4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
molecule tags Cell cycle/inhibitor
source organism Rattus norvegicus
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
5LOVB 3M8KA 5CA0B 5JH7A 3RB8A 5KX5B 4O4LB 4U3JA 3RYIA 5LP6A 4YJ2A 5JH7B 3N2KB 4LNUA 1OFUA 4HNAA 1Z5WA 3JAWA 4O4HA 3UT5B 4ZOLA 4IHJA 4TV8A 5IJ9A 1FSZA 5JQGB 3JASB 5C8YA 4DRXB 4O4JB 4EI7A 5EYPB 1SA0B 4EI9A 1W581 1Z5VA 3JATB 5J2UA 4ZHQA 3E22A 1TVKA 5CA1A 4IIJA 5LA6B 5LYJA 3E22B 2VAWA 1RQ2A 5JVDA 3M89A 5BMVA 4O2AA 5J2TA 3JASA 3N2GB 5C8YB 4O4JA 5IJ0B 5EYPA 5JCOA 3JARB 5KMGB 4EB6B 4IHJB 4TV8B 5IJ9B 5JVDB 4EI8A 3WGMA 2RHJA 5EZYB 4M8IA 3HKDA 2VAMA 5MN5A 2BTQA 5CA1B 4B45A 4YJ3A 5EIBC 3RYCA 5IYZA 2GVIA 2R751 5BMVB 5LP6C 5CB4A 1W5BA 5ITZB 3RYCB 1RLUA 4TV9A 2Q1XA 3JAWB 4O4HB 3WGLA 4O4LA 4I50B 4U3JB 3RYIB 5LXTA 3VPAA 5EZYA 5LOVA 3HKCA 3RYFB 4X1IA 3RYHA 1W5AA 4X1YA 3ZIDA 4FFBA 4ZI7B 4HNAB 3UT5A 4X1KB 2R6R1 5LXTB 5IYZB 2VAPA 3R4VA 4YJ2B 5LP6B 4WBNB 4U39A 5FNVB 1W59A 1TVKB 5CA0A 4WBNA 5ITZA 5FNVA 3WGNA 3JATA 2RHOA 5J2UB 4O4IA 3WGJA 1SA0A 4X1YB 2BTOA 4I4TB 3HKCB 1TUBB 3RYFA 4DRXA 4X1IB 3RYHB 1W5FA 3JAKA 3JALA 5EIBD 5KX5A 2XKBA 3HKDB 3JALB 3JAKB 2RHLA 5JCOC 4IIJB 5LA6A 3WGKA 1TUBA 3V3TA 4E6EA 3JARA 3VOBA 4EB6A 5CB4B 1RQ7A 5J2TB 4O4IB 4YJ3B 4O2BA 5GONB 5MN4A 2BTQB 5LYJB 3VOAA 4DXDA 3VO8A 5GONA 2VXYA 4ZHQB 1FFXB 3HKBB 4X20B 4KWEA 4F6RA 3VO9A 4ZI7A 4X1KA 5KMGA 3C8LA 3CB2A 1JFFB 4O2AB 3HKBA 1FFXA 3N2GA 4X20A 5IJ0A 4F6RB 3N2KA 4LNUB 4I50A 2RHHA 3HKEB 4XCQA 4TV9B 5M7EA 4O2BB 5MN6A 3HKEA 3ZBQA 4I4TA 4B46A 4I55A 4TUYB 4FFBB 1W5EA 5JQGA 2Q1YA 1JFFA 4I55B 4TUYA 2XKAA 4ZOLB 3ZBPA
chains in the Genus database with same CATH superfamily
1Z7EA 1YRHA 3HK2A 5A4AA 1P62B 5JH7A 3CRVA 4KN5A 4RVFA 4AG6A 4QDUA 1E20A 3BJZA 1NXPA 3K9LA 4ZI7F 1DGSA 2C5AA 1OPXA 5CEJA 2MMCA 3LYHA 3SYNA 4ZN6A 4PLFA 1LNSA 4LYAA 4CNBA 4M38A 1WB8A 4NCIA 4FB5A 1SDSA 3D2AA 3DEYX 3FPCA 4LBZA 3UV6A 3N59A 4DY4A 4E3ZA 5L95A 4GZMA 4MI6A 4W5TA 2MJLA 2DERA 3UQ8A 4JI4B 2ZJZA 5A0FA 3QPAA 3U6KA 4JYBA 3GLHB 4XOIA 5LA6B 3UV7A 4RPGA 1VYTA 4IHQA 1WAZA 1QUFA 3ESYA 1Z35A 4UMVA 2OXTA 3RS4A 2VHEA 3VQXA 3KFXA 5BP7A 2B4RO 5SY4A 3WP1B 1XXHB 1A2OA 1ZCBA 1JHYA 1RA4A 2WOOA 4IEFB 4QYMA 4RWEA 4DR1B 2CNBA 2WJYA 5EERA 4U7GA 3UCSC 2WZQA 4AX4A 4EHJA 1CXZA 2GNAA 5JZBA 4H7IA 4HC4A 1WP7A 4JT9A 1QX4A 2XCRB 3EQ7A 1DL5A 1EQUA 3PVZA 3SHFA 4ICGA 4BNTA 1BA2A 4FGSA 4QOSA 4N5NA 3CUTA 1W87A 4W5HA 4NL4H 2YWJA 4NMLA 3LFUA 2IZOA 3KP1A 1XVIA 1CW2B 5A71A 4X61A 4I9WA 4B85A 2UAGA 2Q5IA 1X86B 3GRUA 3NYWA 4DJJA 1U0SY 4DCGA 3LY9A 2CUZA 2H4FA 2FZLA 4RHXA 4AMVA 1QTIA 4WBSA 3JRNA 2CLSA 3R7FA 1CZNA 4XJTA 5HY1A 1YI1A 2GX6A 4CN8A 4P31A 4YCSA 2NU7B 2ZTUA 4HNAB 1VQ5F 1IVSA 2H08A 1G0OA 3R6LA 1V3QE 2ZJ5A 2GQ0A 1DAKA 1FQKA 1FDOA 3JQGA 4ZPJA 5TQ2B 1HE1C 1BROA 1XEWY 5K8LA 1GQ2A 2YWRA 3MBKA 3NHSA 4IG4A 2MTBA 4LAFA 1FYFA 4RZQA 4TTIA 4TSRA 1NJIH 1ZXXA 5J1TB 2QD1A 2HPVA 2ZULA 4Q3AA 2GPAA 5DNEA 1G21E 4QXAA 4JXZA 1DJPA 1R9MA 3B1XA 1Y1SA 3U16A 2VF4X 4L50A 2CLLB 4D6XA 5ALVA 2J3JA 3RCBA 1BYUA 3WJAA 3WYCA 5ADWA 1HDOA 4ND1A 1T2NA 5A05A 3F9RA 3TXAA 2YJNA 1BO6A 2P2NA 1VARA 1IK4A 3B60A 4FDAA 2QWXA 3ONDA 4BQFA 5CXXA 4YV7A 3QE0A 4G0XA 1WA5A 3GLVA 1TAUA 2QG9A 4O5OA 2QSZA 2TSYB 2EU8A 1VA4A 1Q0RA 3NKVA 3WNZA 5BN5A 2CY0A 4K9QA 1SURA 3O4JA 1UWVA 4K05A 4BO8A 1O8CA 3SJBC 3A6KA 3H1LH 1PTJA 2LP7A 4YJKA 4JAUA 2Z08A 1NJ6A 4TSFA 1GN4A 5GTHZ 1IOLA 1O96B 2VHUA 4GG1A 2Y93A 2YN4A 2BN4A 5CXUA 2OT5A 2GZRA 4RBNA 4YAWA 3MGBA 1EYZA 4O2AB 2I80A 1A1VA 5DWQA 2L26A 4YWHA 3K6RA 1BRMA 2VAXA 2EZPA 2CVPA 2RGGA 3HKEB 3CZCA 3KZVA 5EXDA 1P80A 2FKAA 1M2NA 1U9IC 5BNTA 1B4DA 1TXGA 2ADFA 1D2HA 1ACMA 2C84A 4GPAA 5FHQA 2ZUDA 3SEQA 4AYXA 1NQXA 4JV5O 2DF8A 2ZLBA 1MTOA 2OZEA 1K34A 2ZAOA 3GLUA 4PSUA 4WOJA 4LWOA 2QWNB 3EVKA 3E1KA 2F55A 9MHTA 4YJGB 1UK7A 4EKEA 4RK0A 1WOMA 1ZUD1 2ID8A 1WCIA 1JPXA 2AH5A 4MV5A 3ZIUA 5C7YA 5AJXA 3O3MB 3VVBA 3Q8KA 1HL7A 1F0YA 1B26A 1TEXA 3G9TA 4I9UA 1QSGA 2QE6A 1MFPA 1PDVA 1UKVY 3T3NA 4HZGA 4C01A 1IONA 1K4MA 1RHKA 2QRGA 2VF2A 2W4QA 2YRWA 2ZWPA 3ZP7A 2A8YA 3EA0A 3F47A 4MRMA 4TWRA 4JT2A 2PVSA 1TAGA 1UZMA 2FX3A 1JB9A 1CS0A 2X1HA 2FDXA 4PY2A 3N53A 1DTWB 1SCUA 1EDZA 4RESA 4WGGA 4UOZA 3AL3A 1GYRA 2W2LD 4NAHA 2O5CA 4EBBA 2XZTA 2HRYA 1HQDA 3WJ2A 5KJ6A 2IHTA 1BHBA 5KSPA 2J30A 3SXJA 2PWYA 1YKGA 1ICIA 4DVGA 5CB6A 5JVDB 4GWKA 1Y1QA 2NT4A 1KI3A 3DZCA 2SECE 2JGFA 1P6UA 3OQ1A 1B2RA 1E6UA 3KQMA 1QQ6A 4AF8A 1PQPA 3CLUC 4H60A 4IZIA 2XVXA 2EEPA 1PKXA 1DAIA 2AR0A 4NAVA 3S44A 5JRZA 1FDTA 4DJAA 1FFBA 1O89A 1YVRA 1OCZC 2IFTA 4K6FA 4XSGA 5K0GA 2CNWA 5B6JA 5BR7A 2PSSA 5JZOA 1H0SA 1NI4A 1XEFA 2R6FA 3LC7O 4UPEA 2GPNA 2AMJA 5JIBA 3NJ8A 4MINA 1XEAA 3WWYA 4D46A 1RS0A 1HQYE 2B6HA 3HKCA 2RK3A 3AH8A 1RRVA 3DGEA 4KUHA 4EENA 2YWDA 5LXTF 1XK7A 1JU3A 1QE0A 1WVMA 4NU6A 2D5AA 3D5QA 2X3UA 3Q4HB 4F60A 4ADSG 1BU8A 2IU6A 3CWZA 2BH2A 5EO3A 5GINE 2C4HA 1KP2A 2R5FA 4IXNA 2R11A 3ZIAG 4ETMA 5AQEA 1I4OA 3WNBA 1A96A 3BHMA 2OGWA 3BJEA 1XYGA 5M3BA 1X9IA 4BFVA 4HD8A 1XNRB 4DDMA 4AZ0A 3H5OA 5FUQA 2OHWA 2WHYA 4ASUA 