4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
5EYPB 5KX5B 2BTOA 5M7EA 2R6R1 3JALA 4U3JB 4EB6B 3V3TA 4O4JB 1TVKA 3JAWA 1W581 5FNVA 4ZOLB 5JCOA 3RYFB 5CA0B 4X1YA 3N2KA 3JASA 3VPAA 5IYZA 3JALB 4U39A 3WGLA 3WGMA 1TVKB 3JAWB 3N2GA 4IIJA 3HKBB 5FNVB 2VAPA 4TUYA 4YJ3A 3M89A 3RB8A 4X1YB 3N2KB 3RYIA 4HNAA 1W5EA 2Q1XA 3JASB 1W59A 4I4TB 4I55A 2RHOA 5IYZB 3UT5A 3N2GB 4IIJB 5J2UA 4TUYB 5MN6A 5LA6A 5LXTB 4EI7A 3RYIB 4HNAB 5GONA 4B45A 3JAKA 5MN4A 2GVIA 5EIBD 4I55B 1FSZA 5J2UB 4WBNA 2VAMA 5LA6B 4O4LA 2Q1YA 3WGKA 5LYJA 5GONB 5ITZA 3JAKB 3HKDA 4O2BB 5J2TB 1Z5WA 3VOAA 5IJ0A 3C8LA 4DXDA 4WBNB 1FFXA 5EZYA 4B46A 4O4LB 3ZBPA 5LYJB 5ITZB 3JARA 3HKDB 4X1KA 4X20A 5IJ0B 3M8KA 4XCQA 4EI9A 1FFXB 5EZYB 4KWEA 4X1KB 4YJ2A 4ZHQA 4YJ3B 4M8IA 4O4HA 3RYCA 4LNUA 4F6RA 4X1IA 3VOBA 1OFUA 4EI8A 4YJ2B 3UT5B 4ZHQB 3JATA 5BMVA 3WGNA 4O4HB 3RYCB 4LNUB 4F6RB 4X1IB 4I50A 5KMGA 5C8YA 5BMVB 3JATB 3CB2A 3ZBQA 5JCOC 3HKEA 5EIBC 3VO9A 5MN5A 4I50B 1RQ7A 5CB4A 5C8YB 5CA1A 5IJ9A 2XKAA 3E22A 3VO8A 2VAWA 3HKCA 1RLUA 3HKEB 3JARB 2RHLA 1TUBA 2RHHA 4X20B 5CB4B 3WGJA 5CA1B 5IJ9B 5JVDA 1Z5VA 3E22B 5LOVA 1W5BA 3R4VA 3ZIDA 5LP6C 3HKCB 2XKBA 2R751 4O2AA 1TUBB 5JH7A 3HKBA 5JVDB 5LOVB 2RHJA 4DRXA 4I4TA 4ZI7A 4O2AB 5JH7B 2BTQA 5JQGA 5LXTA 4TV9A 4E6EA 3RYHA 4DRXB 4O4IA 4ZI7B 5KMGB 1SA0A 5LP6B 4FFBA 4IHJA 1W5FA 5LP6A 1JFFA 2BTQB 4TV8A 5EYPA 1W5AA 5JQGB 4TV9B 5KX5A 1RQ2A 4U3JA 3RYHB 4EB6A 4O2BA 4O4JA 4O4IB 5J2TA 2VXYA 1SA0B 4FFBB 4IHJB 4ZOLA 3RYFA 5CA0A 1JFFB 4TV8B
chains in the Genus database with same CATH superfamily
4B35A 2IXAA 3SYKA 1GHTA 3PF8A 3THOA 8ABPA 3U37A 3FAZA 2NO5A 1JFRA 1AKUA 3BVPA 2IS2A 5IBQA 5DIFA 1T4CA 3W9UA 4P34A 4BNKA 2JF0A 3GVIA 2VEOA 4RK5A 4PYJA 4P4SA 1Q6ZA 3R0XA 2Y4NA 3T1VA 4BNHA 3SC2A 4Q5IA 1IBLB 3INGA 2LE0A 2B69A 1JLKA 5BUZA 4RWUA 5CH5A 5DISB 3VU1A 4BMCA 4TWZA 1NY6A 1V9SA 4NYJR 3QUTA 1NYTA 1ZCBA 2X9VA 5CBPA 4L5YA 3W5VA 3M7MX 4B4WA 3QEAZ 1G16A 3HJCA 2A5GA 1ZMTA 3GDWA 3ESRA 4I5EA 1A9SA 1RLMA 4E07A 3IKVA 4ZU1X 1Y7LA 3H5WA 1F7UA 3PHJA 4FE4A 3VMFA 1OGJA 4AMUA 2L82A 5KWJA 1PS8A 4HL6A 4CDRA 2CBZA 5FLEX 3GDGA 4I1SA 3TI9A 3EGEA 1LF0A 9MHTA 2VN8A 5BRJA 1PG5A 5IHPA 2V55B 5B2FA 3B3FA 2QX4A 3TD6A 2PLNA 1VI5A 5HJEA 2A9JA 1QIHA 5HBRA 4MARA 1Q1EA 4CRWB 4AF6A 3T3GA 1VBFA 5J1TB 2JS5A 3GA0A 2ONYA 2HRZA 2NV6A 1XEXB 1NIJA 5JAPA 2XOKG 2QM8A 3L6OO 2JGJA 3AY3A 3VR2A 3EBPA 3OUZA 3RAGA 4XEUA 3ZCUA 5KVVA 1Z6YA 2AC7A 5FOXA 4FMCF 2OCCB 3UANA 1OROA 4Y7DA 1CUIA 5B3JC 1QYIA 3R5TA 2GBPA 2GNPA 2AG6A 4C88A 2ZRMA 1E7KA 2PL1A 4Z8YA 1C3OB 4RHYA 1NQUA 4LF7B 4H15A 3TSZA 3ZDQA 2VPPA 3GW8A 3L06A 4D9HA 1DJQA 5FOUA 1NA5A 1TC2A 4JWKA 2Z2YA 3HG7A 1XTUA 4DR2B 4G0UA 1T8WA 3LIPA 5JXIA 2VSQA 4ZCPA 1MW9X 4LDZA 3ZDYB 4J7KA 3SP1A 2CCJA 1AN9A 4E15A 4HXYA 4FSHA 4GPAA 4U00A 1YCFA 4JCOA 2I6GA 3AMVA 4YJ2B 2OZLB 1OGIA 1M75A 4B79A 3ULKA 3VJMA 4RIGA 4KR7A 1U6JA 5EA2A 3TG2A 1RBMA 3WGQA 2NMVA 2BKLA 3ESXA 2ZBQA 2AZMA 2PZFA 4RTKA 3PAFA 1OZGA 3THYB 5ALFA 2DBVO 5CGZA 4F7WA 1SD2A 5G3ZA 5KVAA 3UGKA 4FBLA 3B1XA 3APQA 5K3FA 1CF4A 2NTNA 4IR7A 4R0VA 3M5CA 3RBAA 3IMGA 9LDTA 2HPZA 1ZIOA 4K7JA 3CPWU 4GNRA 3TNJA 1JVMA 1G21E 4G1UC 3OLXA 3C3AA 1A8SA 1IHDA 5EUQB 1MX3A 4JEHA 4C2AA 2ESRA 3Q6NA 4BQFA 2CCGA 1NL3A 3IXLA 2PY6A 4Q1CA 3IQIX 1EBOA 4GOJA 2WF5A 3VZRA 2XTZA 4X5OA 4JL6A 1TZBA 4RU1A 4XYBA 3VZBA 3DOIA 2XECA 1QFSA 1TA4A 3A1UA 3JQFC 5K20A 3D8UA 3RLFA 4MUYA 2OD7A 4P2BA 1Q11A 3KLNA 1XNRB 1TI7A 5BN3B 1NRIA 4ENPA 2JLRA 1G5PA 1AJPA 4OX9O 2ATXA 4K1XA 3QVJA 3FPAA 1PX0A 4X20B 1VHTA 3GJQA 3E1KA 4QWMA 4DQDA 1XAGA 1GX1A 2JLVA 4PZLA 3RV4A 4LVUA 1XHEA 3CWBH 3URKA 4C6HA 4IFEA 3QLUC 4NCJA 5DNCA 3E8BA 4ZCSA 1RPAA 1NBHA 5DTRA 4RIEA 4A2PA 2O1EA 2ZKIA 5JCJA 2Q21A 2LFRA 1XMVA 1GL6A 1KZYC 4GMFA 3UHJA 3PJRA 2H6EA 4JIGA 4MS4B 1A2BA 1U7HA 3RYIB 1N8RW 1NC1A 4FEAA 1AGNA 1ZXLA 3MGKA 4LMAA 3L1VA 1K8ZB 1Y8CA 3I9MA 1HNNA 5EZSA 1L6IA 3NI2A 5AK3A 1ZKDA 3NC4A 1KH2A 4JB0A 3WNCA 2Q6VA 3S81A 4M89A 4ZAZA 2FN4A 3VBBA 2YXZA 1GQ2A 3NVKE 4WLOA 3K0HA 1JHXA 2WQ7A 4JJAA 1NC3A 1OBVA 2A9RA 4IGFA 4I1UA 1L7OA 2ONCA 1DTOA 4WKBA 4RKRA 3WYEA 1ZD2P 2YV5A 4X8MA 1R3KC 2WMDA 3NC0C 1Y8RB 3KV1A 3MELA 3S4YA 3KZ1E 3RLIA 4EELA 2G17A 1VIBA 2H06A 5I4BA 1Z88A 4URXR 4EEQA 3V8MA 3ZIUA 3OA2A 1N4AA 3WBJA 1TW3A 1K97A 3CTPA 3ABKC 1MX1A 3OT1B 1W40A 2VP3A 4QASA 4R1QA 1G9TA 2IEYA 2VHZA 1SH7A 2WKWA 3TW6A 3U7FB 5FULA 1WZEA 2Y2UA 3SYOA 2QXTA 4OK3A 1YU6A 3GZJA 3DB1A 4WK6A 3G8BA 2BYTA 3VNQA 4E5PA 2HUNA 2H1LA 5AYVA 2CHTA 2NQ8A 4F9FA 2I65A 2FPSA 1PSZA 3BA9A 2J5QA 4NV3A 1DBRA 5EJFA 2BFPA 4RVUA 1UFVA 5CGQB 3GROA 3GELA 2VUHB 1W93A 3I45A 3S3TA 4NIMA 1UJNA 4CIYA 1IDN1 4HBZA 3RFCA 4BO3A 3FAVB 4G9EA 1XTBA 2GFIA 1VF6A 4I2NA 1WMAA 3EHDA 3CLTD 3CPWF 4ZT3A 2R62A 3G9UA 1RVDA 3D54D 5K9ZA 5F3RA 1NTKH 5DNEA 2F3RA 4PVCA 4LTMA 2IYEA 1E4EB 4N54A 1MFPA 1A69A 1KI8A 2VDMB 3SIWA 3UT0A 3GRYA 4Y6OA 5IUJC 3F73A 9ATCA 1DXOA 3I83A 2HMYB 1MO5A 4GVLA 1QKJA 3WMRA 3GLGE 2HS3A 1J5EB 4HEJA 2EKLA 4U6NA 2BMWA 5BMVB 3PHCA 4J4BA 4KHZA 2G0NA 3CCJF 2C99A 3LGAA 1LA2A 3MJRA 1YZYA 4MQUA 3K6SB 