4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
molecule keywords Tubulin alpha-1B chain
molecule tags Cell cycle/inhibitor
source organism Rattus norvegicus
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
4F6RB 1W5AA 5IYZA 5BMVA 5JVDA 1SA0A 3VO8A 4F6RA 1RLUA 4IIJB 1FFXB 2RHHA 5LP6C 4B45A 3VO9A 4IIJA 1FFXA 4XCQA 3RYFB 3M89A 1W5BA 4O4IB 5ITZB 4O4HB 3RYFA 4O4IA 3JARB 5IJ9B 4O4HA 4ZOLB 5ITZA 5J2TB 5C8YB 3JAWB 3WGJA 3JARA 2BTQB 5IJ9A 4ZOLA 5J2TA 5JQGB 5C8YA 4X1YB 3JAWA 2BTQA 4LNUB 4EB6B 5JQGA 3UT5B 4X1YA 3WGKA 4EB6A 4LNUA 3UT5A 2VXYA 4WBNB 5JH7B 4TUYB 3JALB 1Z5VA 4X1KB 4ZHQB 4WBNA 5JH7A 3E22B 4TUYA 4IHJB 3JALA 4X1KA 4X20B 4ZHQA 4E6EA 4EI7A 3E22A 4IHJA 5LYJB 4X20A 5IJ0B 3C8LA 2VAMA 5LYJA 4I50B 5IJ0A 4ZI7B 5MN5A 4FFBB 4I50A 3RYHB 4EI8A 4ZI7A 2VAWA 4FFBA 3RYHA 5CB4B 2RHLA 4B46A 4HNAB 4U3JB 5CB4A 4O4JB 4HNAA 4U3JA 4O4JA 1W581 1W5FA 1Z5WA 5LOVB 2XKBA 1JFFB 3V3TA 2R6R1 1TUBB 5LOVA 1JFFA 1TUBA 3WGNA 3VOBA 5JCOA 3N2KB 4DRXB 3HKCB 3N2KA 5FNVB 4DRXA 2BTOA 1W59A 4EI9A 3HKCA 4O4LB 5FNVA 3WGLA 1RQ7A 2VAPA 4I4TB 3JAKB 4O4LA 3R4VA 4I4TA 3JAKA 5BMVB 3RYCB 4M8IA 3M8KA 5J2UB 4DXDA 3RYCA 5J2UA 4YJ3B 3HKBB 2Q1XA 4YJ3A 5LP6B 4KWEA 3ZIDA 3HKBA 2RHOA 2RHJA 3WGMA 5LP6A 3JATB 4YJ2B 5EYPB 3JATA 4YJ2A 5EYPA 4TV8B 5EIBD 3ZBQA 3VOAA 1W5EA 4TV8A 1RQ2A 1TVKB 2XKAA 5KX5B 1TVKA 5KX5A 5M7EA 3HKDB 3N2GB 3VPAA 1FSZA 3HKDA 3N2GA 5EZYB 3CB2A 5CA1B 3JASB 4O2AB 5EZYA 5MN4A 5CA1A 3ZBPA 3JASA 4O2AA 4I55B 5JCOC 4U39A 4X1IB 4I55A 3RYIB 4X1IA 3HKEB 3RYIA 5LXTB 5EIBC 5MN6A 3HKEA 5LXTA 4TV9B 5KMGB 4O2BB 2R751 5GONB 3RB8A 4TV9A 5LA6B 5KMGA 4O2BA 5GONA 5CA0B 5LA6A 2GVIA 1OFUA 2Q1YA 5IYZB 5JVDB 5CA0A 1SA0B
chains in the Genus database with same CATH superfamily
3OE1A 4MV9A 1E3EA 1KJ8A 2JGDA 4G8JA 4X62O 3CF6R 3BF7A 3VUEA 1ID8A 4ZQEA 1Q7BA 3F3KA 5AHWA 4BEVA 5EE5B 3T6KA 5B3SB 5KU1A 4GZ6A 5JYBA 1N5OX 1MX1A 5JEEA 3HJGA 4MTGA 1VQ6F 3J81N 3U44A 3PB3A 4GUDA 9ATCA 5FLKA 5GIPC 1WE2A 1KQSF 5TGZA 4RKYA 1ZC3A 3ZLBA 5ARBA 1JA0A 2GILA 3FDZB 5DWDA 4NQZA 4NENB 1P4RA 4IR7A 1O9BA 3H6KA 1M1NB 4FMTA 1F2UA 3PSHA 3EG9B 1SB9A 4JXKA 5J2TF 1A97A 4E21A 3UB3A 1XKLA 2WHYA 4BZWA 2BFFB 3HI6A 3EEYA 2B25A 5KTKA 4BEBA 1YL5A 1LSUA 4FLTA 4KX3A 2X7HA 4EPXA 2BM9A 5FBHA 1V7ZA 2WM8A 4OKSA 1FB5A 3UFXB 1PK9A 1SF9A 3BEDA 5DN6G 2C7BA 2BIFA 3GK3A 3IEVA 1AK9A 3QOXA 5I7OA 1ZSYA 2NNWB 2QZ4A 2C5AA 2PR7A 1XTQA 2BEVA 2GLTA 2HQSA 2PRSA 4Z0NA 2FW6A 2XUDA 1MO4A 1C8BA 4XA8A 3BERA 3EZ9A 1VRCA 1NBME 3DEZA 5KQSA 3W06A 3OICA 4NMXB 1E8DA 5DXAA 4FJCC 1HFWA 1ZICA 3F5SA 3JYPA 4MQ4A 1FDRA 5TGTA 1HDRA 3VPHA 1P33A 2IHVA 4LAFA 1PR1A 1M57C 4FSHA 2P9HA 4MRVA 2DLNA 3RRNA 1V5EA 4XEHA 1EE1A 2CJXA 3CEJA 3C6YA 2ZJBA 4B7ZA 3KJQA 2JI4A 2FTKE 5K2OA 4I14A 2VF5X 3HDVA 3AP3A 2A1UB 4UCRA 4R6WA 3NDBB 1R6BX 3UQZA 5A3SA 2Q7GA 5SY4A 4GOND 1DG1G 1NV8A 2YVKA 2HX1A 4GOLD 2IBTA 3BA8A 4D97A 4GX0A 3UUFA 4RTJA 3ABTA 2WLLA 2P9GA 2HF9A 1OZHA 2GPBA 4NU5A 1WSWA 3N4YA 3BIWA 2JLUA 2YC0A 4GVXA 3ZY3A 4JYMA 4KR2A 1YJQA 4RYDA 2YX1A 2EIXA 3NHSA 1Z6QA 3O4IA 2O3JA 4B2LA 2CTWA 4HH4A 4H15A 1VQ6V 1MX5A 1N6IA 1HL7A 4GOJA 2OYRA 2W6PA 3M9WA 4IJMA 4AJHA 3Q8MA 3HACA 1N0UA 3UB2A 2GVNA 4L3VA 3R7AA 3U60B 1R4MA 1DTEA 2ZVDA 1HT0A 1TL7C 2CN1A 3OZBA 4ZP1A 3NTQA 2GTPA 2ES4A 1E1CB 2GXAA 5KX5A 1E1QA 5A7HA 3PC2A 3OZTA 2I29A 5FNZA 3T1YO 4EL0A 1DKOA 4MQEB 1OKKD 3RIHA 1FFXB 3CNOA 5A0FA 3LQFA 4QDUA 4D8XA 9ABPA 5EHIA 1OPRA 4J4TA 4B40A 4DSTA 4EO9A 2R72A 3ZIAA 1IBMO 5KOHB 4IYJA 4OMUA 1JHOA 4BQOA 3MBIA 3G17A 2XPCA 2LBWA 2QYTA 3ZVNA 4DN6A 5A0VA 5LZ8A 4OU4A 2BVNA 4WFQA 4GNRA 4L7VA 3LDTA 1W2BU 1Y5MA 1Y5LA 1LJ8A 4CIVA 5LA6F 2IYPA 4PY2A 1W59A 2JVIA 1EWRA 4II7A 1NVVQ 2Q0HA 5JJBA 3H6GA 3WNDA 3ZPXA 4B34A 5D2CA 5FV7A 3MTIA 5EKTA 2BE7A 1VG9B 1PJZA 2P69A 2WJAA 1HK7A 3DT6A 2IPMA 4UJ3A 4DIBA 2AEJA 1PWXA 1MX9A 4UBOA 1J24A 3D0KA 2BFDA 1Z5PA 4YV1A 2VTEA 5JBNA 3IQIX 5AXBA 3R3UA 5C80A 1DI0A 4LCKA 5FTJA 4LH7A 1VQOF 4ZBMA 1NX9A 4MVJH 3WGJA 2OO3A 2XDAA 1SUCA 2R1VA 2J3HA 4KCGA 4GC5A 3NKFA 1M8KA 3JRWA 1W4BA 4MLDA 4J4HA 1R6TA 4YT2A 4TLBA 3A1UA 3QW2A 5AKLA 3ZHVA 2YSUB 4HOYA 3RAFC 1L6IA 2KHZA 3ZDFA 3CUTA 4NWIA 3OR6C 4AS1A 3BM5A 4NULA 4MWZA 5CT9A 1INLA 1YZGA 3ZUGA 1LU9A 1TCCA 3CSXA 4RYLA 3F8WA 3P9SA 3A58B 4XFKA 1MOSA 3HMKA 5CDUA 4EFLA 3BWCA 4R2IA 2B99A 5K3FA 1P7GA 4NBLA 2CLEB 4QBTA 1ZR2A 4H7HA 4QYTA 1KRWA 1OCRB 2EL7A 3NX4A 4KITB 1UWCA 4AI6A 2VRCA 4JC5A 1NXQA 2JJ1A 4R2KA 3C8DA 5JH7B 1BXRA 2W6QA 3PVCA 4X20B 3P0FA 1NT2B 1AV6A 3AW8A 3P0RA 5J4KA 2FQ1A 1WF3A 2AX4A 1WG8A 4BMNA 4DUYO 5HYVA 4MV4A 4CHGA 4DV1B 2TMYA 2H8EA 3QFSA 2A9JA 3IEWA 3TD3A 3T38A 2V3WA 3BHJA 4UEOA 4OLJA 3FUVA 3H1JH 5K0BA 3D01A 2WF7A 1OX4A 2X4DA 1M9NA 1VQLV 3WBFA 1RQ2A 3OQOA 5B1BB 5JYEA 1CYDA 1RHKA 3EASA 2Y1KA 4X54A 3L1UA 4ZAWA 2EIMC 1VL0A 4LDNA 3ZW7A 2JGJA 3M1AA 1B7GO 3O90A 2AUNA 1ZG3A 3H8WA 4JELA 3NO4A 3R6LA 3ITNA 2Z0AA 4RD3A 5AYVA 3K06A 3LCCA 2BTQA 2FN9A 1P18A 3HJWC 1EJBA 4XLLA 3WR5A 2B20A 1SVMA 4IG4A 4MS4A 5AVRA 3ITKA 3PGVA 2Q4TA 1GO3F 1HYHA 4JF3A 4YRSA 1PN3A 1ZM7A 4X3LA 4OSEA 4CLOB 1ZP6A 4OMCA 6REQB 2DE0X 3BFJA 