4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
3JALB 4DXDA 4U3JB 3JASA 4WBNA 5C8YA 3VO8A 1TVKB 5KX5A 4I55A 2XKAA 2RHJA 5LOVA 2BTQB 3HKEB 4X1IB 4B45A 4TV9A 3JAKA 3N2GB 4TV8A 5EYPB 3JATB 5JH7A 5J2TB 2BTOA 4O2AA 3N2KB 3JAWA 5BMVA 5LP6B 5LYJB 1TUBA 4I50A 5JVDB 4TUYA 4EB6B 5JQGA 4O4LA 3HKBB 3WGNA 5CB4B 5KMGA 5J2UA 5LP6C 4I4TA 4LNUA 3JASB 3VPAA 4B46A 4XCQA 4I55B 4M8IA 4HNAA 5FNVA 4X1YB 4O4JA 3WGKA 4X20B 4O4HA 2RHLA 5CA1A 4KWEA 3VOAA 4TV9B 4O4IB 2RHOA 3UT5B 4ZI7A 1FSZA 3RYHA 5JH7B 2RHHA 4O2AB 3C8LA 5MN6A 3JARA 4X1KB 5LA6A 3JAWB 3RYIA 1W5FA 3WGJA 3RB8A 4ZHQA 3RYFA 4I50B 4EI8A 5JQGB 4IIJA 4O4LB 5JCOA 5ITZB 4YJ2A 5GONA 1Z5WA 5J2UB 1SA0A 4DRXA 2R751 5EZYA 3HKDA 4LNUB 4IHJA 3E22A 5JCOC 3ZBQA 3VO9A 4WBNB 5C8YB 4ZOLA 5KX5B 3WGLA 5FNVB 1OFUA 5M7EA 4O4JB 4O4HB 5LOVB 5IJ9A 4U39A 4O2BA 5IJ0A 3HKCA 2R6R1 3ZIDA 4ZI7B 2Q1XA 2VXYA 3JAKB 5IYZA 2Q1YA 2VAWA 3N2GA 3JARB 4TV8B 5EYPA 3RYIB 1JFFA 4F6RA 5CA0A 4ZHQB 5LXTA 5EIBD 3M89A 3N2KA 3M8KA 5BMVB 5MN4A 5EIBC 2GVIA 4IIJB 1RQ2A 4FFBA 4YJ2B 1TUBB 3RYCA 4TUYB 4YJ3A 5GONB 1SA0B 4DRXB 4EI9A 3R4VA 3ZBPA 4EI7A 5CB4A 5KMGB 5EZYB 3HKDB 1RQ7A 3E22B 4IHJB 1FFXA 4I4TB 1W5AA 3CB2A 4ZOLB 3JALA 1W59A 4E6EA 5MN5A 4U3JA 1W581 3WGMA 2XKBA 1TVKA 5IJ9B 4HNAB 4O2BB 4X1YA 1W5BA 5IJ0B 3HKCB 4X20A 2BTQA 5CA1B 3V3TA 3HKEA 4X1IA 4O4IA 5IYZB 3UT5A 1JFFB 3RYHB 4F6RB 5CA0B 5LXTB 4X1KA 5LA6B 3JATA 5J2TA 1W5EA 2VAPA 3RYFB 4FFBB 3RYCB 5LYJA 5LP6A 4YJ3B 2VAMA 1Z5VA 5ITZA 5JVDA 4EB6A 1FFXB 3HKBA 3VOBA 1RLUA
chains in the Genus database with same CATH superfamily
3NK6A 1I5EA 5K3AA 5JS2A 2Z56A 3GJ8A 1U7OA 5CU7A 3TW4A 3FPHA 4M0UA 1XTZA 4R98A 1XV5A 3PF9A 1DO0A 4BEJA 4KFMA 3BPZA 3DEIA 3G6WA 1CU1A 5DWVA 1JKJB 4KQJA 3RU7A 2BYTA 2P9GA 1T4CB 1IB0A 3WXBA 6LDHA 2VT7A 5IDQA 1ZK0A 1VGVA 1XKTA 4LF7O 4B4OA 4EB0A 5HKKD 4HWOA 4JLPA 1DAEA 1VBNA 4HYYA 2BDUA 1QP7A 2GM3A 3LCUA 3O74A 4UM7A 5FUQA 3VO9A 2IHVA 4D80A 2VQ6A 1CUHA 4GZRB 3UQZA 3ZWAA 2PKYX 1OSNA 2MYNA 4YMSA 1TIKA 5B6JA 2W8BC 1K7FB 4EEZA 3EH1A 3RVZA 2IQ5A 5JSHA 1VQ4V 3RN4A 1JOYA 3OJ0A 3WYFA 2R4UA 4RORA 1IPHA 3FUCA 1GZ5A 5F3WB 3LC0A 2VS0A 5KINB 3LK7A 4DYDA 4OK5A 4K9MA 5M04A 3HXQA 3TMYA 4UKDA 4ETMA 4EHNA 1UJ2A 1D3AA 4FZVA 4AF7A 5HUJA 4YYEA 1I6LA 1IJFA 3X1DA 1LDEA 2WSIA 4M8IA 1OAAA 4DIMA 5J59A 5G4KB 4QE7A 1MIOB 1L0NH 3QX9A 2IITA 1INLA 5TGTA 5F77A 4EPVA 3WRYA 2HDNB 1P6XA 1P2DA 4R69A 3IUMA 3LWPC 3HU2A 4JYAO 4FSDA 4O8ZA 3H6HA 3A1EA 1E4OA 3R3XA 2JLSA 5DLDA 4X45A 3ML1A 1PJZA 5CIYA 1N7HA 5F7JA 1QQ5A 4JK3A 2A0FA 3GMDA 4F6RB 2WEKA 5U1PA 1EBOA 1VQKV 4K9LA 3IJPA 1RFYA 1JDSA 1E0KA 1I9GA 2BR4A 1LC3A 5CDFA 4UEWA 3G23A 3U44A 2YUIA 4JYYA 3ZHUA 4DSZA 3VVMA 3PBKA 4OHFA 4LX0A 1JFTA 1N5RA 2FW9A 4MO2A 3KZOA 1NC1A 1I4LD 4PX2A 1W8DA 3EA0A 4NQRA 2RGWA 4XIIA 3MMNA 5B1AC 3BZBA 1QYVA 3RC8A 4BWYA 1T2DA 3KDPA 1ULTA 3IP1A 1EUDB 3ESBA 4F12A 2H07A 4R1PA 3Q9LA 4KXYA 4O4IF 4WFAV 1V5GA 4K05A 3KAKA 3TM4A 5ALFA 3PDIB 1VKNA 5LKRA 2DRIA 2ZIXA 2ZAOA 3OKFA 5B3JC 3MJSA 1QH1A 3C6BA 4P8RA 1T43A 3L43A 4HQ0A 2EJUA 3I05A 4CMGA 4GRIA 4JVNA 3GGGA 4MRMB 2QWNB 3H18A 1JJBA 3UEOA 4H6PA 1R8JA 3L8EA 1AHPA 3W3AH 1M8KA 3UGKA 4MGKR 2PRJA 2NAFA 3EB9A 8AT1A 2HCRA 4AW9A 1R9MA 3VR4H 4ENSA 4A15A 3HK2A 1ADYA 3UJPA 5AVTA 3MJVA 4GKKB 2E1PA 3B1VA 4AQYO 2PLNA 3C7KA 1A9OA 4CJXA 3HDHA 1HQCA 1D5AA 4LQDA 3RNOA 1TUBA 1DO8A 3TXXA 4BLWA 3W6OA 4IIBA 1EZZA 2JLCA 3BD8A 3FZGA 2EKBA 2IPLA 2Z2YA 1W0JG 2GBLC 2F23A 2JIPA 1TCUA 4BE7B 3GAZA 3WTCA 4KLAA 1VBMA 4XB6B 4E2FA 1LJUA 3S1SA 1XDWA 4EUFA 5BR8O 3DD5A 4EYEA 4ML3A 5BUQA 5DCLA 3K9FC 3OOSA 2DVMA 2OXCA 4ZZ3A 2B1IA 2HF2A 4QYWA 3GCXA 5KMGB 4CMEA 2JFOA 3GVPA 3HYSA 1UC8A 3GJZA 4G4ZA 4UU1A 1P81A 2PZJA 3UM7A 4FDAA 3T80A 2ACVA 4KOAA 5KPJA 4O2BF 2ZCJA 3VHRA 2Q3JA 3H8WA 1VCOA 1C5KA 3UFXB 3OFKA 3CMAF 2V9PA 2ECOA 1NOKA 3SFTA 3O7WA 5DXAA 4XUEA 5KA5A 4PCLA 2KG4A 1BHBA 1BCRB 2C3YA 3BWBA 2ZU6A 4RE5A 2GAIA 2ZYHA 3SHVA 2IGBA 3BMQB 4FXOA 1A1VA 3VJLA 1MW8X 1UJWB 3AINA 3S7TA 3U62A 2ID8A 1O94D 3QEAZ 5KSPA 2P35A 4BCBA 2QDOA 4FE3A 4CMIB 3OJWA 4LQ4A 2GK6A 4BXOB 3WA7A 4B9EA 3C0KA 4ERXA 3UK0A 3GGDA 1Q12A 4RPLA 1ZGGA 2P2YA 4RA9A 5B58C 5J4HA 4LBVA 4DJTA 4RIIA 4J0QA 4OUKX 5AYVA 2WJVA 4NTZA 4KYVA 5CURA 3FAVA 4OK3A 3I83A 4PINA 1L7RA 3UOGA 2VQ3A 5AW4A 2DBYA 1P31A 1J97A 2CKMA 1QAOA 2J87A 1ADJA 2V0CA 3TLGA 3IVGA 4G24A 4IHJF 3H1TA 2EV9A 3C3DA 1R0YA 1OYWA 4YP5A 4EKEA 1UBTS 2PUVA 2JHGA 4MQFA 4EB3A 1ZD4A 4FZJA 2PUWA 2BFEB 3QEMA 2XZPA 4RAOA 4G41A 4GLLA 2ZR7A 2D74A 5F7XA 3QITA 3U4AA 2QMOA 4KN5A 3FB4A 2MOKA 2EL9A 5JWPA 1S3IA 2R9RB 2QE7G 1UMKA 1WIWA 4DKXA 2VP2A 4URHA 5HBGA 2ERXA 4Z3OA 1U0NA 1GSAA 2QLFA 3PCTA 2D13A 2G8LA 4DQLA 3QYFA 1YULA 1Z6AA 2D1TA 5BN4B 2O14A 4FM9A 1ZH2A 4LTMA 1PWEA 4WEQA 3CE6A 3N0VA 4E5SA 3VPDA 4BMVA 3HB3B 2HJRA 1JDVA 2X0KA 4JH0A 1B93A 2P67A 1WS6A 4EH1A 5E1DA 1JIJA 4HNAB 1T3HA 3PUIA 1NW3A 2VTEA 2VBGA 2FXIA 5LYJA 1NHGA 5A7HA 4HY3A 4G4IA 1E7YA 1JZSA 4CIXA 1UT6A 4JGIA 4OGWA 4I36A 2H1HA 4QPJC 5DO9A 3LLMA 3CE9A 3FZQA 1YJCA 3RA6A 2WNHA 2PIDA 1AKYA 4V2UA 4YV2A 3HJCA 5CLQA 2JS3A 2Y27A 4LF9B 