1QTNA 3QVOA 3CU5A 4K87A 2NWQA 1PNLA 3T95A 4P82A 1Z38A 1I3CA 1AS0A 1SVNA 1FYEA 1Y3IA 2ZI4A 2FUEA 4XGIA 2QDOA 3TEMA 3V34A 4QUDA 5FR1A 1CUHA 3EVZA 1QTRA 2XVMA 4XIYA 5T6BA 2AMFA 3I5XA 1J39A 4XVCA 4BKOA 1T9CA 5A05A 1CF2O 3ZCPA 1RC8A 4TRRA 2A0XA 3CR8A 4BLQA 5F35A 3GRFA 5EZ5A 1OH7A 2PMPA 2H2DA 3PUHA 5EIWA 5A3JA 2EIXA 2EX4A 1SN7A 4D2IA 5CXQA 3VTAA 4LHYA 4EGQA 4PHTA 4R54A 2RB4A 2P79A 4XASA 1YIAA 2FG5A 4RPCA 3KSRA 1SXJD 2GFHA 5CDUA 3H1KH 4W63A 4X6YA 5CXUA 2IYTA 2OMKA 3T3DA 3A3YA 2G76A 4AYTA 4PAQA 4BUJA 2CD9A 1OX4A 3OD1A 3W5BA 4YUWA 4HBGA 2ZUTA 5IKEA 3H1FA 4LIPD 5DSXA 2JGMA 3Q7QA 4HLQB 4UNSA 3EGIA 2NO0A 1Q0ZA 3C7TA 3IUMA 4A6PA 2P9GA 3QOXA 1NXVA 1SK9A 3RSZA 1XX6A 3P0ZA 4HGNA 2PKCA 3KVOA 2ZE8A 1UDRA 2PZLA 3LPDA 3OZCA 3ELBA 4B73A 3NX4A 1ZQ1A 1B15A 3Q8KA 3Q7TA 1IRXA 5K5EA 4NAHA 3COVA 3IBYA 4FHEA 3F97A 2OK8A 3ND8A 4EPXA 1PTKA 1ISRA 4YRCA 5HFMA 4ANFA 4DV3O 3NBKA 4JA0A 1B0PA 2V74B 1Z22A 3HA5A 3TLGB 4W5NA 4BNIA 3RRBA 5BRAA 2Q07A 4BNZA 2E85A 2ZR9A 4AN4A 4QT4A 1YVEI 4FJCC 5TJHA 2IQQA 1MB9A 3UUWA 4YACA 2RBGA 3WGHA 3D6UA 1A4UA 1YA4A 1DTWB 3WGLA 5T64A 5AJWA 5IF9A 4EB0A 1KE2A 1NLYA 2ZYWX 2J30A 3IR9A 4RMIA 4RO0A 1JILA 3O83A 3S44A 1UAAA 3F90A 4DCTA 3C8UA 1QCDA 4I0XA 3R74A 1R6KA 4N39A 1L7BA 4YJ3B 3HCCA 4TLBA 1N4DA 3EXHB 3CUUA 4QNNA 2GS9A 3L93A 3RTGA 1BD3A 5DYIA 3SZMA 2WSIA 5TNXA 4RSMA 2NUAB 1LBHA 1IQRA 3JQ8A 2NXCA 3IEIA 2L69A 4LYDA 4ARSA 1CRPA 4PDRA 3GZTB 5KYTA 1RLIA 1PHRA 4QG7A 2O0JA 2ERCA 4HV4A 1N3LA 3V8EA 3E9EA 2O0HA 1Z0IA 2C1EA 2PHZA 1XKLA 3I6MA 3FFXA 4QPPA 1UXIA 3S40A 1JYFA 3THXB 1ZD4A 3L8DA 4NFHA 5ALNA 3G79A 4HH4A 2JKZA 3K0FA 5HCNA 3LBIA 1H2WA 2O2CA 5GIPE 3VC2A 3O8QB 5GAPK 4AHCA 5L3EA 3DLCA 4RK4A 4JI4B 4OXNA 1BCCH 3J7AU 4FN4A 1Z6QA 5E7QA 4FYPA 2QM4A 3NATA 3P2EA 3QENA 2PWYA 2QZ4A 4C4TA 3NO4A 1WXHA 1X80B 1V8ZA 3KCXA 3QXGA 4GDFA 5EWMB 1FS5A 1XA0A 3AOEC 4WH0A 3E9QA 1N8NA 1I3NA 1RC1A 3TIVA 1SMKA 3LXUX 4IHJF 4WNAB 3SHOA 1C3XA 4M7PA 4H7DA 4R4JA 1KMHB 1VG0B 2AI2A 4RYDA 3VSBA 4KR2A 1XLTC 2FZKA 3I6ZA 1NVVQ 3Q88A 5FWXA 3VR6H 2JARA 2YVAA 3UAXA 3WL3A 2BGTA 3FWNA 1SCIA 2R47A 3G6BA 4JHXA 1GN9A 1HEYA 5THKA 3GUHA 1G8YA 1RM3A 3ZZ1A 4FOOA 5L3QB 5D87A 2VG8A 2NZ8A 3K1AB 3OZFA 2Y0IA 1PFGA 3OETA 4MXDA 5EMJA 2AW5A 2F43B 3WB9A 4YALA 1TUEB 2GM9A 2UYPA 2YJ6A 3DMDA 2WU8A 4NMMA 2WNIA 1IBKO 3AI7A 2KW5A 3DMNA 3DD1A 4MGEA 3ZHVA 2I2WA 1E2HA 5TQ0A 1YQWA 5EBLC 2HBRA 3I72A 3OIVA 3WKCA 4WKGA 4NQ3A 1JEDA 1TCUA 4E5UA 2J3HA 1WTCA 4OGQB 2DPXA 1VHJA 3ER8A 2O2IA 4ARZB 1Q6YA 4X3MA 1W3EX 5GWXA 1EUQA 5EK0A 2HF8A 4UXNA 3TIXB 4ALLA 3UT6A 3SHVA 2DQ4A 3GT4A 4TKUB 2IEGA 5FI0B 5LA6F 4BEJA 1RJFA 1VLMA 3AUUA 3IQXA 4GPIB 1OFGA 3V1KA 3JYLA 2AMYA 4ZEVA 3ZXIA 3C3WA 1YS7A 3QOYA 2Q3MA 4RVCA 3VR3A 1F20A 4XX0A 3LNMB 4Y2UA 5F1PA 1FXKC 2GBCA 4KPGA 4OBXA 2HF2A 3I55F 1GZ5A 3WLKX 4C03A 5IG2A 2WDPA 4Q7QA 1IZ7A 2GN1A 4NVPA 3QMWA 1YZBA 2E76B 3FETA 5AH0A 3KXKA 3BDVA 2J3KA 5IUNC 2ZJ3A 4R5HA 5J3JA 1CLUA 3G13A 4CTMA 4IQ8A 5IBPA 1B04A 4J0DA 4LYGA 1K2WA 1FFBA 2QTCA 3HP1A 1ORDA 1HOTA 2WT4A 3N8NA 2OM6A 2YZ2A 5IT5A 2QA4F 4A6EA 4DILA 1QGOA 2J3MA 2G9ZA 5CLJA 4FFBA 4IX1A 4LKRA 1HRKA 1W5TA 2ZEJA 2NTVA 4DJTA 3ZQ4A 2E49A 1MDBA 5BMVF 2KG4A 4QYXA 5C1IA 3ANLA 3D1VA 5FPHA 1OHHG 3QWAA 2HA3A 3WKEA 1H47A 3ZIAD 1XQWA 4M99A 3QUBA 2BD0A 2JIMA 2B99A 1T2NA 3SQNA 2WBLC 5CHYA 4WI1A 1A8IA 3GZNA 5K6TA 3LHSA 2QYTA 4B0OA 2BL4A 5CVVA 3M6MD 3BJEA 4UOZA 3RNOA 1PM9A 2OORC 3DZIA 2X86A 3GGPA 1VQLV 3NHWA 4N49A 1ECLA 4AJJA 5LJLA 4TSRA 3TNFA 4IEIA 5B3SB 2QMQA 3AETB 1UFYA 3L0YA 1Z26A 4X84A 5EZQA 4JFAA 2XYVA 2EIHA 1L4NA 1WRBA 4E46A 4O4JB 5FJ4C 4ZTBA 4OGGA 2P06A 5DLPA 4YAUA 1DO0A 2C29D 4JP3A 2SNIE 3MRTA 3BD8A 2R6ZA 5IYZB 1BW9A 2C3PA 3ZWCA 1KPHA 4YB8A 3WZ2A 1MOQA 1I94B 5JZSA 4V3BA 1GFSA 5EC2C 2V45A 5DULA 3WY9A 3OZTA 5EJ9A 4A8HA 4JT9A 2RK3A 4E11A 1FFXB 3KK0A 1SUFA 2XCQA 3KEFA 3HPLC 2ID4A 3B48A 1Z37A 5ALMA 1L7EA 4HVAA 1PJSA 1UQUA 1F3OA 2ERXA 4IMRA 2PFKA 4D3DA 2G40A 3F0TA 3JTEA 3OLZA 2GEJA 2R11A 1O95C 2Z5VA 4N6GA 1VQ4V 5DOVA 4TV8F 4L5BA 4OD0A 1I14A 1PJ4A 5IFKA 1N3IA 3DNFA 3OJLA 2V96A 1P74A 2YCLA 2QRUA 2QJWA 4W4LA 4D41A 2Z9BA 2OCXA 4MV1A 3NHUA 4IXMA 4J7UA 3VU3A 5I01A 3EXG2 4FGLA 5JDIA 5DGDA 3AVUA 4PTZA 3UW3A 1HNXO 3HH8A 4QVGA 3CGWA 3ENWA 5L4LA 3T1HB 1RP3B 2OXIA 5J23A 1NVGA 1JD1A 1ZITA 4MKZA 3HN2A 2H18A 1SC4A 3TL3A 3SZRA 3ORSA 1XLUA 1O94D 4GAEA 3AM1A 2C3YA 3FD6A 1FVHA 2FX2A 2H8GA 3I3OA 5EIHA 1ULHA 1JI0A 1U8YA 5IH3A 3F5QA 2YYAA 5JFOA 4MWBA 2BP7B 1IUOA 3ERNA 1G55A 1EFLA 3MVEA 3DOFA 2W37A 2XUKA 3SSNA 1C80A 3ND7A 5C3MA 4J2TA 4QEKA 2DT4A 4Q9AA 3RIYA 2QMOA 2GA9A 5EJ7A 1SELA 4D5EA 2YS7A 4QLBA 4OM8A 3O73A 2ZITA 2I3GA 4QYWA 1EUYA 1TAEA 5L4NA 2PE5A 4ZI7B 2YS8A 3ZU5A 1M0TA 4YJ3F 1T0UA 1AGRA 1P1HA 3BMNB 4YCDA 4V38A 3NG1A 4JJ7A 3IULA 1JI3A 4CG0A 3CX8A 1UP6A 3S8MA 1CZKA 3LSQA 4U7PB 1MGOA 3I62A 3V1YA 4YDHB 4AAYA 4J4TA 2R7NA 3TD5A 4DJAA 1PS0A 4R71A 1N8SA 5LYJA 3E8XA 5TB5A 3N5KA 5BSUA 4CIDA 2Q67A 5EXXA 1SCUB 1DB3A 4AZ0A 4Q00A 5J9FA 1WUYA 3IXMA 4HTFA 4CG2A 3PTLA 3KR0A 5H3CA 3B9QA 2PMFA 2ARKA 4B3MB 1YDXA 3O75A 3E9NA 1C7RA 