1RPOA 2O3SA 1IRIA 2PX4A 3SMQA 5AHXA 2NVWA 1VKRA 5CVDA 5IKXA 4NONA 3OJLA 4TTAA 4WESB 1L5KA 1FNSA 4L74A 4EJFA 4QYSA 3HCRA 2VXBA 1SXJD 4QSMA 1OFTA 1E5XA 1NBHA 4HLCA 3CYPB 4EFNA 1LF5A 4GBJA 1YMVA 1U4NA 4Y9DA 2V7QG 5LMNB 2I6UA 2CK3A 1M1KW 3DOCA 5G0UA 3JD1A 3AW9A 3UKJA 5DB4A 1VK3A 4AQYB 1KU6A 5LQKA 2Z2JA 4F1KA 3HM2A 3U0ZA 3DCJA 3SSAA 1YGPA 5T64A 4RK0A 2P9CA 2BOBC 5H82A 4AMUA 2OFOA 1T0UA 1DMRA 1SC1A 3ET5A 3PX2A 1F4LA 1QR2A 3L4BA 3OM3B 3FJ1A 3GPCA 2V6GA 4NYIR 4YY3O 2DUWA 1AHHA 3QNUA 4B80A 4LVCA 1ZFNA 3EXFA 3BIOA 4BVFA 1G3MA 2FPGA 1MP0A 4NXNO 1N5JA 1G1MA 5B2FA 1EN5A 2DPHA 2CB0A 2A0UA 2GJAA 3ZKAA 4RPIA 1YEWA 2ZIVB 5DGTA 2IJJA 1EFRG 2DRIA 3KZNA 1YR7A 1PWHA 3UCFA 5CT8A 3OLWA 1OI3A 1AQ6A 3K58A 5IT5A 2C0QA 3AUXA 4YWHA 3DT8A 1E6MA 5LJIA 2JFPA 1Y7PA 4GNKA 4YDRA 2B92A 4ARZA 2ZBRA 1A8HA 4WPGA 2UVQA 2OCCC 2HC9A 2PX3A 3D7RA 3CVOA 3R6WA 3LC7O 5JS2A 5DHRA 2CE2X 4ZAXA 3PDCA 2FPPB 2W37A 2ZRIA 3VDMA 5IABA 3ESDA 4FZ3A 3PQ7A 5HRCA 2A9FA 4Q3DA 1XJ5A 2FXIA 1Z06A 3WU2Z 2E49A 1J21A 3K2XA 2H8CA 1UIRA 1IH8A 4UHEA 4EHHA 3HM9A 4BFLA 4ACBA 3R3XA 4TT3G 4GPEA 2BGRA 2JFHA 1V4BA 2DBRA 1ZA2A 2P65A 2FI1A 2Q3CA 3TZBA 3AU9A 2ZR0A 2F9ZC 4F8EA 3BABA 4Q18A 4R9SA 5L3BA 1CY7A 3S27A 1H38A 3L8GA 5IJXA 4AYXA 4EKDA 4LF6B 2BMJA 1ZHOA 2XDYA 1DJNA 3AZPA 3BGOS 4FMBB 2HR3A 4MR7B 3TRDA 3KQOA 2JLXA 4P7FA 4AF8A 1IAQA 1II0A 2VAMA 3HLKA 3M4XA 2XSZA 5K8UA 1C7RA 2I4OA 5EIXA 3T5GA 1NVWQ 3A1FA 1OLSA 2EEPA 1XRSB 5C37A 3OZXA 4LF5B 1C2YA 3R7BA 5JMOA 2KBFA 4JI8O 2PA0A 3RTCA 2R0QC 4AECA 5I4KA 4CXMA 2Z56A 4MI9A 5E7QA 3ZI4A 3M5WA 4F4LA 4B3SO 5EP1A 1GN3A 3O0TA 2EWMA 5KYXB 2QIOA 2HJGA 3TECE 3OX2A 3VMFA 1S2OA 1YFJA 2HY7A 2IBZH 4CQNA 4K6GA 2Y1WA 4FDMA 4ZCIA 3AQIA 2YWXA 3U4AA 1TADA 1JXQA 1K7EB 1XMXA 4C30A 1SQFA 1ZD9A 5KTYA 3HVHA 3L0BA 3HB9A 1STOA 5JZVA 3LQKA 2XVYA 1G21E 3T5DA 3A32A 4KPGA 4KUHA 3PR1A 2BFBA 3AG1C 2Q45A 2QN9A 1HYEA 3TIFA 3I04M 1X15A 4LDQA 1Z5UA 3U3MA 3U62A 1HMPA 2Q6KA 1WUHS 1G8KA 3BFPA 4DCVA 2DXIA 5FOVA 3RF6A 4LYAA 3DUFA 1I9CA 1ND6A 4P1ZA 4YQZA 1QS0A 3WGHA 1GNLA 2XNJA 5I8ZA 3HNRA 2IOFA 3W7XA 4HN9A 2JATA 3O3NB 2AOUA 5KUMA 3K9WA 4WNYA 4QHYA 3L43A 1VMAA 4KX5A 3QVXA 3I6YA 4K1XA 1MOPA 3DLIA 4CKEA 3K1JA 1RQNA 4N7JA 5EY5B 2VNHA 3OE7D 3JRNA 5IBCA 2OXIA 2GTHA 4MVJF 4HGZA 3T06B 4B71A 3LUFA 1NNEA 3LWOC 2VDVE 4E15A 2GBLC 4EGCB 1QR9A 4KAXA 3STWA 1VL5A 4KKVA 2XADA 1KQGA 4IOKA 2C0CA 4YV0A 1QZ3A 5H5JA 1DQYA 1EHCA 2X9GA 3CH5A 2ZB8A 3WLQA 2XQJA 2VJDA 2ZE8A 4O6VA 3GDFA 4FYWA 1LBSA 1P74A 5EIOA 5JS8A 4J9ZB 3PU6A 3S06A 1H4VB 1T6XA 4LXQA 2IIVA 2CNOA 1X14A 4FWIB 2ZS8A 3A4MA 4H7DA 3QY9A 1KI9A 4AMVA 1TMKA 2FN8A 3DOIA 3QUWA 1QTQA 1W5EA 2ZI5A 2QRGA 5A9SB 3TLEA 3KKNA 3DLHA 2AD1A 1Q0ZA 3MAGA 4U6QA 1N57A 2PGIA 3O83A 4P2ZA 3OMXA 1WCXA 1VP3A 4RJIA 5I3CA 1UZAA 3C85A 1EZ4A 1R1DA 5FL7A 4H3KB 1PNRA 4KP4A 3OM8A 2Q3BA 5DN6D 3R0QA 1G9SA 1LI4A 5K6TA 2YY7A 1R3IC 4Y0AA 4I0XA 4KHPO 1P91A 3DDWA 1B0UA 3HZOA 4X6XA 1EFUA 4E5KA 4UDOA 1YJWF 3PN1A 5DW0A 5DYWA 5KTMA 5K0LA 1MW8X 3R0ZA 3VZPA 3LUBA 4CEHA 4AYWA 4Z9AA 2VK8A 3GJ5A 3HBJA 1A9ZA 3H1KH 3IC5A 5IT9N 4CU5A 2JLZA 4FDTA 1BFDA 2LCAA 5H8WA 1F6DA 3BHMA 4PI2A 5U4XA 2EDAA 2WFZA 1EG2A 1DL5A 3KAPA 4GGMX 4CL8A 2WZCA 5EWLA 4TZKA 2OAP1 4MVJE 3EIEA 2OWOA 4OJMX 1VKZA 1V8DA 2Q1YA 1UKZA 1WZNA 1M56B 4H4DA 3Q7QA 1QSGA 2GN9A 5KVCA 3QVTA 4AYTA 3R7LA 4AM8A 5TV2A 2C0PA 3HBMA 4LDAA 2QTOA 4RPHA 4U9HS 5T4FA 1E1QG 3ILSA 3H0EA 2QJRA 1XRGA 3UMJA 4S35A 3OA0A 1YDWA 4MXDA 1ZOOA 3SFTA 5BSMA 4O4LF 3Q15C 1VQ8V 2WM2A 2FJUA 4I66A 5BW5A 2GTIA 4DR7O 4IS2A 3HKCA 1JY8A 2ZROA 3L0SA 4WLEA 3L6RA 3K9GA 2ZM6B 3WXMB 2SHKA 1UJ5A 1Q91A 2WBLC 3IAUA 5BN5A 3TCUA 3OZWA 3ZV4A 1QK4A 2VJKA 3GNQA 4IIGA 1A9SA 3FDJA 1BS1A 2R4QA 5LBTA 1HR0B 1ZXLA 2WNSA 4MUBA 2H4ZA 3FTNA 4OREX 2YXLA 4HAWA 1FUEA 2YQ4A 3GRZA 4HRXA 1GG5A 2G28A 3RB8A 2DQ3A 2PCJA 1AC5A 1PKXA 3RIMA 2B8WA 1GVNB 4Q4HB 2N9UA 1O03A 1R7RA 4JENA 4O29A 5J4LA 3RYFB 4BW5A 1RLGA 3FI9A 2FCRA 4OGGA 1SUBA 1NDHA 3B8HA 1Z5VA 5LP6F 1IQUA 3ADOA 2HTEA 4EPVA 4KDRA 3LG2A 4PLPA 4WFGA 4RJTA 1TECE 1A82A 1JHYA 1Z28A 1UOQA 3PSAA 1M93A 4JKOA 3KYIB 1KNXA 4YWJA 5DBGA 1EFAA 4B43A 3OLYA 1NP6A 3C3WA 3TL6A 1RKUA 1UDCA 3OD5A 2D5BA 4PPYA 5K0ZA 4Q1EA 3LWDA 3CZ4A 1YJWV 1G6KA 4E12A 1OGIA 5AUOB 2JIDA 3BWMA 4R1QA 5EA2A 3VR2A 1OU4A 2DQYA 4RHYA 4P58A 1OC2A 3SXUA 4HMQA 4MHOA 4O63O 3C41J 4D9CA 4H3HB 5P8WA 1YRHA 4GYYA 1GUFA 5IWAB 1A9XA 3AJRA 4G24A 4GMXA 1KAMA 1NG1A 5HY2A 4ONEA 4NZOA 2ACVA 3IIKA 3OUFA 4OQEA 4O4HB 2O5VA 1GZUA 5TJHA 3IV6A 4RU1A 2Q4PA 1HQCA 1GOTA 4W1PA 4TM7A 1ZLXA 3EQ6A 4R40B 4E1VA 2OGZA 1TEXA 2VDKB 3WNZA 4KIFA 5CW1A 1M8PA 4I8XA 3B51X 1UJ4A 2C5LA 2VP9A 3S3WA 1EQUA 4IDAA 4GWGA 3U4QB 4LFCO 3G2OA 2EZPA 3H1TA 5FUBA 4YAEA 2OHFA 3E84A 3IIJA 3QVOA 4R1OA 4UTNA 4NXMO 1WR8A 2DOSA 3BWBA 1P61B 5LM3A 3QENA 4GPIB 1OFGA 3W4IA 5E9QA 5HKKA 3B6IA 1KH1A 4LOJA 4HT3B 2FUG6 3N39C 3FX7A 3OX1A 4JBHA 4XIGS 1P0QA 2P41A 1R8QA 1DBSA 3SJZA 1UT6A 2WKRA 4H4CA 4RSGA 4XFJA 1YC2A 4QBIA 2AFRA 3NAZA 3SBEA 4O2BA 1AM4D 2DBQA 1KU9A 4RA6B 3REGA 3IR7A 3AESB 3WY9A 1T3ZA 5HQTA 4JT8A 4IVNA 2HCBA 3QO7A 2IG8A 1SOAA 