4O2AB

Tubulin-bal27862 complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
418
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 418
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2aB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2aB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2aB01
1TVKA 5IJ0A 5J2UA 5EZYA 4E6EA 5MN4A 4ZOLA 4EB6B 3RYCA 5CB4B 3RYIA 2RHLA 3RYFA 4FFBA 3WGLA 1TUBA 4B46A 5MN5A 1Z5WA 2BTQA 4WBNB 2BTQB 4WBNA 4ZI7A 4ZI7B 3RYCB 3VOAA 3HKCB 3JASB 5LYJB 5CA0B 4X1KB 4I50A 2VAWA 5CB4A 4TV9B 4XCQA 2RHJA 5IJ9A 5ITZA 2Q1XA 4LNUA 4EI7A 5JCOC 1TVKB 5IJ0B 4B45A 5MN6A 3WGJA 5BMVB 5LA6B 4F6RB 3UT5A 3C8LA 4TV9A 4KWEA 4O2AB 4I50B 5JVDA 3N2GA 2GVIA 5CA0A 4O2BB 5EYPB 3RYIB 4M8IA 4X20B 5KMGA 1W5FA 3N2GB 4O4JA 3M89A 4DRXA 4FFBB 3RYFB 4IIJB 5JH7A 4I4TB 4F6RA 2RHOA 2BTOA 3JALA 1W5BA 3JAKA 3JAKB 4IHJB 1FFXB 3E22A 4U3JB 3RYHA 4I4TA 5LXTA 3N2KB 1RQ7A 3HKEA 4I55B 3JAWA 4O4IB 4YJ3A 5LP6A 4O4LB 3R4VA 1JFFA 3JASA 5GONB 5GONA 5LOVA 3VO9A 5JVDB 1SA0B 4O4LA 5JQGA 3JATA 5KX5B 3WGNA 3JAWB 4O4IA 4ZHQA 5J2TA 4TUYA 5BMVA 4ZOLB 4EB6A 1JFFB 4IHJA 1RQ2A 5LP6B 4YJ2B 4YJ2A 1Z5VA 5IYZA 4O4HA 2VAMA 4O4HB 4IIJA 5EIBD 4U3JA 5M7EA 3E22B 4ZHQB 5J2TB 4X1KA 3HKDA 2R751 3VPAA 5KMGB 1W5AA 1W59A 4X1IB 4X20A 5LP6C 5FNVB 4DRXB 5JQGB 5EIBC 2VXYA 4YJ3B 5LOVB 1FSZA 5FNVA 5LA6A 4X1YA 5C8YB 1OFUA 2Q1YA 5IYZB 5J2UB 3RYHB 4O2AA 1FFXA 3V3TA 3HKBB 2VAPA 4LNUB 3ZBPA 3CB2A 3UT5B 5LXTB 5IJ9B 5CA1B 3JARB 4TV8A 5CA1A 3WGKA 4HNAA 3WGMA 3RB8A 3JALB 4O4JB 3HKCA 3VOBA 5JH7B 4EI8A 3ZIDA 4X1YB 5C8YA 4TUYB 4O2BA 1RLUA 1W581 3JATB 5KX5A 3M8KA 5LYJA 1SA0A 5JCOA 3ZBQA 3VO8A 4EI9A 3HKEB 3N2KA 5EYPA 4U39A 5EZYB 4X1IA 4DXDA 1TUBB 4HNAB 2XKBA 3HKDB 3JARA 4TV8B 4I55A 2R6R1 2XKAA 1W5EA 5ITZB 3HKBA 2RHHA