3NH9A 2OBXA 2YHUA 1RMTA 2O7SA 3WLIA 4RZ3A 5AVMA 1DKOA 3KYDB 3WAKA 4RC9A 4A6XA 1PTJA 4Y6RA 4Z0NA 3NAQA 3T52A 2HU8A 1AC5A 4YO7A 3QITA 1XZBA 1XZAA 4RX1A 4XJSA 1IVSA 1Y1KE 2KTUA 2JAPA 1MO3A 3VPXA 3TL2A 1T2AA 4H2DA 1QUFA 3PENA 1RHKA 4HNSA 2VRWA 2EZPA 5EJ2A 1CBUA 1JEYB 3P97A 2HKOA 1PS9A 2R86A 1BOFA 3WAGA 7MDHA 1TAUA 3A25A 4D8YA 1FQWA 4G0PA 5EHIA 1UC4B 4K6FA 1SD1A 1V9CA 4XDHA 1E0DA 2WM8A 4NCBA 1XVLA 1G4UR 4DIEA 2FC3A 2F43G 2MSLA 4RK1A 4PS0A 4B09A 2GVZC 4P2GA 4CVNA 3ZNNA 2CZGA 3DHNA 3ZWDA 2DYRC 1NQVA 1PR9A 4YJHB 4BN4A 1RWNA 2XAUA 2E75B 1K8XB 1PJLA 3ZZUA 1NJ8A 2GUZB 2KJQA 3Q0IA 1MB2A 3FNRA 4LXHA 1FXUA 1WD7A 1ZI9A 4WNIA 4IDBA 1EDEA 2E1RA 4GIBA 5LHIA 5DMXA 3K05A 1KI4A 4G2NA 3A1CA 1VRCA 4R8CA 1EFUA 1PYDA 3PA8A 2X8BA 3TLZA 2DQ0A 4BYMA 1ZHHA 5BPHA 3OC6A 3LC1O 5LIPA 2GCOA 1DUIA 1IHXA 2WLLA 3P0FA 2HFJA 3Q9NA 4Q21A 1ZJZA 1XQ6A 4WTOA 2KBFA 4XIIA 3QBTA 5EXEA 2BE7A 2IHVA 3PQ7A 3OLYA 5IVPA 4PSCA 1UK8A 5JSHA 2C83A 2DJIA 1NNI1 3X1MA 2R65A 4CMIA 1C3LA 3KTOA 2RQ6A 2JI8A 5E4TA 1SDSA 4ZP1A 3GC6A 1YI2V 3AW9A 3I0MA 5DDIP 1KBHA 4JL5A 2J9FA 1BS9A 2B4YA 4YHHB 1PZHA 2BTUA 4DZZA 4NBLA 2C9DA 1BL8A 4AQYO 1UZAA 1LUVA 4FLXA 4II7A 3AGPA 4MZDA 3PXUA 1CJBA 5E1OA 1GPJA 4L6CA 5HK9A 3J7AC 4H3KB 1FUUA 2PUGA 1SZPA 1VTKA 4RELA 1T3GA 3IAXA 3S1LA 1SZDA 2A30A 3AVQA 2CJXA 3MWDA 3OKAA 1R6NA 1UJ4A 5KQMA 2B8JA 1R6XA 3A6HA 1AV7A 3MHHC 1Y1SA 4J4HA 2RKOA 4E30A 5L6LB 4FLFA 5HJ7A 5JALA 4RMHA 1K6JA 3ASUA 2GSWA 1EKXA 1JTFA 4UJ3A 3VU8A 4G0NA 1ORQC 5LBTA 1VL6A 2X2OA 1LSOA 3FUWA 2UUPA 2JLYA 4GU5A 4Y0AA 3CC2F 4G0WA 5DGTA 5JMOA 5A5FA 3UAOA 2X8WA 3QU2A 2OILA 5LXTA 1YAJA 3NBUA 1E32A 3UENA 1PJQA 1H66A 5AESA 1YRWA 1JKFA 1BRTA 1TVEA 4O5AA 2BOVA 1R8YA 2ETVA 3IKEA 1QB8A 4DLYA 3O90A 4ZCIA 4RTMA 5LDHA 3ROPA 4PQRA 5IY5C 4EGSA 2XITA 4AIRA 3H9CA 4LXUA 2GLUA 1NJFA 3QE4A 5T3UA 1NBOA 3MJSA 3HC7A 4X65B 4ZOBA 1JE1A 4CFSA 2OHHA 2JBHA 1JR6A 5C1PA 1P3JA 4WUTA 5JRJA 1MRZA 4IX9A 5KC9A 1UEJA 3UMBA 3AHDA 3UH1A 1P1JA 3LXXA 3UWPA 3OPQA 2X3FA 1YE8A 1RADA 3GCDA 3T7KA 1L4BA 5JSFA 4TLAA 4DIOA 4UFNA 3U0ZA 4DHEA 2W8BA 1WUJS 2OO5C 4D7TA 1SB8A 2X22A 5LP6C 5HTKA 4YRQA 2XYRA 5IDVA 1E3LA 1F1JA 4YQEA 3ZCSA 1H2XA 3OIDA 4FQ8A 4EPRA 4AKEA 4XWGA 3O84A 4U2CA 2FPKA 4DMUB 3L02A 5IC5A 2W7TA 2L42A 3OECA 4N01A 3HM9A 4MS1B 4RIFA 2PJZA 2H5EA 2FVXA 4X9XA 2YWGA 3D9QX 4NHOA 2YJNA 4L4YA 3Q0TA 3TL6A 4CL0A 2DHCA 1GU7A 4F21A 2XUFA 3HY4A 3HHEA 2JJ1G 1GKKA 5DW0A 3QG5A 1UZNA 4DZTA 3W2FA 1G20B 4PY2A 3ZWWA 3H01A 2I8LA 1YKFA 3FNBA 1R9NA 3D0OA 2HO4A 3ZV4A 3OUTA 3QU9A 3QK7A 1LVUA 1SG0A 1KZHA 1JEEA 1FFYA 3INTA 2WJAA 2A67A 4JASB 1NT2B 4CL3A 3ZI0A 2R1VA 2BZ1A 3TLCA 2N05A 3NDPA 3ON5A 3PC8C 3I5AA 3WRWA 3R5FA 2XB9A 3PCXA 1XL0A 1ZUIA 5COBA 1DC8A 4INZA 2TMKA 4WACA 2WQZA 1SC1A 2LGQA 3IR5A 4TVBA 2V4UA 1PVDA 1DQYA 2XUPA 1CUDA 1D0VA 4DR7O 1PFVA 1PHPA 2Q5QA 3VR5H 3C3DA 2H8EA 3A4MA 1WB5A 4XQGA 4DGQA 2XXAA 3EUAA 2JJYA 4TLLB 1NPYA 4HRVA 3CRVA 3HB5X 3K4PA 2VDVE 1OREA 4M9RA 3V1NA 3CJTA 4FMCB 4DCNA 4ARCA 3KFLA 3LWOC 1UJ6A 2NU7A 2A1TR 5EWRA 5AJHA 4E5DA 2RC6A 3U17A 3KAQA 4O1HA 1BXRA 2FKAA 3K73O 4EW3A 4BFSA 2Q2QA 3D6VA 4KRXA 2OG2A 4LJ8A 3ZNOA 1R0XA 1X42A 1ZUNB 5IN4A 1N5RA 2WI8A 1CY1A 3MAAC 1EWKA 1WUTA 1DOZA 2XUGA 2VOEA 1KS9A 4J7JA 2RK4A 3EWSA 3FTQA 4IUCS 4PLZA 4DA8A 3THWA 1MDFA 3AHJA 3NHMA 2UKDA 4YXWD 4NTYA 1ZRNA 4ZVNA 4EDFA 2OCKA 1JHZA 1F5NA 4PF1A 2HG5C 3Q3VA 4S3MA 1RWQA 1HW7A 3SJCA 4K9SA 4CU2A 3DVQX 5I9SA 4BNNA 5GINE 2YV4A 1P2GA 3WLFA 2V4DA 4RSGA 2FK8A 2POCA 4KFRA 1ZD3A 4WZ6A 4MSUA 1U5AA 4RKYA 2Z0MA 4M9UA 3SXPA 3LLUA 4P35A 2DWOA 3WGIA 4MQLA 2JK1A 3I92A 2C2MA 4BTVA 3R8FA 4YMIA 1YQDA 2Y0BA 4K40A 1IZ8A 1Y48E 3B51X 2GZ2A 5DM70 1NBME 4YQFA 1N36O 1RLOA 1SXQA 5KOHB 4OHOA 5AKGA 1X1BA 1Q0SA 3CNLA 3ET5A 4UM5A 5HSGA 2Q0OC 1IOZA 2Q3FA 3QG1A 4UE6A 4MVYA 2J9YB 3N0WA 1WXDA 4PPNA 1GTVA 2CV2A 3NJ8A 1SQXH 2QHXA 5LVAA 2D59A 1L7XA 1XZIA 3I9V6 4B83A 5CDGA 3IV6A 3ZQJA 4PAOA 1HTWA 4M9QA 4DBZA 5BY1A 3O4JA 2Z1MA 5K4GA 2WK1A 2XI4A 1U3PA 1FUIA 4D4HA 3WYGA 2W4IA 1E2EA 2RHRA 1JG6A 5DN6A 5C8XA 1B06A 1ODSA 5K8TA 1UOPA 1F6BA 3V7FA 5KMGB 1VHAA 5KVSA 3BT7A 1NI4B 4JKOA 2P9JA 5KX5A 1VMKA 4RXUA 2H4XA 1NBMD 3OJ0A 4GKBA 4EFMA 1YGYA 3OLQA 4C04A 4Z3KA 3OFVA 5EKUA 4G26A 5DM1A 3LQ2A 5DBEX 3TTSA 1M5UA 5MN6A 1XG5A 5ED4A 3K72B 4Z4GA 1PNMA 1LZLA 1JT2A 2Q2OA 1H2SB 3IUEA 3NNNA 4K2AA 4GBGA 4LV6A 4WFIA 2CWDA 4BX2A 5FAKA 3OCWA 2VFAA 2J4DA 2QDKA 1NXOA 1CVLA 3V97A 3O1LA 3NVKI 1V2GA 3DEKA 3K5OA 2PYJA 3IO5A 4G1CA 3H6HA 2GILA 4Y8VA 2CXHA 2VH1A 1I10A 1WEKA 3X2SA 1RQLA 4HDNB 3C3XA 2GLZA 2YFYA 3FKSG 5KZMB 2JFXA 4KXVA 5G0TA 3O94A 4QGHA 3MYYA 4IL6Z 4AROA 3L1KA 2N47A 3HXMA 1W2HA 1PRYA 5L51A 1S72F 3FRHA 1V8OA 4CMHA 1FX1A 2HMWA 1CP2A 2V8OA 4UVCA 3DZJA 3A14A 4UV9A 3QKIA 1R1DA 5AM1A 5K0NA 1BQ4A 5BOVA 1I7DA 5F5LA 2ZM6O 2C96A 3DKKA 1NU1H 3DL0A 5TRTA 4CMEA 2OYQA 3GVCA 5FOSA 2VYND 1NW4A 3AG3B 1H0HA 2UXXA 3O95A 4JLWA 2B1RA 1LI7A 4M8IA 1E7WA 4YDRA 4EFDA 2A6PA 4G5XA 1MAVA 1BFDA 2XAQA 4RD4A 2BGMA 3O8OA 4FKMA 2EJRA 2DFLA 4J2OA 2UUOA 2A5DA 1SCKA 4JI8O 4MWZA 3DO8A 2JZNA 1H85A 3LNNA 