9NA 4WZAB 4QM7A 3SS9X 3BJIC 5EIBC 4BB6A 5JWPA 2B4AA 1A9ZA 4ZVVA 5CA1B 1W30A 2J5BA 2P65A 1F12A 3K20A 2BSXA 2ONYA 3WL5A 1W4AA 3KLBA 4G0NA 1FTWA 2VDKB 2YWEA 1LSSA 2PZGA 1RLOA 5CGZA 4FOPA 4KMRA 2HUPA 1QGDA 4JI5B 1EFRD 1U1EA 5JAIA 4BNUA 5DYTA 1FTSA 1G5HA 5BNTA 4ZO4A 5T4EA 2Q0QA 1XPJA 4N5LA 2ZTUA 5DYYA 4Y0NA 1B8UA 4J10A 3EUEA 4UB6Z 2FB5A 1GKLA 1X1SA 3NTQA 3E7WA 3ZXIA 1HI9A 3MRXA 1UKYA 1WOMA 4GSYA 4YDQA 3VXKA 2Y0PA 2R5FA 3AG4B 3ANNA 3DMYA 5AJTA 4LFCO 4CM7A 1EUQA 4ZYWA 4N8DA 1UPAA 4HN9A 4U02A 3GUUA 4Q66C 3M7MX 4R50A 1O94D 1QX3A 1DFHA 4LYDA 2C5LA 1HNWO 4MUBA 1FYVA 4BHTA 4BE4A 1E1CB 4FHZA 2GYYA 4EUSA 3G6EF 4MTGA 1Z5UA 1NQ5A 1BVRA 2EGUA 3ND6A 2UUBB 4S0XA 2CB0A 3QEMA 4KN8A 1HMPA 4ND8B 5KA5A 1WNSA 4FPPA 2BGTA 2NPIA 2V4DA 1S01A 3II6X 3LLUA 3SNKA 4E2FA 2A8YA 4E2ZA 1EQUA 4TTQA 4UKDA 4FCWA 2UXBB 1UMDB 2QRUA 2PFGA 4X8MA 4CLDA 1T4DA 3ANYB 3D4IA 4FYPA 5DYIA 4KR2A 4K9LA 2M2IA 4WV3A 1SUSA 2POQX 2ZB2A 2RARA 1U6JA 1U6KA 3JQAD 5GZ1A 3OBWA 3BA6A 1O89A 1CUIA 3CNBA 1AQNA 3AR3A 5BV0A 5HWSA 3AKYA 2BM9A 2IYFA 5FUWA 1NQUA 2HFJA 3NALA 5CEEA 2O3TA 2B8EA 2PRIA 1B0PA 1WM1A 3LBHA 2QSUA 2V7EA 1KY2A 4Q0MA 2WA4A 4UW9A 1ZOPA 4EELA 1B04A 1GU0A 1MO4A 1PUIA 1ZDMA 2X0RA 2BWJA 2APJA 5DM60 1QHIA 5FPPA 2X5JO 1XMXA 3ADOA 1VJ5A 4YJ2F 2JGMA 1NYQA 3DFFA 4H0NA 2A4MA 4OOEA 3OZ7A 2B3TA 4TT8A 2Q27A 4MVQA 2HS4A 5AJUA 5AYVA 4MMZB 2LW1A 4U7TB 4JS0A 3URKA 4C08A 1X4TA 2K9PA 4RCYA 1UOQA 3DDOA 1YC5A 1UKZA 1ZSVA 1ZW1A 5IC5A 3RODA 4PS0A 4CNBA 4DCCA 3RC8A 2GN6A 3JQ9A 5CD1A 1R3DA 1TJ5A 2G06A 4MR8A 3VYSC 1H3FA 3OJXA 1M1KH 4MPJA 1CS0B 3WNVA 2JIZA 4TN5A 5A6SB 1PSDA 3M70A 4U6QA 1ZICA 3EZGA 3MCZA 5EA2A 5ALVA 4RA6B 2IYZA 1TJ3A 3ABKB 1EP3B 4FBMA 1ECLA 1RM4A 4XGNA 3V1NA 3DV9A 2WIKA 1U3TA 4ZPJA 5FUVA 2NO1A 1M10A 2Z9DA 2Q5QA 4HWSA 4KIGA 2GPNA 3U0ZA 1CE8B 1M8GA 3FYTA 4H9GA 4P53A 2AJ8A 2JEXA 1Z13A 2I4RA 1NXWA 3OP1A 3I9LA 2ZULA 3AUFA 3FCYA 4EHLA 2QTTA 2OSVA 3P9ZA 3UEOA 3WRWA 1QF6A 2B4QA 1LVHA 4GPTA 1YHYA 5GIOE 3MMSA 2XAFA 1K2VN 1HT0A 2MYPA 2KW5A 2PSSA 1U9YA 4YROA 3TVYA 2DJ5A 2CCKA 2A35A 3KTDA 1VSQA 2DQSA 4L4RA 1WF3A 5K8TA 1VQ6F 1U3UA 1ZP6A 4LYFA 5L3RA 4YXWD 3G85A 2IWHA 3PD7A 4MSUA 1W1WA 2GTSA 3QFCA 1DFGA 2IH1C 3VU9B 4K0KO 1I94O 4JR2A 2IGTA 1HYHA 1ZK4A 2AUNA 5CLHA 4XIIA 1E2PA 3MA0A 2WLLA 3W6NA 1P0CA 2ILVA 4BIZA 1M1KW 3SQOA 2BR4A 5AM0A 1QGUA 3NVKE 2YFKA 5A6VA 3H9EO 2EULA 1NYRA 4NULA 2B5OA 4GPD1 4PM4A 2ZB7A 2CXSA 4B83A 3KALA 4IOMA 2WM2A 4DLLA 1QQAA 4D57A 4WZAA 2A9PA 4Z3OA 1ZRMA 5SZKB 1X7GA 2ON6A 1K66A 4LR3A 1OW3B 4LOLA 5IWCA 3DDSA 3FYHA 1TD1A 1WV0A 4ZALA 2OBXA 4FUQA 3HU3A 5EOVA 3RK0A 3DBVO 4JX9A 1KFEB 2PCJA 1AH2A 1EFVA 1UUFA 3QKRA 1NR1A 2A0LA 2ZJ0A 3L93A 3ZX5A 4A92A 4AU1A 1RQGA 2WR8A 3U31A 1TFRA 1TF2A 1P2BA 1XL0A 1GPJA 5A3RA 1FLAA 5DE3A 4FHGA 3UKOA 5AK0A 3RS7A 1KC8W 2W2NA 3VPCA 5DLDA 4TTAA 4R7CA 1COMA 2ZIVB 2EZ9A 3LP5A 2CLSA 4BQRA 2H11A 1FMTA 1QP8A 4K9QA 1MX3A 3JQ9C 4Q1BA 1YBVA 3CW2A 3X1WA 2F48A 3WV5A 2HADA 3RB8A 2D0IA 1U96A 5LBUA 1M56C 4WK4B 2I80A 4ARSA 3ZVNA 5DW3A 1GL7A 3GT3A 2GXQA 4WXRA 3MPOA 3VDXA 3QEOA 1XBIA 3AETB 3PKZA 2I3AA 4AP6A 3QO8A 2H8PC 5JV5A 1EBFA 4TMVA 3HY6A 2BFCA 4YB8A 2O2XA 1S6YA 1S8AA 2Q1SA 2VJDA 1ZIOA 4AJ9A 2ADQB 4JX8A 1RJFA 1ORHA 2WSMA 2FHPA 3JVVA 2MHCA 1B6GA 2PWBA 4C88A 2ATKC 1W2WB 2XZDA 2NLJC 4A7PA 4W5RA 3A9TA 3PC2A 2O23A 3PCXA 3B9QA 1BNCA 4MKRA 5T4BA 1K9MH 5JMOA 1YTUA 5LQNA 4PWZA 1ZGGA 3MHHC 2V59A 3BFVA 4J07A 4R8RA 3IP7A 2PAFA 2C2AA 4GMGA 2R96A 5DP1A 2DW4A 1J8DA 3MTQA 2WYOA 3OMWA 4MVYA 2R79A 4X41A 3NGLA 4B4WA 2X15A 1W85A 5TY0A 3L02A 1Q95A 3JQAA 1FLVA 4GX5A 3C7DB 3NHPA 3PV0A 2IHVA 5JYCA 3VQVA 1E4EB 1QIMA 1T10A 1T36A 1ZNXA 2G4CA 2W2TA 4HSGA 4E12A 2J3HA 4YC7A 5FPHA 5E1OA 3FTFA 1PEDA 4BASA 2H5IA 2I9PA 4CL0A 5GV7A 1P0MA 1UXIA 2V7VA 5DLYA 1QWOA 3AINA 3DKVA 4RK1A 3TINA 3L04A 3MOIA 4RMIA 5M3BA 2I5PO 1A9XB 2QY9A 3LA8A 1K6MA 2ERCA 3HXKA 4DQVA 2YMPA 3G2LA 3K09C 2HRZA 3FYIB 4I4IA 2O48X 4YUXA 1E7WA 2HDHA 2D3WA 3GMTA 3P32A 3T5CA 2QRQA 5LGTA 2Q3MA 4WFBV 2VP9A 