chains in the Genus database with same CATH superfamily
2XQJA 3BSWA 4KNWA 4L4SA 1F06A 4BO7A 1DEKA 4CJXA 3I42A 3IP9A 5CGZA 2GASA 1XSEA 1EU1A 1PWHA 1Z39A 4MEAA 2BSAA 2DQYA 3ROZA 5A6SA 1A4IA 5DHRA 4X66B 1XNQB 3DJFA 4HUJA 5HZGA 2OV1A 1PTJC 4DV6O 3OT7A 3UJBA 3MUEA 1RQPA 4FM1A 4PDVA 2IHBA 2QT1A 4HSEA 2W2LA 4UMDA 5T4EA 3ISJA 4CEHB 2HCRA 1WW8A 2E4ZA 2Z9CA 1WB4A 3LTEA 1X39A 2BGKA 3OTHA 3ND9A 2OZLB 3VU8A 4TV9B 4EQZA 1DBQA 1KQOA 3IEUA 4FGKA 4M1SA 4PCAA 2GXQA 4G5YA 1YZGA 1Q7TA 2V9ZA 3GJ8A 5FWXA 5TQ0B 2V7VA 4D3SA 1K5GA 1XWIA 2BKLA 4YV0A 5KIAA 5IM4A 2ZIMA 4B0OA 2BHRA 4G6ZA 3ADCA 1Z7BA 1I2DA 2G88A 2QS9A 4BB5A 1ZY2A 5G0VA 5BSEA 5JOQA 4C6TB 1HEUA 5CA0A 3ETHA 3GVPA 3EMVA 4GT1A 4O1MA 5K3FA 2W11A 4I99A 1VP9A 3H8SA 3CNHA 4KKXB 4RPGA 5CAEB 1VL5A 3DVQX 1KI3A 1U2GC 4AG5A 4MUIA 1X1SA 3DV2A 5SZIA 2QEQA 3WQSB 3DMTC 1RM4A 4GQBA 3TOVA 1Z8NA 4MVCA 4A10A 2XWPA 2ZK7A 3RC7A 4AN1A 3J81k 2XOXA 1WB9A 2XGOA 1PFUA 3CCJV 2COUA 2Q4OA 1LI5A 3JZIA 3NHFA 4R8SA 1YCFA 4OA8A 2HN9A 1UK8A 3C6KA 1JHDA 1OH8A 3RUCA 2FN4A 3HI4A 1KI6B 2PRJA 2VA8A 3CRNA 3K32A 3T5TA 2QSZA 2O2XA 5G4VC 3WKCA 1ORWA 3TTVA 1SKMA 4BAUA 1QHIA 1BQ0A 2BJHA 2KX7A 4MH0R 1KJNA 3WJAA 5D5QA 5JAHA 4KDCA 3DTVD 4O4LA 1GH6A 3I72A 3A3NA 4ZZ3A 3H9QA 3IV7A 1TUEA 3K0DA 5DHFA 3A1EA 3IVGA 4WRRA 3DD1A 1E7SA 5BXZA 3GW8A 5AI4A 2M6SA 5B4TA 5L7TA 5CMUA 5MGBA 4AKHA 2XNJA 1E7MA 1QHHB 2LE0A 3DAGA 1NBMD 3H6KA 3G2OA 3HP1A 4LPKA 5AVTA 3M6XA 3RVYA 1L5RA 1T91A 1SUAA 2NZVG 2YJZA 1GDDA 4CG2A 4EHHA 4RPJA 4UBOA 2VEOA 2I55A 3CX7A 4LEIA 2HHLA 4UNQA 2IYSA 1B6TA 4V0OA 3CPWU 4WH0A 4JI6B 1YWGO 2PTMA 4MQLA 3O1LA 3A0RB 5F7OA 2FWRA 3L8YA 4LSMA 4MPRA 1XN1A 4RDHA 