1V9LA 5KOIA 4PHCA 4WOCA 4P4GA 5AI4A 3U3KA 2R6HA 4WBSA 3I5YA 1WB6A 1S5JA 1VCNA 3PXEA 4GSLA 5SZIA 1EWQA 5KKAA 1YIAA 2EULA 4G5SA 1Q92A 2VG8A 1MD9A 2G9NA 4B6EA 2EKLA 3KLMX 1VHJA 1NOKA 4PSUA 3UQ8A 1C8KA 3J80N 1OBCA 3ZD8A 2DT4A 3GV0A 1GNPA 4WBNF 1I6WA 2RK4A 3QTLA 2ZU6A 2I80A 5FKJA 5TT0A 2FUNB 3DMYA 4FDLA 3RPEA 4NBUA 4R4JA 4PR0A 3I23A 2V4UA 1QE5A 3PNPA 1KSGA 3S2YA 3QU9A 5FEMA 2DETA 2FVXA 1GZ7A 4GI5A 4C4AA 4HTAA 3K5WA 1TZ2A 4FMDB 2GM4A 1LK5A 4Q6BA 2F1JA 2WYWA 4N0PA 2EINC 4QG7A 1QIGA 1NFRA 3VI6A 2P3LA 4DV4B 3DDHA 3S44A 3DOEA 4F8JA 4TS9A 3K6SB 4MR8A 2YV4A 1C81A 5HDQA 4XIYA 2WUGA 2OPHA 3FPIA 2A86A 1EM8B 4QNMA 5EWJA 1I7NA 1VMKA 3D3WB 3BRCA 2AR7A 4GECA 5EMHA 3Q7EA 1FFDA 2ZB7A 1JG2A 2CV2A 5JSZB 4NJMB 2V7QD 3A2NA 3KPUA 3L77A 2IA5A 4KQJA 3IAM1 3C6KA 1GUAA 4JP2A 4KFTA 3S2IA 2IX9A 1RTKA 3IUYA 1VXOA 2C1ZA 3HXPA 1I13A 1SAYA 4F6RA 4RK5A 5A3RA 1QLHA 5GGYA 1CUHA 1R4NB 5BW6B 1GGHA 1VQNF 2YS6A 1XZBA 2R5NA 2P9YA 1OHHA 2GS9A 4NE2A 5CAEB 4C78A 1F51A 3RSGA 4AUEA 1S3FA 1LCIA 5IRCD 2QPOA 2OZKA 3NOQA 5LU9A 1N8RW 4CN9A 2O5EA 1H7MA 2UYNA 1TO1E 1R9JA 1BMDA 2H7VA 4MS3B 1QWOA 1RDFA 4JLPA 5C8VA 3B77A 2GZLA 1MTZA 4LJ9A 1DT5A 4D9EA 4LEIA 1V95A 3PUHA 1JI0A 4BO3A 5F7JA 3UW1A 2JS5A 1ZW1A 1UK7A 3PFBA 1UC8A 3Q6MA 4XQ0A 4V1CI 3CX4A 4HF7A 1DCTA 5D84A 1JWLA 5EXDA 1U4SA 4IMPA 3RBVA 4ZOBA 4P4LA 1MFPA 4Z9FA 1KEUA 3U9SA 1ZDMA 1EFRD 3F96A 2YVQA 3UK7A 4AURA 5NLLA 4DWOA 5IYZA 5JVDA 2FFJA 3P2OA 3V7EA 2VVTA 2I2DA 1U3DA 1N5DA 2R7KA 3FZYA 3AJ9A 2Z6AA 1KKMA 2O4CA 1YR6A 4D7SA 4PC7A 5EUCA 1K4DC 2VT2A 5ALWA 1AGRA 5D01A 4LVOA 3UMYA 1BN7A 1WZCA 3L74H 1DZ3A 4U7JA 3LHKA 4Y6SA 4HVAA 1DS6A 2UYGA 3I5UA 3KKKA 4EX6A 2OHJA 4EVIA 1FMFA 2BGIA 1YITF 3GUHA 1SIWA 1DX6A 1YB7A 3ZZNA 3ZD9A 5F2OA 2BHNA 3TOZA 1KYYA 3R4CA 1EFLA 1WD7A 4OI1A 3AJDA 4RA9A 1V1JA 1KEWA 4Q9HA 2DF8A 5T41A 2LXNA 5JUWA 4JWTA 4TT3D 1A3CA 1ZM3A 4MKZA 5TC4A 2H2GA 4YR7A 1Y9AA 3LUTB 1T9HA 3NR2A 1I1OA 1U9YA 4DJEC 1L0NH 1G7CA 2ONCA 5CA0A 1XTRA 2I7VA 5AG2A 3FIUA 3ESJA 1FRVA 1KSFX 3CJHA 2PUSA 3N1UA 3ENZA 1DAOA 1HP8A 2C4HA 4RD2A 4F2WA 1JPUA 1H9BA 5FDFA 4BMSA 2VPQA 5DNUA 3EVBA 3GBPA 4KOEC 4PD4F 1DLIA 1ZOIA 1FFYA 2P6JA 3A05A 3OOHA 2IQQA 3VQYA 3RC1A 3PWKA 1ST3A 4BWVA 3SJCC 1I4LD 3QFHA 3SZGA 5ALUA 3BE6A 4EG6A 1X74A 4PV1B 4LOKA 5I45A 3FPSA 1QQ7A 3NIFB 4FTWA 2GKSA 4EBBA 4Q3EA 2ZAIA 2XA9A 2WOOA 4AJEA 3AF6A 4J1SA 5JD6A 3GLFB 4N40A 2B21A 3HLTA 4RNCA 4LY9A 3P10A 1UT5A 5HP8A 5FJIA 1RC0A 4KMRA 1O87A 5C1OA 2HBZA 5B3JA 4TMTA 3R7NA 1KXJA 1TF7A 2EX1A 1OCCB 2EFYA 3P9CA 5ALQA 1V3TA 2ZYAA 1R3DA 2PU5A 2X2OA 3DF7A 3IDOA 2X8AA 1JSXA 1JHXA 1D6MA 3DFMA 3Q11A 5CIQA 1XAJA 5JAZA 1YS4A 1Y3FE 2XWBF 3GW8A 2WE7A 4NBTA 1ESNA 1YS2X 3DAOA 2O9JA 1TM4E 1TXGA 1RJ9B 4KQKA 2ERCA 2PBZA 3LVBA 2F7SA 3ABQB 8GPBA 3IXLA 1YOVA 4ND7A 3KQHA 5EZ6B 1IBCA 5T8KA 3MJTA 4PNHA 2A33A 3FCCA 3HB0A 2K1SA 1DFHA 3WGGA 2C4TA 4M1KA 4DNQA 4HYQA 4YJ3A 2WMYA 4NRDA 5JPIA 1NJIH 3WLNA 2P1DA 4PZ0A 3A3PA 1BVRA 4E94A 2NVOA 1EG7A 1QK5A 4Z6KA 1P0MA 5G1OA 2IYRA 2UYJA 2PSHA 4D46A 4HDKA 3KTFA 3A31A 2WDPA 3EK2A 2DUUA 4G27B 5DSXA 2Y99A 1JIUA 1XCLA 4GRDA 5JSFA 1CSEE 2PI5A 4JI3O 3R2JA 4RIIA 3U7IA 3WKEA 4C01A 2V8OA 4KXLA 5E0KB 5CHYA 3I52A 3F6EX 1PUJA 2QTBA 1N5IA 5G3ZA 4X9XA 1MXFA 6YASA 4KLCA 1N4AA 4H7KA 4HSEA 3E1SA 3OHSX 4QGBA 1Z8HA 2J5KA 5G40A 4DMUB 5HFAA 2YWRA 4C05A 3DVRX 3NBZC 5HQ3B 1QIFA 3DDSA 4XWKA 5LCXA 3DM9B 1WCIA 1OB2A 4L6CA 3PF8A 3I61A 1JA8A 3LWRC 3NYQA 2W6ZA 3VTKA 5FB3A 3CO5A 3CRZA 5HIJA 3E1GA 4KDEA 1GPUA 1R0ZA 2PO7A 2F6RA 1H22A 4DR1O 1PR6A 2QR3A 4O4IA 4EO4A 3SE7A 3UK2A 2OHIA 4IL5A 3RQSA 1YNSA 2Y69B 3TSAA 3QMWA 4O2LA 4D9KA 1VJ5A 1F1JA 4ZHQB 3DEAA 3PNQA 2ZI4A 1MENA 4JQYA 4MS1A 2CKMA 1BXKA 1TD1A 3HP4A 3O4HA 4Q9LA 4G5HA 4ED9A 4RAIA 3LQRA 3QVNA 2AGVA 1MQSA 2GHTA 4RF2A 2G1UA 5A4KA 1MFZA 5E6RB 1HNZO 3QLEA 4ZMBA 5L3GA 3CC4V 2ZYRA 4M1QA 5K4AA 2EXXA 5IH3A 2H5LA 2EVWX 3UMBA 1I2BA 2LFSA 3ACBA 4QGSA 1VCMA 1XNJA 3P3NA 1Z07A 1OWNA 5MDHA 3BCCH 1P81A 4A5SA 5CVJA 1YE8A 4Q01A 1VSQA 3CCRF 3PFWO 1U2RA 4Q12A 2OGUA 2H4FA 1OZ0A 1IJFA 5DBHX 2H4HA 2XMSA 2AJLI 2PQ6A 4HVCA 5EMKA 4UARA 2IEDA 4V2IA 2X9NA 1GUZA 1LLQA 1Z7BA 1E1QD 2ZIOA 2A5JA 4A6DA 3QLUC 2EX3A 3L71H 2OWDA 4PAWA 2HUNA 4CG1A 2C9MA 1U2PA 2IP1A 2WIKA 2E18A 3RDPA 3MNFA 3H17A 2ZUWA 3D7SA 3WLFA 3TLGB 3TLXA 3D54A 3EXEB 1SVLA 4ZO9A 4YVFA 4YJFB 1MB9A 4B3FX 2PZEA 2AYXA 5IMSA 2ZAUA 4B3JA 1OSNA 1JIVA 2E76B 1WVIA 3AVXA 2YV1A 5G4VC 2J30A 4IRXA 3V4SA 3P32A 5DYIA 1BA3A 3AX6A 1H1LA 4P4NA 3C3KA 4MW1A 3TEJA 1G5FA 2ZAOA 4UULA 3G2NA 3PYMA 5JNWA 1P5HA 4OJQA 1S5HC 1QYWA 1NXSA 2HNKA 3QPAA 3FWZA 2ILTA 4F4DA 3MCUA 3OFKA 1LK0A 2PS0A 3NDPA 4I50A 5E1OA 3DE3X 3FR8A 1JMYA 4L5CA 3PR3A 3E8BA 1BWRA 3G59A 4UVIA 2QTLA 2JLSA 5DN9A 1FRZA 1KP2A 2ONKA 3TBFA 1MRNA 3AB3A 2DH6A 3OIFA 3AKZA 2BPOA 1VA4A 1K8AW 3JD4A 3C7TA 3RK1A 5EZQA 1RLOA 3DGEC 4ERNA 3E81A 1NIPA 1TYDE 3NPAA 4LXHA 1KEEA 3CRRA 2PV7A 3ECCA 4DDMA 3DVAA 3UM7A 1XMOO 2P22C 4IIJF 1T6NA 3FG9A 3BMNA 2P9JA 4P7BA 4EL5A 4FYPA 4JJGA 3Q2KA 5GONB 2PLWA 3E9MA 4OY3A 5B57C 1VDMA 1BEEA 3FB6C 1VP7A 1X39A 2ZYIA 4D9FA 3GA5A 3HQ4O 3FAVA 