4K9QA 1S8NA 2A06H 2WWWA 3EH2A 1F9EA 1Z8DA 2Q6KA 5B30A 3EVTA 4AZWA 4ZT5A 4ZOLF 1L0BA 3B5IA 2QTHA 3QKSB 1CJMA 1IZYA 3C1UA 1J21A 2NVWA 4V1CI 4PZEA 1GA6A 2F62A 1WXXA 4BBZA 4IZIA 1XBLA 2IOHA 3FBWA 2GH1A 5JQWA 1V16B 3HO1A 1ICIA 3A58B 3T2MA 1N6RA 2JIOA 3LFUA 2AFIA 1VMIA 3JD3A 4ABYA 3LZCA 4F6EA 5CT8A 1BU8A 2Q73A 2NSYA 5AOVA 3HN6A 4A1OA 1IXKA 3PS9A 4I3FA 2QW1A 2CFSA 3QKUA 5LNK6 5GIOE 3O5AA 4XB1A 2D2CB 4IDFA 1NJ2A 5EMMA 3SI7A 3EZYA 5REQB 4K05A 4AP5A 1TIBA 1QYXA 3S2GA 3GJYA 2H2WA 2ZWOA 4QECA 4LJSA 3K59A 3ONEA 4QBFA 1NBAA 2V98A 4MVJI 3A3KA 3VH4A 2HO5A 3I0ZA 4GX2A 2VAVA 1BWRA 5GZ6A 1C29B 1CUEA 3OX4A 3ROFA 3ITKA 2HH9A 2H57A 4NNJA 3NXKA 3P27A 4W9RA 2J09A 4C8GA 3SDLA 4Q9LA 1J1ZA 1U99A 5F4ZA 5D3ZA 2Z1NA 3CUWA 1QCEA 3NWEA 1JSXA 2FKXA 2VA9A 2BY4A 4RE6A 3NDJA 2VSXA 1M1UA 2EXXA 1EUCB 5DEOA 2FRDC 2OHGA 1L4HA 1A0OA 1CWUA 3T3IA 3I9LA 1KYYA 3U11A 3FUTA 4CIWA 3SLGA 4CT5A 4DTCA 1IZ3A 3AIOA 3EPPA 5DXJA 1ZKMA 3QLJA 1BKYA 3FIUA 2QUZA 4OBBA 1JFSA 1NW5A 4JJ4A 1L7NA 2AOUA 3KQLA 4DCOA 3FLMA 4UAJA 4YO8A 5KTRA 3IBSA 1JQBA 2I5PO 2HCBA 4OUKX 1K4KA 4RKEA 1II8A 4R7TA 1U81A 5FL7G 1WDLA 3TQQA 1H1DA 3EA5A 4WV3A 3GFBA 3OTQA 1VE7A 3CC7F 4DV7B 2H08A 3HJRA 1T8PA 1B2LA 2YICA 3MHTA 4G0MA 1ZD1A 2C4NA 1FTSA 5TPWB 1SIUA 4LE0A 2PBRA 4CMGA 1KMMA 4KWTA 3WLQA 1TF2A 4O59O 4BS9A 3WIVA 3T3HA 2GBGA 3Q7IA 3LECA 3CBQA 2D7DA 4X89A 4WGFA 2VRNA 1CDEA 3BRWA 5ILGA 3AUFA 1CIVA 3ZHQA 3QVGB 4M9CA 4GYCB 1Q74A 4LE1A 4X64B 2CNOA 1QH0A 2HTEA 3RBZA 1V11B 4YBZA 2YNMD 4C1NA 3L0BA 2P2SA 1RA4A 3DZCA 3DZHA 3DKVA 4UC0A 3ETQA 3SYRA 1OX6A 4N23A 4ENRA 1PNQA 2XR1A 3V8NA 5BSRA 4CR6A 3I37X 3K2BA 1XZHA 1T2UA 2XX3A 4GPD1 2F23A 5CG1A 3MF4A 1JJAA 5JW6A 2WIFA 5L3SA 5CAEA 3SFVA 3PKJA 2RBEA 2YWDA 1GN4A 1RQ2A 1R6AA 2PU5A 2FK7A 3MJDA 1E3WB 3QLEA 3B6JA 3RA6A 4JS0A 3IVCA 5HXZA 2XNKA 5CXXA 2Q3CA 2G4LA 1OPXA 4BP9A 1VK3A 1P8AA 1EG7A 4R9UC 2VZEA 1NFQA 2SICE 1RHJA 3BD6A 1I2DA 1WABA 4ILKA 4K9NA 2IIVA 1YQGA 4WFAV 4IYRA 2HA0A 4ZVTA 3KZCA 1XZQA 3AEUB 4ZI5A 3EDMA 5I3CA 4JYAB 4ZZIA 4H44B 1XF1A 1DCFA 1I0HA 1ACLA 3DKPA 4M3NA 4DCSA 4RORA 4MTLA 2A5JA 4U7DA 1Z7WA 2B8TA 1RR6A 4P54A 1RWWA 4GLFA 3IJEB 1E66A 2XB6A 2JI9A 4KRGA 3NT2A 4EABA 2AOTA 4U5QA 3GPIA 4MWDA 3GQBB 2XKJE 5BOSB 1JB9A 1H6CA 1R7RA 3BB3A 1IZ9A 4Y2YA 4KB5A 4XQEA 4RY0A 3LIIA 2CE2X 2O07A 1KP9A 2ZROA 4RQAA 1S5HC 1LQUA 2NZYA 1UBOS 1V8DA 3A04A 2GD2A 2VWJA 1KEVA 3B2EE 1G2IA 5HWSA 5IULC 2QD4A 3TQOA 2V5VA 3VYWA 1SZQA 5A6SB 1QNLA 4LQ4A 3O9OA 3UMSA 2G04A 1D1TA 4L8JA 4Q1AA 4LF4O 3LDHA 2XASA 3QA9A 3UN1A 3ZHCA 4YYZA 2P9ZA 5L3CA 3OSZA 3OQNA 5I9MA 3L4BC 3QHQA 3CMEF 2BUBA 3S6JA 2BOCC 3HWSA 4R1LA 4X6XA 3EPRA 3CLTC 2OZEA 1PPJH 1CRZA 2WT9A 3LV8A 1S8FA 3CRW1 2I2CA 3ORYA 1SCAA 1ZH2A 4PGHA 1Q95A 1A71A 1IG3A 2EILC 3FZYA 2CTRA 2R00C 1EFRA 1PGJA 1U6KA 4NJOA 3DNPA 2P5OA 2PSHA 2PRIA 2WU4A 2DH6A 2GQ0A 1K8QA 3R7WA 2BFWA 1HNWO 4Y2JA 3V80A 4B7UA 4X93A 3RK0A 1UJ2A 4AUKA 1Q0LA 2CV0A 2GCEA 3D64A 4NZ9A 3CLHA 4D0GA 4PLCA 4NZMA 4IHJB 3UC9A 4FW9A 5F5NA 2CNWA 3UK2A 4L7VA 2H1SA 3BKWA 1JT9A 1OJLA 1J09A 1EGHA 4IDPA 2P5SA 1V1RB 3U3XA 2GPWA 5A5EA 5ELLA 3INRA 3UGQA 2C82A 3I3SR 4OAQA 3ABRB 3DFMA 3RFVA 5DYWA 1BGXT 3JQEA 4OA5A 2ARHA 3OM3B 5ILOA 1YS1X 3T5PA 1DXQA 1N0HA 2FSSA 3E81A 4J7CA 5C5CA 4ACBA 4FLZA 3AFGA 3AVWA 1UM9A 4LJ4A 2FSUA 1CR0A 2JHGA 2WHXA 2CXQA 2FOIA 2DERA 1EFHA 4C2UA 4Q18A 4RAOA 2XEDA 3OQPA 3QIAA 2BOBC 4KYVA 1E2KA 5HIIA 4BEBA 5GOZA 3ZE0B 3IR7A 1CT9A 1U4SA 1V25A 4JQSA 1W88A 1U8AA 3X1DA 1Q3TA 3ZH9B 2W90A 1LNQA 2I6RA 1S02A 4AP6A 4NZPA 3HU2A 4QO8A 2Z2KA 4L22A 5DPMA 3WK9A 1SXJC 1UPTA 3O4IA 1XQYA 2ILTA 1RMQA 4R01A 3F4BA 2G83A 3EWNA 2JK5C 1E7RA 3G4SV 1T4DA 4YCCA 2WLKA 3CCVF 2VDOB 2PZGA 2OZPA 2C9BA 4CM8A 3FPBA 2IUFA 3GB7C 4QU0A 2DYRB 4F3TA 1MBZA 4IGEA 3S0YA 2MYUA 3TNLA 5LA6B 3Q41A 4B3GA 1RYBA 3LSTA 1MB3A 1MA3A 3DG9A 5B1DA 3V5NA 1WQ3A 5HHTA 1E5LA 1ZM2A 2EW2A 3OMAB 2ZWPA 5DX8A 3ZE2B 3KHNA 4E2WA 4AJNA 1KYXA 1X14A 2H1RA 3S2UA 2W2XA 1H3FA 1PJZA 4LFAB 2Y67A 5T41A 1X1EA 1ZVKA 1NQAO 2WM3A 4X8AA 4DG5A 1M0WA 2AMVA 4YJGB 1CY7A 4AWAA 4TVOA 5B7QA 2Y6UA 1CJTC 2ZVYA 3WFJA 3ZCRA 2H1HA 1ABEA 4DUZB 3EVFA 2AMTA 3RI3A 4FZJA 3FXAA 3DAHA 4Z53A 1KR2A 3GLFA 2JI4A 3U9SA 1RCTE 4YUXA 4H60A 3VXKA 2JNBA 3DXYA 4G1VA 1VKZA 1AJEA 2GEVA 3LLSA 4DFDA 2GZMA 2C2GA 3CXRA 4J0IA 4KLNA 2GYYA 4IIGA 1X2BA 3LUPA 5C1BA 4DMFA 5JAZA 1J42A 1M72A 2J33A 4BMXA 1VMAA 4FX5A 2I4NA 2WFAA 1OV6A 2ODBA 2WG0A 1JLSA 3C8DA 1XVTA 1CUFA 1O8BA 4HB4A 3RUPA 1GDTA 3S8YA 3UK7A 4MVJE 4ATNA 1G60A 2GJKA 3B7GA 4CEJA 2B5OA 4ZT7A 3AEXA 4JMLA 5KHLB 3JSNA 2FWNA 2Y1EA 2Z1FA 2CLDX 3OR7C 1H1LA 3I1JA 4QA9A 1B0ZA 3CZ9A 1QGUB 3VYRB 3JQAB 3TW4A 1Y3HA 1I9CA 1BT8A 1AE1A 1C7QA 2FN9A 2OHOA 1ZD9A 5C4MA 1S89A 1X0VA 1YDMA 2ZT6A 4B3IA 1VFNA 2O6HA 3DLBA 3A0BZ 3HXOA 3D7KA 3FHJA 2C2WA 4JPRA 3PIDA 4XSHA 2KSQA 2BR5A 4Z3OA 1RHUA 4XIGS 3DMYA 1II0A 4BTEA 2WIGA 3MN1A 1Z0UA 5JMPA 4CQJA 1XNGA 5AVWA 5IT9N 1VL1A 4JUIA 2WWXA 1HBJA 4KL1A 4IIXA 3LWNA 4X7BA 3FFMA 4IF4A 1FQOA 4NFSA 2QWPB 2N1BA 2WYUA 1W42A 4DQUA 4OQMA 1QQBA 5F7ZA 4RTOA 2VT7A 5DHQA 3FFAA 3NH6A 4ZEXA 