3CMCO 4ZC1A 3EQ9A 3LIIA 4MCIA 1YE8A 1OXKB 1H2AS 3MGGA 2UZHA 2XNDG 2CCJA 1XVLA 2YDEA 2JAQA 3EAGA 4MV7A 3AG6A 4LSGA 1TM7E 3SS7X 1MPXA 4AJEA 1UJ5A 4BGVA 3MT0A 1VJ0A 5BUSA 3F3SA 1N9ZA 1FSPA 1VXOA 1U28A 3IEIA 1U1DA 5FX2A 1S2NA 3SGLA 2BGRA 2R8PA 3PC8C 3GLFE 4P30A 2NO7A 1MENA 4LXGA 4PSUA 3VYVA 1JLRA 2WFZA 4ZOEA 4HGOA 4AAYA 4ZEVA 2V98A 1UKCA 2I22A 3TL3A 2WJ4A 4G1FA 2GEFA 1A4UA 4MP8A 3MYYA 4TYMA 1F0YA 5ALJA 3LX4A 2RGWA 1NWCA 3ZHXA 3M1LA 4CUKA 3JZMA 1X19A 4BNIA 3UGJA 3GRRA 5AP9A 5T7BA 1MJGM 3IP8A 3SYNA 2JIRA 2LO1A 4MEJA 8LDHA 3U4QB 1YDHA 1JR3E 1XYYA 2ZODA 2EJRA 4TSFA 3K0GA 5E6RB 2PS0A 3VR4A 5DHTA 3SGIA 1N34B 3TRJA 4GQBA 3BA8A 5ELXA 2GLTA 1EIZA 3HSYA 4DEXA 1L5HB 4DNOA 4Z4EA 1L7RA 3FWHA 3G0IA 3JCZA 3LLVA 2IBSA 1JU4A 4W1SA 4DC9A 1GCUA 3C8LA 2WIGA 4X1YB 2MR5A 4MVSA 2P41A 2FPIA 4JC4A 5CT5A 4HXEB 3L7QA 1C9DB 1QHSA 2FEXA 2PEYA 4HC4A 3IBCA 4UXNA 3OQ6A 2F9MA 3ANMA 3E9NA 1WEHA 2I6TA 1VQPF 3LC7O 3N3AC 2DM6A 5JPDA 2B8NA 1HOTA 1UMBB 4Q03A 5AJZA 2FC3A 1U9ZA 3S2EA 2GHQA 4DJ5X 3T0IA 4KIJA 2EBUA 4I50B 2Z1UA 1WP8A 5JEEA 1ZHFA 1VBFA 5JW6A 3E53A 4AJ4A 3K9GA 3PGMA 4MS1B 1MIOA 3HU1A 2AFVA 1A4IA 2FP4A 4BIOA 1TLLA 4Z9BA 4TXHA 1SVWA 2RGCA 4LQCA 3FYDA 2BP7A 3BWYA 2P6YA 3FNHA 3N07A 3IAEA 2TS1A 2GBLA 1T9ZA 1FXUA 3NIDB 3DEAA 4M9CA 4XFKA 4BUCA 1GKUB 5AJVB 3WYAA 4MVUA 1XILA 1R1MA 1JG6A 2OL4A 2VQ6A 4HN2A 4H33A 3CHYA 3QBTA 5CNIA 2ZJ4A 5ALGA 3VR0A 3VYWA 3OQNA 3E3OA 4RFSB 1C9YA 4KFTA 4ACBA 3DTTA 3THYB 1U2DA 3PGVA 4PA3A 1GP2A 4YCMA 4MQUA 5JZMA 1XTJA 2DHQA 3ZVMA 1SKQA 2WJGA 2XZPA 3RC9A 1YRLA 1M1YE 3DEJA 7ABPA 3LO8A 3UAOA 3QNWA 2Q7EA 3D3KA 1DLBA 1AUVA 1Y3BE 1B00A 3LWPC 2AVDA 3R7FA 2OO5A 4OLBA 1C1DB 1A2OA 4KGDA 1E1MA 4XM1A 4L3WA 3EAFA 1GUZA 1QK3A 2WP8J 3ZXXA 1ISFA 4KW7A 3SC3A 4GR4A 3CMEV 4ENTA 5KOIA 4C2TA 5FD8A 3OC6A 1MVNA 3EF3A 4I1UA 4OA8A 4B80A 4F2HA 4BWAA 1FYDA 1DEXA 1S4QA 4F9EA 4ZEWA 3RGBA 2P5OA 2Y4TA 4MR7A 4Y6PA 3KQLA 3KUXA 7MHTA 2F1KA 3E7PA 1CIPA 4CI0B 4PR0A 4Q15A 4B2LA 4CKWB 1D2MA 6CHYA 1C1XA 1J25A 1MH9A 1XP5A 4UAGA 3ADDA 1KARA 1PT7A 3B6KA 2A86A 1OAPA 4TT3G 2QGFA 1KU9A 3C9RA 1Q84A 5F78A 2KKWA 3P9NA 3D31A 4K1XA 4BYGA 5KLVH 1OJLA 2WB4A 3OZRA 1WUJS 2QYSA 3Q6MA 1YL7A 5LQSA 3CGWA 3CLUC 1ZINA 2FWJA 1XZDA 2DWPA 4P33A 3IULA 4E7PA 4IGKA 1L5FA 1CR0A 4G4IA 1CD5A 2II6A 3NNDA 3QFTA 3BMNA 4IF6A 3WLPA 3W79A 4BNFA 5LSAA 3VSDA 1LTKA 4PN7A 2DLNA 3DEIA 1RPOA 3K08A 2WTBA 4GUDA 4KE8A 5B6IA 5GINE 9LDTA 3V4DA 3OX2A 5B3AA 1Q15A 1Z22A 4AROA 2C95A 1E96A 1KYQA 1ITZA 1MLDA 2ZIWB 2FVXA 2CBZA 1SVKA 3DW1X 3K15A 4WY8A 3GFQA 3RSQA 5IXSA 1YHQF 4QSHA 4G09A 1EDBA 4BMCA 2K1EA 4O3MA 2QJWA 1MABA 1MAAA 2B8WA 2EWCA 2DPHA 2QUIA 1TXGA 3GGSA 3QEMB 4Q7KA 1IIBA 3EVKA 4GVXA 5KYWA 1W8IA 2WWTA 1D5NA 3GJ8A 3NYRA 3EBPA 3CVJA 3CW9A 5EO3A 1A96A 3NJ4A 3NTRA 3OFKA 3SSNA 3EQ6A 3WMRA 3RNLA 2QOEA 5CB8A 1VDZA 2ZI5A 1N0NA 4JWTA 5EPOA 4FSHA 4MAMA 2VP3A 2OT5A 1TIPA 2V6IA 3OZDA 1U0GA 1WUTA 4ZQEA 3TPFA 4QDXA 3GH1A 2B83A 2OCGA 1ZKDA 2CK3G 1S2DA 2PKQP 1YEWA 2DFTA 2PVPA 3P5BA 1OLOA 3R5JA 2AOUB 2CLLB 3PD0A 4FSXA 3SE7A 3MQWA 3T15A 5B12A 3UXEA 1PQWA 4MJLA 4QGSA 2XWPA 1RRKA 1CG6A 5I7VA 3I5AA 2ZBDA 3UMRA 1A2KC 5E2AA 3I9KA 5FUMA 1C3XA 1JEQA 1J20A 2HRBA 4QUKA 3TLBA 3I56V 2XDQB 3NQ41 5IKEA 4QO7A 4C9BA 4CDGA 2XUHA 1MQ8B 4O0MA 3JVHA 3E3NA 3NH9A 2IHYA 2DJIA 4BJ6A 3KEGA 5A5FA 1FA9A 1RQRA 4WKCA 1IWOA 4H3HB 3VNAA 4QRDA 3QG5A 3ND8A 3WGYA 4Q7MB 5ANRB 1N5LA 1ECGA 2JIQA 1HFJA 1PN3A 2JIZG 1W0JA 2Y69C 1Y8CA 4OFBA 2DFDA 1Y4MA 4BFXA 1EA5A 1TJNA 3WHKA 2GUZB 2BMVA 4C04A 2ZEJA 4C6RA 4F96A 2G80A 4MR9B 3PXDA 1V8PA 1MG1A 1ZLZA 4KACA 2HF7A 4I2VA 2GZHA 421PA 3QTBA 3R0QA 3AX6A 1I1NA 2M6SA 4HQLA 1ZO8A 2UXXA 1Z2GA 3EFHA 2ZSAA 3WTBA 1RS0A 3F6SA 5CK5A 1COWA 1AVTA 4EB3A 1B8VA 1ZJ4A 2I65A 2UUAB 2P4QA 1N57A 5KOHB 2EKBA 4QOEA 4B81A 3HTNA 1DXHA 4YAJA 5LQCA 3AVWA 1MJGA 5D2CA 2O0MA 5C0OE 1N5RA 3CBGA 3ZYZA 3LTNC 2ZZKA 4ZK7A 1WP9A 1HNZO 2C2BA 1P1JA 1Q8IA 2FQ1A 4JI4B 2JAUA 5DIZA 2OFFA 2R66A 2M6YA 1HMYA 2BFCB 1U11A 3SG0A 1HNNA 1YDEA 