2F8SA 3K9LA 5KQPA 1V5GA 1C0IA 4MHTA 3X1MA 1KFJB 3P9IA 4BT3A 4UD6A 3H8VA 3K70B 4LXTA 1XYGA 1FTGA 4H60A 2NYVA 1SKUA 3BMOB 3II6X 1TIBA 4QULA 5E2BA 5JS7A 4LOIA 1LVUA 3DB1A 4BCCA 1L7AA 3PXBA 4IYHA 2Z04A 3EVCA 1HNXO 5F3RA 2GRAA 2AZXA 3CBQA 1YZNA 4KP4A 1H7MA 4IL6Z 4OQLA 5AK0A 3WDMA 4ZZ2A 5JH7B 1M1YE 4ZEOA 3QKWA 3TLGB 4BNDA 1P5JA 2QOEA 5EI5A 3L7BA 2Q4DA 4RQFA 2OZBA 2JFXA 3NIFB 3R7FA 4GMGA 4AQDA 1E79D 4G9GA 2PS1A 1ISRA 3DWIA 4X54A 2QBYB 1ZTEA 4AY6A 4R2XA 4AY5A 1XTSA 1VDMA 3QNEA 3N8DA 1DUSA 1JHUA 1JLLB 4LH7A 4PSVA 4BFLA 3C3TA 1AKQA 4D2IA 4N9QA 3DTTA 4PLVA 3RS3A 4C21A 1W5EA 1SUFA 2QMUA 3NHYA 3NOOA 4G4YA 1YGPA 4MWSA 4PC7A 1VQOV 3FPBA 2UYHA 1KD1W 2VHEA 1C0PA 1YR1A 2QQEA 3L0PA 1ESZA 1H42A 5EN4A 3CCLV 1H23A 1XAGA 1NW9B 2DBZA 4D7TA 2AI2A 2P3QA 2RC6A 3DTVB 3N75A 3O2QB 2ZJ0A 1Y48E 1STOA 2P41A 1COMA 3VZDA 4E09A 4QYSA 2H4FA 4DQKA 3GRVA 3MJFA 1QCEA 1QDLB 1R6BX 2IV2X 3DM5A 1NMUB 2P6NA 4RPLA 1KQSF 5LYJB 1O4WA 4IXMA 1HEYA 1UC8A 3ZI4A 1M34B 4RPKA 1JEJA 3RVQA 3WRYC 5CURA 4H7KA 5I7EA 4D4LA 3UMVA 2V65A 1OPRA 3W7BA 3MUNA 2C4VA 1KDZA 3RF7A 4NOLA 1BTOA 3A9TA 3AK1A 3FOAA 2QV0A 4M1YA 4XBFA 5ALHA 4QUEA 5AO9A 4DJ5X 4BVAA 4OGFA 1L3CA 2VSQA 1SVMA 1Y6JA 3KUUA 1KAOA 3S27A 2ZI4A 4TKMA 1XPOA 3FJOA 4OJMX 3VC2A 2XI4A 4Z3KA 1E1CB 3GYBA 3PKZA 4C7BA 1FJXA 2VDWA 4TTSA 5FR2A 4MW3A 5HP4A 1BSMA 3R0IA 4UXIA 4PDRA 4MGYR 1AI4A 2J9ZB 4Z2AA 4DRXA 2FUG1 3CB4A 3KQLA 1OZGA 3MHPA 2RD2A 1YJWV 1AUPA 2OE2A 1N6NA 3L4SO 5KYYA 3KTFA 2RHMA 2WINI 3Q8XB 4HR7A 2PUCA 4L7QA 3A6EA 4Y9TA 5KNLA 1BMFG 2KS6A 4L78A 1VZ2A 5B3SC 2FOLA 1T2FA 3DFZA 1A0OA 4RQUA 1MPTA 4WF9V 5F12A 4BO4A 2O7VA 4WBSA 1EBFA 1ZD8A 4YFYA 1TOAA 3IELA 5E2AA 5I3CA 4CMEA 4WCFA 1KERA 5DK6A 1N9ZA 5E4FA 2QUIA 2QGFA 