1B16A 2ZDQA 3WLOA 1CG6A 3STVA 3IALA 2GM3A 4CIXA 4PZPA 5DGCA 2PX2A 4GECA 1NG9A 3HDGA 4CLOA 4FZRA 3DMTA 2ONKA 5BV7A 1EK1A 2VDLB 4C21A 1FYFA 1W76A 1BH2A 3GBVA 1YA6A 1FDVA 2LIVA 1XKTA 3LPMA 4PG7A 1QH9A 4UUQA 1VCHA 1DDOA 1HLGA 1D7OA 2QE7D 4V3CA 1CK2A 1WCIB 3II6X 3RAJA 1AVTA 2W6ZA 4KLAA 1VG8A 3CLUD 4TV8B 4ASUA 4MQEA 5M7EA 3CEMA 1K7DA 4QJ5A 4PTLA 2ZTSA 3JALB 3J7AR 3DQQA 4JCCA 2Y0EA 4WXRA 3A6DA 1VSUA 3L8HA 5D5PA 1T1SA 1DGQA 1JPJA 4UDNA 3OE7A 3OHMA 3DT6A 3E48A 2YZNA 4HLUC 4P7FA 1NJGA 1LUAA 2IXFA 3TCUA 4QIWF 1TCCA 1YA8A 2OBBA 1ADGA 5TR9A 4QE3A 3BSSA 4B6QA 3L0ZA 4CBCA 2KLBA 4G8DA 3P9XA 4HN4B 4M6WA 3LC7O 1IL0A 5GIPC 3HFSA 3IGAC 4NYKA 1NNLA 1BHAA 4ZZ2A 1CN7A 3MT7A 4NBKA 3LK6A 3HTXA 4AMVA 2XTAA 3HKEA 2EJBA 1J5PA 2XKAA 4ZO6A 4AN0A 4KV7A 1NE2A 3I5YA 1LTHR 1M2KA 1Z6TA 4HD8A 3HR4A 2Z01A 1VDMA 3HKBA 1D2RA 2CL0X 1KFBB 1QOZA 1QHFA 2Y66A 5ALLA 1N2CE 2KI5A 3N8KA 3KNZA 1VSTA 3PE4A 4ZHYB 4AJEA 2ORVA 4LMBA 4EAAA 4OQDA 3SU8A 5ENVA 1SQGA 4N5DA 3F3MA 3CCRV 3CISA 4ZYVA 2Q4DA 4HDSB 4HUQB 2C4VA 5K1XA 1PEKE 2PSDA 1MUUA 2V6BA 4NRDA 2FETA 4NKGB 4TLMB 4DT1A 4GXNA 3P3PA 2JS3A 5E7JA 1PUJA 4BLTA 2CTQA 4HLNA 2GBOA 2YVQA 3PC4A 4UARA 5HKKA 3L0PA 3G9QA 5BUQA 4DG8A 3G71F 3LVBA 3OHSX 4LMPA 4O63O 2Z3WA 1XZNA 1NMSA 2EATA 4TRMA 3OX1A 4F6RB 4A5UB 2L17A 2XOEA 1N7JA 2WD8A 3CC4F 3C14C 5AWFC 3KTDA 3O1JC 3AR4A 2AC2A 1VQ8V 4G09A 2IOFK 1IOLA 1ZONA 3EH1A 5F1OA 4MPDA 1CQJB 4G5HA 3OCJA 1PK8A 4CKYA 5FLKA 4KXLA 1LEHA 1LRLA 3L7DA 3S3WA 1W57A 1GAEO 1QKKA 4BMSA 2W42A 1BJTA 1JU4A 2WU3A 3P2MA 3TZBA 2EJCA 2PLRA 1K1EA 3FZGA 2Q8QA 3ORFA 5LU9A 1N0WA 1PDOA 2RHBA 2WJ4A 1SVUA 3P0JA 1RRFA 2OZVA 1DG9A 3GJRA 3F1LA 4LWSB 3SPCA 1QHXA 4L6IA 1IURA 3WMGA 5ICSA 3PFWO 5BWOA 4BVKA 1IN4A 5JZOA 3JQBA 2CYAA 5KSOA 4KXNA 5JLAA 1XCMA 4GP7A 1J7JA 1BQ0A 2Z83A 2XAJA 6AT1A 2QM0A 2WLJA 5TXGA 1PUIA 3OZWA 1UBCA 1J0CA 4RIHA 4P9NA 4EGJA 3I2IA 1QF7A 4HS4A 4QUJA 4YAFA 5A4IS 1Z29A 5EJAA 3E2PA 4EHDA 5IX8A 3F5FA 3ICPA 4C0SA 1UKEA 1QAHA 4URHA 1LRKA 3KQHA 1SU4A 5ALUA 3KR1A 3GI1A 5THXA 1L1QA 3UW1A 4M53A 1YIJV 3NEYA 2ZTMA 2XRYA 1WCV1 2FDRA 1BGVA 2E3JA 1DIOB 2AYZA 3DF7A 1KH1A 4TYNA 1QTQA 3L6RA 1JKXA 4Q9NA 3OBYA 4TXNA 4JUAA 2I78A 4OMUA 4P4UA 1HY3A 2INGX 3G2LA 4EPWA 1VQ5V 2RGXA 4B7ZA 4O4HA 2D7CA 2P5YA 4BVJA 1IUNA 1QVGU 2VDWB 1FB5A 3IRUA 1DQSA 2ODAA 1D8TA 1T3TA 5LL6Y 5SZJA 4N5NA 1OIXA 3OGCC 2AS0A 2J07A 1DJMA 3WKBA 2XBLA 1ZH0A 1TK3A 4GPTA 3GLHE 3DTVB 4UU7A 1P29A 4A73A 2BSQA 2VJOA 2MYPA 3I04M 1ESDA 4IIJF 1ISMA 4DR1B 4B7AA 1JPVA 4G84A 1ZC3A 4R3NA 3VA7A 1QV9A 3I9OA 4QXRA 2B36A 5CFMA 4D3ZA 4FLMA 3K9HA 1XKXA 2I7TA 4IWYA 1DO8A 2XB8A 1EA5A 2Z9DA 4FCWA 5C3UA 3GXBA 3MT0A 4RVNA 4UCFA 1E1MA 2YXEA 3EF0A 1EIWA 1VCOA 4O0LA 1I1HA 1OFUA 3OIYA 1TX4B 5JZVA 2ZR3A 2V4ZA 3VQWA 2MYNA 1BVUA 2PFSA 1BDIA 3AF4A 1N6IA 4RDXA 4D46A 3DOCA 2GCIA 5H4GA 4EHNA 2HWXA 3BCSA 1UPCA 1E0AA 3P5SA 3JCMM 3ZMSA 1A1VA 1GZUA 3V7WA 1O94C 2C9CA 4PLWA 2ISSD 2Q99A 1R4AA 3UJCA 3OQIA 5AD1A 1W5FA 1UK6A 3T9DA 3CG6A 4HZGA 1N9ZA 1M2JA 1AK9A 3IAHA 4YIPA 4HQNA 1P6XA 2ZIOA 1B4DA 4MEJA 2W2OA 3A6KA 3ELWA 1ZAUA 4O4LF 4ITRC 4BRWA 2H7CA 3N2KB 4QODA 5BWMA 4RL4A 5F7XA 3C39A 2AR9A 4NFLA 1T26A 1AXGA 3C98A 4HDKA 5K6AA 5D3QA 3WBFA 3K1TA 4RS4A 5IANA 4YRBA 4QG3A 4ZVQA 4URWR 1XRLA 4WW0A 4UNRA 1QANA 3GZ4A 2HMAA 1X8XA 3MSCA 1YJNV 1Z5ZA 1W4AA 1U98A 4MICA 1QHYA 2YHIB 3WKDA 4GKJO 3GGSA 5TGDA 4RPGA 5F77A 4M76B 1O3YA 2HLDA 2HV9A 3FOZA 2CLHB 4JLKA 4AP9A 2OV1A 1IV4A 4YYEA 2WUDA 3UB4A 3QKRA 1XA4A 1XFAA 2YVLA 4NYIR 2JRLA 4M8NE 4HNTA 4DR6B 2JAWA 2BFNA 3WHPA 3ASOC 3RB8A 4C6TB 4B74A 1J4AA 4ISBA 2UZ4A 5J2UA 2C9MA 3HCRA 3AUSA 5J4LA 4M7OA 4CKEA 3U48A 4WBSA 2P4HX 1AH2A 4HGRA 4EFNA 1VMDA 5EMLA 1NKSA 1QVGF 4KKVA 4R98A 1YACA 1CCWA 3L6DA 4O29A 3H11B 4GUNA 3P2YA 3PRHA 4RVOA 1VCNA 3HLTA 4NMXB 5BPFA 1YH3A 1VLLA 3DR5A 1IU9A 1ST3A 5BYJA 2EFHB 3L1IA 5LP6F 4PYNA 2WHPB 2EERA 2BKUA 3H5NA 1I2BA 1W75A 2RAUA 1EHCA 2JJ2G 4DRXB 1SA0A 4C7JA 5KPJA 1U1GA 2J48A 4Y2XA 1Q91A 1BE6A 2VSFA 4PLPA 4TMXA 1E6MA 5CFQA 4HZUB 3V32A 3PLAE 4JLDA 4YAGA 3NBQA 1WPQA 2RAPA 1RS0A 1P4AA 3OPVA 3D2BA 3DOJA 3D3WA 5DV9A 2BGRA 5ANRB 4MTGA 4G63A 1JHPA 3E1YA 2OBMA 3CZCA 4YS6A 2SCUB 5I8ZA 3UYKA 3SQMA 1NN3A 1A27A 4C4PA 4LE2A 1JIUA 1M6WA 4ND8A 2JGDA 5B1BC 1ZGCA 4A0QA 1WG8A 3BWMA 3R9IA 3VH2A 1LTQA 5HFLA 3JXEA 1TAQA 1EDOA 2QR4A 1A97A 3NTXA 1BEEA 1IBCA 5IJ9B 4F4LA 4MJ7A 2V7WA 2VWQA 3G8CA 4OATA 2GERA 2VQ6A 4C7XA 1K88A 1DQPA 4IS2A 1Z9BA 2DWUA 2PGIA 2FJ0A 2C5EA 4OP1A 3WU2Z 3HR0A 2WWIA 4QGPA 5SYNA 4M21A 2VTVA 1YF3A 2SECE 1FRQA 4KUGA 1BRMA 2W6NA 3BEOA 4RH3A 2DX7A 4GYKA 5I5EA 2Y9MB 3TLMA 4LDPA 1SQ5A 4MR7A 3VJRA 4IMIB 2W2QA 1PZEA 4O6VA 1ZXXA 3WLHA 2QTSA 1TU0A 1VQMF 1HXHA 1P5FA 4M1KA 1HE4A 4WXPA 2R6JA 3BWBA 2OQIA 1ESZA 3RUCA 3RAPR 4QFCA 1HR0B 2DMXA 1I7PA 1V5EA 3T4XA 3WGTA 3D1JA 1L8LA 3KOXA 2CNDA 1AQLA 3V42A 4M88A 1TA0A 1J8DA 3SGIA 1S4QA 2W2KB 3W6ZA 4MV9A 5CA0F 2L26A 3OIWA 3UJ9A 2WKRA 1DEHA 3LXMA 1G66A 1TIKA 4WA8A 1KXJA 1G3RA 1S8OA 2QTLA 2CGEA 3A4YA 4JXJA 3T80A 1Q3KA 4MV6A 4TXMA 2A4MA 2E6KA 2EGGA 4C0JA 4IGAA 1OBFO 4LDQA 