4RJLA 1P2GA 1R50A 2DPGA 4PSDA 3NDBB 1MX1A 2H16A 7MDHA 1FXKB 1MXFA 1KBHA 2DYRC 1GG8A 1K4DC 1E9DA 1PSZA 2GCNA 3ZMVA 2XE7A 3AY0A 4FK8A 3IEQA 4X20A 3I9FA 4MUGA 5IJZA 1Z6ZA 4JLBA 3L7JA 1XCBA 1BWPA 1Y7PA 2LUOA 4RKWA 2YJGA 5D5QA 1VF7A 5TS3A 2ZI7A 2GMWA 3FSRA 4EGCB 4P5DA 2GN4A 4XD7D 3QPBA 1O95D 3B7GA 2HGSA 4NEQA 3RF6A 2HLHA 2VTVA 4YN3A 4XWOA 2XZLA 1Y1LA 5G1PA 4M8NE 4YP5A 5LLDA 1BW9A 2F43A 2C7RA 3SYCA 1H05A 2YNMC 2FSHA 4RH1A 4BTVA 4DR5O 4N76A 4RNDB 4R8KA 3DLHA 3H9GA 4ZFNA 4F91B 1VL6A 1SVLA 4L7VA 4DMMA 5IVDA 1XZGA 1DHTA 3GLKA 2CLEB 3WGUA 2PLFA 2FMHA 3H1BA 3M9XA 4C6TB 3G5LA 4AG6A 1VPTA 3IKMB 5CH8A 3V32A 2QNRA 4B9AA 3ICCA 3TTTA 1K06A 4TMTA 4F46A 5KPDA 3S29A 1VH8A 3DSQA 3RRFA 1TGYA 1D5WA 4DV1O 2NSLA 2SNIE 1JR6A 5L4SA 2QTMA 1N7GA 3LPMA 3VDNB 5HQ3B 3I3FA 4EKYA 2KG4A 1JHXA 2P9BA 3I4FA 3PKIA 1JSXA 1BDJA 4RHYA 1E9SA 1AA9A 1BX0A 1KF0A 1PGPA 2HMSA 3PNBA 5ENDA 3RVOA 2LBPA 3ZGNA 1ECPA 5AVTA 1F4NA 1YQWA 2SBTA 3SIRA 3GNSA 2I99A 4N3NA 4PVDA 1X74A 2RSLA 4TRJA 16PKA 2EQBA 5JH7A 5E7IA 4C4WC 4GPEA 3LT5A 2IX3A 2BFNA 1GNLA 4KREA 2Z2XA 3GLHA 5DN9A 1NZDA 4F4FA 4FOTA 1MV5A 1RBMA 3R8FA 1Q0QA 1KY4A 5FPTA 3LWOC 2M6RA 2PAAA 2V8OA 5DM0A 1ZJ6A 1QYIA 4BX3A 5BVHA 1KYOF 2IRWA 1UC8A 3CKMA 1P45A 5J2TF 3QKIA 4IOKA 4LCJA 2EFYA 3RASA 2PMEA 2JJ2D 4D4MA 3KJHA 4MVXA 5ALOA 2N48A 2SCUB 3DR5A 2CXQA 2E82A 2XGGA 3ID6C 521PA 4PPQA 4LDQA 2L19A 2FRXA 3PNVA 5HMMA 1CW2B 2EBFX 1XQ1A 4C5BA 3MC1A 4LTMA 1OZHA 5AW7A 3HHEA 4RZUA 3OT1A 2YHIA 3EXAA 1ZQ9A 2PGNA 1ISGA 3DL4A 1CVLA 5GMOA 2O7QA 4U3JB 5AVZA 4PPFA 4XDZA 4LJRA 3P9XA 2ABWA 4EEQA 3RRXA 2F8TA 4QTZA 2AG0A 5EMMA 5KSOA 2ATVA 4UNPA 4ABMA 1EVKA 1SY7A 3GNQA 3BCHA 4NOKA 2NLOA 1EGHA 1UWLA 2HK8A 4OQXA 2NWQA 4U8HA 4ZU3A 2WJ6A 4IMJB 4WNYA 5TSDA 3ROXA 3TI7A 1Z63A 1LUVA 4YYZA 3UJCA 5CB6A 3RW0A 4CQNA 1FSZA 2V45A 3D0KA 3OBYA 3OIUA 5J47A 5CVDA 3K5MA 4JI6O 4P31A 1QV9A 2JLZA 3V1MA 2JLXA 3N27A 1X1RA 2BV3A 2HJGA 2Y68A 2PJDA 4XUEA 3PS9A 2X5OA 5ALXA 5IARA 2V7TA 3G82C 5L7TA 1VHWA 2VZ9A 4J9UE 4DW8A 4S3MA 4DR2B 3DLTA 3E9EA 1Z2OX 1YCFA 5KTNA 5FL7D 4BXOA 1CUDA 1G63A 3KAQA 1R6UA 5AI9A 3PHHA 3HJWC 1R3JC 1MPTA 2B36A 4FX2A 1WPRA 2C4UA 2NADA 3B9PA 3H9JA 3WWCA 4DY4A 1CRPA 4IH4A 1Y4DE 3LHSA 3W9UA 4D5EA 2Q07A 3L73H 3L8HA 5T4FA 3D1JA 4J91A 2FTKE 1N2ZA 1JSZA 3ONVA 3TAXA 1PK9A 1W0KD 3EWIA 3AIKA 4QREA 2W2LD 4HXGA 5AR1A 1UT5A 5MHTA 2EX0A 3S5UA 4WOPA 2GD6A 2ZKLA 5HQTA 3DZGA 1XTVA 4PIVA 1T9BA 5I8PA 2YZNA 5JRZA 2IYQA 3AK1A 4NZZA 2EEZA 3BJZA 3DCIA 4HB4A 2OVBA 3QFSA 3A1FA 1WEKA 4ND4A 1QIKA 2NSYA 3AI7A 5AICA 5TPWA 2WICA 5JJBA 1ZK2A 4MR8B 1H2YA 1K63A 2LDBA 2YJZA 3SJCA 2FN9A 2H57A 3WDKA 2BFEB 5BN4A 4EKIA 4IIXA 2EERA 1P2VA 4M8IA 1FX0A 1P7GA 2I6QA 2X13A 3LTEA 3NTUA 4FM2A 4R2WA 3V8EA 3VJKA 3WK6A 4B6QA 1M2GA 4BRZA 1QGZA 3HWWA 3Q98A 2ONKA 3FLAA 4BO3A 5LLTA 2P9CA 3PR3A 4M0CA 4RKFA 3TXYA 3TVTA 4BZPA 1LPMA 1KO1A 4AO8A 3ZZ1A 3NDIA 5AOCA 2GTHA 5BN5A 4TYWA 2NZXA 1PZNA 4WEQA 3CXRA 4KUHA 4ZCLA 1ZD8A 2K5UA 2RC5A 4OPMA 4RY8A 1QRRA 1Y76A 2B92A 2WZCA 3QVJA 5HCUA 4W5OA 5IDWA 4NFLA 5KQLA 4FDLA 2AC7A 4JP2A 2O2EA 3JU3A 2OORC 3GC6A 4C0LA 3HYSA 1NURA 4L02A 3RC3A 1W0CA 4UTOA 2ZE6A 1UPGA 3IUJA 2PXCA 2O3JA 2X4IA 4BZXA 3FTCA 4D9BA 4QRHA 3QXJA 1XAGA 4Y2JA 1XA3A 1WW2A 3HRIA 1A2QA 2GAFA 4BV2A 1RJDA 3ST7A 4HBGA 3GMSA 3CWQA 2QEQA 4M0UA 4MZDA 3VAAA 3VR5H 2CKMA 1FXKC 2OKCA 3TDKA 3LAWA 3UWSA 5IG2A 4DCMA 5GADl 1PG0A 4GKJB 4G2TA 4PYKA 4BB9A 7AT1A 3O2JA 1ZL2A 1L7EA 2QXTA 4PLTA 1F38A 3FI0A 3T7TA 1S02A 3NJ8A 3PN1A 3X2EA 2I1LA 5CFRA 3VNRA 4ICIA 2AIRA 2AFHB 1EVZA 1GU7A 5D3MA 3FAZA 5KNLA 5AHOA 5IBQA 3OO0A 2JZOA 1CS0A 2DBYA 1Q7TA 2GJSA 1FW8A 3O8LA 4NPCA 3MG9A 4FFPA 4CCSA 4QVGA 1VA5A 2V1XA 1NE2A 2F4VB 2FCAA 2XOXA 2XAQA 5D51S 5CDGA 1ZZGA 1NF8A 1N3BA 3CXUA 5EYPA 3NBQA 3PFIA 1CUUA 2XGOA 1PGQA 2XITA 3CE6A 3JYLA 3PIDA 4AWAA 1H2XA 3WZ2A 4C7KA 3ICPA 3PYLA 5M04A 1UM8A 4W9NC 5F23A 4EI9A 5CFMA 2B25A 1JSRA 1JFRA 5JBNA 5KQGA 5L9AA 2JGKA 1M6HA 2YX1A 1T8YA 2QLTA 1O97D 3A4VA 3WV4A 4IDAA 4EO7A 1H7MA 