4DRXA 1OFUX 1Y4MA 2GTPA 4X1IB 1KVSA 2YDYA 3VC3A 1CEXA 1U2DA 1WXFA 2I8CA 3KOMA 3QG1A 4UFNA 2NU8B 3EXEA 4C6RA 4DUZB 1IAQA 3WLNA 1VKJA 2CBGA 4I4LA 4PSKA 1W93A 4E6EA 2REOA 1DIOB 3S3TA 2QD5A 4ZO6A 5KPJA 2BFNA 4HQ6A 3CBQA 4DR4B 2EATA 4MJXA 3DDNA 3VR4H 4YUWA 3ZE7A 3BL6A 4HWSA 4OLJA 1SQBH 5HQJA 1GRNA 4JJEA 3KELA 3IEWA 3ZRVA 4JVSB 2BTQB 1FIUA 3QU5A 2LDBA 1BOOA 1VA5A 2E89A 2PRKA 3UJ6A 4RFSA 3JCMM 3DLPX 4YDHB 3C1UA 4JLUA 3EEYA 3K5PA 1IQPA 1UEJA 3KWMA 1QNMA 3FPFA 4FUQA 2MSEB 2P9CA 4KNWA 3SXUA 3V7WA 3OMNB 2E4ZA 2HZBA 2QRJA 3B8MA 3F0GA 2UYGA 3B5EA 2Y6UA 1R3KC 4LI0A 1ESCA 3ETEA 2Q3BA 1NA5A 4MW0A 4Z2YA 1EZ4A 3C7DB 4IHAA 2W0XA 2KBFA 3DC7A 3IAS1 4UQOA 3U9LA 2FW0A 3T5AA 3CE6A 5MN6A 2C5FA 3EWIA 1NKVA 3JQ7B 3WL7A 4BFZA 4I1OA 1J2JA 1SKVA 4Q1BA 5AJZA 2X0FA 4FQ5A 5HIAA 4PPQA 4BTLA 3L71H 5HIJA 4EF6A 3RJTA 3D3EA 5FTNA 2VQDA 1NWHA 3MRXA 4IXTA 2GB4A 1BE8A 3HYNA 2ZETA 3P0IA 1JHOA 4JR1A 4PNZA 3TLBA 4AS3A 2ZT7A 4FGKA 3TAXA 4DMGA 2HNKA 5K0EA 3HE3A 3AZOA 4GSYA 1N78A 2V4ZA 3HRHA 3P0FA 1KC3A 1TVCA 2VBFA 3CIFA 2YIJA 3K6JA 4QJBA 3T9EA 3TXYA 1NVVQ 2Q6VA 1GMGA 2XE8A 4OQMA 4KRYA 2Z1MA 1S8OA 4DFDA 2DX7A 2ZW9A 3CH5A 1NN0A 3EMKA 1SA0B 1L4NA 2HU5A 3RS7A 3TZ6A 3WO0A 4RTNA 1PJSA 2G4VA 4JHLA 3PXGA 4BBZA 3ZX6A 5ED0A 2INGX 4K9MA 2V7QG 2XI4A 3QU7A 5IT4A 3AG2C 2QPAA 2HMAA 1JAYA 2D2EA 1GGHA 2H92A 3SM3A 3TD6A 3TDNA 4HY3A 1ILWA 3WMRA 3CUUA 3IE1A 2LIVA 1Y37A 3O2QB 1PJRA 2V5VA 3DDHA 5AVVA 1VHJA 2BV3A 5JEEA 1ZOIA 4EMBA 4A6XA 1N77A 1II8B 3L8FA 5EE1A 4AUMA 2XTAA 2A6PA 1IHYA 1VL1A 4P83A 4RDHA 2C0PA 4FK8A 1OI3A 5LZ8A 4I7EA 2GTHA 5DXJA 4X7RA 1OC4A 3ZX4A 1QZTA 5FR1A 4Y3UA 5JTUA 2P9FA 3ONEA 3IPCA 3T5BA 4EEZA 2IVFA 2C7BA 4R41A 1SXIA 5KTRA 5EJ8A 3BTVA 1EX6A 1RQRA 3A4LA 4V1CB 2JNWA 1AQUA 2EL9A 1CDOA 3CN7A 3U7EB 4CCWA 3VCZA 4IGKA 5EBWC 3LWRC 4R1QA 3ZLBA 1TK3A 4GICA 2OBYA 5I9BA 1TMKA 3AVYA 3S7ZA 1PUJA 1Z3IX 4GYCB 2Z2YA 3HJCA 1PR9A 2GZ3A 3WKBA 5KX5F 1B74A 4TKVB 5E6RB 1Z6YA 1W6RA 1LDGA 4C7OB 3WB1A 2XQGA 4V38A 4EY4A 4ZOBA 4KQEA 4FYKA 3TSWA 4BMVA 3LPAA 3TNFA 4M0FA 2EX1A 3IUEA 4P2GA 3VTAA 2OVBA 3MB5A 4DR2B 3HJNA 3IOBA 1QRUA 3FTCA 3CSXA 2PY5A 1VJGA 6AT1A 4OAOA 1B00A 4F1WA 3ZVKA 4ABYA 4UBIA 3A31A 3X1YA 3OCWA 4IKOA 5EWJA 2O6LA 3VHLB 3DL7A 5AP9A 1EP9A 3HDVA 1G1MA 4HJRA 1LCIA 3EUWA 4ALKA 4Z1OA 1A9XA 4GS5A 1DUSA 4B3XA 3ZOZA 3I39X 2IJHA 3TB4A 1H23A 1SRQA 1Y9AA 1UZUA 1Z88A 2JA2A 2X5KO 5E8JA 3QVJA 1IEVA 4ESHA 3LPCA 3WSVA 1YO6A 1HE2A 3FTPA 3W6PA 3PXDA 4TQ9A 4XQGA 5DPMA 4Q48A 4WZAA 3ZXXA 1CULC 1ZAUA 3B53X 4IQGA 2FGKA 1YF2A 5GM2A 4N21A 1V6SA 2ZDHA 2Z1FA 4WLFA 5MDHA 1KIAA 4EDHA 3W1EA 3OCUA 2G0NA 3DKIA 4OHCA 2JEZA 5BSRA 3ZCRA 1ORVA 1ZH4A 2PKCA 5GV8A 4C04A 1NY5A 4WLNA 3ZDZB 5JAMA 5JYEA 2X9GA 3GRZA 2VHJA 1IURA 3EPLA 2DE0X 3DYIA 2PKEA 3L41A 2Y69B 3PX2A 3TH5A 5JMWA 1U0GA 1ZOSA 2P2LA 2QN3A 3LI2A 4IDFA 4KSYA 5FPHA 2AE1A 2DYKA 3IJRA 2QDXA 3TGWA 1FS6A 3S03A 2OSBA 2FPGB 3T1YO 4LOLA 2PVCA 1US8B 3O83A 2N74A 4XWGA 1F8GA 4Q20A 1P0CA 5DXAA 3INYA 1FUEA 4YUYA 2W37A 3L0PA 3G4SF 2C7PA 5FBHA 4IVRA 1PQ4A 1VLHA 2H06A 2CHQA 3KB6A 1UPUA 4H44B 1GU1A 1PU2A 4HB3A 4JJ7A 4PHTA 4M1WA 5HUQA 2GM9A 3UMSA 1J49A 3VBBA 1NMQA 3HV0A 3RK1A 2FZKA 1Z13A 3X2QB 4B82A 1PZFA 1YHQV 2D5LA 2PBRA 2VYFA 3ZHRA 5LD2B 3UJ3X 2Y0IA 1GCOA 2C31A 3FUXA 4MJ3A 4PCUA 3AW9A 2HWUA 4DMLA 2KG7B 5I9LA 4AJIA 1UXIA 1IXRC 3R9KA 3T1HO 1JKFA 1SEVA 1CQJB 1L5SA 2QX7A 1ROPA 2WWXA 2ZATA 3ZBHA 2G40A 2ZRBA 3OZEA 3QKWA 1XEXA 1O95C 2ZI9A 5AHWA 2BFEB 1UC9A 5EXEA 4B8WA 1AXRA 2JZOA 1MB9A 1P91A 1VIMA 1Y82A 3N0WA 4HH4A 4LA4A 1IBKB 3EWNA 4PC3A 4IJKA 1M2GA 2SICE 3RFVA 3FWPA 4WFHA 3DHNA 4YVFA 1ACLA 1FB5A 3AM5A 3HNPA 4RSRA 4E1VA 1KFKB 2AX4A 3L75H 4TWZA 1QIMA 4E15A 3S8YA 1CYEA 1MAWA 1NVWQ 1YJ8A 2ENWA 5SZJA 2VDVE 4DV3O 2BT4A 1JWBB 3GQBA 5CFOA 1NBAA 4CTKA 1SBZA 4KQ1A 3GLKA 1PG5A 1KAQA 3BE6A 5G0UA 2WLIA 4WFBV 5CPFA 2Y1OA 1XJWA 4IQ8A 5T67A 2BFBA 2JFZA 3EY9A 3OMWA 1UMBB 3RYFB 3BJIC 1KAMA 5F1YA 1H6AA 1TX4B 3CSSA 2HI0A 4EPXA 3QYJA 4R8CA 1QIJA 2OZLB 5JYDA 3PPXA 4TMZA 1CS0B 5F9HA 3OIDA 1NC3A 2NZXA 3EWSA 3SHTA 3UMRA 1WV1A 1J8QA 1N6KA 2ZP1A 3FTQA 3ZQJA 5K0SA 3EQ6A 5DGIA 5EQFA 4ASUG 2XITA 4FS3A 2TECE 2W2QA 3A0UA 1KKLA 2CF6A 2VXBA 4YWJA 2Y69C 3NYIA 1C1XB 4NCKA 4PZZA 1AVMA 3CZ5A 1L5RA 2I9KA 3RYHB 1N2GA 4O02B 2HPZA 1ODJA 4P1ZA 5CJJA 3JAKA 4DA6A 2IH5A 1V55C 1MRNA 4M36A 2ACWA 3F2IA 1T0IA 4QYXA 1T8YA 5TNXA 3UCFA 2VDKB 1QV7A 1RNLA 1GTJ1 2JBWA 4JUBA 3WRXA 5HFLA 2NMVA 1Y5NA 4F0JA 1GV0A 4R7ZA 3R5KA 3E35A 2COUA 3HH8A 3LBYA 2QAJA 3UWKA 1X7ZA 2QVZX 3W8NA 2WUVA 2PMKA 3E3OA 3QLUA 3GA0A 4OQEA 3CP1A 2CSLA 3H87A 2WYUA 4M9ZA 3FKSD 1JEYB 3SZLA 5DIFA 1UDWA 1C50A 4E11A 4HQ0A 3UKDA 3I62A 4GWLA 3ICEA 4XJSA 4K9DA 4LMBA 5ESRA 4OXSA 2DSNA 5H5JA 2XHEA 2ECQA 5FL3A 3WHLA 3ZGXA 3KOUA 1E3LA 1IZ9A 2G9VA 3PDHA 5HKLA 4YT2A 3IL2A 5B53A 4DCCA 1X1CA 4QDXA 4DJTA 4LFCO 1WP9A 3GUZA 5HTKA 1MOPA 3P2MA 3B6JA 3RQSA 2I66A 3WWDA 3HKEA 5BYKA 5EP3A 1VEWA 5ESXA 1J23A 5AM5A 3P20A 3ZMTA 2OHVA 1M5IA 5CMUA 3A1WA 3SN6A 1ZIDA 5BQXA 3EH2A 3QKTA 2QORA 1DWPA 1LNQA 4PLVA 1V7CA 5JJEB 2UYJA 3ESBA 4RFLA 3TMKA 2YFQA 3TCKA 