3LPNA 1USIA 1NM5A 4EB6A 3UHFA 1HKUA 3CW9A 4RKFA 4ZO4A 3F6BX 4PFQA 5GJCA 2OILA 3HJUA 5SZHB 3L1KA 5HK8A 2IEYA 5DEIA 4IZ6A 3DXRA 2RGDA 4GEKA 1DKQA 1T4BA 4UEWA 2Q4BA 1LLUA 4QWWA 3USES 4NTZA 2R84A 5EJMA 3PGLA 4QEZA 3X2SA 4GR5A 2VSXA 1GZ6A 2IT1A 4DMGA 1FP1D 3DFKA 2J31A 5JZBA 2POQX 1L8DA 3LCJA 1Z2NX 3HO6A 1NE7A 1D2NA 2YWDA 3KB8A 3QLVA 4YUAA 5F2NA 1QHIA 4XM0A 3U31A 1JG3A 4Z0TA 5LC1A 1K97A 2EC5A 5DPMA 4N21A 4OYHA 2HPHA 2BELA 4D9JA 3VYWA 4EG4A 1L4GA 1PGPA 3UHJA 3BY6A 3COPA 2PS9A 2M6KA 5CX1B 4FHZA 3K1TA 3OF2A 4L85A 3V1TC 1VPVA 2VKQA 4I1OA 1G20A 3HVKA 1J6UA 2E87A 2C31A 2B9ZA 4AWXA 3BWXA 1FDIA 3LDGA 1GV1A 2EILC 4WCFB 4I1RA 4PX5A 4YIPA 3UH0A 2JS3A 4FNAA 4ZODA 2O8DB 1EA5A 4TTRA 1DJPA 2RKWA 1AB5A 5JSYA 4CV3A 3HCEA 4P53A 1L4EA 5H0IA 1L5FA 4QAJA 4Q7EA 4QBHA 4EHBA 3QMVA 1TJ4A 1F9EA 4L6AA 4Z2YA 3IVXA 4TTJA 3S40A 3KTAA 5DGHA 4NARA 1XPRA 1DIOB 3KQWA 1AVTA 3DBRB 1VYTA 4HAVA 1QIEA 1R3UA 2FJ0A 1JILA 1KIAA 5ERYA 2OORC 4HRYA 5DNCA 2SICE 3ANMA 1UBOS 4JZYA 2VRWA 4QYWA 1WETA 4I19A 1CRZA 3HU5A 1RAFA 3LL4A 1PL6A 4PX2A 2ZS9A 1QGDA 1DKNA 5AM5A 1VI2A 4MLZA 3NBYC 1GU7A 3T2MA 5ERXA 2JKYA 3IR6A 1CKEA 4FFBA 2NADA 2CJWB 2WWTA 3IEKA 2AHOA 3PDIB 4C9BA 3DTVA 1ITZA 3MGKA 1ZLZA 5BR7A 2AX3A 1W88A 1VLMA 4LHXA 5DM6V 3FUTA 3FMVA 2Q8NA 2PSJA 2CGNA 4QX6A 4XD2A 3LY8A 2QE6A 2G76A 1X87A 2V97A 1UR5A 4XJVA 2F64A 2FAXA 1JW9B 2AS0A 4EGQA 3CS5A 4L0QA 1AGYA 3DE1X 4AZ0A 2QWRB 1QUFA 3DZFA 1S2GA 3F5QA 1JLLB 4ZXFA 3A6JA 2WFLB 5GY7A 1GKIA 3CCEV 5KMGB 1MPXA 4MRSA 2VTBB 5JS1A 4WJLA 3ABLC 1Y1PA 2BF7A 4XRRA 1YB5A 2W0FC 3DAYA 3T12A 2F1IA 1CUEA 5H02A 2QSJA 2PK3A 1Q0HA 4JTAB 3FSJX 4E6EA 5SYAA 3EVFA 3RSOA 3U9TA 3O26A 3MTEA 1Z15A 3VIUA 3KZMA 1Y6QA 1SHUX 4RK1A 4I9FA 3RS2A 5AKGA 4WFEA 4M4SA 1CE8B 7REQA 2PFGA 3IOCA 2L17A 3HHPA 3GYGA 4AX4A 1Q1BA 3CG0A 4X89A 4TMXA 4WCEV 1JG1A 1JHQA 5CFPA 3U37A 3IAHA 4HBZA 2O07A 5K0SA 1Z7YA 2ODTX 3LLSA 3WGMA 4KXNA 4ALLA 4GZ5A 3T1HB 3H5IA 5K8JB 3CCBA 2QX8A 4HK4A 3DXZA 1DBIA 1CEEA 4IWYA 3QKRB 1SHTX 2WIJA 5LHHA 1SXPA 1PV0A 4X1YB 2SKDA 2QRPA 1W57A 3QUSA 1UJ2A 2OWEA 2PKRA 5I8PA 3NOOA 3VSCA 4M38A 4ZDJA 1XFDA 1Z26A 2II6A 2ZAYA 4JJEA 3CT4A 4XX0B 1NNUA 2A9KA 2DHRA 4WVLA 3BDAA 4H6PA 3MB5A 4TX1A 3HJNA 4PAOA 1MC1A 4ZIRA 2CSLA 2D4HA 2B6NA 3IOYA 5JI2E 1IHUA 1Q84A 1ZPDA 1L7OA 4XE5A 2ZTSA 3JQGA 4DR3O 3L79A 1UI9A 3ZHYA 1XCJA 2Z1MA 1R6DA 4S0ZA 2XSZD 3HDTA 4I4CA 4RIHA 1DAKA 2PVPA 5DLEA 2WUWE 4HNRA 2OBYA 4WY5A 9GPBA 4BJHB 3RK0A 3JWGA 2PJUA 4LBZA 5JV5A 2PWPA 3HCNA 1REQA 2EWVA 2I2XB 2QY9A 2BEWA 4XB1A 2I65A 3M0EA 5ITZB 3AG2C 4HX2A 3PD0A 1XZMA 2ZJ7A 2EG5A 1S3JA 3ZJ5A 1UKYA 1ZNWA 3I04A 3UGTA 2CLDX 3SZMA 4AKHA 1SD5A 5EBWC 4GHWA 1IV2A 1QGUB 2J9ZB 1ENYA 2CDBA 3LT5A 5FI5A 2BKUA 2XNSA 2YJGA 2PVSA 2Q5EA 1Q22A 2CDAA 4Y6PA 5BSGA 1RI2A 3OWXA 1S4QA 3C1OA 3WPXA 3ZMVA 2NUAB 4WFFA 3LI2A 3OURA 2HRYA 3I0NA 1JKFA 4YT4A 4QDTA 2ZRMA 4GUAA 2E3CA 4YBZA 1IY8A 1E9SA 3RR2A 2E48A 1ZRNA 3LY9A 1J7KA 4QGAA 1GEGA 3GARA 3NCTA 2C2MA 2Z57A 3EZLA 2FKNA 1MZPA 2RCVA 4H9GA 5DBOA 4FR2A 3IOEA 3I4FA 1II8A 5AVYA 4AK9A 1WNSA 4JROA 3B1JA 3PE3A 3NEPX 1QP4A 3D00A 2XMRA 2VSYA 4OB7A 1M34A 1Y5RA 4YCNA 2QWNB 1IAVA 2KWIA 3OOYA 4MUFA 4B0PA 2FE1A 3A1DA 5HBRA 4K6MA 3U4MA 1RS0A 2P1RA 1H65A 3C39A 3STYA 2JHFA 2D6FA 2CVFA 2NTJA 1PV4A 3TNLA 1NLFA 2FFAA 4OGQB 4A4DA 4BJ1A 1RFYA 4YC7A 2C5BA 4RCVA 4U3JB 3I5AA 3I7TA 1EKXA 4YYEA 1NUTA 3ZWBA 5BZBA 5JAOA 2LIPA 2VRBA 1GRQA 3RU2A 3ZWNA 4A8JA 1NAIA 2JZOA 4NHOA 2F2TA 2Q07A 5FNVA 1WQ3A 3ITEA 2RGNC 1RRKA 2J48A 4B47A 4KN6A 1BHJA 1QX4A 1M6HA 3EUEA 2J9FB 2X7RB 4FCCA 2PGOA 1YBMA 4ALJA 1N2SA 5I9BA 4K6KA 4KH0A 2Y0BA 3BMOB 2QW1A 5BORA 4Z4GA 1VLLA 3ND9A 1SA0B 4ETNA 1VQOV 4A16A 3FZQA 1YQTA 3TPCA 3KSAC 4WV3A 5CM2Z 1EH5A 4QTTB 3JQ8A 4JK3A 5F76A 2XE4A 1PW7A 4DAOA 2OMKA 1S1CA 5ED0A 1NYTA 2VDJA 1VBNA 3JVDA 3TR0A 3R3YA 5FI0B 1PQUA 1Y8QB 4A1FA 4X88A 1GNTA 1SD2A 2Q5ZA 4R1NA 1HDOA 2N0SA 2AG8A 721PA 3NM5A 4MYHA 4FFKA 3TZEA 3K96A 3ILXA 2PV0A 3WO0A 2AJTA 3RSLA 1AK2A 1X7XB 1SCDA 2CJYA 4TMYA 2UXCB 1GR1A 2Q4EA 4YJGB 3NRJA 4EX7A 1E3TA 4WACA 1VMIA 5BOVA 1OAAA 3T61A 3KDSE 3EISA 1AROP 5K20A 2BGTA 3TR6A 1EVJA 2C9CA 4R98A 3TB6A 2X1MA 3KQMA 4NKRA 3AG4B 4ZZ0A 4P3KA 2OFXA 4O33A 5GANK 4G37A 3PKIA 3JPWA 4O1IA 4YXWA 3QH4A 4CCSA 3ER8A 3JAWA 1NA5A 2HWWA 4F3NA 4ND2A 4IX9A 1TFUA 2R86A 1YJXA 1E2JA 1WQ1R 4LBVA 2A59A 3AEUB 4QEKA 1CEYA 4OFZA 4WGGA 2OPBA 3I9NA 4NP6A 4LXUA 3S0YA 3AKEA 4XDJA 2RH9B 2OXFA 1UXGA 3T95A 3CU5A 3VR6D 2DJIA 4DKXA 2YZ7A 4II2A 4HG2A 1YE3A 2C8LA 4WY2A 1DSSG 3SYTA 3GY0A 1VB5A 1KD1H 4JLMA 4ZTUB 5CJJA 5GQSA 3MRSA 4HN2A 4DV1O 3CF0A 1NW4A 1H93A 3JYNA 2ZU0C 2CMHA 1I0HA 3DLCA 5CH8A 2CUKA 2X0IA 5K3CA 5ITSA 4N9QA 4B3DA 1ACJA 4QJ5A 3G71F 5CCXA 3W7BA 4B85A 1THMA 1SZCA 4I1YA 3U4DA 2VK1A 2OESA 2FZ5A 4B84A 4F9FA 2ZT5A 1QC5B 1GL7A 5HA5A 4QPJC 4TGLA 2AW5A 5DTJA 2QP4A 2IP2A 3UWKA 1PNTA 4C81A 1U0FA 1ZWIC 2H9AA 3S1AA 2WLHA 4UDYX 2D0DA 4HPWA 3K7EA 5KHHA 1W75A 4XVCA 3MMNA 1WA8B 1NJ2A 2WF9A 4IQ0A 1CDDA 9LDBA 3N7AA 3Q72A 5IMBA 2F9FA 4CS3A 5T3YA 1U6JA 4HGYA 1PT7A 9MHTA 1EZVH 1J9EA 4EJSA 3FH0A 3KKYA 4RXUA 3KWMA 