2BGNA 3B3QA 3EXEB 1WSDA 3MDSA 1XC7A 4FLYA 1TCBA 1Y7IA 2A6PA 4M49A 4BT2A 3L8ZA 5FQNA 3RB8A 5AUPB 3ESDA 5B7QA 1RM4A 4Q4JB 1RJ9B 3SLRA 4EPWA 1N1GA 3KYBA 1VQ6V 3NVIB 4LBWA 1THTA 4BQIA 3QVNA 1DSSG 3ABMC 1X25A 2WJ6A 2BOVA 4M7WA 4AZ3A 3H6GA 1I94B 5T5QA 1T15A 2YC2C 4JBNA 3LT5A 3IOMA 4KE7A 3O8RA 4C3VA 3B1XA 3F74A 2OBMA 1SC4A 1RACA 1KS9A 4MITA 2P9TA 3OJOA 3K92A 3J80N 2IPOA 4F2WA 2R25B 5HHTA 3UK6A 3PENA 1G5HA 1AKWA 1UBSB 3C97A 4EELA 4XR9A 4C7MA 2VDPB 5T6MA 2DUWA 3RVNA 2AKEA 2UKDA 4B3FX 3G89A 4JC0A 4D2IA 4WESB 3CCJF 1ZSYA 3I9LA 2FN3A 2CEKA 2JLAA 2QTSA 1E4EB 2JHPA 4IMIB 5C35A 5IABA 4PWYA 3LP5A 1RP1A 4ACAA 2Q6IA 1ZAUA 4MIKA 3KXKA 3S0HA 3DOHA 3RC9A 3A6KA 4XVUA 4FNGA 4B43A 1SR8A 3KB8A 1OYOA 2REQA 3F73A 2ZGVA 5B1EA 1A77A 3A3NA 1CF4A 1M0WA 1DCTA 4U9HS 4JI0B 4G4SP 2F95B 3D2AA 5ER9A 4JUCA 1HKUA 4JB0A 2Z3WA 3Q41A 3SR2C 3EVKA 1XOIA 1DXQA 2FSIA 3IR6A 4EMSA 2QYSA 1Z4QA 1HNNA 2ADOA 2FFJA 2PBFA 3OTIA 5TEVA 2IODA 3SKVA 3C1OA 1JPXA 3QO5A 4WKCA 2CJYA 2FB5A 4J3NA 4HH4A 2GHRA 1EWTA 3RFFA 1QWSA 2FEXA 2CJXA 4C8GA 2W6JA 4DV6O 1DB3A 1PNVA 4YCJA 4LOAA 3KOWA 4NCBA 3BB1A 1ST2A 3SE0A 5A2GA 4UVAA 3LLVA 4MVCA 3IXQA 1SKQA 2QKCA 3GROA 1W0KA 4DIOA 4YY3O 4DCNA 1OH6A 1JQJC 4RKEA 1W87A 1BYIA 2V7BA 1H4TA 2HA6A 2P7HA 4JLMA 3GY0A 1BHO1 3KU4A 4O2AF 4BWGA 2WWTA 2PUSA 3VMFB 3VKHA 3PC2A 1I3CA 4GMDA 1J9GA 3VIUA 4DDHA 2HO4A 4DREA 3KJEA 1URPA 4MIYA 4JJFA 5FTLA 3PL5A 1VQLV 3U4CA 4KR3A 1SVUA 1M0EA 3JWGA 3LUPA 1SURA 1PYGA 3J81N 1TU4A 4EKYA 1H2KA 1OXBB 3CNLA 1S0VA 5JTUA 4BNKA 1EH5A 4M7OA 1MIOA 3P94A 3CPWU 3EFBA 1YA6A 2Q7EA 2EFYA 2V3WA 3L6CA 5I8ZA 2QJ1A 3JSXA 1ONOA 4OMUA 2C3MA 3ICWA 2JZOA 2XUJA 3CR3C 3OLWA 4HRXA 3P0RA 3C15C 1XTPA 4PC6A 3CXHF 2HMSA 1L5HB 3QEJA 2YMQA 4LNHA 1ONNA 1U0HC 3DZJA 1N78A 2ORWA 1D2AA 4MI3A 3RV4A 1KQNA 2ZVYA 5KU1A 3WSVA 5LZ7A 1C2TA 1U8EA 1VIYA 4RDCA 1FVOA 3CCJV 1CZUA 4DNPA 3GEIA 1U1EA 1OH8A 2CCJA 2H29A 3BCHA 4IO1A 4A26A 1NQVA 5ALHA 5CNJA 3KLBA 2RB5A 4FFLA 4NLLA 3AVYA 2ZS9A 2B7BA 3O9MA 1F6DA 2QLLA 3QYPA 2HJ9A 4HEHA 4KRYA 1U1IA 3QXXA 3MJDA 5AK3A 4A16A 2BLLA 4BRWA 4JAVA 4GI2A 1YFKA 3QFSA 3LA6A 2F43A 4JLAA 2CXHA 2YJZA 3LGSA 2BMWA 3PKJA 1CHDA 1R12A 3ZVNA 1KMMA 5BR4A 4WCFB 2C5FA 4KLZA 4EW1A 1I9CA 3K9HA 3ED1A 3FDJA 2IFTA 1YZLA 4RZXA 5JH7F 4V39A 1LRKA 1ZD9A 4M0FA 1MRZA 1KC3A 1FVFA 4LJKA 4TWRA 1AMUA 5CX4A 5ETJA 2ZANA 1XNRO 2ZB2A 1PQPA 4UVHA 4C07A 4HZUB 3EIQA 3FDIA 2V59A 1FJXA 2WLSA 3NT4A 4LJYA 2BRUC 5CBKA 4WMLA 5B1BC 1SBCA 4YT4A 3PGMA 4XLLA 5AI6A 1NS1A 4G67A 4LUCA 1QS0B 4ITVA 1WY5A 3MXTA 3I2YX 2VPQA 3IKFA 4DQVA 1NVKA 1GN6A 1IG3A 2ZAGA 3B09A 1X7XB 3DEYX 1I30A 2P0AA 1X1RA 5LB2A 5KMGA 1LKZA 5ITWA 1LI4A 1B6RA 4F5WA 4ENQA 1JXMA 3AM4A 3M6AA 1HDZA 2QTWB 1NQTA 4GKJO 4LC9A 4J76A 4W5QA 2UAGA 4ZAVA 4RD2A 3H6KA 4XM2A 3AG6A 1BCRA 2QMEA 1DLBA 4ID3A 3EXHB 4C5BA 3IQXA 2XEXA 2BOCC 1FU4A 5ALXA 1SXGA 4Z0PA 3U3RA 1Q1EA 3S0JA 4W1QA 1XKLA 3WHKA 3BERA 5CFRA 4HUQB 4R1OA 3Q3VA 4C21A 4CMIA 3P0ZA 4QU9A 2D2CB 5AVWA 1FS6A 4BXOA 3UW1A 3HWWA 2VRWA 3OZFA 4YJ3B 1SBNE 1RZUA 1U81A 2YQ5A 4AM8A 2OTCA 4C7UA 1T2AA 1LTKA 4R8SA 1XBLA 2OZKA 1UPTA 1AXGA 2P2LA 4M0PA 4Y2QA 2EWWA 3B9PA 5GZ6A 2GPBA 4Q9JA 3NGXA 3SYLA 3C3SA 1NXQA 2RGGA 3O1LA 1R3LC 5DT2A 1YIOA 5IAGA 1YB1A 2WIBA 1E58A 2R87A 3OJFA 4QO8A 5K3CA 2FWRA 2KMLA 1G8FA 1LNSA 3AR7A 4J4TA 2V4MA 4WZAA 3R3UA 3MPOA 1RXEA 4B47A 3UBTA 1PG5A 1LI7A 5KREA 1EFVA 4CLEA 3SM9A 1DAIA 3HY6A 1WBDA 2IVZA 2GTSA 1AKMA 4YJ2B 3E7XA 1M74A 1DV1A 3HGMA 4BO9A 2WIJA 1NVXQ 3DTVD 2AYZA 4JFRA 4QOHA 3GEMA 5DB4A 1IXKA 3RVDA 4NECA 5JZ9A 1UAYA 4FILA 3UAWA 1DTWB 4C7OB 1J2UA 3UMMA 1WNSA 2H18A 3GNSA 1U2TA 4JP2A 3RO7A 1GOTA 2WKQA 4JV5B 3K0DA 1E6UA 4QOJA 4TV9A 5KTOA 2J5XA 2EULA 5KOHA 5AVXA 5FLXM 3Q9UA 5EMJA 1VJGA 4O1IA 2IYPA 4LHEA 3BH6A 2WU1A 1L5VA 2GPWA 4IPTA 3ASNB 4HNAA 4YGYA 2YOFA 1K97A 5DM2A 2GFHA 3GR6A 1NZDA 1X80A 2P4EA 2EJ7A 3OIWA 5ITZB 2B8WA 4B31A 1M1ZA 1LBQA 2A5LA 4ZCMA 1A2BA 3HBLA 1LF5A 1UKAA 3RAPR 1K33A 4V3BA 3M8KA 4JVOA 4PRLA 3CZ9A 3H5WA 3W8FA 3AP3A 4JQOA 4P0QB 3GLSA 3SS9X 3MGGA 3CPSA 3RU3A 4MJ3A 1E1QD 3AEIA 5E9AA 3CINA 4OQDA 2QQGA 4IH4A 1YIDA 3BUSA 1EBBA 2ZB8A 1ZOPA 1A9YA 1KFKB 2VRBA 1SXHA 1GDTA 4F9TA 5HF9A 3HVRA 2BN4A 3GTZA 3HR8A 1PJAA 4YMHA 1V47A 1SHUX 4FDTA 5LWHA 1KSJA 3I6BA 2VRCD 1A5BB 2YFHA 2D1FA 2P2NA 5B4TA 1QP0A 4ZU6X 1MEJA 2VJMB 1L0BA 2NPIA 3KV3O 4XDZA 2H8GA 2Z58A 4QXAA 3OQIA 3WLPA 4DIEA 3FMVA 5I8WA 4CKEB 3K14A 4UTNA 2FPOA 3P10A 3GGSA 1EA7A 3TQFA 1FXUA 4QODA 3HXOA 1JV2B 4TQDA 4ASUA 1KY5A 1E4EA 4HNQA 4LF8B 2CL5A 3MAAC 3WLSA 2PRKA 4JC8A 1NDUA 1IULA 1N36O 2B37A 4CF5A 2HU2A 2XNDD 3RRMA 1BMDA 5ESXA 1EM1A 5J3JA 4GBED 3ZMTA 3CCEV 1T1RA 2C5GA 1YVPA 4OYHA 3QBTA 2WFMA 3QUCA 3D6UA 5A0FA 4Z2YA 4CU5A 3DMNA 1C9KA 3UUGA 3GB9A 5TMEA 3OQNA 1UFYA 3CZ5A 4JFAA 1QCCA 2HDHA 1TKAA 3ZXIA 4DUGD 5I48A 1YI0A 4P82A 1A9ZA 1X7WB 1SU4A 5GP1A 3VFDA 3KSBC 2O2EA 3KWJA 3TDMA 2XNKA 2XNSA 2IEAA 3EVEA 2WWHA 4MV3A 3E2PA 5GJCA 1ZJJA 2FYTA 5DYTA 2QVCA 3R3WA 1EFHA 3AU9A 2WNIA 2AMJA 1G38A 3CLSC 2WVJA 3M2PA 5ALOA 1YQEA 1N2BA 5FWNA 5DYYA 2IM9A 2F59A 3LHKA 5DN6G 