4D8XA 3U7GA 3GL9A 4BN4A 2K9PA 3TRKA 2DQSA 3GH1A 1QQ5A 2MHCA 3I42A 5HWSA 4JI6O 2I99A 2HLDD 3H5AA 4DA8A 4GFDA 4B6PA 3EFBA 1QF6A 4EG8A 3RFTA 3QNWA 3G0BA 2MSDB 4NESA 2PV0A 1YGPA 2AUTA 4H37A 1P75A 1RR6A 3M83A 3MLEA 4JZYA 5AJTA 4FC7A 1V45E 1Q44A 4V0RA 2ZVZA 2P06A 3PEUA 5E9JA 1YQNA 1JDBB 1R6TA 2P5SA 2J31A 4GH5A 4KGVA 4DHEA 1ACJA 1W30A 3NM4A 1X59A 5TQ2A 4GI7A 3AB8A 4GDFA 3KIZA 4YYEA 1ZWZA 3FA2A 2YZMA 2B34A 4ALJA 3FCYA 3MAGA 3OLVA 3A4YA 4QU0A 3UENA 3VR2D 3IAXA 4PWTA 4GMFA 2G4CA 3SHVA 5DH9A 3EDYA 3IKTA 1E92A 2O8FB 5HY2A 4M8IA 5B2ZA 2HQSA 4QRDA 1LLQA 4L5AA 5AG2A 4HN9A 1Y76B 3CC7V 2ERYA 4Y18A 3H2BA 1M56B 8LDHA 4TRJA 1AQJA 1Q2UA 5D84A 2ZRJA 3BFJA 2P7HA 4I1IA 1VCOA 7ABPA 5DCWA 1AF7A 2RB5A 5GZ6A 3IV9A 4R83A 1G3IA 2LW7A 1Y5MA 4BNWA 2H85A 5EE0A 2Q1XA 2L2QA 1IV1A 3OAAA 5A4FS 1XE3A 3TECE 3AO0B 3TAUA 1PR6A 3K1JA 1XTPA 2H7YA 1Y1RA 3O4VA 3OOSA 4B2IA 4IRMA 1XF1A 5LIPA 3W5DA 3E89A 5CVTA 2I7CA 2QAGC 3C3SA 1QFZA 3GJSA 3RJZA 1THZA 2QZSA 3DPSA 3GRFA 4I5GA 2QRUA 2VDRB 4CKYA 2KI5A 5I8ZA 4AULA 4F2WA 3GGPA 5IVPA 2VPXA 4YAFA 1BXKA 3MMXA 1IAVA 3M4ZA 2MINA 2WWFA 5JASA 3CUVA 2RHDA 3SI7A 4GIBA 3CVYA 3K04A 1W3EX 1KPGA 1RQNA 3KYJB 2OXCA 1A2BA 3PI7A 3UJPA 4HP8A 4DANA 1JQEA 3JWGA 4YQFA 3O0DA 3O3OB 2MOKA 3NH6A 3T3EA 4PNHA 1KJZA 1IDSA 1WLSA 1WB7A 1EDEA 3AR6A 4P86A 4PS0A 3HDGA 5IAKA 1UBLS 4C88A 4WZBB 1SQPH 5HY4A 1JU4A 1OBHA 5LA6A 2G5CA 2WTMA 3KM0A 4IDHA 4WNYA 5HCUA 3WGOA 1MPXA 5CEFA 5AVUA 3IP8A 2A5YB 1FVOA 3KZIZ 1NFRA 4P54A 2H7CA 2HREA 3E86A 3ZN0A 2UZAA 3DKRA 2AFHE 1VF6C 3BA1A 2MSWA 3GFRA 1N0NA 1NKSA 2P9YA 1T6YA 4G01B 4XYMA 3E5RA 4FLFA 5EKUA 4QYIB 5FFNA 4MQ6A 2BWJA 2I2WA 1CR1A 1A82A 4UTPA 2V45A 3G71F 5KYUA 5JR3A 3Q1LA 4QD3A 3TOVA 2ZIZA 1TL7C 2ODAA 3I45A 4BEJA 5AVYA 4RW0A 3EGOA 1WMBA 2OD9A 3PPWA 1Q11A 2HD4A 3F7MA 4D6PA 3GJ7A 1N0IA 2MINB 3NC4A 3GAFA 3R0XA 1I9GA 1MDFA 2JFFA 2PT6A 3D7SA 3H9JA 4JGIA 1RIIA 3GPLA 2R79A 3RBVA 3AB3A 2GCNA 3CR8A 4EQZA 5H6RA 2IRWA 1I5OA 3HJTA 4RM2A 4ARAA 5JNTA 4K9SA 2UYQA 3SJ7A 2QKYA 1W40A 2Q3MA 4G4JA 2EFHB 5KX5B 4ANFA 1DMSA 3EPJA 2B82A 2CMKA 3UO8B 5KHJA 2Z6AA 1WEHA 3CR3C 1YFJA 4FB4A 1TCVA 2Y1FA 4EUKA 2CK3D 3OKAA 4HAXA 1OWLA 4LXXA 4PO8A 4XB6B 5CNIA 4B3MO 2OXIA 4ER7A 4OEHA 4EB0A 1CRQA 4BEWA 4EBFA 3I01M 2CD7A 1S5JA 4OHOA 3HR0A 1XKTA 2P75A 3LUKA 3ORQA 4Q4LA 4MVSA 2A59A 4XB2A 5LIRA 5GGXA 4UVCA 1O58A 1GAJA 2H3OA 4JBWA 2EIJB 5K6AC 4EI2A 4B62A 4UEKA 2ONYA 4FR2A 1N1MA 4ZEOA 1QR6A 1VJCA 2PS9A 3ELYA 4HEA6 3QPVA 3WS7A 1NW3A 4FKMA 2X9QA 3KB8A 3O92A 4BZQA 2QLBA 4KOEC 3MBIA 4J6EA 1D1QA 1M34A 2PBFA 4HNRA 4NV1A 1YE5A 1F4PA 3IXMA 4CKEB 5KIAA 4AMGA 4IDOA 5L3DA 2IYLD 1E1RG 2ZPTX 3NHFA 1WZIA 2E21A 3TUIC 3COJA 2V4DA 1U7ZA 3D0QA 3EVFA 3HUEA 1AKNA 5FLEX 4AICA 4CKWB 2FEMA 5GTIZ 1V2GA 2JBHA 2CWDA 3R9XA 1HP8A 2H1OA 3KU1A 2QA4F 3TGLA 3A6LA 5GJVC 3OETA 4LCJA 4HWGA 4YRSA 4YCLA 1ZUNB 4CH6A 3CSDA 3CPEA 2WLLB 1ZQ1A 3GG9A 3FWNA 2Q4RA 2WA2A 5JLJA 2WNHA 5K0JA 1P49A 5KQPA 1ISGA 1KQPA 3MOIA 2B5WA 3LUHA 3F5QA 2BFPA 4KDFA 5JANA 4NB5A 2HT6A 5HJ7A 3TDMA 2JA1A 5D85A 3TG8A 2XLBA 4X1KB 4KXFB 2BFBB 3DE6X 1C9JA 1QKKA 5B3KA 3QRWA 2JJ2D 3VZRA 1QO9A 3QITA 4CQLB 3LLCA 3QWBA 4RY9A 2ES4A 3F3YA 3ZLVA 3HDHA 3EIQA 3EQ8A 2IP2A 4I9NA 1PKEA 3IB6A 2G28A 3AUXA 4BRWA 1XTTA 2GEKA 4FXPA 3T4UA 2W7TA 3R0IA 5DIZA 4GT1A 4DLPA 2G88A 2VJDA 4FGZA 2R7NA 4UCXA 3IVMA 4C30A 3UAYA 1TM1E 1EN5A 3SYQA 1VCMA 4MW7A 4ZIRA 4XGNA 5CTJA 4YJHA 2EWCA 3RSFA 3V3KA 2WJWA 3A6PC 1U1FA 2W0FC 4F5DA 3ZHUA 5H81A 1KO8A 3B36A 2R8XA 1LBEA 2VZ0A 3L1HA 2X15A 4XPZA 2EKQA 4XIJA 3ZYCA 3CNQS 4OMUA 1JPNA 1M1ZA 2JS5A 5IWAB 1J0AA 1NP7A 2ZJ4A 4Y98A 4ZVQA 3CZQA 4AJJA 5H9CA 3PRKE 4EZBA 1J8YF 4AKHA 5G4VC 4DA7A 4EY3A 2AGAA 3F7OA 3CVVA 4ARSA 4YRQA 4RA9A 4X24A 4ER3A 2GEUA 1XFAA 2CHGA 1YEWA 5FEUA 2GTIA 3MJTA 4J0JA 1MJGA 1ZBQA 2H57A 3WVNA 2R5WA 2XDWA 3MAAC 1ILEA 4CBCA 1Y3CE 1AQYA 3TVTA 5D3MB 1EK2A 4ZRDA 5C7LO 3FSEA 1LUVA 3FDZA 3ZGYA 5JEDA 4K0KB 3U0OA 4I50A 1V9LA 2A78A 3AP3A 1NL3A 4KQMA 4YEDA 4F4LA 4K28A 5F4ZA 5T41A 2OQ2A 1T0AA 2FN9A 4B0PA 5KDOA 5C51B 1KU9A 2QQGA 2ERXA 2ZQZA 1WCV1 1ATZA 4IUYA 2GASA 4BT6A 2HK8A 2NSJA 5F7ZA 5FUVA 4WLVA 5HP8A 2M9MA 2ORIA 2P4UA 1RRFA 2YMPA 3GGDA 4QDJA 1N9ZA 3WWOA 1BJTA 3R0PA 4JN6B 1GU7A 3C1AA 1C29B 1W19A 4PLYA 1DBSA 4I5IA 5T4HA 4I7ZB 4B7KA 2JEUA 1VQ8F 3B3QA 3LXRA 1N9GA 2GN4A 1YHZA 4ZQEA 3BEHA 3EVNA 3L73H 4Q1EA 4TS4A 3UK6A 2IXAA 4ZCIA 3I5XA 4R1PA 3NOQA 1ZM3A 4B6JA 1DTSA 1E2QA 1NPYA 2XWSA 1L4UA 1GQFA 3AHFA 4LIPD 4YAGA 2P11A 3DPUA 3LUGA 1NJGA 3DWEX 4RPIA 2X7XA 3EDMA 3HVIA 4C22A 4L87A 1Q8RA 2NVBA 2PGXA 1XEXB 1CY8A 3UWMA 4HDNA 4X65O 4LJLA 3IAM1 1T9GS 3B09A 3OX1A 1Z5GA 1RFYA 1Y8CA 2C3PA 5GV7A 1TO1E 3SXPA 1F2TA 3GLIB 5C9ZA 1SCJA 1C7JA 2GBFA 4D0RA 5IM4A 3FYHA 3TLKA 1S5HC 4HAUA 1BKSB 2VBCA 2MW2B 4KGZA 4L2IA 3T7SA 4M9UA 2ZOVA 1GG2A 4EY6A 2MT9A 4H1WA 2AI1A 5C1BA 5FYDA 4DREA 3O8BA 3CCVF 4M98A 3CURA 2WKWA 2P4EA 2FPUA 4C29A 4NR1A 1JFLA 4MKFA 3WYGA 5CH3A 7GPBA 1NQOA 5HPYB 2HAEA 4Z0HO 1Z4MA 2RG1A 4DYVA 4C7OA 1T1SA 1LV7A 4GI5A 3AERA 3H4VA 3ND7A 4OJYA 2PRYA 3EQ9A 5BOSA 4HEQA 3UTDA 5C81A 1B6SA 4TYQA 