3JRXA 3VX4A 1XSEA 5M7EA 1IY9A 4MICA 4CM1A 2QUZA 1QONA 4TWIA 2YIBA 2OIEA 3FSRA 5GAPK 2OVFA 3X2FA 5HFMA 2PJDA 4QBGB 3GPLA 4FFRA 3DP7A 3VYUB 4F93B 2WALA 2KG7B 4MAMA 3ETGA 4WCVA 4JL5A 1NVVR 2WSYB 5C8YB 1QH0A 1N0WA 3PT9A 3ZYCA 3SS8A 3F1LA 1JR6A 3VO1A 3RFVA 2DSTA 2JFZA 2PUJA 2YC2C 3GWOA 3RRBA 1KP3A 4AQYO 2LIVA 4B0OA 3HXOA 1G66A 4DGSA 2RHTA 5C2JB 2X0KA 4JDPA 3IPAA 4EPTA 2YMQA 1Q1AA 1E99A 2QRJA 5E6SA 4C7OB 1UEIA 5GIPE 5D85A 1R3LC 4EB0A 2R68A 4ZVMA 2A4MA 4HPJB 2VN8A 5ALVA 3BGIA 1E6WA 5EAZA 2PSEA 4Z7JA 1GZHB 2FFBA 3I2HA 3KYBA 3QYJA 4C5CA 4F5YA 5CVUA 3RVOA 1JYEA 3H0KA 5LGTA 2P4SA 3PIRA 3VNBA 1JG7A 3IAAA 4PN3A 5AICA 2YOFA 1G7RA 2Q9AA 2BUBA 5IXYA 2GCOB 5GINC 4Y1RA 4MW8A 4IJQA 2QMUA 3QUQA 1V16A 5L6LB 2HRDA 1RLTA 3BQMB 2UZ0A 3G71V 3BK7A 3BMXA 5GZ3A 2ZBDA 3DCYA 3VSAA 3RYHA 4IINA 4OB8A 4WLNA 4I9QA 4OATA 1BE1A 1OCOB 2O2HA 2PT9A 3FVVA 3B60A 3K79A 1QIMA 1V3QE 1OBFO 1O94D 4Q9DA 1Z25A 1IUPA 5H68A 3P0JA 3IR9A 2GZMA 4D6TH 3TLMA 3AOEC 1QR8A 3SOPA 1FRQA 1MO5A 1QF6A 4PFJA 4R83A 1CD5A 4LVUA 1YR8A 2BMAA 2XQFA 1N9ZA 1V6CA 3HVUA 1QBZA 4K9RA 3CXRA 3OEWA 3BXZA 1JXAA 1G63A 3THRA 4NQRA 1L1FA 5J1TB 4H18A 4KN9S 4BU1A 2H2FA 4PEVA 4XW2A 2BGKA 2WD7B 1PHRA 2VZLA 1DLJA 4BAGA 1F7VA 4YUXA 2IFTA 1P29A 4IBOA 1HLPA 2JHAA 4FBLA 5GVRA 1Z6YA 3L6CA 4A73A 2VYND 4PU0A 3TDKA 3U16A 1QH1A 4FFVA 1BU8A 3IOMA 3OUZA 4LF6O 1GFIA 1BX0A 5JFOA 2NUPB 2Y2UA 1HNNA 5AVKA 4DYHA 1E2DA 1VSBA 4QDZA 1TUEB 4ALKA 3FYHA 1CB0A 4HTFA 3M6FA 1WF6A 4J41A 4KUGA 3PQCA 3PCXA 3IUEA 1CQZA 4F4JA 3FSEA 3COVA 1MA0A 1IOLA 5B1DA 2V03A 2NXJA 4EUNA 5KO2A 2EWCA 4XQ9A 3VR3A 3AK2A 4IYIA 3URKA 4C14A 2WMNB 3U3RA 4ZK7A 4R0NA 3IKVA 4X1IB 4M9QA 3R6DA 3C70A 1XI1A 4G1CA 1Y74A 3WJQA 1NH2D 3MS7A 2OSVA 1S9DA 4XOIA 2HWXA 5DNYB 3K9HA 2XCLA 3C4VA 1L7BA 5B64A 1CCWA 2W7TA 3WSVA 1CV2A 4WJZA 1DC8A 1T36A 1FCJA 2VA9A 3GJQA 1WSAA 3ZLJA 4ZAYA 2C82A 1IBKB 2H07A 3R9XA 2PGLA 1XLTC 2K87A 4IFIA 2HIMA 3GPIA 4ZEMA 2BMEA 1OILA 4RACA 3D81A 5A6SB 1ZVMA 3B8NA 4IVRA 3SQNA 4N9WA 1K8YB 2P2ZA 1RLMA 5CHEA 2GZHA 2ID8A 2OBMA 4RZ3A 1UBGA 2XMPA 1X7WB 5B1AB 4CUJA 1UFVA 4L75A 1BE6A 2C20A 5DHTA 1YS7A 4L95C 1W85B 1PRYA 4IG9A 3PCTA 2XNCA 3BCSA 1IZYA 4IYRA 1FJHA 1Z2DA 2N47A 3MWFA 4I5EA 5HMMA 2C07A 3EIFA 4X5OA 4KMMA 3WL4A 1ZCAA 2J9GA 2H2IA 1YZVA 1J97A 4XSHA 1OX5A 2ZB4A 3CKLA 4S2UA 2QM0A 4X3CA 3GH1A 4CFSA 2YVLA 3NATA 2X0RA 1FYFA 4NV3A 4MWDA 3ZX4A 1C9KA 1N2CB 5DGXA 4QOFA 5I01A 4YT8A 3NM6B 4JT2A 5LN1A 1FSGA 3GF4A 3K9NA 3S68A 4X71A 5ULLA 1HG1A 1WRBA 1FXWA 2FSUA 2QPLA 2LBPA 4DUGD 4HNAA 5DECA 3QPCA 3ZIAG 3QRWA 5LD2B 3N75A 1RT9A 2F3QA 4C4ZA 1XUQA 3ZKWA 4YMUA 2FSHA 1GO1A 2IY7A 3VTFA 3ABKB 4HNVA 2XE6A 4QASA 3AONB 1YUBA 3KQLA 4NTXA 5BV8A 3LVFO 5A7GA 5JE8A 5H9WA 1ZL8B 3EEIA 4PZPA 3CNLA 3X1ZA 1FU8A 2X1HA 1XNRB 5TQ2B 2YIDA 3H4MA 1YFKA 4ABTA 4RW0A 4Q47A 1OA1A 1SIBE 1J0DA 2AF4C 1M2VA 5I7HA 3KOZA 5JQGA 3CHXA 1I6MA 2JJQA 2P8JA 3GRVA 4JTCB 2P0YA 3F46A 5TY0A 4E2WA 4NECA 4CMCA 3MUOA 4D92A 2QMHA 4NMMA 1JT9A 1OIWA 3NRBA 5K3DA 3W04A 1UBTS 1SUSA 4DV3B 2E85A 4ZT5A 2Z0MA 4BV2A 4F5WA 1IUNA 5BMVF 5I4IA 4QIWF 3M4YA 4JLKA 3ZEIA 3ROEA 2RJNA 4KFMA 1H8HA 4TQAA 4QUEA 5B66Z 4BMCA 1RNLA 2P7IA 2Z1FA 4HAUA 4MI6A 1SPBS 1IQ0A 4BVLA 3GLIB 4AVYA 3EZGA 3SJAC 1B6TA 1UQUA 3ZQ4A 4V0ME 1XMVA 1IBSA 3LCUA 3D6JA 2BFEA 3U48A 3BORA 4G23A 1WUKS 4AC9A 1NOJA 2IHBA 1MABB 4US2R 3AHFA 3JCZA 5KKNB 3BGSA 3UO8B 1T25A 4H6WA 4IW3B 2QP9X 1Y37A 5KC8A 3DZJA 4OJYA 4RTNA 1HC7A 4WUTA 3K70D 1XIVA 3A0BZ 1QF7A 2JJ1G 4C2BA 1C3EA 1G6OA 3WJ7A 3I92A 4Y6GB 2Z6VA 3QIVA 3CYOA 3C3JA 2BI8A 3S2ZA 4BX0A 4DIMA 1I3MA 5J9FA 1VF6A 1Z5NA 5EJFA 2HIGA 4YRRA 1UADA 2YC4C 1E5QA 1HLDA 4KBFA 3UUEA 4INOA 5HK9A 3ZXXA 4UBLA 2AZMA 4KFCA 4AY2A 2OZPA 5KHGA 1EEXB 2PMDA 3H19A 3P9KA 2O2JA 2DMXA 4FFWA 3TO5A 3MTDA 4F86A 3AERA 2X9LA 1JUDA 1VE6A 5E9AA 2ZM6O 1XZPA 2V4ZA 2PZJA 4YXFA 2JRLA 4RH0A 1JDPA 1HR0O 2ZWMA 5E2BA 3VZSA 1RPTA 5F98A 2HGZA 3E03A 3AUSA 1G7SA 4X45A 5AJUA 3JW8A 1R4ZA 4M22A 2JANA 3K1ZA 1IB6A 1POWA 2FMTA 1KJIA 3WYNA 2JI9A 3C3DA 2WLNA 4GMFA 1N2JA 1LVUA 1BCSB 2JFOA 5FUMA 2QL7A 3NFYA 2HQRA 4JWKA 4BX3A 2QTGA 1E6EA 1Y4SA 1MG5A 1SBZA 3K5NA 1P0FA 2POCA 4DNOA 2IGBA 5D51S 4H1WA 4OQPA 2C5FA 4L2IA 3M9XA 1RIIA 4EF5A 1RWVA 1TZCA 4NYJQ 1MVOA 2X8JA 8ABPA 1OFUA 1TF2A 4OYLA 3HDGA 5IUKC 3MF4A 4TUYF 1N0HA 2CK3G 1TA4A 1SCJA 1B6QA 4G6ZA 2JAHA 4HZGA 2B6HA 3INGA 3SKVA 3DMRA 2RCNA 2IQIA 3L6OO 3S55A 1TVMA 4F5DA 2ZSHA 4L5BA 5GM2A 4RTPA 1J2EA 3ETCA 4PBRA 3B82A 1VQVA 5J4HA 5HGXA 2YWFA 1RJWA 3P2YA 3DEFA 4FM9A 2IHKA 1RQ7A 1XNGA 2GN2A 1DADA 2VDNB 1IM8A 3HXMA 3G8AA 2Q1XA 1UMCA 2XNDA 4OHBA 2CXNA 2QM4A 2A5DA 1Y3CE 3VKHA 1BKDR 2RG7A 3HFJA 3RRXA 3IB3A 5JEDA 1VE1A 3G8CA 1AKYA 1VE9A 4RZUA 1WN7A 4LRWA 3S2GA 2N42A 1LXCA 4YB8A 2V1DA 2E6UX 5EKSA 5IJZA 2WFAA 1W9MA 3V97A 3O6VA 1R50A 1F4NA 2AG6A 4MWCA 3P2MA 3OECA 1T2CA 2HF2A 2XODA 4LWOA 2IYQA 5JSKA 7GPBA 3OLVA 3G1WA 2ROQA 4PZYA 1ZN2A 4FLUA 1JL3A 1NJ5A 5EZ5A 2YRXA 2ZJ1A 1FXVA 4O2AF 2W2KA 1V11A 3CGWA 1V96A 4MW4A 5DASA 2WB2A 4B8ZA 4DSAA 1K2VN 5LLSA 2DFVA 4XPIA 1CXZB 2BGUA 4XB6B 3AVPA 3I55F 1UZLA 3IERA 5I4BA 3VH1A 