4A15A 4HJRA 4XQ9A 4RSRA 3I9V6 2J08A 4LY9A 1RPJA 2WYVA 3UKMA 1JY8A 3BE4A 1E3IA 1VFNA 3RYIB 1YE5A 3HKEA 2GXSA 3D3JA 3IQGX 3PJDA 5GOZA 1QNFA 3I45A 1MW9X 4RY2A 5H9CA 2R3SA 2JNBA 3V8MA 3PTAA 3IQDB 4RHTA 5BVGB 1UKVY 3KR9A 3NTVA 3G6BA 1M5UA 1X7ZB 3JAKA 1Z83A 3H17A 4HQ6A 4M9UA 4UU8A 4P4GA 3EVZA 4IG4A 3I2HA 2PPLA 4N18A 2FWNA 5BPHA 1Y6GA 1DO8A 2F3TA 2LDXA 3O47A 2Q6TA 2AZXA 3RABA 1IM2A 4M0DA 5CDTA 3MLAA 4YXFA 2Z01A 2IK8A 1DBWA 4HVLA 4G0OA 4BMDA 8AT1A 3AZQA 2WSYB 4XLLA 1YMUA 1EDZA 4RQOA 1HE8B 4PS1A 3ZY4A 1U8AA 1P62B 1NN5A 4BP8A 2B4YA 1IEQA 3CC7F 4DYVA 2O2DA 1F7YA 1K9MW 2ZYRA 4ZAGA 4IGIA 3R7LA 1MU0A 2QMUA 3EZ9A 4ZIRA 2XA1A 3PHBE 4ITVA 4RU1A 3ROPA 4GFDA 3A28A 3TW6A 3QM1A 2O2SA 5K8CA 2QXYA 1DGQA 5ICFA 1JHYA 3L4BC 3HCCA 4YCNA 4ZA2A 3TOZA 2Y48A 3ZWVA 3IVGA 1CN7A 3GEPA 4DDTA 1NJ5A 4KR9A 3O21A 4MTFA 2G9ZA 5CJ2A 3J80A 1I3MA 3FR7A 1Z4LA 4E6EA 3ZRWA 3QLEA 3IOYA 1M2OA 1V2GA 1NMQA 1ADBA 5ED4A 2XMQA 4DYDA 3K5WA 3VTIC 4GLXA 5LGUA 4YFVA 4E1AA 4E0BA 2G4LA 3LUBA 3ZZTA 1QR9A 1R4MA 4TKUB 3E9ZA 2F3RA 4IUYA 4UAJA 4KO1S 5LXTA 5LBIA 2PGXA 3I6MA 4CKEA 1TA0A 1TQHA 1B0AA 2A57A 4JZKA 1POWA 3MJRA 4MAAA 1SC4A 2GUGA 1DINA 2JFYA 2QD2A 3B48A 3HSSA 4L72A 3RUDA 1E3JA 1R0XA 3QVSA 2ZSHA 3EOBI 4HQKA 4NDNE 3LI2A 2HA5A 4M1ZA 4M38A 5ECGC 5EIOA 3UJAA 5KVAA 1JEYB 3ZHBA 2YDXA 4URZR 2HRUA 4XJTA 1Q7CA 3WLQA 4C6HA 2FCRA 1I8TA 3W4IA 4FOOA 3ZLUA 1HC7A 4IYRA 4YASA 5CVCA 3VTAA 3TOCA 3QBDA 4NR1A 2EL9A 3GZNA 2ZT5A 3A27A 4TYNA 2QS9A 1P4JA 3HWSA 4UHBA 4CBCA 3G67A 4P36A 4XSGA 1MSWD 1ZSNA 1FFHA 4BMPB 1K6EA 5YASA 1ESEA 1XEWY 3L6BA 4RGYA 5AW5A 1B8OA 2PMFA 1JDUA 1C7QA 3N8HA 4MUFA 3E8SA 3V8NA 4FE4A 4YRPA 2UYNB 3LFTA 1RKQA 2IOHA 4IZIA 2AUTA 3TFQA 4N40A 1E5TA 5A4MS 1KWGA 3L1HA 3VPGA 3L79A 2BKEA 1RPNA 3CX4A 4F85A 3Q4HB 4TSFG 1CYDA 3CJRA 3TAUA 3HVKA 4L0QA 4QDJA 4IM7A 4BWVA 3R40A 3RK4A 4DV7O 3T35A 2C98A 3HBLA 2D54A 3I55V 5ARDA 1PO7A 1JHDA 4LHSA 3WGTA 5H0IA 2WMNB 4YJ3F 3KLOA 4MGEA 3I1JA 4TYPA 3QY0A 3PFNA 3VJMA 2YNMD 1YZUA 1O96A 3DDUA 3GG9A 4QG7A 5DO9A 2IU3A 1EG7A 5I9LA 1D4OA 2D13A 2IZ0A 2CW4A 2XDWA 3PA6A 2O2IA 2KYRA 1UAAA 1BDBA 3BXXA 1SKYB 1C4KA 2F43B 2WWRA 1FSFA 5JANA 3BPZA 1EBOA 4JJ4A 5SZIA 2ZTSA 2HA4A 2ZPAA 2QQEA 3HYCA 3SX4A 4BQOA 4UZSA 3CS5A 1E7SA 2DF8A 2OYQA 1F8GA 1OOEA 3ZJYA 3ETGA 4LDRA 4TROA 4CLOB 3MAAC 4OFXA 1HDYA 1QKIA 3FE2A 1H8EG 4C8IA 1OX6A 1XZJA 3B51X 4OL0A 3SSOA 2H7YA 4C0JA 2HHJA 1F5NA 1GFIA 1TEXA 3OCJA 4UVCA 1Z7WA 5ALMA 3BXFA 1EX1A 1YHZA 2YUAA 1G8AA 2KS6A 2QUZA 3TQTA 3KD2A 5JDCA 4HGYA 3ERCA 2VSQA 4C14A 1NQWA 1GYRA 1TVKA 2C7GA 1LPPA 4M88A 4YACA 3HC7A 3H0CA 3IEUA 2PVCA 4QUIA 1XJ5A 3G4SV 4J4HA 4ZCIA 4BVRA 3UM9A 4TMZA 1DQRA 3MLEA 1R3LC 2WJIA 3OD5A 3L75H 1D2EA 1KP2A 5TE9A 2HMAA 1DRJA 1ENYA 3TNLA 1N2IA 4HZUB 4FLYA 2X41A 4N6GA 1LLFA 2R00C 3FMPB 4KQ9A 2NNLD 5C81A 2IJGX 2P9JA 3FZEA 3R20A 3DE0X 2PSDA 4NDAA 5JMWA 3V8RA 1K34A 1KZHA 1UJMA 4LNUB 4LJLA 3CKLA 5CHEA 4BWFB 4EA7A 4DDVA 2GKOA 2PZFA 2O8FA 3I72A 3SQMA 1N2EA 4CS2A 1S72V 1GGVA 3OHMA 1L5ZA 3PGLA 3B9RA 4IVNA 5JQGF 2QU8A 4O2AF 4I46A 2BO1A 4CGZA 4DV0B 3JD1A 5LQAA 2HVKC 4HMPA 3LPLA 3LL4A 5HKKD 1EM8B 5JXJA 4Q4AB 2XUAA 4GE0A 2EW8A 1HE5A 4I66A 4CTOA 2QQ5A 4JLVA 3K2QA 4ZVTA 3T5AA 3AIOA 2JAXA 2P2SA 4G0VA 4U9IS 1BW9B 5KINB 2MINB 4X3OA 5DN6A 1TYBE 5IH3A 3ZDEA 1H6DA 1N2GA 1CNEA 1ID1A 1NVTA 3IRUA 2FTKA 3IJ4A 1UBLS 2QPOA 1A3CA 3EPPA 3H75A 4AHCA 1CUVA 4IOJA 5JXHA 5LNK6 4DRZA 2ZYHA 4UFPA 1SHLA 2CL0X 2G1AA 2VPIA 2XEXA 3B6EA 4V0QA 4ZHQF 5C8YF 4CMHA 1K7SN 1F8XA 2VF7A 4WFHA 1HLGA 2Q3JA 4HWGA 4JY7A 3ZHOA 4S04A 4TZKA 1UC9A 4Y9RA 5KWJA 4MULA 4P32A 2QL7A 4RORA 3TDMA 2A9VA 3UXMA 1PD3A 3MN1A 4Z7NB 1N6KA 2W8ZA 4O08A 3C45A 2QN2A 1JR4A 1PQYA 2BT4A 4IDOA 4MHSA 1W1IA 2HPZA 3T7SA 3G23A 2H8CA 5JAPA 2OLKA 3MIIA 4AMUA 3FB5C 1Z12A 2IYRA 2PMDA 1MOPA 3NAGA 4TKVA 5EAIA 4AS3A 5LNK1 3TR0A 1TEVA 3IT3A 4JEIA 1GTVA 2FF7A 1ZJZA 2FPLA 4LJSA 4TL6A 4YT5A 5DHUA 5K9ZA 3B89A 2C5AA 3QLTA 3RLIA 2WT8A 3DMGA 4FM9A 2CTQA 4FFBA 1GUDA 2IZ7A 4KAFA 5EP1A 3V4SA 