3D2AA 1KMIZ 4WKNA 4B09A 1ZX1A 2J59A 3DTVA 3K9HA 1UINA 4B3RB 2ZCVA 3C6QA 1FXSA 5J9FA 1Q5PA 1M2WA 4C76A 1KH2A 2VCYA 1RAAA 5B58T 3SLKA 4EMTA 4X8AA 1H1TA 3C41J 3NV9A 4WKBA 3UK1A 5LA6F 1ZNQO 1AKYA 4NMHA 5AESA 4NR0A 3MT8A 5AW5A 3TIGA 1LF0A 3ON5A 4BFCA 4FLMA 3H2BA 1M2FA 3RW0A 2ZRNA 4LXXA 4EG4A 2H2FA 4UBLA 3U9SA 2B9ZA 2PM8A 4QUHA 3RG2A 2VATA 3K3PA 3OIDA 4LDQA 1NVGA 1UWVA 3RKSA 2QZ9A 3WA7A 4Y3UA 3AEQA 3RRBA 1T8WA 2B1GA 2ARKA 1U9JA 2PKXA 4I0WB 2AUMA 5D87A 3WFJA 1H6CA 4UVCA 4KOAA 5TF0A 2G4CA 2R9AA 1MF7A 3U56A 3CH6A 1H6BA 3SIVA 4HQOA 4R68A 5ALWA 3MGBA 4QPPA 5T3YA 2YRWA 3OC6A 3EDRA 4N6OA 3O84A 1G8FA 3STYA 3ABOB 1E0DA 5KQGA 4U9HS 2R1VB 4Z1VA 3HBMA 4JELA 4LX0A 5CDHA 1FPQA 2ONYA 4CEIA 1KRWA 1JDUA 5FTKA 3R74A 1KK0A 1QF6A 4BNHA 1VIDA 3WSWA 4MAMA 3KEQA 3SKYA 2NXEA 1HX7A 1FBNA 4PGHA 4RENA 1KSFX 2HF9A 4L9AA 3WBBA 1W1WA 3CMAV 1ZEJA 3KQWA 5IY5B 3TKLA 4OYYA 2YYSA 3RFCA 4ZKIA 2MDTA 4A2CA 4N5NA 3FNBA 2HMUA 5C34B 2H2GA 2Q9CA 1KAGA 4ZJPA 3DLTA 2R4TA 2JFZA 1R15A 1FXKB 1CC1S 3RCBA 1TC2A 1QYIA 2PV0A 2QUAA 4MKXA 2GO7A 4MR9B 4DCVA 1RXWA 5JDIA 3SYLA 2RGGA 4GAEA 1PR6A 4MWCA 1NBAA 5AXBA 1KVQA 3C3SA 3ECCA 3R9XB 3DZ8A 3GFOA 1DMSA 5EC1C 1O1YA 4LDJA 1BVRA 1P1KA 2WU8A 3PUVA 3SYRA 3QLEA 1DAFA 1RRGA 4LR3A 1K73W 2AC7A 2FKNA 5TMEA 3WZLA 2UU9O 1U1IA 2Y68A 1J00A 4ZI7B 2W6OA 3SX0A 4CNQA 3E23A 1AE1A 1W29A 3NTQA 4ENVA 1NJ1A 2O8DB 5D3MA 4OHOA 4WNYA 1JJFA 1ECFA 1IUOA 2OYSA 4EYGA 4BMPB 4YROA 3VV2A 1GD1O 4PX2A 2GAIA 4D0RA 2AJLI 1RI5A 2ZJ7A 1SZPA 4PA3A 2JC3A 3ZEDA 1YI2V 1FDOA 3L3BA 3PGKA 13PKA 4IVQA 2LKCA 2QP9X 3D6TB 5ALGA 4NJMA 1YHNA 1WNSA 1L5MA 1Q3HA 1A7KA 3TZ6A 5HXUA 2P2ZA 3GBPA 5A9GA 1P19A 1M57B 2YJ6A 3MWGA 1K7EB 2J32A 3JQEA 3PFBA 5FOUA 5I6DA 3E3OA 