1GTSA 1KK0A 1O3YA 4IDGA 3ZCSA 2BMEA 3FF4A 4N5HX 4X97A 1GO0A 4FXOA 1LQUA 2BLNA 1X0VA 1YR7A 3BMXA 3SBEA 1U7WA 5CB4F 4BNVA 2H1CA 3IP9A 3PQ6A 5T3YA 1D4OA 4BGEA 3K14A 4M54A 4LJAA 2OFPA 3ERCA 2WJJA 3BS4A 3DVQX 2BM9A 2KB1A 2F1MA 2WHQA 4OJTA 3V4DA 3BXEA 4NNPA 4PWYA 5A9SA 1KYXA 2DPXA 2RB4A 3JTEA 3OZGA 1IZYA 1PF5A 3GVMA 1N5OX 2RI0A 2ZSHA 3N6XA 3FM9A 3LT4A 3O4RA 4KL8S 2HS4A 1QHSA 1Z0IA 3REGA 4LF8O 3NEYA 3CXCU 1W0JD 3PZRA 4FIDA 4YRMA 4BWAA 2WAAA 4G9EA 2BGWA 4IV8A 2P5UA 3K15A 2V3CC 2DECA 5ALWA 3PUIA 1VCHA 4NZOA 3OLWA 4UOQA 1OI2A 3WE7A 3OUFA 1B0ZA 1V6AA 3ID6C 2QTFA 3NHWA 1ZSYA 1X8XA 3M6UA 4BT5A 2A57A 2NVUA 5CIWA 3AVXA 1XZPA 1D2DA 1OW3B 1V95A 4FHGA 4IIUA 1DO8A 2X22A 4BX9A 4ERXA 1KKMA 1DF5A 4UCRA 2AVDA 3IQEA 3CCQV 3Q9LA 4P3NA 1RBQA 3WWEA 5I51A 1GADO 3K70D 4OGKA 3SYKA 4UUOA 1UK8A 5LBQA 2WPNA 3H16A 2MDTA 4MUNA 5F2KA 1YZYA 2VAVA 4C7BA 1KDRA 5HXAA 4C7VA 4KYUA 4F4FA 1A71A 2RGWA 1AGYA 3ZW8A 4PR3A 4R1SA 4CM1A 5CEEA 5L6MB 1YVPA 2ATKC 1B0UA 2BW0A 1N6HA 4PZUA 4YJFB 4XLZA 3L6OO 2OTLF 3N74A 1Q19A 1XYVA 4XUCA 1T2AA 2V6JA 2HWYA 5EPEA 3K9SA 1RWWA 2YJ5A 3JZDA 3L7AA 3ROZA 4AS2A 4BC0A 4EM6A 1VK3A 4A0FA 5JRJA 4NECA 4Y9UA 3HSKA 1EDDA 3AIOA 1KEEB 2HA5A 3OCXA 1PJAA 4AN0A 2YY5A 5FI1B 5JDIA 1G2OA 4GZ6A 2PIDA 5CVJA 4LMRA 4JBXA 4HEJA 4O59O 2QRKA 3TIXB 1U1GA 4YFYA 3PUHA 4RVOA 5SY9A 1Z2EA 1ECGA 2JJ1G 4RO0A 2JIOA 1QO7A 1E7YA 3UN1A 5C5CA 4EKNB 4K0RA 3OJWA 1I30A 3AUFA 1NT4A 2PE5A 1GA6A 2PD6A 4W1QA 4B3IA 3MWYW 2N75A 3KXIA 4LJ7A 4WXRA 2YY6A 1VSVA 3PCRB 4DEXA 3KOYA 5K6AA 2WQ7A 4P0PB 1L8LA 4BVQA 4GLLA 4YRIA 1N7JA 3ZZMA 4A27A 3HNRA 3BGSA 3STXA 2J9YB 3MWEB 1ZCJA 4AQ7A 3QO5A 3QEOA 3BTUA 4RANA 4P35A 1E9RA 5KNCH 3WIEA 1SHJA 4S2EA 1ZGBA 2FC3A 2CVOA 3PICA 2IWHA 2JAQA 4AJ9A 5KNLA 3AI1A 1BCRB 1CUBA 1V35A 5AI4A 2VP3A 4OREX 3ROFA 3V1KA 2CLMB 3BK2A 3IP1A 4KN6A 2ZGVA 4RJLA 3DV2A 3HDTA 1R8JA 5DI3B 4BNUA 2NXJA 3PJDA 4HADA 3VKWA 1U99A 3V7YA 4BFSA 2W22A 1QE3A 3AU9A 3O3CA 4P3XA 2RQ6A 1M6YA 2AG8A 4B6QA 4ZHVA 2BEWA 3R8FA 1MRSA 1PJQA 1I80A 3PAFA 4ZI7B 1NBMA 1G21A 3HBAA 3HEMA 3OCYA 2HT1A 1QH1B 3U5TA 4RIFA 2AQ8A 3PF8A 1J8VA 3ZUGA 5J4HA 2ZT8A 4WDRA 4G5QA 2DEUA 2LKCA 4XLTA 2XMPA 2ZQ5A 1FLNA 1GPKA 3B6ZA 5LMZA 1IY2A 1LSSA 4BO3A 4B4DA 1U63A 2Q5EA 1DQPA 4DQLA 2K2QB 4RAIA 4BFWA 4MUYA 1NZJA 3ESJA 2C4NA 2EFDB 2ZYDA 5JYCA 3EJWA 3DNPA 4DC9A 1E98A 3CPJB 1TKAA 1YDMA 1HDGO 4KVFA 1RABA 2ZTHA 3MHSC 5DB4A 3CEJA 4I9GA 4R98A 4QO8A 2Z6QA 2HSJA 4AZ0B 4UM9D 3WK8A 3FD8A 2VYVD 3PXCX 3L0OA 1YKSA 4GXQA 2ZK7A 2QBYB 1RM3A 2DW4A 4Q1AA 2CHFA 3CVXA 1VP3A 3RT7A 2PX8A 4FFKA 3EPRA 3SOZA 4B09A 4K0KO 2B2NA 2DOSA 1P9OA 1KOFA 1SXJE 1Z4PX 3JQDA 1M2KA 1KI2A 1AGPA 4GKVA 4PEVA 3KSBC 3I9OA 4J9VA 5CBPA 1UC8A 3M6MD 5IWCA 4XD2A 4QYTA 3HN2A 1TT7A 1PWXA 2XT9A 1USVA 1V16B 2XIJA 3OEEA 3F5WC 1DOZA 3WSTA 2QA4V 2JS3A 1O77A 2C2MA 1UEXC 4GC5A 2QGZA 4NMMA 5SZKB 3IHTA 2GXQA 3GOHA 1M2VA 3Q41A 3WYEA 1ZR2A 1QBGA 1UJCA 4W5RA 3BCHA 4CDGA 1LR1A 1I1OA 1FMLA 2WTBA 1VJ0A 4PPYA 5KNBA 2X1MA 3OX4A 121PA 2H4ZA 4LBEC 4ZP1A 3OLXA 1S9HA 3H2GA 4TTJA 4D92A 1PAUA 4O4LB 4IIFA 3QMWA 1VQ6V 3C3JA 1CT9A 3CZPA 3DO8A 3PVCA 3OEHA 3ORHA 4R1OA 4HCJA 2ZJOA 1OX4A 1TW3A 4BJ5A 3W9YA 1D2CA 2DQYA 2QN8A 4BS9A 2R86A 221PA 4PX5A 4AMUA 1YZQA 3FVVA 4PA9A 1OT5A 1RHQA 3LSYA 2CE4A 5IAOA 5KYTA 2UYNA 2HLHA 4S1WA 1EFKA 3SPGA 4RETA 3U37A 4I36A 2Q2VA 1E6CA 3LRTA 2UVQA 4I2VA 5TF4A 4CF7A 1RC8A 1XREA 1XP8A 4MWZA 2PMCA 2QWQB 1PT6A 2ZYHA 1X70A 3OU7A 4NBLA 1MEEA 3JY6A 4ENSA 3RWRD 5C8YB 4KPFC 5EBMC 3OCCA 3WQSB 4FJ0A 1VP7A 3CLRC 1XVVA 2FV8A 3KWLA 2XYRA 4NMXB 1HT1E 3C7KA 3G8YA 2RGXA 3VIUA 4MKHA 2DUMA 1A1SA 1U3DA 2F67A 3SDLA 3EVCA 3X1JA 3QX8A 5CB0A 4KSBA 3NB0A 3IUQA 2W2VA 4RKYA 3ABLC 4R9NA 4AUNA 4ECAA 5AW4A 2FDCA 1PJ3A 3LC1O 4CEHB 4JI1B 1HZZA 3PVSA 1IBRA 4NC9A 1ZVVA 4BU0A 2EQAA 4IOKA 2BFDB 1JJFA 4AXXA 2QAGB 5KQGA 3ZS8C 1WF3A 3GFOA 4M1QA 5DCUA 3AK1A 2ISSD 1M4UA 1Y3HA 2PBLA 3GK3A 2BR5A 3E81A 4BX0A 2B1IA 4AKSA 1W4CA 1TU0A 4I6JA 1BNCA 5F51A 3BRCA 3QTCA 1FMTA 1YCFA 3KHKA 3PUYA 1SULA 1ND5A 1CU1A 3CNLA 3D4OA 2Q4DA 4WECA 3O1IC 1HNWO 2FZWA 2HXSA 2FW8A 5L7TA 4KO3S 1L3IA 4C0JA 4U39A 2LJ2A 4GLXA 1DCMA 1UDCA 1YBMA 2C99A 2IHYA 4P4UA 4WJZA 3I5DA 5A3VA 3U40A 2PXAA 4KWCA 4LF7O 4CLOA 4Z4QA 5FL7D 4Z1VA 3QBVA 4PPGA 4CR6A 2ZR9A 1BWRA 5LU8A 4Q34A 2CLOB 4UHFA 1H94A 4Q9HA 2HRBA 3U26A 1XF9A 5JPIA 3SHQA 1F7VA 2IH3C 2YZKA 3I2KA 4F5YA 2Q67A 5ALJA 3LVBA 3OZSA 3EE6A 4P4SB 1CUXA 1UBNA 2XSZD 4K03A 1E58A 2IDKA 2WLHA 4XWTA 1QGED 2ISQA 4LYHA 1XLUA 4CKBA 4TYYA 2CLFB 3AG3B 3O74A 1VGRA 1EK5A 3CNBA 1FFSA 1RZUA 3FDXA 4BMCA 1TM2A 2RGUA 7AT1A 3GPDG 1JEEA 4QEKA 1L7BA 1IHXA 4X45A 5E2AA 1WL8A 8ADHA 4JBGA 1SBYA 2NLJC 4G36A 1G0NA 4QQNA 2RH8A 5AHRA 5A1TA 1M5UA 4DCSA 3HHEA 5JC8A 1O8BA 2PFGA 3ZLUA 3W5HA 4RE6A 2LIPA 2P2YA 3GB9A 2ATCA 5CM9C 1U1DA 3UY4A 4C2BA 2YQ4A 1G42A 2DETA 4XXHA 1FRQA 3GEDA 4DZRA 1G291 3R3UA 2XZOA 5D3KA 4D2IA 1RHRA 3ZU3A 2LNDA 2VDUE 4KX5A 4MUXA 4PFQA 4RA6A 3SPJA 2DAPA 1EFTA 4J1NA 4NBTA 4BCDA 3Q10A 2B98A 1ZLXA 2W8BC 2K2WA 2G5TA 2WLSA 1OCZB 2GKGA 3STYA 4ATNA 4YRRA 4KP7A 3LE8A 1EXMA 1FDVA 5KCMA 