4LDRA 1N33B 3I32A 4CTNA 1YOVB 2QN7A 4FYXA 1WB7A 1W36D 2A33A 3NHWA 1AC5A 2PVPA 4KV7A 3LY9A 5E7QA 4UTZA 1MMFB 3D7MA 1WQ1R 5E6SA 2ONKA 4GOMD 3ROZA 4L5BA 3MBMA 5GJWC 4EJ6A 3ICEA 1V6SA 5EESA 1PT8A 2ACWA 1NP6A 1Y4AE 3COWA 1W4AA 2IS2A 5COBA 4ZEOA 1P1IA 1VGQA 3D7KA 3G1UA 5AM2A 4KACA 3PC4A 5IG2A 1A04A 1GFSA 1PR9A 3F5TA 3QOYA 2QKSA 5HY0A 2GYYA 5LBTA 1K8AH 1W55A 3RSSA 5GONF 2DT5A 1NJIH 2UYGA 3V1MA 3ZP4A 1LPPA 3IRVA 1VQPF 3CE2A 2JW5A 5C7YA 1TYAE 5JS8A 2NYAA 4CM4A 1Z6YA 2YV1A 3AUTA 3K09C 4JB3A 4AILC 4D1YA 1YTUA 1P5ZB 3CU5A 4KGXA 1A71A 3D7RA 1XUOA 3VI4B 2G83A 4ZOAA 3KTAB 5AHXA 2WYWA 3E0QA 3PCRB 4MUAA 3N6RA 3WIEA 4IIUA 2BUCA 1FD9A 4JODA 2FG5A 3A1VA 4GPAA 2Q7HA 1Q0RA 1P7YA 3PTZA 1KAHA 4NYJR 3RGBA 3OE1A 1YHYA 4GUNA 1XQXA 1LVGA 1K5GA 4CFZA 1KHTA 3CXUA 1MA1A 1OREA 1ZK4A 2VQEO 1JEEA 3EEFA 2PLWA 1K7DA 5I4KA 3VR5A 5KYNA 4WCFA 3OQJA 2P6RA 1DCFA 3DA8A 4J2HA 5LP6A 4TYYA 1RHMA 5CA0F 3PIRA 3CONA 5JI3E 5CYGA 3CUSA 3K6SA 4WLFA 3EIFA 3M5CA 1XAHA 4J49A 1XCOA 2YC4C 1PIWA 1BKDR 3EBLA 1EXWA 3VX3A 5DHUA 3IS3A 4ITRC 1DRJA 1V3QE 3E58A 5JJBA 2P2GA 4HD8A 1AR5A 5EIEA 4D9JA 4YP9A 3OF2A 2FPIB 5K03A 4EX7A 3LLSA 2WUVA 2K4MA 3EDMA 3QSGA 2X14A 5ALUA 3ZCQA 5SYNA 3BXFA 4QOSA 1R6AA 4XCVA 1XQWA 4ZEVA 1SBIA 1HA3A 3TOZA 3H9QA 1NN3A 5C8YB 2VJAA 2X22A 4CI0B 4R9VA 2O8BB 1TTQB 5TVGA 1U4SA 3ZZ1A 1UAAA 1X7XA 3DFMA 5C37A 1TE2A 1E3DA 2Y1OA 4EVIA 3HSSA 2XKBA 3UC5A 1K92A 3QUWA 2AD5A 4R6XA 3NBQA 4INAA 1AF7A 1NYRA 2WWRA 4KNVA 4HZIA 1V25A 3GZ4A 2DJ5A 2BI8A 5KB3A 1KL7A 4CKCB 4D5EA 5HIAA 3GLVA 2RKWA 3LD9A 4RFLA 4DV4O 2I3GA 3L9DA 2P78A 4ZHSA 4PSDA 3PJDA 1HR0B 2G70A 2F1IA 3D4OA 1U9JA 1FP2A 1S89A 4PBTA 2UZAA 3BL6A 4M9UA 4HT3B 3OP1A 3L1JA 4ZV9A 4DHWA 5JXGA 2YYSA 4ESHA 4HX9A 5FWDA 1KI2A 3PC3A 1VB3A 2CLLB 1EGVB 5JAMA 3UT0A 5CB6A 1NXVA 1WUHS 5J1TB 3SQNA 4B3DA 3M89A 3TQTA 3IALA 4K9PA 2WUDA 4ZHQF 1QTIA 1BT8A 4RZIA 2HWWA 2BGKA 2AVDA 3VR1A 5HSGA 2GN0A 1SC1A 4AL4A 4X8AA 1W4LA 4MV4A 5JAHA 1PJ2A 4ARUA 3DE5X 4B4WA 1SC5B 4HAUA 2DR3A 4FMCB 5B64A 1YR3A 2ZDQA 2WHPA 5L3SB 2JGNA 3MSCA 1AUVA 1KGDA 1U2DC 5LCXA 5CDFE 2L35A 1A88A 3F3KA 3HO8A 4ZN6A 3AF2A 5B7PA 3OURA 2XAUA 4I81A 1WCV1 1PP4A 2VIIA 3FI0A 4B3TB 3KUDA 4AZTA 1XMOB 2HM7A 3B89A 4I5SA 4BVRA 1XRPA 1V3UA 4N5HX 4Q20A 3TGWA 3LFOA 2B1GA 4C7OA 2RGBA 2VHVA 1AHHA 3AM5A 4R83A 4NDAA 4OAOA 1Z39A 4Y2SA 4BEBA 4N7RA 5LOVF 3TZCA 4XVRA 4FFBA 1RMYA 1MC1A 2HUNA 4X66B 2RK6A 4GQIA 3OLCX 4B74A 1TA8A 4PQFA 4E12A 1JP7A 1FP4A 1SZJG 2CUNA 1NBOA 4OG2A 1KIFA 3NWOA 1QP8A 2Z8YM 1J90A 5ITZA 5ITVA 1BE1A 3GUYA 1T0AA 1Y98A 5CDGA 2CXQA 2W6MA 3G9XA 3PYMA 1UCFA 4H60A 2E4AA 4ZVQA 1S7GA 2Z1EA 1Y6FA 1BFUA 2W4QA 2YN0A 3ONVA 2VBIA 1IEWA 3BXPA 4Z8YA 4QOIA 1UFQA 4XCXA 4Y3UA 4U6SA 3U44B 1BVUA 4H7KA 4AWXA 2AX3A 1OA0A 3KOOA 3TZ6A 3LYHA 3FPIA 5C80A 2FNAA 4HJRA 4HB2A 4EGCB 1EFRA 2QTLA 1DKRA 3T9AA 3G68A 4LHWA 1P2TA 4RF5A 4TQAA 1V9SA 2BWJA 2W11A 3JTMA 2XHBA 4UBKA 2XVAA 4GR5A 2QAGA 2G82A 1JHQA 5EJGA 5DMXA 5I7VA 4EBFA 4R5MA 1GP2A 3BL5A 4OTZA 4EJSC 2IBZH 3EGCA 1GRJA 1QH1B 1QDLB 1T2NA 2G6BA 1LLFA 3OQHA 3USCS 2XVZA 5THKA 4M86A 4GKAA 4L9RA 2VDKB 4XJSA 1D03A 4MH0R 5TARA 2YOGA 3HB4X 3FFQA 3TBHA 2CDYA 1C4XA 1VQ8V 4NV1A 4IDEA 2ATXA 3MCZA 4YALA 3GFTA 2P8JA 4BVAA 4OL9A 4Q19A 3ZEAA 1E3EA 1CDEA 3DM5A 3HJHA 3PFWO 3SBDA 1QQ7A 4H0LB 1GNVA 1CR1A 2Y2UA 4UQPA 3VTAA 3ADCA 2CHUA 1LDGA 1B2LA 2OXEA 1QO0D 1TI7A 3F78A 3LNNA 1L7EA 3WYEA 3IYLW 1USGA 2GCOA 4FINA 1UZLA 4CC6A 3CUYA 3KUCA 2I71A 2PX6A 4G4VA 3KQYA 1KPGA 2OYRA 3V6MA 2XE7A 1VH8A 2HIMA 4AFNA 1V7QA 1F8FA 1X7WA 2ZSIA 2OFFA 2CYAA 3EOZA 5TVKA 2AHYA 2HMTA 2EJRA 2FLVA 2AFIB 4DK1A 2POCA 2QQFA 3E5NA 2EP5A 5GOTA 4C4WC 5JARA 2ZR0A 1JPVA 3KQHA 2BFBA 1R8XA 3IKLA 3WFVA 3D81A 1YC5A 2CHSA 2XVYA 2PZAA 2Q2QA 3UTDA 3X2EA 3VUEA 3Q7TA 3DHNA 2Q7XA 2EHDA 1N57A 4X92A 4UCOA 4EDFA 1W49A 9LDTA 4JT8A 1G3UA 3PJSK 2HTFA 5BRNA 2NVUA 4B3HA 1MLDA 1ECLA 5BPHA 2C2WA 2I4OA 4M21A 3VR5H 1GA4A 2MSCB 2ZOVA 4DANA 3UJHA 4EJFA 1CWUA 1FP6A 2WHXA 3KEQA 4LYGA 1A8IA 3MF4A 5GTIZ 3QMWA 4IXMA 3ZHRA 3N2YA 1QHNA 4TLCA 4Z99A 2W6OA 2CLSA 3CC7V 2NSLA 1JHAA 1JR4A 1U0EA 3TLGB 4BPRA 2IX9A 4R1UA 4C30A 3EJWA 4F46A 1YZGA 4JYZA 4MQFB 3R7NA 1XZJA 2XD9A 2XQVA 3QEMB 4I5DA 4YX9A 1G2OA 1QOPB 3GRRA 2UV8A 3OMWA 1P2VA 2C4KA 4QPDA 2C94A 3NAMA 2IOQA 5BRAA 3A9SA 4AF6A 5F5LA 5K0JA 3AVPA 1GL6A 3D6JA 4AZSA 2PBRA 1QQAA 1AZTA 4QNMA 4ZVSA 3MMXA 1N2ZA 1RCUA 3NM5A 4C7VA 2YY7A 2Q1WA 4L75A 5IUJC 2VKQA 1J2RA 4G28B 2RFLA 4ZVTA 1O89A 3DB2A 2D4AA 3GRPA 3A7DA 3HADA 1SOWA 4X3MA 3VNQA 4ATNA 5K3OA 1VQ4F 2OSBA 1MABG 1VE7A 5E38A 5B2EA 1E6CA 1XZEA 1CFJA 4XEHA 2VG8A 3K0BA 2B25A 2OYCA 1A4RA 3UJ6A 5LYJB 4FC6A 1UQTA 2FW0A 3BMXA 1CUUA 4XRRA 4CTMA 4TZZA 3R5JA 3O4VA 4Z3DA 3S5JA 5B36A 1PS9A 2CFSA 1E6MA 3MS4A 1YXBA 3ZGOA 1TW3A 3DMHA 2Q6TA 1WXIA 3APOA 2HYIC 4V24A 1F2VA 4GVXA 3SR4A 2ZDGA 4IEEA 5IARA 4FGUA 5THXA 3K0FB 4N8SA 5LD2B 1NJFA 4YPVA 1W7AA 3QUQA 3NP9A 2H1IA 1NASA 1T6ZA 2BZGA 2CNBA 2FW1A 2CBXA 3O9ZA 4PYRA 1LGYA 4WFHA 4LISA 4CMCA 3RRXA 1OYYA 1G5TA 2FZKA 4AO6A 4AZ3B 1IYZA 4TXJA 2KGWA 1XMSA 3ZW8A 3VC3A 3W1VA 3W5AA 