5BPFA 2JAQA 1ADGA 4ZVTA 2AOXA 1V4BA 4J3NA 2AIFA 3KYDA 3DF7A 3TBFA 1RA4A 5A0VA 4QSMA 1EJ6A 3M2PA 5I5GA 2PLNA 3CNQS 1EZ1A 4H3HB 1ADFA 2KKWA 1KY3A 1EAMA 2F43A 4WI1A 3AG3B 2NO5A 1T0BA 4WQMA 1VBMA 3B12A 3HEBA 1NMZA 1GG2A 3AJDA 4DOMA 1UPFA 4YJ3A 1OBFO 3D7RA 5EXSA 4O4LB 2ZWIA 1P2GA 5FBZA 4ANFA 2QRZA 3TTUA 2CZWA 1U97A 1AKUA 1IZYA 1Q1QA 1SC3A 2A0KA 3RTCA 4ZZ0A 2R8BA 1PL8A 3M3PA 4DPKA 1NMYA 4FFNA 3RLFA 3T2MA 1ZOIA 2L18A 3GFTA 3Q2IA 4LY3A 4DQVA 3E3NA 5LDDC 5H68A 1I3KA 1CJKC 3KZVA 3M33A 4K6OA 1YCDA 3AG4B 4K0KB 4F9GA 1OREA 2VDVE 2WUGA 1QUFA 3SR0A 2FWIA 4G81A 4HGZA 4AF6A 2NYAA 1KA9H 3F9IA 1YE3A 4YP5A 1ZJWA 1OE0A 3SDZA 1EWRA 4PNPA 1LBHA 1CS0A 4Y2YA 3OUSA 1TGYA 2R751 1B4DA 2CSXA 4X1IB 4JBIA 4OPHA 2NU7B 3U11A 4QL3A 3QOFA 2Z30A 3H2JA 1IQ0A 2H5LA 3COSA 3GGPA 4A5SA 4UHEA 2ZOVA 1DOZA 2PGXA 3CEAA 1WXEA 3OKCA 2VUHB 4AMYA 1PP4A 1GTMA 3WQHA 2B8TA 4GE3A 4ZYZA 2DWDC 3F3SA 5ALVA 3KT6A 4UV9A 2DYSC 4DK0A 1AKVA 1ATZA 1W8IA 3FOBA 3MCAA 1QBKC 3BWCA 3HBNA 4I08A 1P1BA 1VF5B 4RDXA 3H1IH 4PTZA 3G2QA 2AXTZ 3LUCA 2OT5A 4FXOA 1E4VA 2JAOA 4X9XA 2ATEA 2B4TO 1ZL0A 2VK2A 2OQVA 4D81A 5WRFA 1JE1A 4YTEA 2Z58A 3D4IA 4H7FA 4MVWA 3P30A 2BELA 4HWGA 5CLIA 4YRJA 3I55V 4YXWD 3IAXA 4QSHA 1VB5A 5F2EA 3PFCA 2WLIA 3KTAA 1JKIA 4W7IA 1QYRA 4DIKA 2WM9B 5SZJA 4V38A 5SZKB 3Q8KA 4L4ZA 4U9UA 1D5CA 3SE0A 4Y2XA 1NU8A 1KMHB 5TQVA 3MG9A 4AO7A 4DTIA 4MV5A 5EMHA 3F47A 1YTFB 2BBWA 1VJ1A 3DOIA 4MJ7A 2ZB8A 1G8SA 3OCUA 4ABYA 3T9FA 3C8UA 3GQVA 2HMTA 2J45A 1V6AA 2ZJ5A 1COZA 1Z5GA 1YRBA 3KXLA 2Y0PA 2PUTA 4H7IA 4G5XA 4JUCA 4TTJA 3RRXA 1RRFA 4E6EA 1V71A 2I6QA 3PAFA 1SBTA 3NVAA 2AGVA 3ZCUA 1AS2A 3RYIA 2DPLA 1BMFA 2FSVA 2XUDA 3L70H 4C5AA 5IVDA 4JUIA 4DLVA 1RPZA 2O54A 2UUAB 2Y6UA 2OIGA 