2IYRA 1A97A 4QC2A 4RMNA 3WLFA 3COPA 1VPLA 4NX2A 4IUBS 1FYEA 3MRTA 5CLJA 2IPLA 3HVKA 4BO4A 1FMCA 2J5BA 4A3SA 2RBKA 5AD1A 1LY1A 4POOA 5JXIA 4DLTA 1VZ3A 2ZI7A 1R73A 1F1JA 1V43A 1WDLA 1MD9A 2BBTA 1V6CA 2ILVA 3KRTA 4TLAA 3X2SA 5HRCA 5LP1A 3DZFA 2V03A 3LGXA 3RSHA 4J29A 5JISA 1AE1A 3QELB 5G4UC 2VQ3A 4LV6A 2CFRA 2IGBA 4M1OA 1RJ9B 3UFXA 1XTBA 3N2ZB 4R8RA 4XASA 2ERCA 2ZG6A 5F35A 4A10A 4C6SA 1K5GA 2K5UA 4UUNA 2XYHA 2C2ZA 3M89A 4NE2A 2R60A 4XYEA 3PEEA 4A4DA 3V7QA 1JG6A 4FGWA 5IJ0B 1PBTA 1PJ2A 1V54B 4ISCA 3S8EA 1G8PA 2DLCX 2OIGA 5BW6B 1IHOA 3UJ8A 3UM9A 3KUDA 4J0HA 1E0SA 3FYEB 3J81A 1V25A 3LX4A 3SJAA 3I04A 3CLSD 3X1DA 4DQXA 4GBED 4CKZA 2RJ3A 2VS1A 2UVPA 2D2IA 2VWPA 4KQCA 1Y98A 4Q18A 1DRKA 1J97A 2C92A 4HX9A 2QJOA 5ENVA 1W48A 3IQDB 2MK3A 1ENYA 1MKYA 1ZA1A 1VDMA 3N6VA 3CCQF 2J0UB 4V0KA 3JAWB 5ALLA 5GIPE 2COKA 4FZ5A 3QKUA 5LXTA 2ZR2A 1GLGA 1PV2A 4NHOA 1DC7A 3MOSA 4RQUA 3W8DA 1BMFD 2BEJA 3PIRA 1P1FA 4LDNA 4J16A 4XQCA 3AG1B 1P1JA 3FROA 1QHEA 1U7HA 4BTVA 3RBXA 3WI7A 4ITUA 2WMOB 2NIPA 4FI3F 2UUBO 1Z25A 3W5VA 4LPKA 4UBNA 1JJBA 4U7TB 1XYYA 4DSUA 4R2IA 2FSUA 4LY9A 5A5FA 1BXRB 1N5KA 4IYHA 1O97D 1GM7A 4DR7B 4EPVA 2VUTA 4KVAA 5E38A 3Q3VA 4ZCTA 1KBQA 1WUJS 3CUSA 2KB0A 3ZZTA 3PC7A 4G5RA 2OWOA 1ZW6A 3AVUA 1TM3E 2QXYA 5NLLA 1GPNA 4IIJB 1L1RA 2C2XA 4DXHA 4FNOA 4A5OA 2WFLB 1EGQA 4J9YB 1CK2A 3Q72A 1SQ6A 1YIOA 2C3UA 1LUWA 2WF5A 5EWLA 4ZA2A 4CV1A 3SPXA 4NQZA 5L3SA 2FK7A 3BFRA 2C2WA 2Q27A 2WG2A 3F5DA 2JGUA 1N4CA 4LWQA 1FTWA 4O08A 3S2SA 2OV2A 2KTVA 3CCJF 4B3SB 2DGDA 4DPKA 1KRWA 1E9FA 2QTGA 2I78A 4H3SA 4A2CA 4F4JA 4F6LA 3HKBB 2P7TC 4WD3A 4DLYA 5DGXA 421PA 2LBTA 2J5QA 3VPBA 4BVLA 3H65A 2G25A 1Z73A 5F5LA 4QUBA 4XUEA 4CG1A 2JEXA 3L9DA 3SGIA 1QJCA 2CGEA 3GZNB 3GRYA 2FF7A 4ENTA 1BVUA 1QQ7A 1KERA 4JYAO 4BWYA 2BE7A 1HDCA 2HQ1A 2I2BA 1OFIA 2JRCA 4WOBA 1AUPA 5HGXA 4G1VA 1AQIA 2EIMC 1SCNE 4HLQB 3BFXA 2ODTX 2QMZA 1X1QA 2O06A 3JAMN 1LW7A 3DVRX 3ELBA 3A37A 3QPWA 1HLGA 1ZOPA 4TXLA 5F1PA 5HRUA 4C0AC 4C4TA 3QX9A 4TKMA 3RO7A 3SDSA 5KTPA 5FORA 1MRZA 1DXHA 3D7MA 1PQWA 4V0LA 5FLXM 2FB5A 1JR3A 1ZP6A 2JGAA 5DV9A 5IVKA 2WFAA 1XZKA 5EUCA 3KCNA 1C0LA 1SVLA 5BQFA 3G2IA 2KQXA 3AJDA 4BEBA 2WUEA 2DPLA 2PGDA 2XEXA 4PG5A 4PRYA 2NO6A 4V3BA 1K9VF 2FPLA 3UICA 3PEWA 1JA0A 4G0QA 1AP6A 1OHHG 1FLVA 4ASUD 1MC4A 5I47A 4RWUA 2AKAB 4RCZA 4OI0A 1KDOA 1MF7A 5JCXA 4RF4A 1J9EA 3UK7A 4ES6A 2IY8A 3B1WA 3SPCA 5IVHA 3GFQA 5I8PA 3B8NA 1PYOA 5A6VA 2Z9BA 1HOXA 2X2FA 4MSUA 3OZVA 2CZGA 2C0QA 4QUDA 4Q9KA 3GFVA 3WRXC 1JQDA 3LUDA 3PSHA 4CMCA 4F3TA 1YS4A 2HSGA 5BSHA 1YT5A 1AI7A 3WKAA 3PQ4A 2ICAA 2CVZA 4K9NA 1JIVA 1JJ7A 2UYHA 4ODIA 4TS9A 2DC1A 1JEYA 2I65A 1B8VA 4CEHA 1SD5A 1A8IA 1UKZA 3G2NA 4GXNA 4RACA 2DH5A 4YPFA 3HR8A 1WD7A 2FA9A 4JLNA 1T9KA 4OHFA 4PE5B 1UMDB 1N5IA 1TI7A 1T4BA 3FYSA 4FS8A 1RWVA 2R1VB 4WZ6A 3MS2A 5EIFA 2A33A 4E08A 1PK9A 1I5RA 3RIXA 5F3RA 2YYYA 2BZGA 1OXBB 1P1KA 1W47A 3GFPA 4OIMA 1HMPA 1IIBA 1IBKO 4OHPA 3HYTA 2BAGA 2KGWA 4QECA 4B5LA 4CQMB 3TQOA 2AC2A 1UBCA 4C3VA 2OCKA 3WB0A 4G0VA 1I2MA 4LQ4A 4CKCA 5I7WA 4DQUA 1JU9A 1U97A 1MW9X 1PSWA 2WMDA 4P38A 2R6R1 4NULA 5DSTA 2HRCA 1K5HA 1RI5A 2FQXA 1JR2A 1RAAA 2GCPA 2XMQA 1J90A 5F1KA 4WY2A 3TZBA 3O9VA 3U48A 2EZ4A 5FNVB 4DR6B 3SQXA 5CA0A 3ICOA 1K27A 2ATXA 1UQUA 3IOCA 2NQTA 1JI0A 1UIMA 3AVTA 1ZOLA 2H0AA 1L2TA 2O3RA 3C8UA 1KU0A 1T3LA 4JCCA 4XIFA 4ZOCA 1IXMA 3NIFB 4ZU3A 6GPBA 1BQ4A 1C9EA 3D01A 5JZMA 1KB9F 3RYFA 1CWUA 2HF8A 3OBYA 1WABA 5HW0A 1VJRA 1VSTA 1PT7A 4I81A 3EZ2A 2ZIGA 1E6EA 2OFWA 3VA7A 1QVFF 3U11A 2CE2X 1Z6XA 1L5NA 1V5WA 3N0TA 4N5DA 1QCDA 1C8LA 3QUWA 5T7BA 1NH2B 4DUGA 1J39A 2RIRA 4NBUA 3N0VA 5BORA 1QGZA 4V0QA 1NJ2A 2OPBA 5DM6V 1WHTA 3QWIA 1GA4A 1H1LB 5DX0A 3OQMA 1JILA 2VQEB 1G20E 1A9SA 2O0MA 4OU4A 4X71A 2GZHA 3BORA 2PNJA 3KZCA 1HDXA 4TVOA 2EDCA 1NIJA 3RUDA 5K1PA 4KQJA 1FFAA 1PNVA 4L5BA 2PCLA 4QU8A 1P2SA 2RCNA 3AEQB 4IDDA 4UVBA 4C9BA 3BMQA 3MTEA 3T4DA 1T36A 2D0IA 2P62A 3B6MA 3FRJA 1OCEA 4MVJE 1GSHA 2FWMX 5DM1A 1ZL0A 2KS6A 5BYAA 5GONF 1EK6A 2R00C 4E5PA 2IH4A 3C6QA 2A88A 2VHQA 3E5NA 3I28A 3PGVA 2F8SA 4TSFD 2TMKA 2AIFA 1AC5A 1SH7A 3COWA 4L28A 3TETA 1OZGA 2HA3A 1P7PA 4TYNA 4W9MC 3ZHQA 1KI9A 5EK0A 2WSIA 2O8EB 5J9PC 1TRHA 2AOVA 3GWOA 3VAZA 3A0HZ 1XCLA 2DBVO 2I4TA 1SC6A 2X41A 2P4SA 4G4IA 4MRSA 1T0BA 4MTXA 3MFYA 5LLSA 5K6RA 3OP1A 4LF6O 5CBFA 1SUSA 4EGJA 5EHZA 3NM6B 4UQPA 3WK7A 1LBSA 1QRTA 1UOQA 3O1HB 3S28A 3DLAA 3LVQE 5C8XA 1S7GA 4PAOA 2AN3A 4OHRA 2DR2A 3G2KA 1O94C 3WNCA 1P4SA 5LN1A 2C5GA 3MMSA 1CE8B 2DBZA 2DN9A 1RQ2A 4BKPA 2P1DA 3FR7A 3EGCA 1DI0A 4K2AA 3D3QA 3X44A 4PGHA 3AINA 3HJWC 5TS2A 2QTSA 2QL6A 5KTOA 4R0NA 3KR9A 5DP1A 3EUFA 4Z0NA 2AEMA 1TVMA 2Z57A 3B5JA 1ESMA 2BZ0A 3OFSA 4PXYA 2NOAA 1PDOA 3E58A 3KJIA 4NBSA 10MHA 4KNYA 2V5AA 3K5IA 3FPBA 4TWKA 3SJCC 1XLVA 3KXPA 2Q0HA 3ZGLA 3E3LA 4NEGA 1RI3A 1TTHA 2PUWA 3D4NA 3OFND 2O1XA 2XX3A 4NYJR 3T52A 3RFRA 3K8OE 3VSCA 3OICA 1CUUA 4HTAA 1X8KA 5G3ZA 3G7NA 2Q6LA 2KPOA 1OPRA 1YDEA 1E9CA 2I1LA 2YXEA 4IFIA 4LCUC 4RS3A 3MHHC 1BDMA 1W0KA 2ZVQX 2Q5CA 3TKYA 4UM5A 5JS8A 1U2GC 2JLYA 2CTWA 4KUEA 