4WCEV 1JQ3A 5JVDA 2ZRMA 4U2BA 1G42A 3U4GA 3TQQA 3C74A 2IBSA 5C8YA 2VSOA 2R2GA 2W8ZA 2Q3BA 1DQYA 2O8BA 3LL7A 3LWVC 3I61A 3HFJA 3QNUA 2QL7A 3G9TA 3B85A 1M2WA 1O0SA 1TUIA 1TO2E 4JAUA 4PPQA 1KSGA 3ZN0A 1OZHA 4X20B 3GK3A 3OO1A 3HUUA 3VYRB 3SZGA 2GCNA 2N48A 2IHBA 2YXHA 3DGEC 2FQQA 1R6TA 3A32A 5BYAA 1Y7LA 4ZANA 3WZ2A 1S72V 3OZWA 3I58A 2B2NA 4WTOA 4FGLA 2REQB 3VZRA 1RBQA 1XKXA 3EIEA 4MEBA 3LZCA 2G6TA 4JEIA 4GNRA 3JS5A 4BBPA 3R76A 3PFFA 4X6LA 2HK7A 2RHGB 2RGXA 2IEIA 3DEZA 3LT0A 5B53A 4RO2A 3D36C 2DT4A 1Q81W 3O8LA 4MYCA 3CEMA 1FZTA 4MRSA 2EFEB 2PE5A 3KJZA 2V6GA 4OU5A 3DNFA 1RM5A 3R0ZA 1NAHA 4IXTA 1EKXA 3CR8A 1U2ZA 5FUXA 1RKXA 2Q5ZA 1OUMA 2ZS8A 1PLLA 2NXJA 1A8QA 3QKUA 4EF4A 1NGSA 3B4SA 2CLMB 2X6BA 3A6DA 1L4LA 1Y9JA 1FDVA 2W2MA 4A0FA 5JROA 5FL7A 3GRAA 5LMNB 1P9NA 1UJNA 1IVYA 2NN4A 1YQTA 1JR3D 4UEKA 2C20A 4G81A 3OU6A 1ZONA 2I1WA 4BJ6A 2C9OA 5L3SA 3RIXA 3UMRA 1RRKA 3CJTA 4EEKA 4IUCS 1TCCA 3O2QB 1SOAA 2R4TA 2OZBA 2IT1A 4PHFA 4QAJA 4AP6A 1T0PA 4BQEA 4IIHA 3DZCA 3RWOA 1YRBA 1J21A 1A69A 2B0CA 2QUKA 3AI2A 3L7BA 4F91B 4JF3A 3DAOA 2OCKA 4B79A 2F9LA 2I03A 4AG6A 1JHVA 5DGXA 1VHAA 4K9DA 4DDWA 3QTTA 3K7EA 4HI0E 4S1PA 5ERYA 1SXJC 2PJRA 4ADSG 2JFBA 3FTNA 3UHPA 3IHWA 1PVVA 3QU5A 3AOEC 1KK1A 1XLWA 4F1KA 2WB4A 3V1YA 2Q5LA 3LQ2A 4O8CA 1UF9A 5DISB 1Z5OA 4LZAA 1RXVA 2W2XA 1VSQA 1BZKA 1F23A 1NRWA 3EWIA 4TYNA 4NESA 4QG7A 4FPXA 1QF7A 4RBNA 2CNLA 2C3OA 4KG7A 4V0MA 2Q27A 3V97A 4BLSA 4ZMSA 3O26A 1Z4NA 4Q1CA 3TIGA 3A3KA 1ZPDA 3UJDA 3WLKX 1BA2A 2WFLB 5TPWB 2SBTA 4E3WA 3L46A 1M1XB 3RTEA 4MTFA 3OTGA 1A27A 1TFRA 4QTYA 4N5NA 4M9QA 3ILXA 3O31A 2G77B 1NU6A 1Z0KA 4OD0A 2GSWA 2FZLA 3E9RA 1R0BA 1E92A 4B3MO 5ESWA 4XIFA 1HQKA 3FFMA 2O2IA 3TXAA 1GU0A 1CY0A 1NFRA 4K9NA 5ESDA 2YIDA 3TUZC 5AJUA 4F93B 2RAPA 1KYIA 2F43B 3HVIA 4BW9A 3DFZA 3E3AA 2WAXA 3R7BA 2RI6A 2QGNA 2ZM6O 2LKCA 5A4JA 4ABTA 4DR4O 2Q3EA 1X70A 5KYTA 5HZKA 3OQPA 2ZYSA 4R2XA 1FYWA 1UXJA 4M8NE 4RMHA 5LBUA 4KGZA 3KHUA 4B40A 3CLTD 4U8HA 4MMXB 3FNBA 4OIFA 4POOA 5FV7A 1MSWD 2AFVA 3EUWA 2CL7X 1CERA 1AKUA 4TWBA 3BXXA 1NH2D 2CZWA 2GHIA 4YIHA 4GOKA 1Z63A 3MLEA 1FA9A 1HG0A 3O2NA 4PPFA 3STVA 2QB5A 1TQ4A 3N0TA 2WG1A 1SNYA 1T1IA 2QORA 4U63A 1NI8A 1PQUA 2XUKA 1MV8A 1YNSA 5BSWA 1SQ0A 2IUSA 4FNAA 1SQXH 2LV8A 4RKWA 3GYGA 1QANA 2QD2A 3OFJA 3AZOA 4DLYA 3V7QA 5KNBH 5IS2A 4EKNB 1EHIA 5KQGA 3A2LA 4I5IA 3ZCUA 3B1JA 2CXOA 4MDHA 4F5ZA 1ZVVA 4M36A 4L8LA 2Z1UA 2VJOA 4P53A 6GPBA 1WPGA 2AFIA 1Y1RA 4O4LF 2VDRB 2NU6A 4B87A 4URVR 3IJEB 2X8BA 3HFRA 1SQFA 1T2CA 4MVSA 3KQQA 1D8AA 4WZAE 1XZDA 4ZVLA 2C8KA 4A8PA 1K98A 2IUUA 3MA0A 4R1QA 2PTHA 2Q9CA 4PFJA 3PX2A 3CNOA 3JVHA 4ZGWA 1B6GA 1VQ6F 2I4RA 3T7SA 4HFJA 4MUNA 4NX2A 5DVZA 1KY4A 3RKRA 3UT6A 1F8XA 4YRTA 1CZLA 3AUJB 1WUTA 4ZJYA 2Q7DA 3ZWKA 2XQIA 3QK7A 1R0SA 2Q7GA 5JNUA 3P0EA 1M3SA 1W0CA 2IP1A 4GPTA 4M1YA 4NMWA 4RS4A 2FZ5A 1KD1H 2W22A 4WV3A 3R75A 5E7MA 3OOWA 2D2IA 3HWUA 3PFHA 2AMVA 4HLUA 3CLKA 3TOSA 4JROA 4XWWA 5TPZA 3SEZA 1L7NA 3QG1A 5G1PA 3DUFA 2C0CA 1XA4A 1I36A 1ESDA 1FYDA 1R1DA 2Z1FA 2JBHA 1VL8A 4IJ6A 4XA8A 1M7HA 4QVKA 5TQ0A 2DB3A 4XIJA 3C6YA 3FSRA 4WASA 3IBGA 1YCFA 3IEXA 3VC7A 3OG9A 1V5EA 2QX6A 2OOKA 5HTKA 4K6KA 2F1OA 1M8PA 4R7GA 4BNVA 1F06A 4ZZ0A 4WZAB 1X9IA 2CN1A 2NADA 5A0TA 1QZUA 1EFVB 2VF8A 4CIYA 3BWEA 4RZ2A 4JJAA 3WB0A 3IQWA 3STHA 1P2UA 1R5BA 2WLNA 1XTBA 9ATCA 1T9HA 1WB5A 3EGIA 4AKEA 1N0VC 1RJDA 4LFAB 5KQRA 5JNSA 5BRJA 4X3OA 1FSGA 2DPMA 5FHQA 5HILA 4IS2A 4JQCA 2AD1A 1WXXA 4PZCA 1EFDN 4RSRA 1OZGA 3CLRC 4GOXA 3REOA 4I4LA 1VQNV 3YASA 1E1MA 4UHHA 5DDIP 4TV9B 2OHWA 3NUGA 5KOHB 2GD0A 1L7DA 4PLYA 5AI8A 3HUFA 1JR9A 2WIFA 4A36A 4X64B 3SMVA 3FKSG 1C50A 2H00A 4GH5A 5BQ5A 2QT9A 1O1YA 4RZ3A 2FK7A 5FQOA 2GAFA 3TLXA 3LS2A 3CJRA 3NKVA 4WBNF 1TU3A 3WNVA 1X80B 2Y1XA 3ABTA 2VPTA 2GPYA 4UVDA 3GHHA 4DTIA 3ZGZA 3VKGA 1ZCAA 3I62A 3RBXA 4EA7A 2NPOA 1W1IA 3ABQB 3SOZA 4OPMA 4OK6A 3OESA 1ZG3A 2UZ1A 3A70A 4TSFD 3MGBA 1VQLF 3FLEA 4L9SA 2YVAA 3C9UA 4P3NA 2D62A 1HYBA 3K0FA 2WDZA 2PAAA 3FFWA 3H2HA 3IURA 3JY6A 1W48A 1D6NA 4H0FA 2QQ0A 1K7SN 3S29A 2I4MA 4A5OA 1FUIA 1RRFA 1TIBA 4JA0A 3C8LA 4N76A 4IR7A 4FU0A 3CXRA 4DVJA 3ASOB 4BO1A 1HDEA 3NB0A 1DL5A 1A9RA 2PUAA 3OQIB 3LLCA 3DULA 5K1XA 1P7WA 4YCLA 3UKJA 3WBJA 3WK6A 3HL4A 3GPIA 1VP9A 2I29A 2YV2A 2W2LA 3LDFA 3P26A 3V4SA 4OX9Y 2RC5A 4X20A 1ZI8A 3CZAA 5HMMA 1H8EA 2XR1A 2WTAA 2A0WA 3PEWA 4MOWA 4WECA 4BN4A 4C76A 2WJGA 2VT6A 3MC1A 2VWPA 4L4UA 1E77A 4OHUA 3BE6A 3S0YA 2NV0A 3IMGA 3QHDA 2IJHA 1TL7C 1MOZA 1FMFA 4YXWG 4JI1B 4R2JA 3WG7B 1Z2OX 2ZI3A 2JJ1D 3E4CA 5AKEA 1PU2A 3MNFA 2WM3A 4KLNA 1T29A 3IPLA 1C3XA 4YMLA 2HRBA 1GO2A 2Q50A 3L04A 4P0PB 3TMAA 2HCFA 3AEYA 3L07A 4A9AA 3RJ9A 3M9LA 4OOFA 1I5OA 1J8FA 4OM7A 2D7DA 4HYEA 4GICA 4K28A 5IT9M 1QAQA 3ZMSA 1A7AA 1ENOA 1K7EB 1K73H 2ON6A 3LT2A 4F21A 3AF1A 4GRAA 2EKLA 5EZYF 3C7AA 2VWJA 2E37A 3UMBA 2OC9A 3CWBH 3NBMA 2I54A 3QNMA 5LA6B 4RK7A 2DWDC 4BO0A 1HL3A 3SGIA 4GUAA 5F33A 4JL5A 2VHCA 2ZBPA 4ECAA 3ZP7A 1J06A 1JS1X 1JUDA 4ICIA 3H05A 5EBLC 3CISA 4BMYA 3U4IA 4OLJA 2CVOA 5E8JA 1KQFA 4CTJA 2XUAA 