1DIBA 2RB9A 1CE8A 1FZTA 4IQ4A 2VCYA 2AI1A 3OCVA 2WJ6A 1DKLA 3GJXC 4X8LA 3RC7A 4N65A 4HPJB 3CCEF 1U8EA 3EG9A 2AZ2A 4Z4HA 4AFNA 3FB5C 1U0OC 3V8BA 1U7OA 4I0WB 4GDMA 5GVRA 2FNAA 1Q7TA 4KITB 2C94A 4C06A 1SQFA 2H2IA 3TOZA 2XWBF 4HWSA 2OD9A 5JCOC 2P7HA 2XXBA 3VKUA 1RQ7A 1OXSC 3SPJA 4B5LA 4RENA 4B44A 4KQEA 3KD3A 2HP3A 3BC1A 2WIKA 5GGXA 1OX5A 3QSYA 3VOUA 2A7XA 2ZIWB 4ESOA 4A6DA 1D07A 1FTYA 2DHEA 5IDWA 1S2DA 2AHRA 3I64A 3SS8A 4MO9A 2O06A 3RO7A 1PJ8A 5FUXA 3PFKA 4F56A 1PL6A 2NLJC 4JI5B 3ZN0A 2EILB 4AS1A 1BVHA 3IQDB 3K92A 4FGKA 1ZZGA 4D9FA 2BO1A 1ZMRA 2Y1LA 4Q16A 4ETNA 2PYIA 4G5GA 1CY2A 5C5DA 1ZU4A 3ZY4A 1SUIA 3IE1A 3QWFA 1UK9A 2YDXA 2BSXA 1XMJA 4Z99A 4BMOB 4JYZA 1XDUA 1KJZA 1VYUA 4TXJA 2NO6A 2A0LA 2BGNA 2JFHA 3R6WA 3KSDO 3ETDA 1XTZA 3FOBA 4KP7A 1FP7A 1XDCA 4I9FA 2A7QA 3RRZA 2UZHA 5KKNB 3ES9A 4TZKA 4WASA 1U3DA 1S9DA 3AY0A 2QTZA 1CEXA 2Y4TA 4LZOA 3DYVA 3I30X 4LWQA 1X70A 1LLQA 5ULLA 3QX7A 4BASA 3DUWA 1HLPA 1V47A 1LS6A 2CSLA 2WE8A 1N9GB 4JH0A 1JU3A 3EA0A 4CU5A 2PTGA 4ZOLB 4FR2A 5IT4A 4MLZA 5B5SA 4M1TA 5A0VA 4JOCA 1ZZEA 4AURA 1CUVA 1N5OX 2DOKA 1XOUA 1X7ZA 2A9KA 4GP9A 4LGYA 1HV8A 4O3MA 2WYIA 5CBHA 1PG2A 4ECEA 2QP4A 3ZEAA 2GPBA 1SXJB 3IAM1 2BRUC 2XCTB 1ZOLA 3WGUA 4KAAA 3L01A 1F6DA 2X41A 3CURA 1Z28A 2IYLD 4G4GA 4YCSA 3ABKB 1EVKA 3CYFA 4K26A 4BV2A 4H6VA 3GNQA 3C7KA 3LW8A 3S2EA 1GO1A 3VO9A 1Y67A 1U1EA 1PGOA 2HRQA 2ORYA 2V7QA 2JIZD 3WP1B 4F8EA 4LYEA 2ZU6A 2DU8A 4X94A 2A5LA 4Z0PA 1O03A 1CFZA 1B74A 1F12A 1M6VB 3MRXA 5HQTA 5A03A 1EXMA 1SOMA 4CMKA 3C74A 3SKYA 2H2HA 2VS0A 2VJYA 2KSDA 4G0ZA 1OXUA 2GAJA 2UZ3A 1AK2A 1FPMA 4MGZR 4TUYA 1EWVA 2V7BA 3HBJA 1NRJB 2DQKA 5B7PA 2PS9A 1U02A 3T1YO 3QTTA 1HT2E 3Q3IA 1ARZA 3ANYB 1JYSA 4AS3A 2HD4A 3SM3A 1U0NA 1BE1A 1L6RA 2B6NA 4L4SA 4Y98A 1WUHS 3FCSB 5EERA 4W1QA 2YOGA 2GSMB 1B6GA 2GOYA 4NTZA 5AI0A 3O9MA 1FY2A 2JL1A 4WOPA 2WE7A 1PJBA 4G67A 3KQYA 5LZ5A 1E89A 4PQGA 1GADO 3LX8A 2C95A 2QTVA 1VB5A 3UM7A 1QE0A 3W78A 3VR4D 4HMPA 3DVSX 4O02B 3OTOO 2X23A 1X3LA 4LDNA 4RD6A 1RWKA 2Q46A 1XRGA 3IEWA 5FPSA 3WL6A 5GINC 2JLZA 1WB9A 3FZQA 2BGGA 1AI6A 2EINC 2GF0A 1GDHA 3VO2A 4RJIA 3U31A 1EVQA 4P8RA 1V3UA 5EBMC 4U0KA 4HYEA 4G07A 1E79D 1KYTA 4C76A 4KFUA 2AXNA 5GY7A 5LMNO 5EOVA 4ZOQI 4G85A 1C1DA 1WB8A 1LUWA 4MX8A 2COEA 4CKXA 4X7PA 1NOJA 2FCAA 1P2VA 5B2ZA 3PEEA 1NUAA 1JDSA 1QCYA 3WWZA 1OKKD 5HQJA 5HE9A 4PYQA 4CG1A 4ZOCA 5EHZA 3RVBA 3GPCA 3HEAA 1P84F 5DCWA 5GZ1A 5J43A 3SC6A 1F2UB 3VH1A 3MBIA 1G9XA 4IL5A 1SVMA 4K8ZA 1K9MW 3SHQA 3BRSA 4W7IA 4DLLA 4I6GA 2YWRA 2SKCA 1FJHA 1KO5A 3TUJC 4AZVA 5LQMA 1YULA 1PJ2A 1D1QA 1L7QA 1V2HE 3O3NB 2FFQA 3A28A 3EYWA 2IX9A 3IIIA 1O58A 4Z1OA 3T0FA 4C05A 5KUMA 1QPGA 2QN2A 5K0CA 1L1FA 4ZYWA 4PA6A 3SR4A 5F51A 4EYEA 2FQYA 3TLKA 3HE3A 1OVMA 2CY0A 3MRSA 5AXCA 3ZLVA 1N2SA 4NI5A 2GJSA 2CHVA 2R9AA 2XOKA 3N2YA 1FLNA 1SQSA 3M4JA 2GVNA 2DYSC 1COWD 3AJDA 3V4FA 3FTCA 4CUZA 4Y1RB 4MI6A 4X54A 1AG9A 2CMGA 4WXEA 4EK9A 3B82A 4KYIB 1HDIA 4CNBA 2C04A 3SLKA 5BUCA 5DNYB 1KTVA 2H8PC 2IITA 1SUWA 3IBTA 1KDZA 3RVRA 4QLAA 1E0SA 2WVJA 1VBNA 4QKQA 1C4XA 3FCYA 5K0TA 2WWHA 2QRMA 1UL1X 3L04A 1PQPA 3X2FA 1GZVA 4IG9A 1JFFB 1CJKC 1UBMS 1GZ6A 1GR1A 1W0KD 3KVNA 1CUSA 4RUEA 1JQKA 1KC3A 3RRJA 4RVHA 4J49A 1AMOA 4LVCA 1SUAA 3RGWS 4A3SA 5KU7A 1ZD5A 4P3NA 1Y4SA 3FF1A 1GYQA 3TZHA 3OU2A 3CD6F 3WRXA 3LWRC 5EJ4A 3F67A 4C4YA 2OB2A 3ZDEA 4B3DA 2ZIGA 3C7AA 1JJ2U 1HK7A 4P22A 1AMNA 3ZHOA 1U3UA 1STOA 4G89A 4C5BA 4JBWA 4IH9A 5IYBO 4EZIA 1XRPA 3ECAA 1NQTA 4BT7A 2LVBA 4ESHA 5AK6A 3DO6A 1M1YE 4KW7A 5CPFA 4MW9A 2PZKA 3P3NA 1HL7A 2G1PA 2IYPA 2C4KA 2F1KA 1LH0A 3DVRX 4FGWA 2HSGA 3W8RA 1GPKA 4ENUA 3L7NA 1P7VA 1MO6A 1V37A 2EJWA 2X8JA 1ONBA 4AXBA 4EY5A 2ZTLA 2J4CA 3ZCXA 1UBSB 4C20A 2WLMA 3RHSA 3SYNA 3NONA 4ZQFA 2PZAA 4DK1A 3LC0A 3W0LB 2JKYA 4BFLA 4MW8A 1SKYB 4AS2A 3V4DA 4BN5A 4GE0A 1K9MH 2Q1YA 5FBHA 1YJ9V 5A2QM 5E3HA 2WTBA 1SC9A 4LS3A 3SJAC 3GPDG 4OQLA 3OC0A 4RWZA 1JPUA 3ZMZA 2X76A 2HSWA 3GDOA 4MP8A 1RZUA 2P0YA 4J80A 3SJBA 3VC1A 1RW4A 1BE8A 2R4TA 1B76A 1EA7A 3KE9A 3E5MA 4TKZA 3QUCA 2AEMA 2EW1A 4FI3F 4PC6A 1DX6A 3SDSA 3R0JA 1E7YA 1V95A 1CRLA 3E5RA 5K3EA 1E1QD 4RM2A 1JZQA 3AERA 5E8RA 5BWNA 3I9NA 1DAKA 1CQIB 2Q5FA 2W6MA 4BQQA 1G42A 5ALKA 1PX2A 5PGMA 3MBMA 2IW1A 3M2PA 5L7TA 2E9SA 2LXNA 2UVPA 3GVPA 1XHLA 1NULA 4M9SA 2QKSA 4NCKA 1IY0A 1U1FA 1RFLA 3IOBA 5DLEA 1U2DC 4RD0A 1ZOPA 4IDGA 3NCTA 4X1KA 2BF4A 5I9LA 3VKWA 1V96A 4PYKA 1Y5IA 1U0RA 4UB6Z 4B4UA 3BTSA 5FOTA 1ONOA 2WILA 4LRTB 4EI2A 4YK7A 4KGDA 2WRZA 1NW3A 1MMFB 4UD6A 1FX0B 3TSYA 1QOPB 4BCDA 3KC2A 4KAXA 1NNUA 2FWRA 4ZAGA 5KOJA 1GXSA 4KQ9A 4I4NA 2JGUA 2RCNA 1V3VA 5JBNA 4QRIA 2YNMC 1HX7A 5BP7A 3BN3A 2ZUSA 5ECYA 3NK7A 2EZTA 1EP1B 5DI3A 3Q98A 4INOA 3A6ZA 1EXDA 3GMDA 5IUKC 2NUTB 1OTXA 2EDCA 2JD0A 2XNDD 5B1NA 1FP6A 2XDQA 3WQSB 3H5AA 5HRCA 3ADKA 5D5QA 3KALA 2H0AA 2X14A 1MVOA 3Q9LA 1X2EA 4LCKA 4OL0A 3ED1A 5HDBB 1TLTA 3AR3A 3CRQA 4ZIRB 5KYYA 1WPRA 3N3BC 1Y34E 1FXKB 3N58A 3QTCA 2HPAA 1DC7A 3ZH2A 1NFFA 1NKDA 3L71H 1UIRA 4BO1A 1UFOA 3OCYA 2BFAA 1Z68A 3EQ7A 3DE2X 2P6PA 5EKTA 3CV3A 4XWAA 