1C1XA 5CLIA 4Q9JA 4TMWA 5JNLA 3HN6A 2JI8A 4B87A 1Z0DA 1NAIA 3JQRA 1QHHA 1XVUA 2I6GA 1SVIA 3ITEA 1VJ5A 3KSZO 4TT8A 5E7QA 4MLZA 2IS1A 1QU7A 1YCDA 2AUNA 3DAGA 4IOMA 1J5EO 9ABPA 4RD2A 2OGUA 4CYMA 3RAFC 1GRJA 2P2CA 2EIMB 2Q1WA 2Q4BA 5KUMA 2YVKA 5HJ2A 3TEMA 2VPIA 2P0EA 4N76A 3GXBA 1UUFA 3OWXA 4TX1A 3ZXYA 5HKKA 1N2ZA 3MGKA 1I9CA 2IVZA 2WM3A 1XWIA 3OIYA 3V8EA 4C76A 1A3CA 4ZIBA 5LSAA 5IKOA 1JTEA 2XIQA 1RAEA 2QVGA 4NJMB 1S89A 1OCCC 4MHSA 3CEPB 4KYTA 3GQBB 3JPYA 2EVWX 3MGGA 1L8OA 1TIBA 1PO7A 4UUMA 5EMKA 1E5TA 4GLFA 1NN1A 4ZEMA 1WVGA 2ZQMA 2PO7A 3FLAA 4QG3A 3I3SR 5MN4A 2VPZA 4HGRA 4KYIB 3VO8A 1V8FA 4ZO8A 2PTMA 4Q3NA 1W8DA 1QF7A 5JADA 1VYVA 2XT6A 3N07A 1TZJA 2ANCA 2IXGA 3TJTA 5BYBA 1YNSA 4R0MA 4DXWA 1NM5A 1UAAA 1CP9A 1FC0A 3DFUA 1I2BA 5KNBH 1XEWX 4LXYA 2HDHA 4N8SA 3UFBA 2AQIA 4HGZA 2CUTA 3PNBA 5KWEA 2CH7B 4FZRA 2D3OW 4KIGA 3NORA 4C1NA 4H77A 1X1EA 3RK4A 2EZ8A 2NZWA 5I4IA 3I9LA 1OXVA 2ZBDA 3AY7A 2Q6TA 3QLUC 3F5TA 1Y4ZA 4DGSA 5LOVB 3ELUA 1HUQA 1KAOA 3EODA 3LM8A 2RGRA 5LQJA 2FW6A 3NVAA 1QDEA 2PJUA 4FJCC 4DUZO 1DG9A 1TDJA 2Y1XA 4JEMA 3I9KA 5DMHA 3UJCA 2I7XA 2HV8A 2YX1A 1ZIXA 1XLWA 2IDMA 3M3HA 3D6MA 3S1LA 4Y30A 4G4GA 1HEUA 2Z5UA 4PS1A 4Q03A 3PV0A 4X63A 1GN6A 3ABSB 5DTMA 2FN8A 2M1XA 2YOGA 5F64A 3UTCA 2DFKB 5FWDA 3V4FA 4ETNA 3LCVB 4L73A 4X66B 2YUAA 3V97A 2FLKA 4EX7A 4RLHA 2ZUBA 3AUJB 4FN4A 3GEBA 4XPIA 5AVZA 4FPXA 3ROEA 4D42A 2ZDGA 1J09A 4IT5A 1T2FA 4HFJA 2OCAA 2VK2A 2UXDB 1JL3A 2ZROA 4JUIA 3ZGVA 3ZG6A 1TZBA 3E8GA 2YNMD 4WESA 2JJ8A 1VMAA 1ZH0A 1N0WA 3QEAZ 1GAQA 4JZ2A 2AK3A 2P3LA 3GGOA 3KALA 3CE2A 3AGQA 5HS6A 5TMEA 1WXWA 4F46A 3HB4X 1UL1X 2FMXA 4J07A 4NHEA 2EP5A 4UW9A 1DBVO 3BDVA 2HXYA 1VQ4V 5HRAA 2GVIA 2AOUA 3QA3E 3RSCA 3RS5A 3IVAA 3EGDA 4DQKA 2IKSA 5HIKA 1QYCA 1K7EB 1QGDA 5B8FA 2PSFA 1C9DB 2WJ6A 5T3UA 1KDYA 2R4QA 2XADA 3C3PA 4AO8A 5C4IA 5KREA 1OJHA 3C5EA 4FYWA 4IZHA 4JLOA 3FZEA 1PP9H 4O0LA 5KCZA 3OR7C 2AZMA 4IQ4A 4RL6A 3TX2A 2R8BA 3G8CA 4YRCA 3V2IA 2GN0A 4R54A 3BD8A 3GJZA 3KEOA 4KXUA 5LLTA 2QIPA 4X54A 1XZDA 1SKYB 1VTKA 1NVFA 1Z2DA 2A7XA 2G0AA 3HCBA 4OQQA 1H93A 4BYGA 2P9JA 1KRXA 3BSYA 4ZAZA 1NTKH 3V4SA 4TWAA 2P79A 1QCCA 3G3EA 4LHXA 4YH1A 3BABA 5EUBA 5H8WA 1DOHA 3VX3A 1RAHA 5CVDA 2RHOA 4ETWA 4K81B 1OLSA 1D1SA 3AF2A 1FP1D 4HK4A 4IPTA 5E6RA 3PQCA 5EFZA 4D56A 3IQGX 4TMXA 4TKVA 3G68A 3CG4A 3G2OA 4EP1A 1T4CA 3HKCB 1OUMA 3WL3A 3ITDA 2NYVA 2ZB4A 3E1GA 3DL2A 4GP7A 4UHCA 3V7NA 1NJSA 4IL5A 3FSGD 4KNVA 3WWZA 1N5LA 1RC0A 1VHWA 5CVCA 1JFTA 3NDBB 1UKAA 1VE3A 3IJ5A 3O4FA 3ZJZA 4MKGA 1LXCA 1H65A 5BV0A 3JZMA 4ZEWA 3K9AA 4LGMA 1AIPA 4KJZA 2A9OA 1R0RE 5CM8B 1J5EB 3PX7A 1PEAA 3UUFA 4AF7A 4BP1A 3PDWA 2LW1A 2FQQA 1CUGA 3K8ZA 4INAA 1L5KA 4I0XA 1KAEA 1P1HA 1YZHA 1KI4A 1G8AA 1ZGGA 3DLIA 3OOYA 3ZR4B 3ADKA 5IZCA 5HKAA 5FTMA 3VYUB 3GBVA 4YRNA 5IULC 4BO1A 4PFSA 2JPDA 1F9AA 4UAGA 4WCVA 4CLDA 3WBJA 1A9TA 2GLUA 1JSZA 1N2BA 2WNIA 3A14A 3VGJA 3VTKA 5I9NA 3ZY6A 4ZK6A 1GG9A 3CPQA 3W2TA 5DN6G 1COZA 2QRPA 1XZGA 1T6NA 1ZVJA 3L74H 1I6LA 3ZHVA 4D74A 2FOXA 3M4SA 3HFGA 2QUHA 1FBTA 1DDGA 2VT3A 3CH4B 2VK1A 3NBQA 4B71A 5KWSA 1C4KA 3UGQA 2D7CA 1L3BA 1NDUA 2W6QA 4YALA 4PN3A 4RD6A 3NVKI 4GYYA 5AM1A 4BTEA 3IUSA 5MFPA 2PXCA 2EFYA 3CZ4A 1T15A 3F7YC 3PDIA 4LYFA 3LBAA 4PICA 1G5FA 4JJFA 2WWHA 3WLTA 1I8TA 2V4MA 3C3CA 3LP5A 3OE5A 4G89A 4HNAA 4TVBA 3SOPA 4AY4A 2AKEA 3ICQB 2IXTA 2OHJA 3N27A 2NSYA 3H5NA 1HGXA 3I8XA 3H19A 2IJKA 1CUEA 3L4BA 4EGFA 1N25A 1Z5VA 2H63A 2HADA 3NPMA 4IXWA 4EEKA 3FOZA 5CA0F 1D5CA 5EN4A 1JQKA 3QJGA 5TGZA 5LQUA 3EDOA 1N92A 1TJ3A 4MZDA 3BIOA 5GAPK 3MMNA 2O5RA 3OTFA 4B4OA 2I4IA 1QTNA 2VDOB 3HL0A 1PYDA 3CTMA 4DV5B 2FPSA 2VJYA 4YCMA 2QTTA 2R1TA 2ZREA 1E0DA 3JR3A 1NVBA 4NOKA 4FI3C 1MUUA 1WO8A 2ABWA 1BKDR 4UVHA 2NPOA 5C31A 3W8FA 5I7RA 3J7TA 2X40A 3WK6A 4QOHA 5JSQA 1PUXA 3K2XA 2R62A 3BEDA 3I58A 2B9VA 4YCAA 4DLZA 4E14A 2IP4A 1II0A 3O85A 3KE1A 1VB5A 4I1YA 3ND9A 1R0CA 4EPYA 4EA7A 1Y33E 4WNIA 3LPDA 4AJOA 1PJCA 1PWEA 1UJ4A 3K09A 2O23A 3RYCB 4CF3A 1BCSA 4J9UE 1FFCA 4FNAA 4BUZA 1E79A 1PWYE 4AYTA 1MIHA 4DV4B 2I3ZA 3JW8A 4FD2A 4I5EA 2P3QA 1JPUA 1ZAKA 4IW3B 4MMYB 1E2DA 1MORA 1XA3A 2H9AA 2OV8A 2PXXA 3BXPA 3OQBA 4Z9XA 1Z5UA 5EQTA 1SBNE 1GTL1 1E6WA 3P4EA 2PI4A 1L4LA 1SUDA 4N1AA 5AKZA 5DLYA 2ADQB 1CK4A 1UP7A 1HDJA 5F9FA 1JB1A 1CQZA 4QQKA 2OHHA 1WULS 1YUMA 1Y1PA 2JLAA 3BB4A 3BJRA 5HF6A 2G5GX 1W85B 2RKBA 1EFUA 2FOLA 4RELA 5FLKA 3ABRB 2W4IA 3H1GA 4FOSA 3K5MA 1OOEA 1U0NA 3FUTA 1E7WA 3WGYA 2XJ9A 2V8OA 4CLHA 1RBZA 3IMFA 3V4OA 3HADA 3W78A 4GMDA 4GL2A 3BY6A 3D6VA 4MWCA 3V4VB 4HZIA 2YC4C 4PYQA 2RHLA 1N8KA 1HE5A 2OY0A 1EA5A 1TPYA 5CDHA 2UDPA 1Q5OA 2OKCA 4J3FA 2ROQA 3UGKA 2UUOA 5T5QA 4FLUA 1RE1A 1M1YE 4QO7A 4RY8A 1KJNA 4ERNA 3JQAD 4DHWA 4ZKDA 4DUPA 5FBVB 2X4LA 4DMFA 2VHYA 1T8UA 2IZ5A 3P3PA 1X19A 3AUUA 3ZJTA 3LTEA 3L8DA 1J9ZA 3E6AA 2BISA 1OFGA 3F67A 3I9NA 4O5AA 4E2ZA 3HWUA 4Q7KA 3LWVC 1B14A 1H6BA 3VNQA 3CGGA 5HM6A 2ZM5A 3K9WA 3PS9A 3T4XA 2PTGA 2CXPA 2H3EA 1ZAYA 2VWKA 2Z0AA 2O2SA 2V8BA 2A84A 1ZLZA 2C4MA 3L49A 4D0NA 1NF8A 2XF2A 3GEPA 2DBYA 1U96A 3M1YA 1I2ZA 1AUQA 1QHXA 