5AVMA 2AFHA 3OZEA 4YQYA 5JQGA 1AH2A 3FYEB 1N9ZA 3WJQA 1QTQA 5LGUA 1LBHA 4OMFG 2O2ZA 5E6SB 4ZK6A 3VH3A 5DSZA 1KIAA 4NYMR 2PZGA 3CCCA 4M1EA 4DV1O 4FM1A 3F7YC 3BSYA 4AKSA 2BKEA 4FHEA 2O2HA 1UI9A 1X4TA 3WL3A 3CW9A 4OUDA 1IB6A 4JU9A 2NU8A 2VXOA 4R68A 3LDTA 4QPPA 3IJ4A 1JJ7A 3Q0TA 3DOIA 2PRYA 2CTQA 2WPDD 1O6ZA 2X4DA 2JFHA 3DD1A 3P5BA 2B8JA 4TRMA 4A2PA 5MGBA 2IHTA 2RGAA 3A1WA 3EMVA 3VZSA 4GWLA 3PGLA 1C7JA 1Z5ZA 4Y6RA 3PUHA 3WU2Z 4HPJB 4FX5A 2GHTA 4GC5A 5HP4A 1CQZA 1JJFA 1CUYA 4YWHA 1M56C 1MVNA 4C2AA 1ZIPA 2ZJBA 1Q17A 2YJTD 4EL0A 2XXJA 2WFLA 5TPWA 2VJCA 4AK9A 2QLTA 9MHTA 4DCVA 2VAVA 2P2CA 4CM4B 3VH4A 4FB4A 4I0XA 3U16A 4TXLA 4R50A 3STZC 3RR2A 3F49S 4M1SA 1G8GA 3ABIA 1EGMB 1XEWX 1VE3A 4GI3A 4OXYA 1GZ7A 1NSFA 1AI4A 1S2NA 4R1NA 2XUMA 4BYMA 2RGCA 3D6TB 3GBPA 4QUIA 3EHBB 3QLUA 3OE7D 5BWCA 1TAQA 5FBQB 2DQZA 2IH3C 5DM60 2D1RA 4BFYA 4Z4HA 5D3ZA 3ANMA 2YMLA 2JBAA 2OBLA 4COOA 3NPAA 2EG5A 1TB4A 4LV5B 3BXEA 2HF9A 2DYKA 2AZDA 4LSMA 3LKBA 3B3AA 2PGXA 4QTUB 5BW8A 1NW6A 4XXHA 4UASA 4OHRA 1WPXA 2PM8A 1C80A 2FN9A 2QVBA 5LP6B 3D3KA 2CLHB 3KEGA 1G3IA 3M84A 1EEHA 4NFHA 3K6SB 4OGQB 3NOVA 5KOIA 1UFKA 3OQBA 4CG2A 1QK3A 4UFOA 5KLVH 1IZYA 3FFBA 4JEMA 2HG5C 3AY0A 3GRUA 3SCZA 3KLMX 4AJKA 5L7YA 4QU8A 5DLQC 4DRXA 2A9HA 2R5NA 1J9ZA 3HDYA 1DC6A 1WXHA 1HX7A 2JEOA 3WSWA 2OWEA 1ARZA 3C16C 4H1VA 1ORIA 3WIUA 2J3MA 3U4DA 3HR0A 3HP1A 1EQUA 1NVUQ 5KVVA 4PC1A 2B82A 3N86A 1D5WA 1OV9A 1QGZA 4PE5B 1E8DA 4WADA 4DV3O 2OM2A 1I2DA 3DMTA 2E75B 5IDJA 2WF5A 3LDUA 1EB8A 2EARA 3VO8A 3NHYA 1XQ9A 4IV5A 4JLUA 5HDQA 1HT0A 2MSNA 2F8SA 1XVTA 1U7UA 2ZE8A 3PX3A 2OPBA 6CHYA 1JIVA 2CY0A 2K9PA 3OT1A 3U0ZA 2NTEA 3Q6NA 1ACLA 4KN6A 2ZRIA 1LPOA 4TZTA 1AQ6A 1E1RA 4LK3A 2Y99A 4J0EA 1BJTA 5AJTA 3K12A 2IHKA 2C4WA 4YO8A 3ITEA 1LUVA 2Q1UA 5K6TA 2CXUA 1SELA 1AILA 4ALKA 2N05A 1F0KA 3BGWA 2QNIA 4AX4A 5IWAO 1VL1A 3EAGA 3RSFA 1FTYA 2YSUB 1F0PA 5LQSA 3HP7A 3W8EA 3J7TA 1T6BY 3TIVA 2RH5A 1JLLA 2AN4A 4GSKA 5FB3A 2DYRC 4DE5A 2TSYB 3CCEF 2R00C 3DNMA 1HFKA 4WF9V 2Z0MA 1D7OA 2BF7A 4KE9A 2R6AA 1SCAA 3OQOA 1CC1S 1WXGA 4R54A 2WHPB 1B26A 4C22A 2FOIA 3GFPA 4OX9O 3L8HA 1DQPA 3K5NA 3DR3A 2YI9A 1YJXA 5H6RA 5DZSA 3P97A 3UHFA 3NHKA 2F6RA 3NG1A 4D44A 1M2HA 4XR4A 3FY4A 2PF4E 1M6WA 4ME6A 5J43A 1XZLA 1N32B 4YAEA 2OCDA 3TG8A 1A4XA 2NSJA 4QOEA 2FX5A 4LC1A 1AGYA 1QYIA 3MELA 2ZJ0A 4FFBB 3HEBA 5G53C 1SU8A 4Y8VA 2PYZA 1MO4A 4FSHA 4NCJA 3PQ4A 2VZEA 1I0HA 1FP4B 2GEBA 1HLPA 3ADOA 3SPCA 3ZDZB 3SYOA 1CW2B 3G6BA 1GR0A 3F3SA 4EWLA 3F7VC 3AHGA 4Z3KA 3NT5A 2DJIA 1EZ4A 4M22A 1KNJA 4C4SA 1YVUA 5DCYA 4A4DA 4ZMBA 3WYNA 1F9EA 4B09A 1G4AE 4BP9A 2JGKA 4WDRA 2R5FA 4LI0A 2B35A 5B1SA 2PSSA 4BDTA 2OCCB 1CUGA 5ENZA 2C5BA 4P2ZA 4R2WA 4F0JA 2POQX 1T5HX 2YFKA 5IJ9A 2VBCA 3D4LA 3R9WA 4AMGA 1QRRA 3QE0A 5EZ5A 1Z12A 4MS2A 3U9TA 4CH4A 3MJCA 2AGVA 1GQFA 5ALZA 4ZDJA 1VYVA 4M8KA 2VH2A 3KQTA 3WL6A 2P1ZA 4I4CA 4FLWA 2Z9BA 2ZOSA 2DETA 3Q88A 1RIFA 2FZVA 2QTOA 3PEFA 1O97C 5EJFA 1M2GA 3IB3A 3KWMA 2QAGB 4FYIA 5C53B 3LNCA 3MZ0A 1ZKMA 5KHGA 4MP3A 3HFGA 2QMZA 3AEZA 2GKSA 3T41A 4F5YA 1YIAA 1DX4A 1E7KA 1TMYA 3BYZA 2D0OB 3ELUA 2W0MA 3ZXSA 4H77A 1YL6A 1M2NA 1I4OA 2JFWA 1Z0JA 5FEUA 3MBOA 2ZJ8A 1X0VA 3HC7A 3RWRD 4Q34A 3W5HA 1Z08A 1B0UA 3NLLA 3RFTA 2BI7A 5KWJA 2AMTA 1OCEA 1YZKA 1LSOA 1E2MA 5ALDA 2JGDA 2ROQA 1GUDA 3EXFA 2VAWA 3HVUA 2CSLA 4EUSA 1PJLA 2A92A 3J7AU 3LKDA 3AG4C 4MR8A 1ULZA 1U11A 4IDCA 4JP3A 1PNLA 2J3HA 1ZU5A 2O2GA 1E3WB 2GPNA 2GCOB 1RMTA 1E2HA 5JHGB 3JQ6A 1G16A 3GPCA 1NXTA 5H6QA 2ALJA 1I4WA 4KYIB 1ZIOA 3CRZA 5JOQA 2VWKA 3TNJA 2HD4A 1DIAA 2V7QD 4IX9A 4UQLA 2WJZB 2ODWA 1LY1A 3BIJA 3WRXC 3PN1A 2LQTA 2ZI7A 1QXSA 3KJQA 1Z6ZA 3ZUPA 1NTOA 4C0XA 3DBRA 5LQJA 1THGA 1U6IA 2BFBB 1XIVA 5LA6A 1EVJA 2HRQA 2L2QA 4DSUA 3UAZA 1XP5A 1FXKA 3B3JA 2JVDA 5HS4A 1Q74A 3I6YA 4FN4A 5EO3A 2BSQA 3BWDD 4W9NA 2VNKA 3QU7A 1C9MA 2ID4A 2I0FA 1QKIA 2BM0A 3B5IA 4BO4A 2DCMA 4E5DA 1XDZA 1KQPA 5C3MA 2DQ0A 2XCIA 3I53A 5KJEA 2EQAA 1XG5A 1W96A 3E15A 2NVUB 2I2XB 4AI8A 1H0HA 4WOCA 3FHTA 4TMVA 3VCZA 3O91A 4J16A 2QXYA 2PGNA 5I5GA 1R0LA 4I9UA 1N5DA 3INTA 2IYQA 3KT3A 2VF2A 1Q2XA 1UAGA 4XB1A 5IZ4A 3QPDA 1RXWA 1V35A 1WNFA 2PV0A 3A1CA 1SETA 1DG1G 3N53A 1R10A 2CK3A 5HR5A 3GI1A 4LTNA 2QXUA 1OA1A 5CBPB 4C87A 1XA0A 3M5WA 1P0CA 4KH1A 1ADGA 2BH2A 2KLBA 1JIKA 4I9QA 3HCNA 4KAJA 1I1OA 3TX2A 1L9KA 5JCZA 1AQUA 1HY3A 5I01A 4ZODA 5JYBA 3I30X 1KS2A 1XVIA 4QD3A 3HLYA 4UBNA 5GM2A 1HGXA 3O4FA 3AGQA 1G2IA 4BGEA 4Q3AA 2AN1A 4XARA 1ISRA 4RTJA 1WVIA 3MJEA 3RUHA 1NF2A 4C0BA 1M83A 1PTJA 2ZUCA 2IDKA 5H3HA 5B1OA 2MCFA 1NM5C 1N9KA 1Z8FA 1JX6A 4UBJA 3V8BA 821PA 1ICIA 1QDUA 4FZRA 3F8WA 5GGXA 1DADA 3GWOA 2Q8QA 3ONDA 2EYUA 2ZTHA 4OH7A 4UXJA 3E2EA 3QVJA 3ND5A 3NM6B 3LP6A 1RJGA 5JCJA 4DNXA 2NLOA 3CT6A 2B4TO 4D8TA 4TLAA 1PV1A 3IODA 2ZDIC 1W1WA 1XQ1A 5IZCA 3AT1A 4EJMA 1NVBA 1FY2A 5FI1B 1ADBA 3IAEA 1WDLA 2QVZX 2ZFUA 1OGYA 1EN4A 2QWXA 5GAJA 3O3CA 4P86A 1SIBE 3WGMA 2XH8A 2WKSA 3F7TA 3FPFA 3K5MA 5TJ9A 3CXCF 4UTRA 3LXMA 2ZIWB 5B2FA 2C42A 3FW1A 3W3AD 1QAMA 5I9SA 2ZUBA 3VR4D 3VYTC 4D5GA 1EAMA 1MGPA 2OORA 