3TB4A 1IEVA 4IGAA 3AI2A 4HGOA 1RKXA 2H2WA 2B8NA 5DW3A 2XAAA 2B83A 4ZGWA 4OBEA 3RWBA 4IH1A 5K6AA 4Z2AA 3D64A 4HZIA 4PICA 3E3AA 3H8SA 3MJVA 2XVAA 4MVWA 1ZJ6A 2DPYA 3EGDB 3CLVA 1LC0A 4KXVA 4UV9A 4FLYA 3UWMA 3H5WA 4P3XA 4Z8YA 4OYRA 2CVZA 3BOSA 3QXXA 4PRLA 2ZM5A 1P49A 5CDFE 2JHGA 4M7OA 3P0HA 3FZNA 2AFHB 2PJRA 1YJAA 5GINE 6ADHA 3FYUA 3WGQA 3IR5A 3OPVA 2EIHA 3LRXA 3SPJA 1WO8A 3VNUA 2RI1A 2E89A 3HP1A 3C8UA 4W4TA 1RR6A 1RU3A 4BN0A 4Q6WA 4I4TA 1R73A 2X8LA 3TTYA 3FN4A 4DV4O 1O58A 4YRMA 3MT9A 2C7PA 3W1VA 2CY0A 4BJ6A 3BHPA 4N41A 5JXHA 4OH7A 3USZA 1OXKB 1ZTEA 1PWEA 3ZXIA 1E7RA 1N92A 3M1YA 2D06A 1CFJA 2GO1A 1GYRA 1S02A 2DHEA 3FDXA 4XYLA 4FOSA 3D02A 1W2BF 4MLPA 1UBUS 2BM1A 1GFZA 4A7PA 4ARSA 1OY1A 1VQNV 3KDAA 4EFBA 5FPHA 5BSUA 1QNLA 3A1WA 4IOJA 3LIPA 3K59A 4O4JF 5L3DA 2QRLA 1M72A 2QWQB 3LFOA 2FPIB 1Z68A 4K40A 2UVPB 2LCIA 5BYJA 5ICEA 3RE3A 3HL0A 4WT7A 5HJ2A 3V7QA 1Q14A 3CRNA 3DXFA 4DLBA 2ZUUA 3NQ41 3D6MA 1UEJA 2E9SA 4CIYA 1GH6A 4ZHYB 2G88A 3T1NA 3T7SA 2JK1A 4LF8B 1G2PA 3MQ2A 1F5SA 3SPCA 2FHPA 3RSCA 5ILQA 2FRXA 1EX6A 4ZAZA 2HU7A 5JIBA 4CMIA 1NVGA 5HY1A 2OM6A 1TVKA 2HBYA 2NTYC 1LBIA 1JA9A 4J0IA 4I55B 2CLKB 2QG9A 5H9CA 5CLHA 1Q2XA 2JZNA 3REQB 4BO1A 2CGOA 5KQPA 3IXQA 4P36A 5FOWA 3Q3GE 1TK2A 3L4JA 4R3WA 4AXBA 1Y63A 2ILMA 1JDVA 3EY9A 3EEOA 5GZ6A 4KLNA 3HXQA 2FEPA 4DIKA 5KJ1A 4Q4JA 2AZXA 1WOMA 2CKDA 1ODFA 4E51A 4PG4A 3SYNA 3D3QA 3DTUB 4MMXB 3GCXA 4BX9A 1GCUA 3D8TA 3MJSA 4LOIA 3CNQS 3V7YA 3VRHA 2QPTA 1YITV 1Y1TA 4QGFA 2YMPA 3NTRA 2XQGA 3GLHA 3C5WP 3UMMA 2BR3A 3FMPB 1YR9A 3QX7A 5J47A 4B79A 1AJNA 2YJTD 3H1LH 1MB2A 4IIHA 4KW7A 2UAGA 5JDCA 1YRQA 5JYDA 3AEYA 3LYBA 1WNFA 3RT3C 2AZDA 5CVVA 2OZBA 1SZQA 4KMSA 1A8QA 5FPKA 4M0KA 3OBWA 2R751 4GL2A 2ZRNA 5ALXA 1KARA 3MCQA 1B3RA 2C2HA 1LC3A 2BLNA 4B45A 2O7NA 4PTZA 5T4EA 3M70A 2IYAA 1DQZA 1O5TA 2ZXWC 2Q5JA 5TMBA 2FP4A 3TXXA 4CLDA 5FL7G 1ICIA 3FROA 3SU8A 1A5BB 1CT9A 3GFPA 1QCDA 2AN9A 3LVRE 3M83A 3KR9A 5ES4B 2LKCA 5CB4B 4EKEA 4IF4A 1XZ8A 2QGFA 4M8NE 2GD0A 1PYGA 3TQHA 3CJTA 2PYZA 3WIVA 3EZNA 4B8YA 2VTVA 2ODEA 3CPWU 2I76A 3OJEA 4X6YA 2VAXA 1KE2A 3QO8A 5FLXM 1XO1A 1D2MA 1WB4A 3PXXA 1X86B 3LSQA 4NYJR 2O0LA 3NUGA 3FKQA 4M37A 4DMCA 2JI8A 1BWPA 3GRUA 4GT1A 1Y3HA 1E9CA 3K1AA 1JP7A 3U10A 4U2CA 3GRKA 4NVPA 3R5TA 2AUMA 2ZSUA 3VO8A 1S5LZ 3RVBA 3AWDA 3HVJA 5HMLA 2PUTA 4D99A 5WRFA 4ZANA 3T4UA 1E6UA 3QLTA 2MW2B 4F6EA 3CUSA 4GGOA 5C32A 5FR2A 1KEKA 1QTNA 2B1JA 2DULA 4D3FA 3Q12A 3KJFA 1EQ2A 4TMFA 2L18A 5ESXA 4Z49A 2CE4A 2J0SA 2VDUE 2DHQA 2WVAA 3ICVA 2ZNJA 1J4AA 3N0XA 1TF5A 2I4NA 3OAAA 3WKBA 1EAMA 3M34A 4KYTA 5TQ0A 2Q0AA 3FVWA 3QKIA 1NNI1 4ARAA 3EQ2A 5GOTA 2DC1A 1O95A 5KHIA 2P9ZA 4Q0MA 3GJYA 5J58A 1XD2B 4IXDA 1KYQA 2W93A 2KKWA 1B42A 1JLHA 3GG9A 1RRPA 3N2GA 2DWPA 1YZFA 4PHZA 4TKLA 3OTQA 3HBNA 2XA1A 3ZVRA 1GRJA 1KXZA 3H2HA 3FYEB 4MGKR 4HGQA 3KD3A 3NKLA 2M2IA 4ZYUA 3VO9A 4YIKA 1LUWA 4K9OA 3ZRWA 4L4ZA 1T5OA 3A4IA 4ZVOA 1JJOA 1LY1A 3T7RA 3JALB 3D0QA 4IDOA 1K6MA 4OBXA 2ECOA 3OW2U 4MW2A 5IT0A 3ENWA 1HDYA 1ZCZA 2OGTA 3ZIAD 3NHPA 5FADA 1A9PA 5IULC 2PGXA 3ELYA 4AD8A 1AI4A 3IH5A 2ZB3A 3UQYS 5B3SC 2ENWA 4E46A 1YIDA 1M8JA 4M1ZA 4WKCA 3KR2A 4KPUB 4QAQA 2FJPA 2VHYA 1O6BA 3GP3A 3PGA1 2A5YB 2IKSA 2FWPA 3EUWA 1HI9A 1MJHA 1R8XA 1ST2A 2NVUA 5JHGB 3BN3A 1L7DA 4PYMA 5KYNA 4RLFA 3MTGA 5BV2P 2A5GA 5ENVA 2G9VA 4KGZA 4LOHA 2QX4A 4NVRA 2DTDA 3OOJA 3ZZTA 3WOVA 3C9UA 5AK0A 2G72A 3K20A 3PG5A 2H6LA 3GJTA 1JZSA 1F2TB 1FQJA 4AJ2A 5C5EA 4GOMD 1BX1A 1PUXA 4E3WA 2E74B 1TKAA 3R65A 1EU1A 3L7OA 1HG0A 3HRKA 1CJBA 3THWA 1R0BA 3BQ9A 4BC0A 4ZI7B 5TMEA 3PNOA 4Q15A 1ZMTA 3ETHA 3NJ4A 5LWQA 3UN1A 4C4YA 2PZBA 3ZBHA 1SXJB 4G01B 2AZ4A 2RHBA 1AS2A 1ZEMA 4KYUA 5IY5B 1XVVA 4WCDA 3VSEA 2VQFO 3EDMA 2L26A 2VDWA 4F5ZA 3R8CA 4R8RA 3KSBC 1PQPA 2BP7B 1ADBA 4MA0A 4IDFA 4J0JA 3QG5A 3DEJA 2H1FA 3H9BA 2IW3A 2CF6A 2I1QA 2LKDA 1YR2A 4DABA 3CCRV 2PKCA 3H5OA 2PYLA 1IZ3A 4W5NA 4QT4A 1DCFA 1YB6A 2J0UB 1U04A 3A9VA 4D0RA 4L73A 1WUTA 3R7WB 3D4IA 3H11A 1M2GA 2PZMA 3OZGA 1P8JA 4C0AC 1JJVA 1KOGA 1UXIA 5C5CA 3FPHA 4FBGA 3RIEA 2VRCD 4LX0A 3FKSA 3JZIA 2JJ1D 2C3OA 3HC7A 4WLFA 3FDIA 4CZ2A 2ZKIA 4IMIB 2QD3A 4D7TA 1Y0BA 1P84F 1ISIA 3N2KA 3SR4A 5DGCA 2ETXA 2NQ8A 3BWDD 2Z4RA 5L3RA 1J33A 1F38A 2RKBA 3U7FB 3PEYA 5KPJA 2JFUA 3MTJA 1ZR4A 4ZOAA 5AQ1A 4NH4A 3V4FA 4BGIA 3DHEA 4LFBB 4U2EA 1U3LA 4B6RA 4PVCA 3CF2A 1T0AA 5CDHA 1PDWA 4YAUA 2BGJA 2DW4A 3T99A 2Y1FA 4BGDA 3QYPA 4Q34A 1SEPA 3FZGA 3OR7C 3VKFA 3BZUA 1G2IA 1H0KA 3P2KA 1ZINA 3R75A 3TVDA 1LNSA 3S0WA 1XAIA 4IXNA 1S2LA 2W42A 3F6CA 3OT1B 3DDZX 2QJOA 1J1IA 2YJZA 1BDBA 5G4KA 1PJCA 3WQRA 4OHYA 3NUQA 3DEIA 3OOWA 3VI3B 2XITA 5ECWA 2A0LA 4GMHA 4JFRA 1UFQA 4JLJA 2B4KA 1DRVA 3N05A 5FQNA 4ZCMA 5EYPA 5JD5A 3BE4A 3QYAA 3TOCA 5K0TA 4HCJA 5CFZA 5JFTA 5CLGA 1ZNYA 4GKAA 1C7FA 3TUIC 3EDYA 4FLWA 5EEHA 3LOPA 3WMRA 1SG0A 1E60A 2AEMA 5FWDA 3TSOA 1IWOA 3FUWA 4QHSA 1ZIYA 4DY6A 2YZMA 4RJLA 3UYKA 5KNBA 1U2TA 2CK3D 3KLPX 1IXZA 2Y05A 4JHXA 5KDLA 5JDIC 2Q6IA 3C14C 3ZZ0A 2FR8C 4FT2A 4GPTA 3I0MA 1A7UA 4MQFA 1YIJF 4D1YA 3KC2A 1WZUA 4MQMA 1N9GB 4QYMA 4TKVB 1U8AA 