4XDHA 4FNAA 3B6ZA 2C2GA 3V8EA 5EE9A 4JIGA 3JASB 3WL4A 3ZV4A 3T1HB 5DX1A 1HYQA 3LDTA 3TL2A 3LQ4A 4AJLA 3ZCVA 3ER9A 4QZVA 1BXKA 5CDYA 3H1BA 1G8PA 1ZAKA 3AUAA 4EI7A 1TECE 4G5SA 3LF1A 5CT9A 2BM9A 2UZ3A 3M2TA 3TIIA 3U9LA 3ZPXA 2KE5A 1RR6A 2QMYA 3GRKA 3LQRA 1SRQA 3FVWA 1X1CA 2B20A 2ODAA 3BK7A 1DWOA 4G1BA 4RF3A 3QEMA 4KMRA 4S1TA 3QXCA 5CB6A 2XUJA 4YAOA 1LU9A 3GIWA 2IE8A 2ZQZA 5IKXA 1GKIA 4RO0A 4W9MC 1T2NA 1RKBA 2ZG6A 4FX5A 5FD8A 2HR3A 2FF5A 2QI9F 1DTWB 1RE1A 1O94C 2ZB4A 2IGTA 3Q7SA 4LJ4A 4B7XA 2O59A 1OAKA 5LBIA 2QG6A 3OZCA 1C8LA 1W5BA 2ZF8A 1E9CA 1N5KA 1ZU4A 2ZBVA 4GYJA 3UJ8A 4B3FX 1USVA 1IQRA 4DCNA 4GICA 1MIOA 1N6OA 2PS0A 2EJCA 4EJ2A 2FQQA 3PHCA 3OY7A 4EEQA 3EXEB 4QICA 1XVLA 2DN9A 2RGEA 4C78A 4RD3A 1U2TA 3LWZA 1NTMH 3TSCA 1W6RA 4AP6A 2IX9A 1A9QA 3T0FA 5FI3A 4RAIA 3JSAA 3K5IA 3L7MA 1D6MA 5K4HA 2PI5A 3DC5A 4IDHA 3TTXA 1UR5A 1KFBB 3HL0A 1JMYA 4BFSA 3ZVKA 2V7QD 5ILQA 3RVZA 1M5RA 3QQ5A 2WYWA 1WB6A 4HNHA 4HS4A 4PSCA 4MQ4A 3U62A 5CBFA 2IITA 2IS2A 3EYWA 3KOWA 2QJRA 2JH9A 1PJ3A 4MGZR 2PKWA 3SEAA 3BGIA 5JSKA 4O4HB 1EDBA 3JXEA 4R4JA 3P2JA 4EHFA 2C9CA 2YW9A 3A4VA 3B85A 5ESRA 4OPMA 4J11A 3NHBA 3EWSA 1F5NA 5FOQA 2O8EA 1E5DA 2YHIB 4XTCS 1CUEA 2R00C 3DZDA 4C3OB 2FNAA 1SPXA 3FM9A 1MNAA 5DV9A 2AWNA 2IE0A 1IV1A 2QEXV 1S96A 3KKPA 3MMNA 4X1YA 3V7FA 1NQTA 5H5JA 4A9AA 2IPOA 4HADA 4CMKA 3IFXA 1Q3TA 3Q3VA 2WM2A 1GA6A 2JFPA 1YQDA 2R1VA 4C7VA 3T9AA 3WWPA 1YQUA 1PUXA 4AZ3B 4KE9A 2AN5A 1DHTA 4NBUA 4FBLA 3PCTA 4N0QA 4D8WA 1PZXA 4F2DA 4R6XA 3TJZA 1B15A 1Q2UA 1E5VA 1X15A 1OXBB 2E5FA 4IH4A 1QZ3A 3VR6A 2ZU6A 3JQCA 1Z4QA 5IDJA 1PJRA 4HUQA 4UASA 3RE3A 1EQ2A 4HB2A 4QYIB 1DEAA 2PBLA 3RC9A 2ZS8A 3EXHC 1GPNA 3BCRA 3K09A 4V3BA 1PBNA 1NUHA 2BI4A 