3NDRA 3R6DA 4S12A 4UEQA 5L3CA 3EC7A 2CNNA 3UMBA 5FHRA 2WYHA 1C3LA 3C6KA 4QLOA 1O6CA 4MLDA 4X3MA 1ISJA 4PANA 2CKDA 5HK9A 2AW9A 2CHTA 4G88A 5DBGA 4FEGA 2PD3A 1CQXA 3D0OA 1QIFA 1R37A 1K86A 1PV1A 1SIBE 3K0TA 4EFEA 2PA0A 2P0YA 4MQBA 1FEZA 4LF9O 2EJCA 2ZRLA 4L3VA 4P98A 1ECBA 4RZ3A 5F2VO 4XOUA 4YJHB 4EJ6A 2GETA 1U0EA 3EASA 3K0KA 4QELA 5ERGB 4P0QB 1Y3FE 1Y7LA 4CIVA 3QVXA 3ZWVA 1JMYA 2LVBA 3U61B 5DLEA 2Y92A 3GAZA 4EI7A 4HTFB 2ORYA 4MQEA 2VF7A 3EDCA 4F2DA 1VSUA 4M86A 5JPCA 4F6EA 4YRDA 1S8AA 2CLKB 2CDNA 1FSGA 4ARZB 4BNZA 3MVEA 3UXMA 4NEQA 1XROA 1BA3A 5LU9A 1FYXA 3EGXB 2EHJA 2AG0A 4YHHB 3IDFA 4FFVA 1H8HD 1RJEA 1ZWLA 5HY0A 3UATA 3JARB 3HJGA 5KMGB 3DMRA 3EIFA 1AI6A 3NTXA 1LJLA 1U8UA 1KFEB 1H8EG 4JI6B 1P2VA 3ESQA 1R3UA 4UBOA 2IP1A 1U8FO 1MVLA 2O2EA 5EGSA 1PF7E 4TL8A 4WKPA 2QN6A 3KKZA 3W9UA 3E7DA 4BUCA 1RYEA 1IUOA 1ENOA 3AVWA 3UHPA 2Y99A 1TADA 2C8LA 1L8QA 3GPIA 5B1BB 4I1VA 4B4UA 5B5SA 5I9IA 5L40A 4ZK7A 4DYDA 3LCJA 5JAIA 1Z63A 1FPMA 2XXAA 3UXHA 2BDUA 3AK2A 4JI5B 2GN6A 3E7FA 3HXPA 1OLOA 1VG8A 2XNDA 2C88A 2YMLA 2WZBA 4HYYA 1N8SA 1K8RA 1S9DA 1VL2A 1EFDN 1XZIA 3UPTA 4A15A 5AXAA 4GKKB 4XI9A 2AFRA 2O0KA 2H8CA 1S1MA 2JCVA 4FKZA 1EESA 3VV3A 3GJ0A 2E48A 1C0IA 1K0FA 1DKQA 1QK4A 2J6BA 2VF8A 1IN6A 5H59A 4FJ1A 3IBYA 3NAQA 2FUG1 3R4VA 4I9FA 2OO5A 4QIWF 2HBYA 1H0RA 3EG9B 2E5LO 1B6RA 3EDQA 3SBDA 3T7AA 3TE7A 1GZ6A 5H0IA 1XTUA 5KYKA 4RGYA 1Y6ZA 3BDAA 3DZ8A 2XAFA 2QEQA 1PR1A 5AVXA 3A04A 5M2QA 2ZR8A 1BC5A 4JI3B 5LKAA 4XA8A 2CGOA 4C87A 3TQQA 4Z1MA 1HR0B 3A9VA 4ITRC 1WSWA 3R7WA 5CT4A 2SHKA 3O91A 3T7JA 1AKUA 1FX1A 1Q21A 2I8AA 4JLAA 1JQAA 1P3DA 3B85A 4Z2WA 1CV2A 3N2NA 3ODPA 1U0JA 2BKXA 3HJRA 4BW9A 3O31A 1NXSA 3KQPA 1CJMA 4JVLA 3AF4A 4TSKA 4KQWA 5AOCA 2CLDX 1X15A 5G0VA 4DSZA 2YDEA 4C0WA 2XXAB 1J2TA 2CVQA 4KK3A 4P4NA 4B6SA 3QWAA 4AJPA 2Q9AA 2VC2B 4RF3A 5CT5A 2IQ5A 3EGXA 4Y67A 5KHIA 1XQ6A 5DT9A 3T5DA 1YITF 2QA5A 1CVLA 1PL4A 1VKZA 2HRDA 1IDOA 2VCYA 1E3QA 1VKNA 2VTVA 2VH2A 3S0YA 2EKBA 3I2IA 3PT5A 5ALIA 5TARA 5BR4A 2PX6A 4KKXB 1V4NA 2I1WA 4GPD1 2Y1KA 3GUCA 4JI2O 3HMKA 5HGJA 4G4YA 1T5EA 1MH9A 3IR7A 1QZXA 4DWVA 5D6OA 1FFXA 2UZ0A 3BGOS 5TJHA 3K12A 3OPQA 2F43A 3WV4A 4HATA 2L17A 4IGEA 2AHZA 2N48A 1DPFA 1K8AW 2FB9A 2VJBA 1DKLA 2QQ0A 2X19A 3C41J 4GZ5A 1Q74A 1VQ7F 1TA8A 1JPJA 1T5SA 3DD5A 1OVGA 3LDAA 3PNMA 4KTVE 4NARA 1JP7A 2Z1NA 3E3MA 4OXQA 2V6GA 3FUVA 3UNXA 4MWOA 4C6TB 3G6KA 4COKA 1I7DA 2IYSA 2YXPX 1NJ1A 1II9A 2JAPA 3OQOA 2Q4TA 2ZBRA 1EM1A 1EVQA 1QANA 4Z9YA 3CKMA 3K09C 1XALA 1DXOA 2VSFA 3HZRA 5B1EA 2IW5A 1H4VB 3IVRA 4B74A 2RCVA 1K3EA 4Q21A 3KZNA 5CIYA 3OLCX 3O94A 1GGNA 4Y6GB 3JAWA 2FR1A 5A0TA 2YL2A 1G6UA 2NZVG 2Q49A 1MDBA 1ONBA 4J0CA 4N3NA 3T1HB 3WDKA 1IEQA 2XQFA 3UJBA 1CUHA 2Q4EA 3CHXA 4ZCLA 4JROA 1CDDA 3IUYA 2IOHA 3DO5A 1SUWA 4I3GA 3IAAA 4BDTA 3GYGA 4E21A 1L4KA 3W5UA 2WHEA 1DQSA 4ENQA 5BMVA 4FMTA 3QUCA 5EZSA 3VH4A 4QT0A 5J2TA 1UMCB 4JL5A 4X9XA 4C4RA 3K9CA 1JFSA 1C9KA 1IBLB 3G17A 2XUIA 5FAKA 2AQHA 4WUVA 5NULA 3ZWBA 4EJSB 3H99A 2POCA 1YR2A 1NNI1 4QL3A 1JHAA 1KEPA 1QHIA 1T9DA 1UK9A 1E5VA 1WZUA 1B3BA 3H2HA 1JBEA 3M1AA 4PN7A 4Z7QB 1KJYA 2H1HA 1ST3A 3H6HA 3K5WA 4RH1A 2A7QA 4E30A 3L4KA 4PSCA 4RVDA 2IXEA 4TL9A 3D43A 3ZV5A 3V6MA 1CUVA 3LDHA 1EH5A 1KRHA 1ZZGA 4G4ZA 4LZOA 2VI5A 3PITA 4RZHA 3ZCPA 2WB2A 3W7UA 3IDAA 3EFFK 2NPFA 4BEVA 2EGUA 5CLLA 5JSUA 2WM2A 2XA9A 4FBLA 1P31A 3JVHA 3VPAA 4ESOA 2E5WA 1DLIA 2V9PA 3DBHA 4RAQA 1MG1A 1N36B 1QM5A 2B92A 4A6DA 1TZCA 2EKDA 1XRSB 4ZCSA 1CQWA 5H5NA 1UQRA 2D06A 3CVJA 1FMJA 2FMUA 4MICA 5CX1A 2D1SA 1DSSG 2HHHO 4DUGD 1RWPA 1U28A 3QFHA 1C8BA 1D6JA 1E4VA 2PL9A 1A5ZA 3LKDA 4IR7A 3AG4B 2F9MA 5B1HA 3DM9B 1OYVA 2JD1A 3K1YA 2VNJA 4MYRA 3SJCA 4E7OA 3Q5EA 1RM1C 2AIZP 2VOJA 2HF9A 2WKSA 4ZMBA 5HZKA 3R09A 1F2UB 3KLOA 2WJIA 1Z0KA 2B8JA 2NU6B 2QXUA 4GOJA 3F73A 1YL6A 1V48A 4WN9A 3KUKA 3K1ZA 3RTDA 3VJRA 1JDPA 3OPMA 4V0SA 2V0CA 1A8SA 2DTXA 3A1SA 3ZBUA 1CRZA 4D8UA 4EFNA 1M6VA 2XOEA 2JAUA 2B1GA 2P9QA 4U2CA 4N41A 5JSFA 3STVA 4FSXA 4HUQB 3B2QA 1ZH2A 1UBKS 2O2DA 5EJ9A 1SG6A 5ER6A 3GMDA 1TQHA 3PC3A 3UK2A 1KNQA 3NATA 2G9UA 3QMPA 2BKLA 4EHIA 3ZVMA 1SZCA 3AEKB 5JZSA 1YTFB 1O94A 2LZ0A 4NBKA 4IBOA 4MKZA 3PYLA 4IICA 2XNDD 2HN9A 5C1DA 9ATCA 1J0EA 1KVTA 3AGPA 4XWWA 4ABTA 3UKMA 2II6A 1TM4E 3MRVA 4FTWA 4DLAA 1E0AA 4DNPA 1W8IA 1IMJA 3OJ0A 2E3CA 4NU5A 4RORA 3S1SA 4GLOA 1PL0A 1TCAA 1ULUA 3DV0B 1ABFA 1RTTA 2AXPA 3LW8A 5FAXA 3SR0A 5JXHA 5K0FA 4PPFA 2GYVA 5KI6A 4QVGA 2I2FA 1HRDA 4LXHA 2P90A 2WA4A 3FCUB 4BQRA 4TPKA 1JHVA 5CVVA 4FLVA 4XCQA 4K8XA 1O4VA 5T8KA 3GLIE 1ZG3A 1UZAA 2IF2A 1EVLA 3G59A 1Z56C 1U02A 4DA4A 3IQIX 1E4OA 3WU2Z 2NADA 3C4JA 1H8HA 1G60A 1E66A 5CBHA 3DEHA 3IJEB 4BJHB 1PDWA 2NLOA 1TF2A 2WJPA 3QTTA 4HLCA 4P58A 3F2VA 1Q6YA 1Z37A 3DH0A 4HBZA 5DM0A 2BUCA 3STWA 3IMEA 4Q37A 4PR0A 1ABBA 4UTXA 5ECYA 2AW3A 2C9YA 2BFDA 2YV4A 4P7JA 3AG7A 4Q4HA 3OQNA 2PJDA 3W4KA 5KQSA 1ZTEA 3I55V 2QVXX 1SUBA 2O8VA 1GUAA 3LCRA 3LKZA 3OF3A 4MB6A 3WLMA 4FYHA 4C43A 2Q7EA 3HU2A 3CD6V 2HM7A 2FN7A 2IG8A 3Q8XB 1XRRA 1EFRG 4BGUA 3GR6A 3GBSA 4R68A 2JIBA 1RYFA 4IV0A 5ILQA 