3OQMA 2EYQA 3WDLA 3Q72A 2HQSA 1RE1A 5JVDB 2MINB 3MTQA 1WTCA 3P9YA 4EGFA 5ICGA 1N8TA 3E23A 3Q3EA 1F2DA 2CL0X 3EIWA 4MKRA 3SIVA 4RL6A 5T67A 1PCXA 3MOIA 4ND2A 1FDIA 1NVAA 3ZY3A 3NYQA 3ZJ5A 1U5BA 1FLNA 2P5UA 5KIAA 5FCDA 2H54A 3AG3B 1A5ZA 1W73A 1VG1A 2RI1A 5BVHA 1S6YA 3FH0A 3GZJA 1P17A 3TTSA 2V03A 5KNBD 3WG9A 1JDBB 1KZ4A 2OLJA 3VKWA 1QFMA 2ZB3A 4UNQA 1J5PA 3RS2A 3KCYA 3I1YA 3P2JA 1E9VA 2C04A 3U61B 3HJWC 1U02A 4MDEA 1E9RA 2DPLA 1U6KA 5EMKA 3VOUA 2XKAA 3HJAA 4BZQA 3GA0A 1M1UA 1TJNA 2HLNA 2QVXX 5KVQA 2BLNA 2RGNC 1QOZA 1DF4A 3CEAA 2QTNA 3PITA 3CVXA 4D8WA 1XEAA 1Q77A 3WGOA 3TECE 2AW9A 1KYVA 3TCUA 3ZD8A 4ARZA 5A2QA 1VQ8F 3VC1A 1XQ8A 4Q9DA 3NXKA 4XD7A 4TSRA 4DILA 2X15A 1JX9A 2YJNA 3D5TA 4V0ME 2FOLA 2GBGA 3NGLA 3AOGA 5A5DA 1UR5A 4Q37A 1W1UA 5GVRA 4BVSA 4RHAA 1G5RA 1Z7BA 1AR4A 4L5CA 4CCYA 4DPKA 5CA1F 1KJYA 4ZYWA 2RGDA 1MFPA 2I3BA 1VZ3A 1Z07A 1OR8A 2IZ7A 3DO8A 1N7JA 2MWMA 1ZNWA 3KRTA 3ZNNA 3PLNA 4MVJA 4GLFA 3VJRA 1DTSA 1K7YA 3ZMVA 2Q8VA 1YKGA 5KVCA 4QOGA 3FYSA 2LW7A 1UBFA 4RVOA 2W6IG 1N8RH 2Z5GA 4NWOB 1IBCA 4GXQA 5B2ZA 4N3CA 5AM3A 2E48A 2WTEA 2HTEA 2PTMA 1FXWA 3TK1A 1YS7A 1O58A 3E20B 3RFCA 4RK4A 4MW2A 2BCCH 3AKYA 4ZXFA 4O1MA 1ODCA 4P33A 2XCLA 3SJAA 5LLSA 2D7JA 4MQEB 4ZDKA 3RUPA 2BFMA 1P3DA 4LF6O 2J3KA 3LWQC 3TRDA 4BP8A 4QDJA 1SVWA 4DA0A 5LZ5A 5IMSA 5ALWA 4AZVA 3EDCA 2DC1A 1GPMA 1C1DA 4ZCQA 1AZLA 4P98A 3BCCH 4ARVA 4Y0AA 4JXJA 2W48A 5BN5A 3CC7F 3WL5A 1LC0A 3TW8A 3C8HA 4BAYA 1HEIA 2JLWA 3HCRA 2JFPA 1H2LA 1NF8A 2CVHA 2VK4A 3MQ2A 5C5EA 2XWJI 3VI6A 4MZDA 4KEAA 3BKWA 4KMSA 1T0IA 4DIBA 2HIAA 1TEVA 2N74A 5E4JA 2AFIE 3I04A 1CJKC 4YDSA 2I6XA 1T0KB 2XCQA 4MCAA 4OPAA 2GLZA 3JQQA 5LGNA 1E5XA 1HG1A 4MVXA 4JB8A 1NKTA 2VVTA 2DFDA 1YJBA 1UPAA 2ZI5A 4BVGA 2GLTA 1R1MA 4AHCA 2X0NA 4ETIA 2YZGA 1PP9H 2YNMC 1EYZA 3B2QA 5HJEA 3A0RB 3MD9A 1TNDA 2H7CA 5J9PC 4GKVA 4NOLA 2DQ3A 3ZHVA 2XTJA 3C9SA 1AQYA 4JXXA 2C7PA 1CUZA 2QNBA 1NR1A 5FT9A 4ZK2A 3U6BA 3WGKA 2XTAA 1DCKA 3DE4X 2BJHA 1MC8A 1E3WA 4AXBA 3PFKA 3L0SA 3DXFA 2C92A 2NZ8A 3DOCA 2J08A 2CMHA 4ZVUA 5K8JB 3L7AA 2HJGA 4JI7B 1ULSA 5D6OA 1WPBA 3LCVB 1I2MA 5LXTA 1QX3A 4FYMA 3LUAA 3KALA 2Y8EA 3PC8C 2NU6B 4P9NA 4P54A 5EIOA 3KD2A 1JG2A 4BLUA 4F4FA 1DC8A 3GJ6A 5F1PA 4BKOA 5HFJA 1YGPA 3O4RA 4GOLD 2G1PA 1P4JA 4PFKA 1HURA 5K0NA 1H47A 1T6NA 1L5ZA 3AR9A 2P4UA 2QNRA 2ECPA 5DIFA 3IVRA 4FK5C 2C4HA 2QTCA 4XSGA 3A4LA 3ZLTA 2O23A 5K3BA 5AD1A 4NOMA 3PNOA 4R1MA 2NUBA 2EEPA 2JIZG 1X7ZA 4HWGA 4Q18A 4K0KO 1J99A 5BXZA 2FRVA 4RVUA 1TA4A 3SPGA 4REQB 2W2OA 2YIBA 1JE0A 1KE1A 2PJDA 4IILA 2P9FA 3DUFB 4NNOA 2CCKA 3I37X 1QVGF 5ED0A 3KK0A 4BNZA 2E4UA 3D1JA 3OEEA 1PEAA 3KLNA 3H5RA 5DLEA 3D0QA 4DV7O 3J7AC 4NULA 3VPGA 4WH0A 5TQ0B 2JAXA 3O8NA 2PRSA 4BZWA 1ZK2A 3RVJA 3PFCA 3MFQA 4RDIA 1S72F 4KK4A 4PQRA 5F4BA 1Q1NA 5DWDA 5DNUA 2XMSA 4KWTA 3EJ6A 3V8QA 5CBPA 1ORWA 2QIOA 5FV4A 4FDUA 3LFHA 1NNUA 2V6FA 3WJ2A 4G86A 1OAKA 2XIQA 2WUWE 4WACA 4W63A 1X8XA 3L4JA 2R84A 1PEYA 1P7ZA 3A9TA 2BGLA 3Q0IA 4K6HA 4FEAA 2H6EA 4WLEA 1VHWA 2ZVQX 1TXGA 4IJUA 4M87A 4ZARA 5D6NA 2HU8A 1S8FA 4GM0A 5ARCA 1AJNA 4IYRA 1CVRA 3G0IA 3BN3A 4IFBA 4AKGA 2CFOA 2B8NA 1TW2A 2BELA 2ZT9B 2GXSA 5EJ4A 3CUEF 3EQ9A 2CF6A 3MTIA 4LH6A 4G5HA 1YK0A 1HYGA 1H2YA 4JI5O 3N3AC 2FPUA 1P4HA 1CVLA 4R2IA 4CM7A 4EKGA 3DTTA 3LCMA 1GTOA 3S4YA 1JLKA 3EIHA 5AH0A 4P2BA 5G0UA 3HVKA 2J9YB 3UKDA 5JALA 1WW3A 1E6WA 4OP1A 3WIVA 4I1UA 4QTTB 2UZ1B 1Q0QA 1XK7A 2WBLC 2QLJA 1P7VA 1PGOA 5EA2A 2VYFA 4S2UA 4D4IA 1NUAA 5FF9A 1S8AA 4EK9A 1PD3A 1JSZA 1ISIA 4KJZA 4MVWA 4B80A 3Q3GE 3WGQA 5EC2C 3ZD6A 4IICA 4Q02A 4D9FA 3G13A 4DN6A 5E8RA 1W6UA 2WVHA 4M60A 4KQCA 2XBLA 3IT2A 2CW5A 4G1MB 2R4QA 2ZDHA 2NPFA 1DKNA 4G0YA 1QHEA 3ZDFA 1V71A 5LDDC 2MINA 2H51A 3R4VA 2CLKB 2WM9B 1FYXA 5E9QA 4GYJA 4LTDA 4BLOA 5L3GA 1Z7EA 2W0FC 5H5NA 1M67A 1Z73A 4CGZA 1IBKB 3ERNA 1OXSC 1LB1B 1LPSA 1TJ3A 3A3YA 1K2VN 1NPYA 2A5FA 4MVJH 2BGGA 4L7QA 5E1OA 2P41A 3IC7A 2NYVA 4RWUA 3RBAA 3RS7A 5C5DA 1Q43A 3ZV7A 3TXYA 2C1EA 3KZ1E 3KSZO 3N05A 3KLPX 4RMNA 4BMXA 2AFHE 4DG9A 4MTXA 4WXPA 3B70A 1HBJA 1Y7TA 4DLPA 2E5LB 3RH0A 3H7IA 2I2CA 2Y1LA 1KYOF 2ZTLA 2CMFA 5AJZA 3UK2A 4UTXA 4JTCB 2ATKC 1TM5E 2WDPA 5JPDA 2GTHA 1CCWA 1ORTA 4EA6A 3NNSA 4WLNA 3X44A 2O19A 1PTKA 4L0QA 4U4AA 1EWYA 1SKAA 2B83A 5F35A 4JLNA 4MRVA 2E4YA 4HJXA 1RYZA 4KNYA 3LC1O 1IK6A 1G4YB 2YN2A 4NTXA 5E0OA 2GJ8A 2ZSFA 3B36A 2EWVA 3PT5A 1D2NA 5FEMA 3PICA 4GZMA 5TXGA 1EDBA 4DIUA 3Q8HA 1J5EB 5I9LA 5AHOA 1EG2A 2O3UA 4H7EA 1NJ2A 3IQIX 4QREA 1L5GB 5AW3A 3QXSA 4CEJA 2XWPA 3ZHSA 2RB9A 4BBZA 2Y6VA 4LG1A 4M1ZA 4ZEXA 5IXSA 2AFHB 2Q7OE 3QVKA 5JQGB 5HK8A 4G4XA 1NVFA 1GFZA 1Y76A 4Z9YA 1CY4A 1DKLA 4WEOA 3T7TA 2LVBA 1CXZA 3E0XA 1KU9A 4Z0HO 4MVJP 1U9ZA 4GLXA 1SWVA 3FWKA 1LJ8A 4TLBA 1GA1A 3X2FA 1RA4A 4PIMA 2VHUA 3AJ8A 1JKXA 1JIIA 1BU8A 4OUDB 1XMIA 1KMCA 2NU8B 4ZQGA 3G0BA 3OLVA 2C2KA 1VL0A 3IAAA 1YI2V 2PMKA 4EHKA 3AXSA 2CDNA 5CFZA 2VOEA 1AK2A 4TT3A 3IEQA 3VXKA 1OX5A 4XQCA 1LLUA 5BN3A 1Z68A 3FMFA 1WP4A 1GAQA 5KYWB 1O95A 3HJRA 4MQEA 2BDTA 1IQUA 2O0JA 3DCIA 3R40A 1GRVA 2JAHA 3O4JA 3D6FA 