2NN3C 2XWQA 3ESZA 1FFHA 1GGKA 2R65A 1MENA 2DTDA 3A27A 3I12A 3E9CA 3PEVA 3WLKX 1TYEB 2ZDIC 5IM4F 2YUTA 3CISA 3SS9X 4B4WA 4ESHA 4XAQA 3U31A 1I3MA 2Z56A 1XYVA 1VF6A 3CUSA 3L6EA 3RG8A 1N33B 1DQYA 3ETJA 4BCBA 1HE3A 3BIFA 4A16A 4D4GA 5KWEA 3LDUA 3EDOA 2F9MA 7ABPA 1P7WA 4INPA 4X8MA 5A04A 1H2YA 2E4VA 1ZD1A 3A1WA 3EQZA 3IJ5A 4L76A 4LSWA 1GPDG 1BMFD 2CK3G 1M8GA 3ND7A 3WFVA 3TLEA 4K86A 5BWNA 4QATA 1I5OA 4LF5B 3ILVA 4U6NA 2YWHA 3I6YA 4TL6A 2G1KA 4C81A 4MI9A 4WESB 4XPZA 4PGFA 4ZPXA 3D81A 4BLOA 1VHAA 3EC1A 2AG1A 3DDHA 3HFSA 1ZISA 2HBRA 3KQVA 4BNMA 4WVFA 5IF3A 3C90A 2G9RA 2YNMD 3RJZA 2HJHA 3FRHA 1KETA 1J09A 2BEKA 2FC3A 5KHJA 2BEJA 3ABUA 1SK9A 4JSTA 2GVDC 4BASA 4YAKA 1K4KA 1F48A 4CKZA 2X5JO 3DO8A 2LZ0A 5B1AC 5FLKA 4F6RA 2ZU0C 1DG1G 3HLKA 2WD9A 4Q6WA 1JRLA 1Q0SA 4TRRA 5E6SB 2YEVB 1UBSB 3CCEF 2PQ6A 2X5OA 5ALYA 4MV7A 4WGGA 2LP4Y 5CNMA 1KS2A 1JVMA 3SPJA 1DBVO 3O31A 4JT8A 1NRIA 1NR7A 1C4XA 3HJWC 1XCLA 1A8PA 1CY7A 1T8YA 3K15A 4XJXA 5EHGA 4EH1A 5L3QB 1NMQA 3QI7A 2W6PA 2MSCB 2FN9A 3ZP7A 3H01A 4NHOA 1PKXA 1VE7A 4PF1A 4Q15A 4TMVA 4AVYA 4F4CA 4RF2A 1U2QA 2NU9B 1KOFA 1MEJA 2NSLA 2WJIA 1G18A 1JW9B 3TR5A 3KT8A 4OXYA 4L16A 4Y30A 3E3MA 2VHXA 1LSSA 4RK6A 3OBYA 1Z2GA 4AI6A 3TE6A 3WLOA 1NBEA 4R2JA 4UC0A 1X1TA 5DX8A 3TQHA 2OBNA 1PM9A 1UJ5A 2HA7A 4B4VA 2A3RA 1R00A 1RPNA 1ZGJA 4OP1A 1WOYA 2YIAA 4KQFA 3FFTA 2QT0A 1XFAA 2OVFA 5FADA 3JAMN 4KI7A 3I5XA 1TLFA 3PIDA 4WGFA 4X64B 3JQBA 4DB4A 1MW8X 4JI2O 1QNMA 4ZQEA 2DYKA 2HNBA 2H1WA 2NTVA 5FBLB 4Y6RA 5KTNA 1XHEA 1UXJA 1P0CA 4QJ5A 3BXZA 1VQ1A 2N42A 2F3SA 3CUYA 5HW0A 1Y42X 4CM8A 1VQ6F 1G19A 2NSHA 2YDXA 2HCBA 5AKYA 4BNDB 2QYTA 4GBED 1WZEA 3X1KA 2BFDA 1PNMA 2WUEA 2YWDA 3L8ZA 1U8ZA 3E8SA 3K2IA 2R0QC 3C3AA 