4YWHA 3IPXA 2EQAA 2PLFA 5JWHA 1JCHA 4PZDA 3OJOA 2QF7A 4O5OA 3IGFA 5DGXA 5FV7A 4DDHA 4OHYA 2BZGA 1R0WA 4J3FA 2VO1A 4UCVA 3D8CA 1P1RA 3T3PB 1TYEB 4BNJA 2BKEA 3CJQA 4FK5C 4WFFA 4NQRA 4Z4EA 2H5JA 4FIZA 4EA9A 4QXAA 1WPGA 3PT5A 2IYFA 2XGGA 1RAFA 1O87A 4BZPA 3N7AA 4C7OB 1BX3A 4D9NA 4MVOA 1EVIA 1W44A 3D4IA 5LQNA 3F4LA 5I7SA 1QF9A 4WDRA 2WSBA 1EVZA 1VQOV 1SC5B 1ZH4A 4P08A 4ZCRA 3LUTB 5HGJA 1S3GA 1SD5A 4B4KA 1DC3A 3SYLA 5TPZA 3K0DA 4E4TA 1MV5A 3IVGA 4TLDA 1MF7A 3A0HZ 5EHGA 3I09A 2E6UX 1JIQA 2NSHA 2AT1A 3NDIA 3I04A 2VNSA 3SFZA 2DR0A 4JZ2A 2FA9A 4RGVA 1AHPA 3H97A 1ZLYA 3KCQA 4JU9A 3QBDA 1A8UA 3OUFA 2DYKA 3TM5A 4WVLA 2X6CA 1ZBDA 1FXHA 2G7ZA 3JQ9C 3ESZA 2PMDA 2RGDA 1GRNA 3T7JA 4NNOA 4X0EA 5JYBA 3DV2A 1GPH1 2JFGA 2A0KA 4WEQA 3FMIA 4L76A 3REFA 2ZAUA 5HZHA 2D8AA 4OY3A 3AP1A 1ST2A 2IODA 1V9LA 3VAAA 4H1TA 5FWNA 5HIAA 3QPBA 4NLLA 1YNOA 3PYXA 1ZIYA 1RJGA 2GZ3A 3DYIA 2ZTUA 2G28A 1AXEA 2P6UA 2H16A 1YB2A 1H4VB 3FPKA 4MGKR 1H2KA 1E9DA 4KWHA 1XEXA 1NPTO 4IHKA 4LZZA 5ERYA 4AY5A 4K1LA 4CC5A 2HCFA 3ZV7A 4LX8A 3B7PA 5ALXA 2AG0A 2Q8NA 4EBBA 3E22B 1BC5A 4OB7A 1H05A 3I56V 3JW8A 3C6KA 1UXJA 1CP9A 1AA9A 2D0DA 5JDCC 1ZPDA 3B9PA 1C3OA 4J41A 4RD2A 5EGNA 5AJUA 3GPLA 5IVIA 3TGWA 2OCBA 3I12A 1RI4A 4Z1VA 3CKYA 2FPGB 2I3AA 5JNUA 3E0XA 2HMVA 4X1YB 4PELA 3T3EA 3OO0A 3IB6A 4IVQA 1R6UA 3CMMA 2IJIA 1FDIA 2ZSDA 5C1DA 2XODA 5IJ0B 1XRNA 1BVYF 3MTGA 1UBJS 2X13A 4YJ2A 3G1TA 2OZLA 2Z5UA 2IXEA 4UTOA 2PDAA 2HRYA 4ZU3A 1SCQA 4A82A 3SPGA 3KB6A 1V6CA 3I32A 4MQMA 2JFWA 2R6FA 3FYHA 3THYA 1Y9DA 2FLKA 1KRHA 1WTAA 3NT5A 4JZYA 1S3IA 3PWTA 1OC4A 1KU0A 4WLFA 3MS7A 4IUDS 4BX9A 2Q6IA 3RTEA 4B6OA 1HSOA 3T1CA 3SNHA 3UA3A 3NBYC 3WLMA 2V54A 2XWSA 4I55F 2PRSA 1AZTA 5LQJA 5B1BB 3GJZA 2B0CA 3ASNC 1TMYA 3JZFA 1PR0A 2MR5A 1Q1NA 5L9AA 3MK31 1GTJ1 1VRVA 1ECJA 5IDXA 4L4UA 3VZQA 1IQUA 1G8PA 1DHRA 1PNTA 4FFLA 4P5DA 5B4TA 4Q19A 3IP1A 2DLNA 1BQZA 1WSWA 5JTUA 4FI3C 1YBFA 1PQ4A 3IQEA 5D00A 5T6MA 5BN3A 1ZVMA 2JFOA 2IPMA 5LJIA 4W5JA 1PNRA 3RHZA 1DBVO 2IVFA 1MG1A 1WXFA 4TL9A 1R1BA 5TSDA 1CVIA 3QEOA 1Y8AA 3DTUB 1Q17A 1AP5A 1W46A 3O8RA 2QS9A 3OZBA 2V5UA 2IWRA 5KNBD 3IC5A 2OUIA 1GTMA 1PWZA 3WYBA 4JI6B 1IBSA 1GQOA 4PHFA 4JOQA 3WLTA 4U3JB 2LBPA 4R1SA 5IAOA 1VQKF 4MS4A 5LQCA 4AG6A 3I8SA 3RYIA 3PD1A 3BMCB 3REGA 4ETMA 3CX5F 2GEUA 2JFNA 3CZMA 2K1SA 2ZW9A 1XPJA 3DAPA 3ZE6A 1TJ5A 1QRDA 3D8TA 3R65A 4EKWA 2PUHA 1T6NA 1AK1A 5CYFA 4RHCA 3GRPA 3SK0A 1HDZA 5DX0A 1CR2A 5PNTA 3FDIA 2IP1A 3RW9A 2QNRA 4C4WC 4IWXA 4QYMA 4F7DA 4MKIA 1K2VN 3DO5A 1KO1A 2QLFA 4PDLA 1PKEA 3WLNA 2QRQA 4BO2A 4H7HA 5JOQA 1PAUA 4DW8A 3NHYA 4JZKA 3D4BA 3NV7A 5F2VO 1P9OA 4MB0A 1GVNB 4UCXA 1Q0RA 3I4FA 3KJZA 3MCZA 1F23A 2A59A 1JF8A 2W83A 2F93B 3UCFA 1LY1A 4PEVA 4PCAA 3P30A 1Y8RA 5JARA 2IOYA 1E9BA 4JMPA 2VP4A 1PJAA 5FEUA 4EUFA 3UTDA 1EZZA 1W59A 3ZHXA 2AFRA 4IIJB 2A0UA 3CIFA 4AJIA 3OT1A 3QX3A 3GCWA 2MQEA 3VNSA 3FZEA 1MRSA 1ABBA 4BW5A 2WPDG 2RIRA 3HLYA 4IYJA 3CLUC 1ODCA 2AKAB 4M0KA 1G59A 2XAFA 4EY6A 5E0OA 4CUKA 1K5DA 5J4YA 2YQ4A 3Q9UA 1ZA1A 3N6VA 1KEZA 1KDRA 1D6MA 3TB6A 4ZAYA 2X19A 5JS1A 1FRFS 3HDHA 1DAEA 2G5PA 3DEFA 2DF8A 4JV5O 1U9ZA 4URYR 4PBRA 1K7CA 1L7AA 3BEDA 2CXXA 3FAVA 3IDQA 3BIXA 1ZL8B 1V1MB 1T5EA 2ZAMA 4NFYA 1P5ZB 3NIDB 1NLZA 1WMSA 4XOIA 1H2FA 4R3UC 1E2QA 5F33A 4L2IB 1ZU5A 3DW3X 1JL3A 2EIJC 2IXDA 3ZGXA 1R3LC 3RKRA 3A2KA 1KVQA 4XB6B 1YDHA 3CNNA 5HE8A 1E4EA 4CLHA 1N2ZA 5DCUA 1YS6A 4UUJC 4L07A 5ALWA 4ZK7A 5KIAA 4O4LB 2EX1A 1DJPA 1U2ZA 3TOVA 4NU8X 1D5NA 2AJTA 1Y6GA 2QB5A 4OFXA 1YCHA 3RRFA 1PR4A 5BMVA 2I2XB 2H3OA 1HURA 5EJ8A 1QHGA 5TEVA 1GUDA 4CCWA 1CULC 3N5CA 1EQAA 1AXRA 3AF2A 2MOKA 4Y2VA 4B87A 3FLEA 2ZQMA 3BFJA 1ZS9A 3ZI4A 4DJJA 4U1RA 2AXTZ 3PI7A 3CE2A 1QH8B 2GTHA 3C9SA 3KQTA 2AJLI 2HLHA 1UKBA 1G63A 3BCHA 4R7GA 2ATEA 3S55A 3P52A 5JD4A 1HYGA 1OHHA 2UUCB 4EX6A 2WLHA 1PP9H 3GLIB 3BMXA 3GFFA 4CR8A 2D2XA 3SX4A 3RV3A 3BTOA 2RCVA 1US6A 1FS4A 4MVJD 1CQXA 1IHOA 4DWVA 2Y9PB 4J90A 1Q0HA 1BMQA 3CZPA 1K7EB 3ZHSA 1G1XB 3HXPA 2F55A 3L4EA 3E7DA 3TZ6A 5AVXA 1XMOB 1ULUA 5IY5B 4GICA 3IMCA 3CZ5A 4K88A 2PQ6A 4I5DA 3M2TA 1KY4A 4IOMA 1KHTA 3OEED 1GKUB 3SPIA 3CB2A 3IKLA 1KO4A 4Q1VA 3VCZA 2JA2A 2BHSA 4QT0A 1VBMA 5AJYA 5JNLA 2JLSA 3WYFA 2ODMA 3WJPA 1W55A 2VSYA 4DDUA 4PFSA 4N12A 4DJEC 4TM8A 4QTZA 2ZJZA 1E1KA 1ANKA 4N5MA 3ZCTA 1NZFA 2I6UA 3K9BA 3PTZA 1RXEA 5CX4A 5HCUA 1CDOA 5K8CA 3HXLA 1RKUA 5LP6B 1QZTA 2G1UA 1T34A 1M34B 3F9IA 3U2QA 3QLVC 1ZX3A 3AGKA 1NATA 3QVTA 1FAFA 2Y27A 5FBRB 2AN1A 2LBXA 2I99A 2L19A 1D03A 1ODJA 2PR7A 3GXOA 1W52X 2YYYA 2ZBDA 4X97A 5H8WA 1U9IC 4TL8A 2K9PA 5DHFA 3LSSA 1WLEA 5ITSA 2X6QA 3VYSC 4X1IB 1POWA 1E1DA 2IPOA 1WB6A 1U0HC 2D2IA 3E3OA 4JB3A 1BOOA 3IJRA 1S4MA 3TLGA 2IBSA 1Z5VA 4QUHA 1KHHA 1WJGA 1GUZA 3FVQA 4ENVA 3ZVRA 3WMFA 2VH2A 5D2CA 5JRDS 4D7SA 1R0BA 3IP7A 2O5VA 4S0ZA 2XUAA 4L0DA 2QZZA 4GFDA 5IASA 2P4UA 4JXZA 2HZBA 1CUXA 4LOAA 1C50A 2CVOA 5E7MA 1C4WA 1DTWA 2ZRGA 4OH7A 1QIKA 1MHPA 1GCAA 2R79A 4J16A 4LCUC 3CG4A 5FLYA 4WN3A 2AE2A 3RRYA 1ULAA 2Q69A 4ON9A 1YQNA 5F2OA 2VHVA 4G2KA 2DWQA 1SKQA 3QVMA 4MQ4A 