4D4MA 1BCCH 5A71A 5KKNB 4JGSA 1FRZA 4I0XB 1YA4A 1L5YA 4MX8A 3QX3A 4N0EA 4UEOA 3ZXUB 5IVIA 2ZYRA 3QVSA 5H7XA 1EFCA 2QN8A 5MDHA 1IUNA 3U4HA 4ZCRA 3TO5A 4B5KA 3DWGA 2XGJA 4BCCA 1G5IA 1TOAA 2D3WA 2AG5A 2P1RA 4EIWA 3TG2A 3IEUA 4FFRA 5AVRA 5GIPE 1UC5B 3RFVA 1I6WA 1J0BA 3AZPA 2W6JD 5EY5B 5CBHA 3DZHA 2JBAB 2ADMA 3PI6A 4Z0NA 4ZREA 1GGMA 4NEGA 3NI2A 5EMNA 2ORYA 3T5MA 5IYBO 4XJXA 4Q4LA 3W9SA 2ISQA 1W0KD 3ODPA 1Y3IA 4QXQA 2QZ4A 2D5IA 2HBRA 2NQ8A 1R18A 2A8YA 3K5WA 5JDIC 1OJ7A 1O54A 3OHMA 1XDSA 3ZHTA 4FJCC 4IX1A 3A0RA 1WSWA 2R6R1 3G8AA 1VQNF 3FWYA 1PWYE 4NXMB 1MF7A 1N7GA 3H2GA 1V1JA 3IXLA 4DRXB 1E6LA 3TPCA 2R1VA 2QPAA 3LA8A 1L6IA 1CS4C 2XASA 1RNLA 1Y8QA 4QUBA 4B3BA 3REQB 1VYHA 4HB0A 3G5AA 2VNAA 2ZIZA 3JWEA 5G0TA 1RWQA 4OREX 4UCRA 3OZVA 2A1UA 1T3SA 1PK7A 5T7BA 2G9VA 3ABZA 1T5SA 1AUQA 1GZ3A 1KY3A 3BIOA 4FHCA 4L8FA 3F7MA 4E21A 1Y66A 5EC8A 2ZYUX 1JDUA 1K6IA 2XLBA 2ZD9A 3NP7A 2BEUB 4B2PA 1VLVA 4QJIA 2ITDC 4X91A 5F51A 3V8NA 5J5AA 1CS0B 2OQ2A 1PW7A 5FXMA 3PAFA 1VMEA 4YR9A 3SDSA 3H5IA 4ZOLA 2P4KA 3LKZA 2P7IA 2QX8A 4ES6A 4BUJA 2WJYA 3OT1B 4JLBA 5ALRA 4OQQA 4Q3BA 1S01A 3E2IA 4G1BA 2OO5C 2DQ4A 3RSOA 3M4JA 3LL4A 4FJ1A 2IZ1A 2HHAA 1JDJA 2QL9A 3ZBHA 2RNBA 4BVEA 4REQA 5ICEA 1VG9B 4UUAA 3K05A 1E2IA 4BJ5A 4XBFA 4MA5A 2WHQA 3G4SV 4AJ4A 2FPXA 3D0OA 2YMMA 4BTVA 3QOXA 5FBRB 4YRGA 2PXAA 3P9QA 5ICFA 1U8FO 1JLLB 2VHYA 3ETHA 4GC9A 2VDWA 4B3RB 3KJHA 4TZ6A 4PX5A 4KRGA 1REQB 3I72A 1ESEA 5D7NA 1Z0IA 3CB4A 4ZU1X 1ULUA 1EWRA 2PTGA 2DFPA 2OUIA 2XF8A 1V1RA 2Q21A 1CP2A 4LA4A 3NDIA 4NZPA 5FH9A 3Q8WA 3OA0A 3K9BA 1APBA 1HE1C 2Q0XA 4A8JC 4K87A 2BE9A 3MYYA 1GUYA 5BT8A 5YASA 1HNZB 4D97A 2WICA 3ZJVA 4OJQA 3DBIA 4F96A 1B0AA 2IKSA 4NBRA 2DPYA 2QYHA 2JS7A 4RKQA 5B4UA 3G0OA 4F4IA 2E5FA 4HBNA 4CQJA 1KSFX 3H1IH 1V16A 4Z4GA 4LE2A 3AUKA 5NLLA 3GEGA 5AKLA 4H6XA 1GK9A 5AG2A 2VSNA 3BGDA 3RW0A 1KA9H 1WW8A 4CM9A 5A9SB 3U6KA 3M4ZA 1OWOA 4MRAA 2BTUA 2ZBUA 2QBYA 2GEDA 1IIBA 3K0TA 1T9GS 5IJXA 1X3LA 3LBYA 1W2GA 2WR8A 5PNTA 3UAYA 3E6AA 5I7SA 2HJSA 5HRAA 4KO1S 2HVYD 2VT3A 1A8SA 3M8AA 1C2YA 2PSEA 5IJ9B 2PR2A 1R00A 3DDNA 2B1QA 1XCJA 5GGYA 1T0UA 4DPMA 3COPA 5JNLA 2FE4A 1Z4IA 1L5LA 4ECEA 3GA7A 5A06A 5F98A 3IMEA 3RS4A 4UZSA 5HKBA 4RNDB 1ORVA 2Z3VA 2NOAA 1COMA 1VKRA 1H2HA 2UU9O 1LDBA 4YRSA 1ZGZA 4JWKA 3FBTA 3GNLA 4OGGA 4XDYA 2YKGA 4G9EA 3G2NA 1XVUA 1EE9A 5CFMA 5C52B 3NV9A 1Z0SA 2VT2A 1CR2A 3K58A 3SX0A 1VA4A 5JMWA 4UATA 3KPUA 1XQYA 2IYRA 2JNBA 2AB0A 1ZD5A 2E0IA 4ZD6A 1NBHA 4GYWA 1FTGA 5ENVA 5KX5F 3JRWA 3MTBA 4I5GA 3WX0A 5GMOA 2X8JA 4CCWA 4IDDA 2WE7A 3L6RA 5G02A 4MKFA 1CUIA 1CHNA 2JGDB 4AJEA 4IJWA 3W79A 3EXFB 3PGA1 2BKXA 1U28A 2HB6A 3VX4A 2TMDA 4MJ7A 4FJ0A 4DCSA 4MMZB 3NMUF 5HJ7A 1SRQA 3QWHA 4X6YA 1VFPA 2WC1A 4FFKA 2YTZA 4MR8B 1FFWA 2CLDX 3C39A 2X7RB 5DOZA 1SQGA 4NU6A 2I33A 1YL5A 1B8VA 3VDXA 2Y69C 4NBTA 1NX9A 4KFTA 2SECE 3WLLA 1K5DA 1IQPA 1KI1A 3L7YA 4LRSB 2FFRA 4Y2GA 2AYYA 4ZGGA 2Z6AA 4HOYA 3A9VA 4JTDB 4M9ZA 4B2LA 4DKJA 5K6RA 2HHJA 3VGJA 4G27B 2AEMA 2HQRA 2D0DA 1JA1A 2RN9A 1KXJA 3CIFA 2A94A 3L6DA 2E49A 3L8GA 3DBRB 4BNGA 3FYCA 1XHLA 3GA5A 2O7RA 1FXKB 1FTQA 2OQIA 3DE0X 2CBZA 4ZI5A 4RVNA 3KNZA 4O1HA 2XDQB 5C3UA 1OCOC 1YJ8A 2OC4A 4BFZA 4FW9A 4AJ2A 1MJFA 2P5SA 3ROTA 4CMKA 4ZYYA 2HJDA 2J9GA 5H0IA 1S3GA 1EX1A 1QOQB 1GLGA 5B30A 2OG1A 1UFVA 2EZ9A 1OU4A 3QUSA 5LUBA 2D06A 3AR3A 3NYRA 1JVNA 3LDDA 4WFGA 1L8XA 1YASA 4LBYA 2VYNA 5T41A 5AFSA 1LR1A 3INYA 4S1VA 1HTWA 2HS0A 4PZZA 2WYUA 1KDZA 4OBXA 4TMKA 5FI3A 2EZOA 4Z1OA 1GT6A 5DP1A 1WE2A 2OAEA 4HFMA 4OQLA 2TECE 1ZHHA 2QD4A 4TTQA 2IA5A 1MZPA 3W5VA 1F12A 2HQ1A 1NI3A 5A3JA 1ILEA 1P33A 2Q3DA 2FI1A 4ASUD 2GLXA 4G2NA 4DSAA 2O7SA 1RMQA 1V9PA 3BEOA 2VL7A 1R6UA 3A14A 1C4OA 5KYWA 2EC5A 5BSHA 1H42A 2GLUA 3OETA 3L0YA 3SIUA 3O3NB 1WLYA 4KXFB 1JFRA 4TMXA 1ZM4A 3K0AB 2D5CA 1R9JA 2G3YA 3LBAA 3B6KA 1XEFA 3GEBA 4RS3A 4A27A 1QNFA 3ETLA 1K9VF 4UHEA 5J4LA 1NKSA 5AKKA 4AO7A 1YBFA 4DCOA 1OU0A 3BDAA 5FI5A 3HVHA 1SC3A 1ZL0A 3D6VA 5HE8A 4QJBA 4MV9A 3CSUA 4JKYA 2HMWA 1VQ7V 1YKSA 2AX4A 4N49A 5L40A 2HCTA 4FS8A 2UVDA 2A5DA 4Q7LA 5JRJA 3GXBA 4MA4A 3H1AA 1RTKA 3VZDA 5CXUA 1JIUA 1RVV1 3EZ6A 3K5HA 1PFYA 4H7PA 4HF7A 4RYLA 4MR7B 4U2KA 4WT7A 2C9CA 2GT1A 4CLRA 3ON5A 1P8AA 4E6EA 3ZXXA 4D9KA 2XWQA 5KDDA 5TJHA 1IAVA 3PTAA 4KPEC 2RGRA 5CPBA 4PLTA 4FR2A 2R86A 3DCNA 5IFLA 3P7MA 5ELLA 1Y3AA 1IBLO 3R5FA 1I3OA 3GDHA 4FZ3A 2H5JA 5FBLB 2XTZA 2GFIA 2QIPA 3GLTA 4ND8B 4D3XA 2GD2A 1QORA 4KO3S 4LJ7A 3WAGA 4AU1A 1ZOOA 4KHPB 4LDNA 2WAMA 4GP9A 1H8HA 1YE8A 1BVYF 5LZ9A 1KJWA 3L0PA 3REQA 1B3BA 2IP4A 4PNPA 1HMPA 1DLJA 2DFNA 1EWKA 2C8JA 3USES 5CM8B 4PZDA 1DOZA 5H9CA 3K0GA 1YR7A 5FOVA 4L0MA 3H8JA 3ZY4A 3ZX4A 2HL6A 4KQ1A 4YJHB 3S68A 1UK6A 1G8PA 2DBQA 5KHIA 3VPFA 1Y8AA 2ABWA 3CC4F 4YQFA 4N5DA 1U5BB 1V5FA 4CIAA 1HQDA 1XTJA 3QVTA 3N5KA 2BEUA 3NVAA 2C59A 3QXHA 3BQMB 1CS0A 5BVHB 4JPRA 1CDZA 2H9IA 1P61B 2NTNA 1NY6A 2F2TA 2OGSA 1QLNA 3IR7A 5BNFA 1PEDA 1TJ4A 5DTJA 3CN7A 5KNDA 5FIUA 2J9ZB 1DEHA 4MVJE 4DBZA 2REOA 4DEYA 4YRKA 4FDVA 1UZUA 2CKDA 2PRIA 2VHZA 3ZTYA 3IGFA 3KKPA 3GGJA 