2R6FA 3CTPA 4KNVA 4DF3A 1GTG1 2W2KB 3RVKA 2WUDA 3D02A 1N8RW 2F8MA 3RRZA 2FMKA 5KQRA 2OCHA 3GVHA 4TQ9A 3T3NA 3THRA 1OWLA 3UTCA 5DYGA 5EZ5A 4TQAA 3DKKA 4PHZA 1A9TA 1ZNZA 4NJMA 4YYEA 4DAEA 2GUZA 4BFUA 4EY4A 4EPXA 2RFLA 1L1RA 2GBFA 1TU0A 3LDFA 4FFNA 1OBVA 4PZZA 1K75A 1LVUA 4GMFA 4NONA 3CRMA 1RPTA 3N28A 2HTFA 4DT1A 4WJLA 2FL4A 3CJHB 1HE4A 3E22B 3CCJV 1VHJA 2C8LA 3GF4A 3LHDA 3OM1A 3EEYA 3QVXA 3TPCA 4CQLB 1UDBA 2PGOA 2VYND 4E4TA 2OV3A 1RKVA 3WKBA 4BFTA 1TTHA 4YPOA 2XF8A 3C3KA 3U61B 5KWVA 1GZUA 3O75A 2PUCA 3ISTA 1FNBA 1PL7A 1LGYA 3KAJA 4EGAA 1C9NA 1H8HG 4EVIA 3FDXA 3PQ6A 3QOYA 5TPWB 4BBZA 4ZHVA 2BKUA 4HDAA 3IIKA 2P2GA 1SCIA 3HXLA 2HH9A 3CEJA 4DDMA 5FEUA 4JJIA 1VHAA 4M0EA 3PUXA 4TKVB 1US6A 2P5SA 3GFSA 2CHSA 2NAFA 3H87A 3OBBA 1H42A 1K4KA 4R8VA 4BQNA 2B9EA 5THQA 3UMCA 3MQFA 1PTKA 4F38A 3K06A 3MINB 2XB6A 5B2EA 1ZVMA 4RUFA 2BI7A 4KQHA 1NT4A 1VBKA 1WZCA 3B2EE 1Y9EA 1AV7A 2C2KA 4FLFA 4LDAA 5C31A 3SPXA 3HKBA 1KSJA 4JKYA 4EH1A 1K3FA 1YCHA 2O2JA 1KJYA 2NYAA 3EE6A 3IKJA 3ZP7A 1Q1NA 2RAFA 5TPZD 5HOQA 3TGWA 3D8BA 3ITKA 1JFSA 4G4JA 3A1CA 4Z6KA 1ZOIA 4Q24A 3P2YA 1YBHA 2ZDIA 1E1NA 1HA3A 1MO3A 2FOXA 1P0QA 2VAVA 1NW4A 1KH1A 3MQ4A 4GAEA 4RVSA 4X7MA 1GILA 1N8NA 5KYNA 4FDUA 1Z33A 2GZ1A 3C48A 3WB2A 1RLUA 3AUKA 3NX4A 1JJOA 3ASZA 3T7DA 3UUEA 4YVFA 4BFLA 1A9PA 4KQMA 3W6OA 1F4MA 1JA9A 1NIJA 2IY9A 2Y1FA 4EK9A 3SPGA 5IC6A 3E1SA 1SURA 2CLOB 3R5KA 1EK5A 3CRRA 1FNDA 2VSXA 3JWJA 3TRIA 3UQZA 3FVTA 1II0A 1TOAA 2W6QA 1PZHA 2ZRQA 3LW7A 4D42A 4EQ6B 1DZIA 3C16C 4GP9A 5DI9A 3RJTA 3TFWA 2FR8A 3KJKA 3FG9A 2VATA 5CPFA 1OF1A 2A14A 1E3WB 3BK1A 5KNBH 4JR1A 1UMBA 1NMEA 4OHKA 4TT3A 4URYR 1G7RA 4GXNA 1E4OA 3CLSC 5F1PA 3DO8A 1ZPDA 4YUVA 3AB8A 1GM5A 3V9AA 1XTIA 3F71A 1U7TA 2JFUA 3M4NA 4WFFA 4V0MA 2OAQ1 4DCTA 3OOWA 1KB9F 4ANFA 3IB3A 1KYZA 1Q0PA 4J76A 1S2MA 5GQSA 9ATCA 3LGAA 4HV4A 5I48A 1M2JA 4RTNA 2PUTA 1JVNA 3F74A 2HP0B 3WNQA 5CCEA 2QWRB 4FWTA 3L72H 2DQ4A 3EUFA 3S68A 4FZRA 1L5HA 4WK2B 1R3IC 1CRLA 4AK9A 2K87A 5DGCA 4XFDA 3E9YA 5BYJA 4BJ5A 1CERA 2HSEA 4ZJUA 1JI3A 4RQFA 3ND5A 2R5WA 4R1NA 4EFBA 1T15A 2ZE7A 2WPNA 2VLIA 3OTHA 5IJXA 4P84A 2WVJA 3C90A 3DYVA 1AY0A 4UAUA 3KYDA 3MJEA 5HFMA 4JV5B 1O9GA 1RRMA 3G0DA 4OK6A 3W6PA 3UAZA 1R0CA 5G02A 4K03A 1IWBB 5CDHA 3SHOA 4OMCA 2C9BA 1U0BB 4JI0B 2AZ2A 3JCUZ 1L5RA 5B1BC 3C7KA 1J2TA 2B69A 4L8YA 5ITZB 1IN7A 4FLVA 1GNQA 4MS1A 3BB1A 3OE7A 2I9KA 3OBIA 2NM0A 3H9VA 4JUDX 3TE6A 1ENZA 3D2LA 2N0SA 4M1TA 3QITA 4CKEB 3RM3A 4HY3A 1UJNA 1U9IC 4GYKA 4I1YA 1W581 1LFAA 2PS3A 4Z86A 3RYFB 2RH5A 4MQFB 4Z4QA 2QSYA 3KOOA 4KLCA 2CVOA 1JG4A 2W6JG 2IDZA 1AS0A 3KT8A 4KG7A 2IOQA 4E51A 3LSTA 5CYPA 2A6PA 3DOCA 5JCPA 3AG1B 5CFOA 3KPYA 3T5GA 1DJLA 1K5GA 4B32A 2KQUA 1QIIA 4NP6A 2VS1A 1ZFNA 2E5WA 5L3EA 3W1WA 2IZ6A 3G80A 2NVUA 3H99A 3VNQA 5CDYA 1V8BA 2ZJFA 1Q16A 3ZWBA 2J0SA 2NQ8A 3RE1A 5B37A 3SR0A 5FOWA 1W2HA 2ORYA 1KIAA 3BBPA 3N2EA 3NC4A 4N03A 2CHFA 4Z4CA 2GPTA 4X8HA 2EKQA 3KVVA 3ZC3A 2LR0A 2H8EA 4B5KA 2C2OA 3BH0A 3WLLA 3RAEC 2Q99A 1KI9A 5C52B 2E1RA 3QOWA 5FL7G 1VMDA 2WJHA 1XWWA 3O4IA 4IXWA 2PBZA 2CTRA 1NPYA 4HB0A 3PQ5A 3B53X 5AIBA 1F14A 4OX9B 4MKIA 4DA4A 5DI3B 3GL9A 4N65A 3L18A 2WU3A 4PFJA 2X6CA 2FN4A 4C81A 1Q0LA 1QGED 3GDFA 4ARIA 4UV9A 2A30A 1Y1QA 4HEA1 1KU0A 4K9DA 4X7BA 2YIBD 3ROEA 5B55A 1P9RA 2FLWA 5EG5A 5EJ9A 1XTBA 2HJ9A 4PDRA 1JB1A 1Z8FA 4GRIA 5J9PC 1RVV1 2HIHA 4WXHA 2YRWA 3C8MA 5HWEA 1TYCA 5A4DA 3GLGA 4LGVA 3CLHA 4Q12A 5I4IA 2JDIA 2XKAA 3AR8A 1OE0A 3GR6A 1G8SA 3OT1B 4QELA 5FV4A 3MBMA 1XWIA 2I6SA 3OCXA 3RTDA 1H1LB 4V02A 5TLSA 2VWQA 5LUAA 5LDHA 2AE1A 4W82A 4OLFA 1WA5A 5FH9A 4ASUG 2K1SA 1B0ZA 1KD1H 1NF9A 2RGGA 1OB2A 4ZAFA 4NZNA 4IDQA 4XDHA 5GGXA 2WTMA 4ZO9A 2GN0A 3AV3A 3KOXA 1NKSA 4AF7A 2AFIB 1Q90D 2EX1A 1R0ZA 2KTVA 2EJCA 3IAHA 3WGOA 1TKRA 2I29A 2J6IA 5DTQA 3HZRA 2OD7A 4LE2A 1YAJA 2TMKA 1P1HA 2LGWA 1U3VA 1T3TA 5GINC 1M93A 4HZ3A 5JSYA 1DC3A 2P0EA 2QM3A 3R4VA 2FPMA 4QFDA 1MNAA 1IXYA 4GI7A 4N41A 4NV3A 1ZD5A 2YCLA 4I1OA 4JXKA 4DAOA 3JR3A 