2AYYA 4HWPA 1E4EB 2IU4A 1Z2EA 1Q15A 1ZK0A 3SM9A 3K71B 4P30A 4Q4AA 2LGJA 1W52X 4UAVA 1OWLA 1OHHG 4Y2SA 1AKMA 3E8MA 3F0TA 4MSWC 3TW8B 1UKAA 4IT5A 1BT8A 4G1MB 1V48A 4JR0A 1OZAA 4PLWA 4A5OA 3LMKA 3VZRA 5DTIA 2IY9A 3L0ZA 4XDGA 4H33A 3DNFA 2IJKA 3NGLA 2A3QA 4DQLA 1N77A 5CA1F 1XALA 4PQRA 1Q86H 2YKGA 5SYNA 2O23A 1XILA 2RAVA 3KYDB 4IZHA 4D42A 2Q1UA 3AEKA 5LBIA 2H85A 5D8DA 2P4QA 2IF2A 2P4HX 4JLNA 1XEXB 1MMFB 3JAMM 4MW0A 4LZLA 5EERA 2OOKA 4WZBA 3IVAA 3LOUA 1TEVA 4LQCA 3ANNA 4E5SA 1Z4KA 3KQVA 3DE2X 4BIMA 4QYIA 1HQDA 2ERYA 4CH5A 2X23A 4CEIB 1YC5A 3GT4A 2Q5HA 3CWQA 3TJMA 4PWTA 4ICIA 1J8MF 3BCRA 4PBSA 1QD9A 1DT9A 3LJKA 2LZ0A 4O2RA 5K7SA 2QXTA 3CLTD 2I6RA 3CZ9A 2G77B 4FS3A 1U8FO 1OCRC 3KL4A 5F52A 1EUYA 1YVWA 4REMA 1MA1A 4HGPA 2QRZA 2GRAA 2MJLA 1EP1B 1UPTA 4DM3A 1NR5A 1SOWA 2B9EA 3PITA 3QHAA 4TV8A 5D3KA 2Y76A 4YRIA 1N9KA 4ITVA 4UTVA 3ELWA 3RF7A 3QA3E 1C14A 1W7AA 3FBTA 1FNMA 1IHXA 4AY5A 4DZZA 1NQ5A 5LXTA 1U7ZA 2DLDA 2A0WA 1ISHA 3NOXA 1EYZA 1E2GA 3SI7A 5FPSA 5LWHA 5B1BC 4D3XA 3BRSA 1Q1GA 2OUIA 4G0QA 2YIBD 4KSYA 3SM3A 5AK3A 2LD4A 1OREA 1K7DA 2B7BA 4QPCA 1Q0TA 2ARKA 1YIJV 1E61A 1D8TA 4I46A 3R23A 4PO8A 4L4XA 3I8OA 4OHUA 4UHBA 1RE0A 4DV7B 3O8CA 3WYCA 2V8BA 4PLFA 2R7MA 3HJBA 2HW8A 2ZQMA 4RHCA 3TZCA 2I55A 1PR5A 3UVEA 3A1SA 1W30A 2VK2A 2HJWA 2QZJA 5B2ZA 2VXOA 1EE2A 1C80A 1DEAA 2ZIEA 4JLWA 1M66A 1QCZA 3G2KA 3RJ9A 5E3IA 4BVGA 4RD0A 5KIAA 4QULA 1CPYA 4O0LA 1CZNA 3WYEA 3EZXA 1SERA 1EMDA 1ZWZA 1IPHA 1V4VA 3JWJA 4LF4B 4U8GA 8OHMA 4PIMA 5EK0A 2AXQA 4A2PA 5ISMA 1JZQA 1E4VA 1E2NA 1XREA 3F9RA 2PRYA 4BIIA 1E58A 3Q4HB 3NHMA 2WJPA 4JP1A 3RTBA 5BPFA 3N2YA 3FLMA 3OIUA 3CIFA 4G4XA 3THYB 4BLPA 4JI4B 4P3PA 3ZHZA 4LRTB 3OQIA 3Q88A 3AUYA 5IZCC 4MDHA 4BCCA 4UOQA 4QVGA 3VYTB 3CCUF 1H2ZA 3WDLA 1JDSA 5AIBA 3QBJA 1X19A 4PQGA 1M5TA 5EFZA 2JA2A 4BVBA 3ESXA 2HQOA 3FJYA 4P9OA 3NJRA 4HZ3A 2QP3A 4KQFA 3T4PA 2RDMA 3T1HO 5AK4A 4HAXA 4JZGA 3FLAA 5DK6A 5E6UA 4F4IA 2PYDA 1K6IA 5K5EA 5F4ZA 4IH4A 4UUQA 1LI5A 3OBIA 4YQEA 3JQFC 1W8IA 5IAEA 4EUFA 3ZWVA 5BR1A 2GCNA 1EXWA 5JXIA 3JAKB 2BHRA 4FE7A 3O8RA 3IAFA 1FVXA 4WFBV 4KV9A 5DM0A 1ZX3A 5P21A 5JRJA 2JPDA 5A0TA 1HZZC 4A27A 3DKKA 1AP6A 5TR9A 5EJ8A 1ZUWA 1CLEA 2YTZA 4E6PA 1E2EA 1DRKA 4HADA 2HJSA 3ZWWA 4NTYA 1Y9DA 3D3JA 3S5UA 1HDZA 1KC8H 2CHUA 1XWIA 3CEMA 2WLTA 2JLQA 4P0TA 1P2TA 3WP1B 2P4EA 3B5EA 4KQEA 3MJEA 5DWVA 2Q7OE 4Q4LA 1FQKA 4S1OA 3MMXA 4DW1A 3RASA 5FL7D 1H3FA 3S81A 2H8PC 2GXUA 4IY1A 3VC1A 3LCVB 4L15A 2CW4A 4PS0A 3FNRA 1VPLA 2Q1SA 1FXKB 2P5OA 4PHTA 5JAIA 2ZI6A 3L70H 1Z17A 1EM6A 2F4VB 4F21A 1HNWB 3NHBA 1AX9A 2ATVA 4M6WB 4EYKA 3LTEA 4HLDA 4OHXA 2ATEA 4UW9A 4I6GA 3O2NA 2JEZA 2HK7A 2XRFA 3WRVA 1TQ4A 1J42A 3KUUA 2HS0A 1YZ3A 5DBEX 1EFCA 4TKUA 1VG1A 3M6WA 3BHIA 1O97D 1QO0A 3PC8C 2HO5A 1NY5A 3RU9A 2H1HA 2C54A 4CIBA 4JYZA 3DR5A 5F78A 1HKHA 3AFGA 4I9NA 2DUMA 1JXOA 2QN7A 1NR1A 2VBCA 3ACCA 1DQRA 5CFLA 2QRNA 3DJFA 3SK0A 1U1CA 3NM4A 3VHXB 4QDJA 1L4LA 1W8DA 4U6SA 5ECDA 2DEUA 1MC5A 1H3EA 2JGMA 3DMDA 5FI3A 2YDEA 3AY6A 4CKYA 1X7YA 5BW8A 4QT0A 1TK9A 1U8XX 2AW3A 1RAEA 3W7AA 2R7AA 3ZY4A 4LSWA 3VNSA 1EGVB 1KFEB 4MUHA 4DF3A 1DARA 4MUIA 4RH1A 1KBHA 4CTOA 3CV3A 4BBZA 3WL7A 3RG8A 1C30B 4H31A 3G23A 2A94A 2YZKA 4NL4H 2FWMX 4TL7A 1E3JA 2YWBA 3ZDDA 5EIBC 4OK3A 4BNDB 4PQYA 2ITDC 3MFQA 4S12A 3E20B 1VL6A 4LRSB 2EQAA 2E4AA 2JJ2A 3JYQA 1QQ5A 2I4TA 1R37A 2OD2A 1JJBA 4OJNA 1BFUA 2J09A 3EYAA 4MA4A 3ZS8C 3MTBA 1W4LA 1XZIA 3GZ4A 4GPD1 1EFVA 5ECYA 3EGXA 3L7LA 1LUAA 2WSLA 1EWYA 2XVMA 2W5UA 1JQ3A 4I5DA 3S0HA 3N8HA 1K34A 1RHUA 3V8VA 2N1MA 4OXRA 1L4BA 3I1YA 2FUCA 3QVGA 1QZXA 3TNFA 1YI1A 1SOUA 2V6MA 4N0EA 4OBWA 4LKOA 3AEZA 2G9QA 4YJ2B 3CMMA 5AXDA 4F45A 3WMFA 4JVSB 3UBMA 2UXCO 3AF5A 3OCWA 3CEIA 3ETLA 3L2OB 3I0ZA 4RKRA 2XHBA 2W2VA 3ZE1B 5LMNO 3VR2D 1G55A 2Q27A 5FTWA 2H4WA 3C7DB 4POAA 4BNJA 2MYNA 4UNQA 1KO5A 3P26A 4L1KA 4M2LA 5TIIA 5LKRA 2GTSA 3SG0A 3OEHA 8LDHA 2J08A 3D8BA 2JASA 3ZWKA 4YPFA 3WHLA 4PZZA 3KQSA 2BD0A 4JI2B 2VP5A 4OFXA 3KXDA 3SBXA 3KKPA 2EJWA 4TKZA 4URUR 3PWZA 4OIFA 2QI9C 4FILA 5LOVB 4OGKA 3O8OB 2LGQA 2B5UA 2ZCVA 4G9EA 4W99A 4DR2B 3GT0A 2GKOA 1KUQA 1UBRS 1Q21A 3HZZA 3DXYA 3E9CA 5KTTA 4OXYA 5E0OA 5AKEA 2XIQA 1VI6A 3DO8A 3L93A 5GTIZ 1CW2B 3KHUA 3UKOA 4OA8A 5B4VA 4BEWA 3KR1A 3FKSG 3Q40A 2AJCA 3BRWA 5HKKD 3GUZA 5K51A 5CFQA 3LSYA 1RWPA 2HT1A 3ROTA 3J81A 2RBGA 1V41E 1U97A 1ZM4A 2PL3A 4N7MA 2ZIAA 1UDRA 4N5HX 1II9A 5JH7F 1G8AA 1ILWA 1A2KC 3G68A 4K6FA 2JG3A 4PLTA 4IQ4A 4RQUA 4YBRA 1DU4A 1A4IA 3TKYA 4IDBA 4QUJA 1A4UA 3PICA 2SNIE 5JOQA 3SF8B 5H5NA 1O96B 4P0QB 3WQQA 1JA1A 5IM5A 4MB2A 1WEHA 1DV1A 3U0VA 1JLMA 1M56C 1FUKA 5B2EA 1IWBB 4WKPA 2YQ5A 4E14A 2FUKA 2P6UA 3GGSA 4UB6Z 3C87A 621PA 1XA4A 4C0JA 4C21A 1AI5A 2AG1A 2NO7A 1CUDA 4WNCA 4R51A 1U2ZA 3HKEA 2OYCA 3BBLA 5FR1A 4F91B 3RE1A 3Q3EA 1I5YA 1RRCA 3A0RA 4UBJA 4YREA 5LD2C 1OLXA 5F51A 2VS0A 4ZFNA 4QO7A 1NW7A 1PS9A 1Q3KA 4XCXA 1ZI8A 4WQMA 3L0CA 3VDNB 4H6XA 1NVUQ 3ZWQA 2FZWA 4UTPA 2MSLA 1VHAA 1ISFA 3NC4A 4M49A 2CL6X 5AKKA 1NJFA 5F35A 2YOHA 3X1DA 1WDWB 1PM9A 2X6QA 1Z38A 1PJRA 1Y6RA 1C9JA 4QJFB 1VH8A 