2Z8YM 5DCLA 3CC8A 2VAWA 3FYCA 3MAQA 1Y5RA 2UYNB 1PGPA 2A1UB 2XBUA 2I67A 4ZD6A 3MUFA 1D5NA 1MP0A 1YQGA 1L4HA 1XRMA 1C0PA 2FFBA 2Q2QA 3G5MA 1AS2A 3L9XA 4IJUA 2JFXA 1V9CA 4JR0A 5BSVA 2QP3A 3HFJA 1Y8ZA 2R68A 5AKEA 1I1NA 3WFVA 2EHDA 3NV9A 1JHRA 1QQAA 2ZI3A 2P2DA 4EITA 4UE2A 5C80A 4E4YA 5IDWA 3PA6A 4MDHA 3MWLA 2DWOA 2ZM6O 1THMA 3IAM6 4UE6A 3LLUA 2E49A 3BHNA 1FJXA 3IEPA 3IKFA 1XHLA 2GYYA 2ZIMA 3KUXA 3LYBA 4JB8A 4X7BA 1FRFS 3TZCA 4JYCA 5AXDA 1JDTA 4PHHA 3H9VA 4B3RO 5GZ1A 3F4LA 3U7IA 4C4YA 5C32A 5LMNO 2D5BA 2JI9A 3DT6A 3AFMA 2P1ZA 1NXXA 3NHRA 3QLJA 1O4WA 1ONOA 4GAEA 2GJ8A 4OBBA 2EJUA 1Z2AA 2E1PA 2V9ZA 2YY7A 3BE5A 3JQAA 1JJOA 1M8GA 1SIUA 1I3CA 1XCBA 2D54A 4DF3A 5DNYB 1SXPA 2OYRA 1BVYF 2RH9B 5FPKA 1GDTA 4PZ9A 4CIDA 5KU7A 2DZDA 3WYBA 3OIUA 3HC7A 1LC3A 2WM8A 2IDJA 3C87A 3ZHBA 2H51A 2GLXA 1GRVA 1XTQA 2DFPA 2DVMA 4B5CA 4NZYA 2A4KA 4TV9F 3JATA 1YOVB 2XB8A 4Q93A 2C54A 1P39A 2D3WA 2J3QA 1UBTS 2Y9MB 4GX5A 3KYCA 5LBTA 2C8VA 5B55A 1NLZA 1B6QA 2QWRB 1KSJA 1MTZA 4DG5A 1ZWIC 4O1HA 2VDQB 1WV0A 3MWJA 1KQSU 3LDEA 5COBA 3SZUA 3GRPA 3U10A 5EJ4A 5B7QA 5J4LA 3IKEA 2WWGA 4PO3X 3CG6A 3NWOA 2VS0A 2I55A 4BP8A 2X14A 1OXTA 3I01A 4Z9AA 1Y4DE 2GD0A 1GQYA 2FSSA 3KFVA 3OJFA 2QAIA 3ZNPA 2E6UX 4WOCA 4DV0O 2QE7G 3ZO8A 1RRPA 3T1CA 1VE5A 2GUWA 2FRDC 2IEYA 1GFZA 3CWCA 1U0RA 2ZYRA 4FFRA 3VQWA 1DZIA 3ZVRA 2AC7A 3GJYA 2NU9A 3ZK7A 4IDPA 1IZ3A 2BP7B 2C00A 2L18A 4OA8A 2P3OA 4W8HA 4HX5A 3UAOA 4FZ1A 2RJZA 4TVSA 3A6ZA 4P81A 3C5HA 3R66A 2BVNA 1Y66A 2LPMA 5FR2A 1KNXA 4L0MA 3S70A 1X52A 2OBNA 2OEPA 2H11A 3I2YX 1L6RA 1ZGAA 3KZXA 2N47A 4PV7A 2FSGA 3RSSA 3I1FA 4IWYA 3CSUA 2LO1A 1UKCA 5EKXA 5H3HA 5SY6A 3K58A 2BCGY 2GZMA 1S1CA 1WY7A 1G21B 4BMOB 3ZY5A 4F86A 1U4NA 2WLKA 1YZVA 2KJQA 2LGQA 3K70B 3QI2A 4EWLA 3PD7A 1SCAA 5C7IO 3AOEA 2M7WA 4UCSA 3JD4A 5LHIA 3EXFA 4NBVA 2GAIA 5CW1A 1IEWA 1M66A 3M7IA 1U1CA 3N2KB 4I50F 4GGMX 1X9HA 3FHJA 2R6DA 4NTWA 2RGDA 3NK6A 1EZ1A 3G0DA 3I1YA 3QPBA 4BZWA 4OPHA 2XYVA 1MEJA 4B34A 1JX6A 1LDNA 1RSOA 2DSTA 3DXFA 4IQ0A 1K8XB 4ZEVA 2PAAA 3JATB 3VU9A 4PHGA 4CKXA 4DKJA 1GK9A 2VBGA 3CCUF 3W5CA 1UM8A 2JLQA 2V7WA 1HURA 3TRIA 5TISZ 4RU1A 1HQKA 4C89A 2EJRA 3B12A 3EAGA 5BT8A 3NFRA 3BCCH 1NXVA 4IDEA 4CDRA 4G5GA 5IBRA 4OI4A 4MS3B 5IJ9B 2GCOB 2EBUA 2PZKA 5KUKA 5DNDA 4MW8A 2XNCA 5ARCA 3U7JA 1QNLA 5JE8A 4WEOA 2Y4NA 4EYQA 1SOUA 2HA2A 5ADHA 3BIFA 4NG5A 1W4LA 1YS7A 2IL1A 1XVTA 3F49S 4YY3B 1ZR4A 1L8AA 1BHSA 4YK7A 1BW9A 2NV0A 4M1SA 4CMEC 1GNQA 3UMFA 1YJCA 4MQLA 1KZYC 4O1IA 3BT7A 3BHJA 1HA3A 2Q1TA 3H2ZA 2RGNC 4NXMO 4RDCA 1T8SA 2N0SA 1P2TA 3CYOA 1DEOA 1YCHA 2WYIA 3V9AA 2AL7A 5LZ4A 4JB2A 4YAIA 3KWJA 4F4IA 2PUEA 1K5QA 4J7AA 1JYFA 1N3YA 4UCOA 5K8VA 2VZEA 3BQNB 4WK0B 5CH5A 4TN5A 1UFVA 2R00A 5ECGC 3IP3A 2A9VA 2C5BA 3PNVA 2J3HA 1BFKA 4WBNB 2BCCH 2HSZA 3AHCA 4H0NA 1OAOC 1DFIA 2NTEA 5BSEA 2E76B 1QHNA 4V03A 3DL0A 2ILMA 3I8SA 1E1NA 1GY8A 3OPYB 4PG4A 3EB9A 2JNBA 2O3JA 3ZU4A 2K4MA 3WXMB 1IL0A 1I33A 1J1IA 5AXBA 3EHDA 1FE8A 5CT6A 1K6EA 2G4LA 1QPZA 4C4AA 3FNBA 5FL7A 1RP7A 3R3JA 1FNCA 3KYIB 3LKBA 1USKA 3U3RA 1EUDA 2DYSC 2JGIA 3R41A 4OUDA 4NXMB 1CUJA 1G64A 2X5NA 3RT9A 1DQRA 4CMBA 2B35A 2HHCA 4RABA 3L7MA 4DE5A 4JJAA 2H6LA 4KO2S 4TTRA 2OV4A 1ZONA 4RQEA 3FNGA 4CU5A 2L0XA 4E2FA 1OYYA 4Y6LA 2A9JA 3FCCA 1ECPA 1RPNA 4NBWA 3FE2A 2Q6KA 3H04A 3V8BA 4QA9A 3ZW9A 1K3FA 2WT9A 4RIIA 1XU7A 3V1MA 1DFGA 4EG5A 2A9QA 3N2GA 1SS3A 1QDLB 2Q7HA 1XNJA 3E61A 4YXWD 3Q85A 3T06B 1UPAA 3O90A 3V4ZA 1NC1A 2ZXWC 5AI8A 5LDHA 4YP5A 3X43A 1SHZA 4B35A 2X0IA 4GX2A 1L5HA 3T35A 3DD1A 1MQAA 3J81N 3C6MA 3GJQA 4ZJPA 1ITZA 2UZ1B 4JU9A 1BQEA 4PG6A 1S72F 4UUAA 4Q4AB 3JXEA 4OSEA 2UYCA 1SOAA 4MP6A 2HO4A 1R0KA 4N12A 1WAMA 3SE0A 4GLJA 2XE4A 1DJNA 2W6CX 2QLLA 4TTTS 2OLKA 4JKYA 3UT5B 4KN8A 1FZTA 3CNHA 1T5HX 1GAWA 4IDBA 3AC0A 3RVPA 5D3ZA 3V33A 3LH5A 3ZZ0A 1ZLYA 3FH0A 4E88A 5DECA 1W2BU 1MT0A 1TJ4A 3GDOA 2G63A 2O1EA 1Z16A 3NIWA 3PHIA 4FCTA 1NOIA 1U8YA 2WKPA 3BE8A 3ENNA 4FFLA 3KVOA 3ZIAA 2DHDA 3ENQA 4UFZA 1XJCA 1Y9EA 1UPGA 1KY5A 2QP4A 2X3YA 1YB1A 4NMWA 4EGQA 3CCMV 2E4VA 2PMPA 1H1TA 1M83A 3U4IA 2C8KA 2Q5FA 1KMHA 1UBOS 2OECA 3G8AA 1MABB 4YIOA 2EILC 3H5TA 5H3CA 3EXIA 3MXTA 5FULA 4JVOA 3DBLA 1U4SA 4HQKA 4DEYA 2IJIA 1X94A 2RARA 2QNBA 4ED9A 2N1BA 1TYCA 2FMIA 5GVRA 3CF4A 1CYDA 1PFKA 4A23A 4OK5A 3ZMZA 4PVDA 1GYQA 1F60A 2ZBPA 4OCZA 1DBFA 1P3Y1 4I4CA 4PU0A 2DJ5A 1N34B 3L0YA 3FNIA 1WBBA 3C85A 2YWEA 1UT8A 1VL0A 4WFIA 1VQ7V 5J47A 2NNUA 3K6SA 1AOXA 2P6NA 1R1BA 1B43A 2XCTB 1MAVA 1QLJA 4I50B 4EW3A 1X7WA 2HCBA 3BGIA 4TLBA 1AILA 4NWOB 4UM8B 5FA8A 4DM7A 4MVQA 3DR5A 3LC2O 1ATIA 4ZQIA 3VVLA 4BOYA 3JQ9C 4H0FA 2XUAA 3U44A 4O8CA 1IVYA 2HJGA 4WE3A 2JFOA 2XSZA 1UM9B 2HUPA 2IAFA 1WXGA 1V47A 1UF9A 1T1IA 4P7GA 3AUKA 1YRYE 4BCCA 4D0LB 3L0CA 2VR1A 5HKKD 4LRTB 1JKIA 1KO4A 2ZPUA 4E4RA 1K7YA 1E1MA 1AKEA 2OV6A 1AJNA 4KTTE 2WSBA 3FWZA 2J3MA 3SCZA 2VYCA 3DC6A 2X8AA 3SSNA 3C6YA 1EFPB 1M2OA 1QS0B 3A28A 3B1ZA 2GILA 1QVGU 1ETHA 1NBOA 2XVAA 4FFNA 3TRHA 1GNSA 1QIIA 3D6FA 4BNMA 4WY5A 4YHBA 5L3QA 1NRIA 2Y1LA 2ZYSA 3R24A 2B8TA 5D2CA 1BU5A 1FVHA 1ID1A 1SK8A