3LYLA 1N8TA 3EXHA 3EJWA 5EWLB 3QEKA 4LI0A 5DHTA 3WQHA 3K09A 3KL2A 1DINA 3ABMC 4MKFA 3OE1A 2NUAA 3KJQA 5ARDA 3A7DA 1Y76B 4R9NA 4LRSB 2CT8A 2ODQA 1S5JA 2XZOA 4GSYA 4Z9YA 3DSRA 2PBFA 4A26A 2ON6A 3KJIA 1FFSA 3JX9A 4R2HA 4CKBB 5D8DA 3UYLA 4PPYA 3BK7A 2DYSB 2WNHA 1CUUA 3DTNA 4UVGA 3THXA 2ZT5A 3WL7A 3LCMA 5CA0B 2VDJA 3P9CA 2O2HA 4B7EA 4BN0A 1XQ8A 3MAQA 3P9KA 2E4ZA 4KE8A 3O8QA 2M1XA 4LBYA 4PPQA 4QATA 3GRZA 4ZO7A 3ZV5A 4BXOA 1BWPA 3CWQA 3MAJA 2TMDA 3ESQA 3X3HA 5DTEA 2B8EA 1OSNA 4A92A 3N4YA 1T3SA 3CF2A 1X80A 2QX6A 5JJEB 3WNZA 4EO7A 5EWMA 1CX9B 5AM5A 2LRHA 1OLSB 3C15C 4UHKA 5T4HA 3B7WA 3S2ZA 5CW1A 1AILA 1TRHA 3A0RB 4FHFA 1J90A 4C0WA 4B0PA 3DLTA 5JCXA 5BQOA 5DEDA 3OCCA 1BJKA 4WNAA 3MS4A 4AI6A 5BYAA 1IBRA 4B8WA 1KMHA 1DAFA 1G2OA 2ITCC 1P73A 1W36D 5AK4A 1ZM7A 4BVRA 2C1XA 2ZJAA 4AT1A 2QLTA 4G4WA 3UAVA 5ECWA 1KI2A 1DU4A 4KR3A 2WTNA 2WWVD 4NCNA 2BTEA 3RVLA 2ZBUA 4LJ9A 4Y0NA 1JDBC 3BIOA 5DM4A 2VRCD 3KJNA 3DGEA 4PIVA 1TIPA 3I73A 3PGJA 4LXTA 4R2MA 2QMHA 1GPMA 5L3QA 2QUBA 2B9EA 2IC5A 1A4XA 2DJVA 3K1AA 3IE0A 2M6SA 2NACA 3EGXB 2XCOA 4NJEB 2WZCA 2F43A 1QJCA 2I1WA 1KAHA 4HEHA 4AULA 1TUEA 3OJWA 3SJZA 3TLYA 3IP5A 4RQOA 5CPBA 4JNKA 1N33B 1TTPB 4K9KA 3R5XA 4M9ZA 4H18A 4P92A 1TO2E 5SY4A 2I2BA 3GF4A 2I33A 1BZKA 4FLUA 3AIMA 2O8DB 4UQPA 4C01A 4NCHA 3G6KA 4ARZA 3KWLA 4LBEC 1RJ9B 1U0SY 4Q9HA 2REBA 2IIQA 4TKUA 1E7QA 2I55A 3KWJA 4JJFA 4NXNO 3UHFA 1R0CA 2JDID 1W5AA 3K14A 1UJWB 3BWXA 5E3JA 3HMKA 4QNMA 3P26A 5AJVB 2Z5FA 4XM2A 2X9GA 4WBNF 5MDHA 3LUAA 4AY3A 3V1LA 5IAAA 3BL6A 1HLFA 2G80A 1JPNA 1LLFA 5HUJA 1Y4DE 4X92A 4WOJA 1VM6A 5HF6A 5FO1A 3DAOA 4MRPA 5E0KB 2B2CA 3LDUA 1YDGA 4P3XA 3NHJA 4MQFB 2WY2D 5IM4F 2GR9A 1WOYA 1H2AS 4UPVA 4BMPB 3MWFA 1TEZA 1GSAA 3KLPX 4C1BA 4KPYA 3CYQA 3STYA 4BNMA 3MDSA 1VQ9F 3OZRA 3UB3A 4O8ZA 1X94A 3J80M 3LVFO 3IAS1 2ID9A 4BNLA 1E3EA 2HA5A 5BN1A 3KOYA 1GCUA 2PX8A 3ZPXA 4H59A 4MUIA 3T54A 1I0ZA 3RRNA 2A9PA 2XTNA 5FPRA 2PIDA 5BNFA 2BCJQ 1C2YA 4RM3A 4GZMA 3K8QA 2HMSA 2P8JA 4Y6LA 3KOUA 4MR8A 3W2TA 1U4OA 4ZCMA 1PO7A 5H59A 2IBTA 2P7TC 2OXFA 3AEQB 1Q3EA 1QYVA 2ZR0A 4OAOA 3UY4A 2RDCA 2A86A 1ZJYA 3BL5A 4ERXA 3A1WA 1NMUB 1KKUA 5CFLA 4E1VA 2B7LA 4G24A 1XR3A 4B76A 3PLAC 5AW1A 2F3TA 3F5SA 2ZT9B 4B8YA 4PX2A 4OK6A 4AVYA 3LWQC 1UFRA 2FPLA 3UNXA 3R3YA 3K4HA 3TAHA 1DIRA 1U8CB 2IJHA 1H2ZA 1GCOA 5C37A 5CLGA 3TZQA 1S6YA 5EIAA 3CW8X 1KVRA 1RLUA 3LG2A 3LE8A 4K8RB 2J0QA 2UYCA 3PCRB 3MB5A 3LUGA 1TQ4A 3U3MA 2KM1A 2FGJA 1C30B 3NIGB 3AETA 3K9LA 3TAXA 4LEIA 1V71A 3ZN2A 4JT8A 1NQ3A 3L07A 4O4JA 3F4KA 4PGFA 3ZWOA 3DLPX 4LI3X 3KQSA 1Z56C 2JJ8A 5IYZA 3DMGA 2QUKA 2Y1OA 2BPOA 3FHOA 4NYMQ 1IHUA 1NBIA 4UHJA 5BNTA 6CHYA 2F1IA 1MAHA 5L3RA 4YMTA 3FTNA 4C5CA 2YN0A 3CPQA 2HADA 3QFSA 2GPTA 4RDCA 2A57A 1FFXA 2PKWA 2V5AA 1ZC4A 3VX4A 4M60A 2PX4A 1R5BA 4MUJA 2VTBB 3TUZC 4PO8A 3WYDA 4DA4A 1ORWA 4QOFA 1BGWA 1B0AA 1GPNA 5CA1F 2OMEA 2B1GA 5DP1A 2Q0HA 3L8EA 4W4KA 3JATB 2NG1A 1DTSA 2QA4V 1EFKA 3B1WA 1XP8A 4MRAA 2P4EA 1VB3A 2HBQA 2BKAA 2HQSC 2HR1A 4EL5A 4IDDA 4WZBB 2BJVA 3AFHA 4IW3B 1R0RE 2PG3A 4UMDA 4E6EA 4BL5A 1SM4A 3ADDA 2IL1A 2JJ1A 2C7VA 5GONF 2R6R1 3T6KA 2ZJ2A 1Y66A 5KJ6A 3CO5A 3HZRA 2XSZD 3PX3A 3KKEA 3BWEA 2JAUA 2PUDA 2DBQA 1BD4A 1QFXA 1U97A 3EDCA 2XKKA 5G4LA 1FQKA 1A9YA 1W8DA 1NVWQ 5JPCA 4EG4A 1A2OA 2OBNA 4N3NA 2MSCB 2BP7A 1PE0A 1XDZA 3ZC3A 5H9VA 3ZDXB 3HEBA 1N2JA 4M1EA 2ZSBA 4LISA 5GZ3A 3PEFA 4QC2A 4QYIB 1OILA 2XEXA 1G21B 1XMSA 1GSHA 3EGOA 4YFVA 3U5ZB 3L8GA 2UYYA 4EDHA 3F0DA 4DY4A 3M0EA 1X1CA 3EULA 4ZI7A 2O7RA 1WX1A 1W8IA 1EGVB 4UFPA 3BMNA 2VCHA 2WTMA 3WK7A 2HHHB 1RXIA 5IAGA 1N92A 1J8VA 2OCYC 3D0QA 4JENA 4GKKO 3NKVA 4ND7A 4F85A 3HYSA 3AI2A 5HCIA 2GUWA 3PB3A 1VLQA 4ABTA 3BJIC 4J1QA 3VKGA 3JWEA 3UKMA 3L8ZA 2BZ0A 4UNIA 4R81A 5SYMA 1P80A 1SCUA 1O96B 4GBED 1T6YA 1OXBB 1M3SA 4X71A 2YJGA 2H2FA 4CEIB 2VT3A 1RBQA 2Q1TA 2W6PA 4QYTA 5FV4A 1YL7A 5K2OA 4GM0A 2QP3A 4MVSA 1I51A 5ESDA 4OHMA 1ZNZA 3KYDA 1JSLA 4C0AC 3OFJA 2VJMB 4BWAA 4EA7A 3WOHA 3FDXA 5KCZA 3CCMF 5JSUA 1X8LA 2XJ9A 2AR0A 1XTIA 2OR3A 1YB6A 2BTQB 1NURA 4HUTA 5FP0A 2YYSA 5DMHA 4L78A 3DDHA 1PEAA 2O3QA 1XK7A 1JEYA 1QQ7A 5LIRA 2JD2A 2OB1A 4MYRA 2JFVA 2WA3A 4EGCB 3C9RA 2HF7A 1C9NA 2AF4C 1N2XA 3JZIA 1X15A 2ZRCA 3NEJA 2HCRA 2A3RA 4RH0A 1G6OA 4N0QA 2ASEA 2PCLA 1ULZA 4EB3A 1KA9H 1HDOA 4NESA 1SETA 2CLLB 4S04A 1JR3A 3QUAA 2Q9AA 3ASNB 5LDDC 1DOHA 4R83A 4YJHA 1RCUA 1DC5A 5YASA 3FNGA 2YXBA 2GUZA 3VOTA 4KIJA 5I7AA 5U4QA 3V4LA 1XL4A 2FP4A 3K7EA 2VF5X 2IH5A 3HEMA 4Y1GA 3FIJA 3AHHA 4P81A 4UVIA 3OT5A 5JV5A 2LDXA 2RJNA 3A2MA 2IWHA 3MJFA 1RYYA 3PXAA 2BMJA 1MJFA 3DMHA 4OMCA 5TT0A 2QBYB 1J25A 4RAQA 2RGBA 1U7UA 4WLVA 5H83A 4HOYA 3QH4A 3WJ7A 2G9NA 3OBWA 3H1JH 1UP7A 3ETNA 2W70A 1TVMA 1HFEL 1FYJA 3B89A 1H2LA 4LBWA 5A4AA 5KSWB 1VHQA 4J0EA 1SBZA 3TQTA 1A04A 2Y92A 4F3RA 2ZOSA 2R1TB 4H0NA 2BMFA 1SURA 2WD7B 4ND3A 2I6QA 2PH5A 3CH5A 1M8FA 2X7RB 3NM5A 2N1MA 1KK3A 2OKCA 3SJUA 3AFNA 3FKSA 2WWTA 4CGZA 4JLBA 1WVMA 3D8SA 4V1CB 2NUPB 3I1FA 5BNZA 3Q8MA 4FDMA 5LLSA 2GZHA 1Q20A 5KVQA 3ROMA 1E8NA 4KVAA 1ENZA 3H83A 4BPBA 1SB9<