3WRWA 1U0RA 1JN1A 3SC2A 5BWBA 3I23A 2Z8XA 2EJCA 4JZGA 1JHXA 4RACA 2ZUEA 4WBXC 1G4HA 3ZKWA 3QXJA 4OQYA 4BJ3A 4TLMB 2VUSA 3R6DA 3AIKA 4EL5A 4ARZB 1YU9A 4F3RA 4WZZA 1OIWA 3DXZA 1RC0A 3S2ZA 3AUXA 2PUTA 4PZ0A 3AVQA 3A31A 3BIXA 3VR5D 1REQA 4NJOA 2WUGA 4EZIA 4J4HA 2VQSA 2YXLA 1P0IA 1H5UA 3CYFA 4JXKA 4LJRA 2BOBC 2O48X 3GHZA 1AY0A 1ZAYA 5F12A 2R8RA 4CCYB 3OC6A 1J0CA 3AETB 3WMXA 1PFGA 3NRCA 3KQVA 4F4LA 1MTZA 4QM7A 1QR6A 1X52A 5AVKA 2OTLV 1GYQA 1QE5A 3GJ7A 1WLEA 2HNAA 3F9CA 3PSAA 4QVIA 1Y33E 4A0HA 4YTEA 2I91A 2X7XA 3SU8A 2DMXA 4GECA 1WQ3A 3CEJA 5IY5C 1OHHA 1H2EA 3RKUA 5ALEA 2FR1A 1AURA 4HG2A 5KVSA 4BQSA 1UQUA 1QAHA 4K6GA 1U3WA 4NKRA 1MR3F 2VJLA 2ZROA 2D54A 4WOJA 4JIGA 3GG2A 1IUOA 1L1EA 4MKIA 1TADA 3DL7A 5CFLA 1KEUA 1QCEA 1E79G 2DY1A 5SZIA 5A9SA 1IUKA 2C88A 4G1UC 4DSTA 2I7CA 3V5NA 1XRRA 3SWWA 1XYYA 4X62B 2B1JA 4ENWA 3CC4V 1JBKA 1I2CA 5KSWB 4L51A 1N3LA 4JT4A 4QRHA 3E9NA 1K6EA 1C1DB 1PHRA 3CCQF 2P6OA 3K8ZA 3P71T 1OBOA 1U3CA 5FPSA 4LXHA 3L0ZA 1EK1A 2YH2A 3TQCA 3PLAC 1O9BA 1P3Y1 5BN5B 2GPJA 2DH6A 3DMDA 4MPTA 2IIPA 3TW8B 4BECA 2CWDA 5L3ZA 3BICA 3OPXA 3I55F 2CLIB 3E18A 1WDKA 4FM0A 3THWA 1BVRA 1XLVA 3T3PB 4EGQA 1GPUA 4C5CA 4Y7DA 3MQ4A 3GPDG 4I4IA 3V80A 4HYTA 2ES4A 5K0EA 3PXBA 3TR5A 4AS1A 2EHJA 2UXXA 4GWKA 2AHOA 4LDPA 4KR0A 1OFTA 3JQAB 1QDEA 1YRWA 4F1JA 2C00A 4BQNA 4GU5A 4QU0A 1ZRNA 2ZXEA 1K2WA 4DXDA 3CNHA 1G5QA 4Z4IA 3R3VA 3LAWA 1Y67A 1BA3A 2QU7A 1ESCA 3P32A 4KLRA 1U2QA 5DX8A 3LPNA 5CT4A 4DM3A 3QFCA 3SIWA 2AEFA 1XWFA 5TMBA 1JVSA 3R7SA 3R0XA 3T7IA 5EIAA 3A1FA 5B7GA 4M1KA 3GFFA 4I3FA 1XZ8A 3WB9A 4ZT2A 4GBMA 4I55F 1XDGA 4TXHA 1JJOA 5C31A 1V8OA 4B4DA 1XU4A 1R0WA 5BMVB 2R6JA 1GM8A 4QTZA 4EGSA 3L8YA 3N1UA 2YHUA 5SICE 3CRAA 2QQ5A 3VAAA 1JMYA 4YA6A 4CQLA 3NOOA 3STWA 3JWPA 4GLOA 4EVSA 4P4UA 5BWLA 5LXTB 5JBNA 2FZCA 4C4ZA 3L3BA 2P65A 5C5CA 3V4DA 3MAJA 4WVLA 4BGVA 1PR0A 1M2VA 2UUAO 4YMUA 5LQKA 2IV3A 3P2MA 4X6UA 2QXTA 4RTOA 1OGJA 4A82A 4DUYB 1FTNA 1IM5A 5E4YA 1Z4PX 5KHLB 2C2GA 1SPXA 3VSDA 1KAMA 2BGUA 3HGTA 1R50A 2FSSA 3WICA 4C14A 1OPXA 3RHZA 4DMUB 3MCUA 4EY8A 1PSWA 2XDQA 4MQLA 1Z2AA 2ZNJA 1GXSB 3NVKE 5AW1A 3LVFO 3ZHZA 4B82A 1I1NA 2G9QA 1X7ZB 4WLUA 1Q19A 4V38A 5CCDA 1EFRD 5ER6A 4IDPA 1L5NA 1Y4MA 5K2OA 1SCKA 3U1VA 4B75A 3EF0A 2ZB4A 1ODEA 2P6NA 1NQOA 1VE1A 3BVPA 3EZFA 3CCQV 3D4NA 1OX4A 3QI2A 4M0EA 2YY6A 4E2ZA 4EFEA 4N9QA 2GK3A 2KSDA 1Z22A 1ENZA 1CG6A 1BSVA 1EFTA 3RD5A 4AMUA 3I55V 3K1TA 4MWDA 3MTGA 4RXMA 2WLIB 2LIVA 4JJIA 4HNGA 1JEYA 1Q7TA 1GZVA 1V55B 2Z9CA 3BHMA 3PZBA 3ER6A 1ZU4A 2WU8A 1XFAA 2CXRA 1SUDA 2CV0A 1YHNA 4RSGA 4P38A 2TYSB 4IQ4A 4PSVA 2X4LA 1JQ5A 2H65A 3F98A 3WJAA 3FUTA 3K0AA 1NG1A 3FPGA 4G0WA 4BDSA 1E1YA 1ZJZA 5KAMA 3FB8C 4X5OA 5J5VA 3P8ZA 5DHRA 3FTFA 1GAWA 5JNRA 4QUKA 3GT3A 4H31A 2ZBEA 1B4DA 2EOAA 1SCIA 1BS1A 4MW7A 3WKAA 1VPEA 2AMLA 1UP6A 1RYMA 3G2KA 2IP2A 1FXVA 2Q8NA 3CXCU 3LP8A 2QVLA 1TZ2A 1U2PA 4EABA 4BO6A 3CZ4A 4CR6A 4LW8A 4YRLA 1CYEA 4TWAA 3N59A 2KE5A 4GD3Q 3DV9A 1Q7BA 1S8NA 3EW7A 1DX6A 2Q9UA 3OZRA 4U8GA 4MR7A 2JARA 1B42A 4BNFA 3K59A 1QQBA 3I5AA 3PXUA 3KG2A 3L9WA 5H3CA 4WK0B 3OMNB 1T5TA 3H84A 3MINA 4U0KA 2QTAA 4GOJA 4LDJA 3RGGA 3VKUA 3BCUA 4MPDA 3HUDA 4UVBA 4REMA 1YCDA 1KECA 1Y81A 1RRMA 5HX7A 3ZOKA 4DLLA 5KA6A 1D8TA 4BLPA 1YZ3A 2RKBA 5LMUB 4F4HA 4ND8A 2HLDA 3ITDA 3KBBA 1VXRA 1SQSA 3OX4A 4LQCA 4YH1A 1KERA 1BE6A 2J3JA 5HPYB 2A1IA 2LCAA 4KKXB 3WWOA 1ZLZA 2OCLA 4CPDA 1GU7A 4NYIR 4EARA 1UXIA 3FHCB 2WD8A 1ZBQA 1SH7A 3MBIA 2OAGA 1EK2A 5FKJA 5JMOA 3S03A 1RLTA 1B16A 3M1XA 4UCTA 2B5VA 2EILC 1NXPA 1RWXA 4ZOQI 2H6LA 4RJIA 4YJHA 2EFJA 2Y05A 3LCJA 5EVCA 4OKIA 2RKOA 4Z4CA 4L02A 1EXVA 3KCNA 1XJCA 2CXXA 4ZYLA 3HYTA 4GPEA 1Z2PX 1XL4A 1TKBA 1XRNA 2B30A 4QASA 2JGMA 4FHDA 2FRXA 5EC1C 2ET6A 1TYDE 3R23A 3CA8A 1Z25A 4F5EA 3R7DA 3OEHG 2FXVA 2IELA 4LZJA 1WKCA 4NBWA 5B3SC 5TRTA 2EKPA 3I2KA 3BIFA 2HSWA 4E03A 4BVKA 1NRJB 2O5RA 1O7JA 1RIIA 3AR6A 5KCZA 1ES9A 3KS9A 1BS9A 2ZAIA 4NG5A 4HKTA 2WQ6A 1K3EA 4JSYA 2FPWA 3ZNOA 2AXPA 1IH8A 1D1PA 2UXCB 1V54C 1EUCB 5ECYA 2QPTA 4Q3CA 1YJWF 3RS8A 4TL8A 1YT5A 3OTWA 1T24A 3K9LA 3NK7A 1JALA 2QROA 4CS3A 3RE1A 2R48A 2XODA 4KIFA 2BE3A 2OTJV 1L7XA 1GRQA 2ZTSA 3D8RA 1MAAA 3FPAA 1NYLA 3LX4A 2QGFA 4U5QA 4MKHA 5BSRA 4CEJB 1Q20A 4WJZA 2YDEA 2VDOB 2WUFA 5EMLA 2KS6A 4NPAA 4KQ9A 1GUBA 2PFGA 2YJGA 3F4KA 3AETA 3H2JA 1ZRSA 4UMVA 1P6UA 1TIPA 2ZTUA 3ZBPA 3PDWA 4ID9A 1Y76B 3SVLA 2IV7A 4G07A 4NHEA 3I3SR 5EKXA 5JJCA 1DTEA 1X1SA 3IELA 1L8LA 5L6MB 3A28A 1CXZB 1UUFA 2OESA 5JD4A 2X19A 2LNDA 4NBUA 4KR7A 4W4KA 3WI7A 5ADVA 1Q6UA 3O1HB 3P0FA 4ARCA 4N48A 1JR6A 5KI6A 1W40A 5JWOA 3OVMA 3CBGA 1JWLA 3PWKA 3NCHA 2VQFB 5FNZA 4HRAA 1BS3A 2FETA 2ODNA 3F2VA 3GPLA 2Q4BA 2NXWA 3G7UA 3QSYA 1Y63A 1ZNXA 5DMHA 4N18A 3JVVA 4R1TA 4LH7A 3FVVA 3HLKA 1KQOA 3MHSC 4ZICA 1GPJA 5BN3B 3G0GA 4HGOA 4PZ9A 4MARA 5KSZA 4RLSA 1MD9A 1XXLA 1NY5A 2AOWA 5K5EA 5B3JA 4KZPA 2A30A 5AW6A 3GJTA 1W41A 4Q24A 1WA8B 2Y9PB 4JLJA 1WZCA 1EX9A 4O4HF 1KYTA 1ZC3A 4RULA 2Q0OC 1P44A 1WV0A 2NNLD 3NFRA 5DTQA 3UMYA 4Q4DA 4S05A 3EIUA 2A4MA 3DDCA 1SWWA 2AC7A 3PEUA