1GUYA 3GVHA 4UNIA 1Z6XA 4V1CA 2HP0A 3WISA 4RO2A 5IKOA 4LF5O 1EXMA 3R5FA 3FTQA 4GP9A 4Z4CA 2ABWA 2W2QA 2OCDA 1XU7A 3DZIA 1TKCA 4HWKA 4XARA 3DP9A 3ABMB 2R8PA 3JQQA 4EJ6A 1W42A 4O25A 1GY8A 2F59A 4US0R 5IN4A 2NSYA 1XF1A 4CG2A 2A9VA 3QTBA 4DLAA 1XCPA 3C5VA 3GYBA 4QQNA 5CPBA 4CBVA 1U5BB 1O77A 1T3HA 1KC3A 2JFQA 1WWKA 4RVNA 1WPQA 2GFIA 4FONA 3ZZUA 4IGIA 1GRVA 2XCQA 1URFA 5L40A 3WB0A 3AM3A 3ERNA 3RIYA 1WTCA 1PTJA 4OU5A 5CB0A 4CKZA 1ECLA 3QELB 3VPSA 3ND7A 1XQ6A 4X91A 4HDNB 1ES9A 4NX2A 1SBNE 4QXOA 4QA9A 3L05A 1OHHD 1UWLA 1G5QA 4A0FA 2FV8A 4K6OA 1NBEA 4JB8A 2EJCA 3R20A 2GN6A 2Q69A 2HDWA 1BS9A 1YBAA 4R5MA 3X1XA 1XUOA 2XBMA 2HXGA 3IPXA 2QLBA 4HBGA 3JVUA 5IVHA 3D0RA 5EJ5A 1EIZA 5FTLA 4X44A 1TNDA 4C29A 1S3GA 3R3VA 4HJRA 4IDEA 2PWYA 1T2FA 4KO4S 4KI7A 1NLUA 3UGJA 2YI9A 4I7ZB 1LD3A 1K73W 4RZIA 1UMKA 2QD5A 2GJ9A 4JPRA 4URZR 1M7GA 4BKOA 1LR1A 1N32B 4MMYB 4X7BA 3ZRVA 4BNYA 2AK3A 4U6NA 1JNXX 3THSA 2UZHA 3BX1A 3NV9A 2Z5GA 3DOUA 4HYTA 1S6YA 2Q5LA 4YAWA 5FWXB 4XASA 1PJ2A 1WOYA 1CZRA 2CVLA 1SQBH 4ND6A 5A4MS 3WRYC 4MVJI 2UZ1A 3UHPA 3V1NA 4G0OA 4TYYA 4V24A 3PXGA 4X60A 1ADFA 4PCLA 3D7MA 4NYKA 3GZTB 3MTAA 2Q3JA 4JNCA 1R18A 3TH5A 2EJ7A 2VWHA 1C3VA 3WB2A 2ESRA 3BAAA 5TRTA 4EA8A 3M6MD 3VPBA 3I2YX 3NIBA 2LJ2A 2ECQA 2FOLA 3I12A 1ARZA 3FCAA 3OZCA 5BOSA 1OWOA 3V46A 1T9KA 2W2TA 4RQOA 4NCKA 2EDCA 3JR7A 2ZVYA 4ALIA 2FPUA 4FEGA 3A06A 4KE9A 1UMBB 3FB7C 3RVYA 4CV1A 3H18A 3F7MA 3DKRA 4NOLA 1DT3A 2KSDA 2R87A 2DG2A 3EVEA 1EXVA 3PRYA 2Y9PB 1KMIY 4W9MC 2KB1A 4G0ZA 1WPGA 1XPJA 3K8ZA 1K4MA 2XWQA 2IYTA 3PC4A 4DK0A 5FPRA 1A9TA 1M76A 4DCUA 5DEDA 1MO6A 4RVCA 3K05A 3NBQA 2FEAA 3LKDA 3LW8A 4RTLA 2PG3A 4E7OA 5C1IA 1U2EA 5C18A 3TIIA 1T4CB 4DIDA 1MR3F 1T0KB 4MRMB 1V1RB 3ERCA 3KJJA 3I6QA 2YWCA 3IUNA 4JLOA 4BXOB 4NAVA 1E69A 1G42A 4YUZA 2VSFA 1HXHA 3AVYA 4CLRB 4FZ1A 2X1LA 3AKCA 1U3TA 4B4UA 4AN0A 1RAIA 3EBOA 4MR9A 1E9BA 1UEXC 3SQXA 5EIHA 1IHYA 1OYYA 1UC5B 1JMKC 5IANA 2I4IA 2LWIA 1FKAO 1N3YA 2BKXA 1KTVA 2CXXA 1S7CA 1SHZA 1X1CA 1H47A 1ODLA 4ID3A 1JQEA 4G2KA 3HR7A 2D7JA 3AK1A 1LLDA 2VNJA 2Q4DA 2PBLA 4C0BA 3R24A 5DE3A 5L45A 2ZUDA 3ENVA 1XRLA 4BP3A 3R8FA 4XLZA 2DTXA 4AJJA 4J0EA 1E62A 1PI3A 3QPWA 3HV0A 1S89A 4PYJA 2GSMB 1RZUA 1EVEA 1LVGA 4DILA 1P62B 3IHLA 4N8SA 4RY0A 3MAAC 1T5BA 4AULA 3J81M 5MN4A 3GOHA 4GLBA 5F77A 4CEJB 2I91A 3SYPA 3W5HA 2NTVA 1LQ2A 3ZK9A 1DBVO 2XTMA 4Y9RA 1C4XA 3KOYA 5FOQA 4L08A 4QFDA 2ZIXB 2XGOA 2WTUA 4OP1A 4UE6A 1W76A 2AI1A 4U7PB 1XNRO 1FSFA 3MUNA 2CNDA 3VPDA 5K0FA 2CLLB 1KMHB 1RE1A 1B8PA 3FHJA 5K6RA 1D2HA 4OUDA 3BREA 1V43A 3DBOB 1YBVA 1RA4A 1AA9A 3OJXA 3ZV3A 3IDZA 4Z3OA 2IBMA 2BFAA 2JVDA 1W4CA 4YUVA 5FLXA 5SZJA 4NCJA 2VDLB 1N2OA 4AILC 1V8ZA 3F71A 2WWVD 3CX5F 2YWJA 2YEVB 1J70A 2ORVA 1H0HA 1CUXA 3MVEA 2CXOA 1U98A 4N7RA 1O89A 4YCBA 4AWBA 3NMUC 3AM5A 4DV3O 4WK4B 3K8YA 3IVCA 2O7SA 3LQQA 3U7QA 3DTNA 4X92A 3IVRA 5F3WB 2QI9F 2BRUC 2YXEA 4MCJA 4DV0B 3NWJA 3BICA 4H17A 1BXGA 1JBKA 3GU3A 2O3QA 3E86A 4YHBA 1UPXA 2GMWA 2I6TA 2Q8PA 1Z08A 1U0NA 5IWAO 4QTUB 4CKBA 2HMTA 3KE8A 5BN4B 2H92A 4R0MA 2IPXA 3TSWA 1E9VA 1KRHA 3OU7A 4YXWG 2DY0A 2QE7A 1OXVA 1IOZA 3C3TA 4G81A 1YF3A 2VDRB 4GR9A 1M6WA 1G8SA 1WW3A 2PLAA 3MWYW 2NZ2A 2RK6A 1HWYA 4NEQA 1YL7A 4B82A 1R8YA 4OI0A 3UWPA 1GRRA 4I1PA 5IKMA 5JASA 5L4LA 2QT0A 1H9CA 4UAUA 3X1WA 5H3HA 1ZMOA 2NSLA 1T9BA 2Z6UA 1NQUA 2KQUA 4PCVA 2O2SA 1IE3A 1MRZA 4BQQA 4NUTA 1XYYA 3DMNA 1V26A 3IULA 2WKPA 1GZ4A 1GUDA 3CLRD 4AS2A 4ZU6X 2W6MA 3MWEA 3R7SA 1RLJA 3HE3A 1M2WA 4PC1A 2Q7EA 2YS8A 1K7FB 1MIOB 2QTAA 1EK1A 1K5DA 1GM8A 3M5CA 4FCTA 1KB9F 2FG7C 5AVQA 1O95D 2OP1A 5LQAA 2UUBB 2FWRA 2F9MA 2A9PA 1A2BA 4RJKA 2GSWA 3KXKA 5LFAA 4MQ5A 3OLCX 4D6PA 2ECPA 1RWXA 3ZD6A 5LQRA 3U49A 3U3JA 2VFAA 4BB5A 3B36A 1OCCC 3KKQA 2WLIB 1NKSA 4R1SA 4M9RA 3SPGA 4H6VA 4N3AA 1KEZA 4RV4A 3KJKA 3HUUA 1B3QA 3AJEA 1UFOA 4L3OA 3N0RA 1CZOA 1TT5A 4YLEA 3D54D 1CQIA 4EY8A 3GJZA 5HJ5A 2WJ4A 4BW0B 1E77A 2P5YA 2PX5A 4H7EA 4IOMA 1SKAA 4OOFA 4A91A 1QHHB 4TV9A 2QLJA 5THQA 3LRPA 3RRJA 3KNZA 1OYWA 2Q0SA 4PG6A 2X6TA 4C2UA 1G8PA 2BHLA 2FFRA 4B3IA 1AZLA 2PMPA 3KXLA 3JCUZ 1BC5A 1AF7A 3I9FA 3U11A 2AMLA 1PR0A 2RGUA 4F12A 1HT2E 1Z0FA 1M5IA 3BXOA 1JIIA 3MQFA 1A5TA 4JVMA 1VP9A 3LQ1A 4EUHA 3PZRA 1X1DA 5EIFA 3OPYI 4S1TA 2Q1TA 1CUCA 3DTTA 1Y9ZA 2XUGA 3GDGA 5BSRA 3EIQA 1IDOA 2PGNA 3V7FA 4NS1A 4OIMA 2XXAA 2DM6A 1B26A 1PJBA 1QPBA 4DSNA 1RWKA 5K4GA 2ZDHA 5HFJA 1FU4A 2JFYA 1Q0LA 4H0CA 4LJRA 1A96A 3ZP4A 1XBLA 2RI6A 2A35A 1PF7E 2A30A 4O4HF 3TMKA 2RONA 4UQOA 1IG3A 2XAHA 3ASYA 5BT8A 3T1CA 3IJEB 1N4DA 4FZ5A 3LUPA 1GDTA 4D44A 3AR4A 4X95A 2X3FA 4GSYA 3KKMA 1ULSA 2J3DA 1JR3E 1X59A 1FX0B 4OHKA 2G0NA 2XZTA 3GNLA 3S2SA 2W2PA 4OBBA 5JJNB 3FX2A 3LT4A 1U0SY 1CNMA 1SUDA 1M1ZA 5GJVC 4MGHA 1T9ZA 4Z2WA 2YNMC 3EIUA 2OT5A 4N5LA 4FIPC 2Y69C 4HLUA 1T2EA 3I55V 1NNSA 3KELA 5J2UA 4DC1A 2COKA 1LEHA 2V4DA 1NFQA 3FKSD 5BWOA 1Q8IA 2FY8A 1RC1A 3MXOA 1QIDA 3RNOA 3RS4A 5M3BA 3D6NB 4PAQA 4YROA 1T9CA 1E7KA 4JGIA 5EIAA 3JQEA 1PLLA 1OGYA 3I4CA 3UC9A 3GN2A 2GASA 4KQHA 5COQA 1CR4A 4KOAA 3UTDA 4BFZA 4QPZA 5HW0A 4P4SA 1K3UB 4MGEA