3OMLA 3J80M 5EUCA 3WL6A 2XTAA 4ZVRA 3BC1A 3Q0IA 5A05A 3EHEA 4Y2TA 5FHQA 3U5ZB 1E8MA 4QLOA 1RMYA 1D7AA 1PRYA 1JJIA 1NJ8A 4GOLD 2WD9A 4YUZA 1XZQA 2ZT9B 4JBIA 4F7WA 1GTRA 1QF9A 3FCCA 3T4XA 4HFJA 5LA6A 1KUQA 1UBUS 5HKAA 4XD2A 3TVDA 3LVBA 3VZSA 4UVGA 3LP8A 4DMKA 4BT7A 3HU5A 3NRBA 4I55F 4EBFA 3DL7A 2PN1A 4TLDA 3I6QA 3N75A 1MZFA 4JBHA 4RSMA 4MQMA 4JKIA 3E3MA 3RT7A 2I6GA 4FLZA 4KXMA 4MUYA 4BBJA 2QT1A 4QUGA 2VVTA 4OLJA 3CX8A 3UHJA 4BNJA 3P3PA 4WXPA 4ESOA 4L8WB 2YL2A 3DULA 3FYUB 2B34A 2XW6A 3FKQA 4HHEA 5AKHA 4Z3DA 5BRJA 2FV8A 1BMFD 3I2KA 1F2TB 4INZA 4QOJA 1CBUA 3F7MA 4Z7JA 1ZA1A 2E5LB 2DWEC 4FI3C 1HFEL 2EP7A 2VWHA 3JVIA 4GBGA 2X3FA 4HOYA 4IJVA 2CNDA 4IRXA 3IOBA 4MYSA 3B1FA 3UJNA 1I5XA 4K6FA 3B1KA 3U81A 5KNCD 1T1GA 3LZDA 2VOJA 3PJEA 5A9SA 1QONA 1TM4E 4RS3A 1GO1A 3DUFA 1UZAA 2BH2A 4IJKA 1T8UA 5IBCA 4EVRA 2P06A 4LBEC 3DVAA 4CMAA 1VQVA 1T0KB 3DDHA 3B6NA 2VR1A 2LP4Y 2ZBVA 2RKBA 2ZT6A 3EG9B 3IUEA 2NQTA 4MW7A 4DS3A 1QH8A 4E13A 4MJ3A 4C21A 2ONZA 3HN7A 4G2KA 2XCUA 4EUNA 4Y1RA 3G2OA 3RIHA 3EVEA 1NI3A 2VOEA 4YGXB 3N74A 5FWYA 1ZG3A 4IUBS 2XMSA 2P6NA 5HM8A 5EJEA 4BLWA 3T1CA 4DUGA 4IHJB 1LNZA 2RGUA 3EFEA 3AWDA 1T0BA 3MUOA 5JI2E 4FHFA 2CVFA 2Q6KA 2EWMA 4RGBA 2R6CA 1GPNA 3Q2IA 2W98A 3ESDA 4F11A 2LKCA 1WDKA 4NJOA 1NTZH 3DH0A 1DTEA 4LYGA 1I7DA 3BDIA 3ZW7A 3CD6V 4ZMSA 2JJ1D 1B23P 1LPNA 1AROP 3KT6A 4COOA 3WICA 2VRWA 3C3SA 2FZVA 4AXXA 5CFNA 1I2AA 4WOJA 3HA2A 1OCZB 3L77A 6REQB 2JJ8A 4C4PA 3GRCA 4B7EA 3VR4H 1TZJA 3C6ZA 2VJMA 3AVUA 3UENA 3PFBA 3RI3A 5C8ZA 2Q0AA 1Q6ZA 4ALKA 4NTXA 2F9LA 4W7IA 1KKCA 4H37A 1SXJC 2CFIA 2W48A 3H11A 2VPPA 5DXFA 5A02A 3DBHB 4BT2A 1CP2A 1NUUA 1Q5PA 4ZT5A 3ZZ0A 4JA0A 4A16A 4WT7A 4KN9S 1EDOA 4MQ5A 3ON1A 1UC5B 1YR9A 5JG7A 3RS3A 5DZSA 4G1UC 3TMYA 5HFAA 4Q4CA 5CIQA 5JFTA 5TMPA 1N5MA 1HTBA 1IRXA 2PKRA 2FEKA 2QAGB 1D1PA 4YRLA 1E7QA 1EFPB 2GHIA 4JVMA 2FSUA 4KC0A 4AJLA 3NKLA 4MTOA 4RIIA 4REQA 1MFZA 3UT5A 4TVKA 2IHZA 3APOA 4B5LA 4OHXA 2Z95A 1QTQA 1XEXA 5T41A 1KAQA 1N2BA 3OIDA 2G76A 2JHFA 5DX8A 4X8AA 1DC5A 1XK7A 3KC2A 4Y8VA 3UTDA 2HFKA 5J2UF 2QLFA 4EL5A 1OAAA 3L4EA 1VG8A 3A1NA 4Q7QA 2O8BB 3N86A 5TQ0B 4YR9A 1NVUQ 3KPVA 3SJBC 3TJZA 3ZWDA 3WRVA 3GOHA 1LS6A 2HCBA 1MJNA 2Z2JA 4AYXA 2YXPX 4D8YA 3KXLA 5FULA 1I2MA 1A4RA 1QQCA 1DUSA 4X00A 1H4SA 1JG7A 2DWQA 2OXEA 5DWQA 1PJLA 2WJAA 1XU4A 5G3YA 1Q6YA 1FS0G 2Q45A 4OHOA 5GTIZ 1CUYA 3EWAA 2R00A 3NOVA 2X19A 4DUPA 3UF0A 2PY6A 2QUJA 4Q3NA 3WLEA 3TLYA 2G3YA 4E08A 4E46A 3GJZA 2UZ4A 3V55A 1I0LA 4ATNA 4TQDA 3N3BC 5GOTA 1VQ9F 2UYQA 5T4HA 3SMQA 5IWAB 4NXMO 1V1RA 5AW4A 4YY3B 4R9VA 2IYOA 4S24A 5EIAA 3TB4A 3RV3A 1SVSA 3I8SA 5CNJA 4K2AA 1QHXA 2Q5IA 2FWBA 1YITV 3CPWU 1WKVA 4HB2A 1G38A 1ECCA 2PWPA 1RQNA 2XIQA 1SUDA 1AI6A 1PZMA 3OKAA 4OLHA 1JHOA 3C3XA 1YULA 3L0IB 3LY9A 4NSNA 2XYPA 3ETHA 5A9SB 3IDZA 1FTQA 4QICA 1OASA 4QYMA 5TC4A 4RHCA 1EFRA 1Z35A 5CVUA 4YIOA 4ZI5A 1JX9A 1PKEA 3QXCA 4LCBA 3ZOPA 5T57A 5JS8A 1Q3TA 4FFLA 4GMDA 1I1OA 1ACMA 4URFA 3CMMA 2PYZA 3RVMA 1KMIZ 1OHHD 1B41A 4JUCA 5FI1B 5GV8A 1DJNA 5JNUA 2JEOA 3QY9A 4NBSA 1HZJA 4BTLA 3C5HA 4NNPA 1I14A 3CCQF 1OTXA 3IJEB 3FX7A 4RTKA 5F76A 2DR0A 3U3ZA 5DSXA 1BN6A 1R18A 2JGNA 3CT6A 4RF3A 2XT6A 1PJ2A 1J0AA 1TW3A 1C7FA 1U3GA 3VH4A 4EJ0A 3HRKA 2AEJA 1OI3A 2YN2A 2BZ1A 1EXMA 1MC5A 2FX3A 3K1YA 2BGIA 3FJOA 2BSAA 3I9JA 4GSKA 1I5EA 3PPIA 4MH0R 5JALA 1KP9A 1FVOA 1UQUA 3HQ4O 3KL2A 1M90W 2Y1LA 4JL8A 4B2PA 3I5XA 2VA8A 5LA6B 3RVQA 3TIFA 3K0DA 2C3MA 5GM1A 3UJHA 1EHIA 2B6NA 2GZMA 4QFMA 2GXAA 3GHYA 1NBME 5JBIA 1NXQA 3WOVA 2PO5A 3WYGA 2GWHA 3FETA 4MVZA 1K33A 4GI2A 4NEHB 2PFSA 1CY4A 1I01A 4Q1FA 3M4ZA 2EJWA 4JJ6A 5G0SA 5B5SA 4JXXA 4NCIA 4B3JA 3NR7A 4KWEA 3LF1A 4BLQA 3L4KA 1YS1X 4IUDS 3CX3A 2WFMA 1CQPA 3FD8A 1C4OA 3DC5A 1P80A 3HPLC 3HNOA 4J0FA 5BSVA 4CIYA 3KHKA 4H6WA 4ZK6A 3DLPX 4RXMA 1S2OA 3KSAC 1DXOA 2PMBA 1TO2E 4JJ7A 3S5JA 4ZGWA 3NUQA 2GRJA 1E2NA 3P2KA 3JVUA 2KI5A 1C3EA 3NK6A 2VAPA 5DPMA 3I1IA 8ATCA 3QO7A 2YRFA 1ML4A 3EDRA 3PHLA 5EQTA 4Z7OB 1RWBA 4Y0VA 2A9KA 2IBTA 1OZGA 4N0DA 3VGPA 1IBSA 4XOUA 2KB0A 1H1LA 4EYEA 3H1KH 2AR0A 4NMXB 5HHTA 2RBGA 1X39A 2X1MA 1T4GA 1XDDA 4LF5B 3PQ3A 3A9SA 4P3KA 3TD4A 4PYIA 1T4BA 3IAAA 3M5PA 1X0XA 1VM6A 4TL7A 3L74H 2JLCA 2YBDA 4ZOLB 1VK3A 1U98A 4ERHA 1I3CA 2XUDA 3PPWA 5LCXA 5BR4A 1GGEA 1YJCA 1GNVA 4NCBA 3NT5A 4MWBA 3KWFA 3DKPA 3AUJB 4WZBB 1E6MA 2OR3A 1UFIA 1N25A 1D6MA 4PV7A 2YV1A 4YCCA 4C0WA 4JDUA 5AVWA 1RI5A 1LSUA 3CJHA 1BHJA 2H85A 4MJXA 5DASA 3ZYCA 3VBBA 4HVCA 4BO2A 2QWQB 2PYDA 5ITSA 2AOTA 5H70A 5JARA 4XKJA 2A0YA 3TUIC 4C6TA 1E9FA 3L70H 1YNSA 3VV2A 4EJ2A 1VI5A 3PEWA 5T3UA 3I2GA 1GTZA 2PRYA 2IIBA 3JWIA 1BH2A 2PZMA 2Q4BA 1QVAA 5KBYA 4J7XA 3TZCA 1Y3HA 3L6EA 4YECA 4DV6B 2WWFA 1NLZA 4JTAB 3KYCA 3H2YA 4BX8A 1G98A 4B87A 3WL3A 3R3WA 1Q3EA 2JI8A 2EKPA 5ERGB 4X88A 1CDZA 1OLXA 3S2FA 2OBNA 5KMGB 3K0AB 3OKCA 3VQTA 3IPXA 1SC1A 4PZPA 3VNSA 1IEWA 1VKNA 5IM4A 3S7TA 1KMIY 1XL6A 1PVDA 1EWKA 1Z6PA 2H2IA 2DC1A 3A2FA 3RYFA 2K6GA 3NTLA 4LOHA 4TMKA 5A62A 3QVKA 1KMCA 3RBVA 4BN4A 3QFRA 1TO6A 3WDLA 1CEYA 5FOSA 3CZ4A 1UT6A 2FK8A 1ZQ1A 3NIWA 4FDVA 3P2OA 4Q6WA 2CHTA 5BOVA 1YBFA 2HN9A 4DV7B 1IQ0A 3VNUA 1C7IA 4LECA 1SPBS 4PAGA 3DMPA 2VHCA 2VXCA 2IV2X 5CH3A 2JIBA 3DMFA 1WB9A 5J43A 3IKEA 1SVUA 5BR8O 1QVRA 2O0HA 3N05A 1IYZA 1RXWA 4Y2QA 3QTTA 4A5SA 2UVPB 4UARA 4EG8A 1OX4A 2DRIA 3C5CA 4XWGA 1VQMV 4KFMA 1IB6A 1VE6A 3LC1O 4IX9A 2INGX 5HP4A 3WIUA 4UUBA 3AXSA 2IIVA 2WG1A 3V7QA 4HH4A 4WLEA 1BU5A 3WLKX 4EKEA 1IV2A 1T0HB 4IFIA 2MYNA 1R5OA 4RQUA 3T38A 4FTWA 1ODSA 2Y71A 1ZMXA 2G1KA 3NGXA 1KQPA 2YV5A 4KXYA 1P3Y1 4UEWA 3SAJA 5E3HA 4J3FA 2RB4A 1KETA 4B44A 3DB2A 3GFVA 4YRNA 4KYTA 1X7XB 4JQYA 3G68A 5J5VA 1WA8B 2YZMA 2Z30A 3SKXA 4AJHA 1I6LA 1JX6A 3V7YA 3B3GA 3RSLA 1YXMA 2KGWA 3EGVA 4O4HA 1L8DA 1BXRA 1MX5A 2OTLV 1KVUA 4ILEA 4JNCA 1NQTA 4HDCA 2BISA 1WULS 4RD1A 4CKWA 1PNKA 1ZRHA 1YZKA 5CBGA 1OV9A 5CMUA 1GQQA 2NZVG 2VJOA 3DC7A 3TLXA 2QEXF 1XMIA 3A9WA 3D1VA 3KDPA 3R24A 1PLJA 2EAUA 3PAFA 1HYGA 1Z6XA 2CLMB 3UUFA 3ZV4A 5C51B 2SICE 4J3JA 5AI0A 3SHFA 4B31A 3SKVA 2OGUA 5BMVA 3KJEA 3OFJA 3IT1A 2G63A 4H1UA 3OLWA 3WMGA 3Q0TA 3B8NA 4WIAA 2QPTA 1NPTO 2Q67A 3TXQA 3OZUA 5D5PA 3AY7A 4NWIA 2QQFA 3JYNA 5CX4A 2VWKA 5IDQA 3AEUA 2M6LA 1YZTA 3TQOA 3JALB 4UBNA 3F0TA 3MJFA 3NKFA 3VU9A 4KHZA 5A3VA 1VQLV 1U8UA 2YEVB 2HPHA 2FUG6 3E61A 4RK4A 2V55B 1RXSA 2WOJA 1UIRA 1R74A 4C3UA 4D4HA 5HIMA 1QVZA 3CLSD 2ODAA 5AH0A 5JNLA 2WWHA 4RABA 5KYKA 1BD4A 1IY0A 3GDGA 4KQ6A 4DBLE 4KXWA 3OJEA 1P44A 5REQA 2D1SA 3CB4A 5J2TA 3O83A 3PI6A 5E1DA 3CRCA 2EDCA 2J3MA 3D43A 5GVRA 2XYRA 1N6LA 3WG7C 1QUEA 3GHHA 4IIYA 3UK2A 2HJSA 1NI5A 2R25B 4G1BA 2YXHA 5U1PA 1GM7A 2EBOA 3PHCA 3BRSA 3IAS6 3R6GA 1Z47A 2G7ZA 1NVBA 3Q7TA 4FDMA 2O7NA 3S4YA 3C3BA 1OZ0A 2Q1WA 4J94A 3U6BA 5DCVA 1O5IA 5LHIA 4GR5A 3OLYA 5FOXA 4HKTA 3WB9A 4AKSA 4C7JA 2Z8ZA 4X94A 3N0WA 1NC1A 4F84A 5BV2P 5F51A 3GWKC 3MTGA 1HXHA 1NBEA 2ZR9A 3ADPA 4C7UA 5EINA 3E3AA 4WF9V 3MTBA 2NTEA 4GLJA 2C57A 3CG4A 5J4KA 1FMCA 2Q8VA 2VQFO 2IA5A 3R3VA 5AQEA 3PKJA 4BPRA 5CIYA 4DQXA 1UDAA 2FX5A 2WJYA 3HGQA 3O73A 3HGMA 1B16A 1FRZA 1P73A 1XRLA 4G8BA 1KTVA 3NBYC 3P52A 2WU1A 3WGZA 5CG2A 5CITA 2C59A 2UYHA 3BE6A 1GPAA 3OOHA 2Q1UA 3U44B 1ZJ5A 2ZDQA 3O82A 4BT5A 3G59A 1QU9A 2ADPA 3IAM6 1OH7A 5LP6B 3OHPA 2IPMA 2JGRA 5JS6A 4FE7A 3MDSA 4DCUA 1ND6A 1OLXB 1QE3A 1X7XA 4UCFA 4U00A 4OKSA 1GA4A 4P9NA 3ZE0B 5GJBA 4Y6GB 2Z3WA 4DADA 3WJRA 3LUGA 1QLEC 1GG5A 4DXDA 4KQIA 4WZBE 3DFUA 1LTHR 1VHDA 2RG1A 2X0IA 2X6AA 2ZYTX 3E89A 2LCIA 4LDZA 4LRUA 1X9IA 2Q0XA 4RPHA 2OCPA 3T1HB 3GT7A 1EGQA 3A4NA 1X42A 3AJRA 4QGGA 3C6XA 4JGSA 3F6CA 3H5RA 3RA5A 1LQUA 1OPRA 3QVMA 3D3QA 3VR3D 4U6NA 3ASUA 1J2UA 3DT8A 5F3RA 4A23A 5JECA 4PX2A 4NU5A 4LZNA 2PSEA 5IT9A 1ZUD1 3EQZA 2AJTA 3WIEA 1J97A 1FFEA 1EAYA 2QR5A 2XNCA 1X2BA 2I6RA 1J09A 4X97A 5JLJA 1ATZA 2Y05A 3SZGA 4BP9A 4A1FA 5JFGA 1PE0A 1XLUA 3OOYA 3EFOB 4LCKA 3PRHA 3OG9A 1G3QA 1TAUA 2WBLC 2HLDG 1CHNA 2QTBA 4MB0A 3SR4A 1M34A 2YASA 4CUJA 4K6GA 3EZLA 4TMFA 4ZVSA 1MABB 1MBZA 1TCCA 2G9UA 4AQDA 2QYOA 3T1YB 3ZV3A 5ALFA 3HXOA 3JS5A 1T9KA 2C2HA 2PMCA 3N2ZB 1QDEA 4CG2A 4DV5B 5JSUA 1KQFA 2DEUA 3MIZA 4YP9A 1XDCA 5E4FA 4HDMB 1GGMA 4D7SA 3FMIA 1T5IA 3P5SA 3VOUA 2C4NA 5L40A 2P5TB 5DV9A 3VH2A 5HY1A 1NNLA 5G0TA 3HVHA 4UCRA 3CLUD 3DGEA 3USES 4BIUA 2ZNJA 1N1GA 4FMPA 3SMVA 5C7YA 2H1RA 4OJKA 4MUEA 4LF9O 1VGRA 2UKDA 4PFSA 4X65B 2ZZMA 2SKDA 2AWOA 3L0SA 4QD3A 4ZKEA 3OY7A 1IBLB 2QD5A 3FAVA 3GEBA 1IB0A 1ZCBA 3F46A 2XVZA 3P45A 3ADBA 3B1WA 2XRYA 4I08A 4EG7A 2D06A 1ZX1A 4ML3A 3KU4A 4NVPA 4L3VA 1G1XB 2W9XA 3NEJA 2DYSC 4PGFA 5FTNA 1XMSA 1ZU4A 4BIIA 5AVSA 2HM7A 3GLFA 2AXTZ 2IYTA 3B77A 1KDOA 2H4YA 2WLNA 3AL3A 4JAVC 3SLRA 1OCRB 4OBWA 3Q7IA 4WD3A 1T9HA 2DFPA 4PDVA 1H5UA 2H92A 2R6DA 1VMEA 4LQ4A 1M0TA 2PL9A 5FR1A 5K3BA 3E7XA 4NCHA 1J23A 4FS3A 5ALYA 4BKOA 2WLKA 4DSNA 4QUAA 2AIZP 2GM3A 3DQPA 4ZANA 4OTZA 2VHYA 5EMKA 1CZOA 1OTYA 2FN8A 4KIFA 3NHLA 5L6LB 1J00A 4PU0A 4Y6LA 5HY4A 1SQVH 3GZJA 3T7CA 1Z08A 3K31A 4Q1VA 2FYTA 3DAPA 3F0DA 3CRZA 3DSRA 1PV1A 3MELA 4QGHA 1R3UA 1QIJA 1XJ0A 4FGJA 4TKZA 5CHYA 3TRDA 4S1TA 3OEED 821PA 4AECA 1WBJB 1OYOA 4DM3A 1A5SB 2HRCA 3NBKA 4EHAA 1EZ1A 1WZUA 2ZRBA 3L7NA 1OKKA 2DX7A 2QR3A 5J1SB 2FEWB 1NVDA 2ZJ2A 3AI3A 3BS4A 3KKEA 3TOVA 4BNGA 3VC3A 1HRKA 2WJZB 4FJ0A 2G07A 1MAWA 1WU7A 3ZMTA 2GESA 2V4UA 3EVDA 4GUAA 4P34A 4I3FA 5D3MB 4O2BA 4HGRA 4UNNA 1RKUA 1CDDA 1GPLA 4PIPA 4EGFA 2AZ0A 3RD5A 1GGHA 1E5QA 1LWNA 1V16A 2V3VA 4H4CA 2HVYD 2GCIA 3M84A 3S8MA 5FXMA 5AW6A 5KTOA 4TYYA 4TMXA 2HEPA 3JZIA 5KKCA 5DT9A 1JYEA 1KK2A 1KRWA 4UBMA 4B0PA 2VK2A 2O2YA 1YZBA 2X9VA 1CJCA 4OI2A 1OAOC 3E1KA 1C8KA 3IESA 3DW3X 3IMGA 4CV2A 3KQQA 2PR7A 4JLAA 1CE8A 1VQ7V 1GWNA 1YKGA 1PGOA 4LNHA 2ZDIC 3FRHA 4FKMA 4RACA 1L4EA 3KX2A 3LLCA 4TL8A 2ZB8A 3T4PA 4DLXA 4E11A 1S8FA 3AHCA 5IWAO 4WNIA 3BN3A 3KQHA 4Q39A 3M33A 3VR6D 2JATA 1F6WA 1QBKC 2J3IA 4XGIA 2J6BA 5EWRA 2V9ZA 1D3AA 3F6YA 4RKRA 4GI5A 1X7YB 5E7QA 1DELA 1M1YA 1NXVA 3TLJA 3D9QX 3FDZB 2R1TB 4KNWA 3CCEV 1FJ2A 1KR5A 1M1UA 1Q83A 3PR1A 2PFKA 1SUFA 4Q00A 4FGWA 4L6CA 3MRTA 5K4HA 2QGNA 5J2UA 3K3WA 1BTOA 3JQEA 3VOBA 2H4JA 4IV5A 3RIEA 1FYEA 4GEGA 3ZCTA 5LN1A 4F12A 2B1JA 2ZRHA 4RW0A 3T1VA 5K6RA 2ZRLA 1TQ6A 1KI4A 2H5EA 4FONA 4G1EB 1QYXA 5EESA 1YR6A 4ND1A 1GZ7A 1E20A 2PH1A 3HVUA 1PYOA 4I36A 1T0IA 2ZBUA 1QE0A 7ADHA 2O8EB 2N3ZA 1WZIA 2GERA 2CHQA 1YSCA 4JYAO 1TADA 1PD0A 2EWWA 2QMYA 2FMIA 3A05A 4XYBA 4Q3AA 2CSUA 4P0TA 3N4YA 2FDXA 2GVZC 3GLRA 4GMHA 4XDGA 3T34A 3SYRA 1L5YA 2M1XA 1AT1A 2GWRA 1KP3A 2WHPB 3G0GA 4HEJA 5TMDA 3UANA 1W5EA 1J42A 1MZVA 3MGCA 2MCFA 3K1AA 2BBSA 1GFWA 3UYLA 3QH4A 1HT1E 4R2KA 2X1LA 4OHWA 2Q7GA 2BGLA 2HHLA 2PV0A 1Y98A 4Z4IA 4XH9B 1PL6A 2KSQA 1GRRA 2ZG6A 4UFNA 5AKEA 4J4TA 1FP7A 1RBYA 1JHRA 1UPBA 1GR1A 2BUBA 2HYDA 3AMVA 3F2VA 3KKPA 3UHPA 3H11B 1FPOA 1GEEA 2XUPA 2LWIA 5HGJA 3ASOC 2X3UA 3GN2A 5EZSA 5HCIA 1DWOA 4HLCA 4PXYA 3U3DA 5C4GB 4JIGA 2AW5A 2NO6A 1QYCA 1HOXA 3PXAA 3D2AA 1NVMB 3OVMA 4TWRA 4E5DA 3D3IA 1Z37A 2X9QA 4ZKDA 3BXZA 3F5MA 1KK1A 2Q2QA 3LUJA 4UOQA 4AUNA 2VI5A 1C0LA 1IPAA 1R37A 4PAOA 2CV1A 1B1CA 4XASA 1V35A 5E4JA 3BWXA 3M4JA 4LBWA 4M86A 5EMLA 4HXYA 1ZUNB 5H6QA 3BD7A 5TQVA 4B6FA 2A5YB 4LI0A 4D81A 4HTFA 1A32A 1VQOF 4YI3A 2TMDA 4UM9B 3FHCB 3KSBC 4MHTA 1KORA 1O95A 1TPZA 1Z7YA 3CINA 3O8BA 1PF7E 1CQJB 4IHAA 4EF5A 3WL4A 1QOPB 2DBVO 4EECA 1GKKA 3TCXB 1K3UB 2ZUEA 3HBMA 5E79Z 1LPSA 3LA6A 4NOJA 4DIKA 5JJKA 2HFEC 3BQ9A 1KWKA 4CM4A 3M2TA 4MCJA 1HDZA 3KU1A 4NYIQ 4F3YA 3NXSA 4G89A 1KQSF 2Q4EA 3WFJA 4B3CA 4B3XA 1AXEA 4JT4A 4RVGA 3E15A 5E1BA 2WPDD 2IYWA 4UNQA 4OHPA 1GIAA 3OGCC 5K3DA 1IZ0A 2CB9A 5C5EA 4FR2A 3CXCU 2HSGA 1A5BB 4KX3A 3AG3C 3LWDA 1Q22A 1XZNA 4KVZA 3VH1A 5I5GA 1ICIA 4HYOA 5HXZA 2GTPA 4JGGA 2VRBA 5IPFA 5AMXA 2ZCJA 1XNQB 1X15A 5KDLA 4O4JB 1N6OA 1W49A 3RV4A 3TB6A 5G4UC 1A9YA 1LVGA 2CY0A 2AXEA 3KZOA 5LMNO 2RHLA 1H3NA 1LJ8A 3OUZA 4Z99A 2WAMA 2YXYA 1R8YA 4GHWA 3GQBA 4L6IA 4BTEA 3IE1A 3U4MA 4JJKA 4B17A 4JUAA 4QYXA 3ZIAA 2VH1A 2GN2A 1LLQA 1E69A 3RYHA 3O8CA 3H1IH 5A9RA 4UCSA