3O38A 3F6PA 4LXGA 4ZVVA 2UUOA 3I5MA 3UNXA 3JD1A 4EY8A 2WWRA 3DOJA 4BMZA 2FZEA 2J4CA 4IHQA 4LQLA 1RI3A 3H1HH 3RB8A 3T4PA 3L1KA 4BAYA 4J7KA 3VDRA 4K8OA 4BT6A 4O0MA 2ZLBA 4KFUA 4L2IA 4ZN6A 5JS6A 1I0HA 3IMPA 4B3JA 2J9XB 3VPBA 1S2MA 2J6BA 3PFGA 3AVPA 3UQYS 1DHRA 3RBVA 3LNNA 3ROKA 4J9UE 1RXUA 4JL6A 1U3LA 3ICVA 1A71A 1BE8A 2C5EA 4M87A 4KE6A 4M60A 3AHFA 3A1SA 3CXRA 4KUGA 3REQA 3L4BA 3L18A 3NJRA 2Q5CA 1NPYA 2R8EA 2RHHA 2BCGY 2VJYA 3CF4A 3FPLA 4K9KA 1CNFA 4M1TA 2UUAO 3GVCA 3OHSX 2CDCA 4LMAA 1P5HA 4PO1A 2CHQA 1B42A 5DNAA 5FBKA 5AXDA 2ZUFA 3NNSA 2AL7A 3OP4A 3VVBA 1E62A 4JI1B 1IJBA 1BXRA 3D0KA 4XLLA 2ZRDA 4IWYA 5BVGA 2ZR7A 3E1KA 4BDSA 1VPWA 4AS1A 2NADA 2IU3A 1M34E 2AB0A 2YJNA 4C82A 1S2IA 2PRIA 4UATA 3D3NA 2IH1C 4LFCB 2BZGA 2I4LA 4UU8A 5H80A 1RWPA 3TCKA 2KTVA 2NZJA 3ZZ1A 5ILOA 4D4IA 1BEZA 1MV5A 2VRWA 3BDIA 1Z4KA 3THOA 1MJ5A 3JQGA 4N40A 4UQLA 3GLGA 1QH8A 1N9GB 3L79A 2ZYSA 3EDCA 3R7WA 4S35A 3KVVA 4KCGA 3K1ZA 5IC5A 2CTQA 4NOMA 1BW9A 1MGOA 2HFKA 2XNDA 5GM2A 2VP5A 1Z7GA 2QM8A 2LWIA 2GHTA 4RAQA 1RQLA 1AG9A 4QUGA 5DTQA 1Z5PA 5EJ5A 1HDIA 2AG6A 2GNOA 4DREA 1EP2B 2PYJA 1UFKA 3AXTA 3CO0S 4KWIA 2VHYA 1R4MA 2RARA 3QNUA 3RGWS 1G3QA 5SY9A 3H2SA 3H9EO 5C3MA 4ZK6A 1NW6A 1RXVA 4NBLA 1H5NA 1E1LA 2J0UB 1ZMOA 2DT5A 3DFKA 1J39A 3L0OA 1IVYA 1ICIA 1XCMA 1LI7A 2QMZA 2XNSA 3B9QA 1N0UA 2OK7A 3BN3A 3CG0A 1X6VA 3I52A 2UDPA 3GDGA 3O95A 2HRUA 2HF7A 3BJMA 2RHTA 2BCJQ 4Q3DA 3T7AA 4GR9A 5GOZA 4B7CA 1MVNA 1IOWA 2DJIA 1GO2A 1PNKA 2VHCA 3CCCA 4G28B 4F86A 1M6NA 4CEHA 1E1RD 3KQPA 1I3OA 4RPIA 3QTYA 1JPJA 4TMXA 3CCVV 3EBLA 1SAYA 2LKDA 5LFAA 3UJNA 1RJFA 2FSGA 3PXXA 4M4SA 2BI7A 2E4YA 1XR3A 1RJ9B 1GYPA 1DQSA 3HR7A 4AICA 5HIAA 1TQ2A 2FZWA 2V6BA 3GGSA 1E2DA 3M7IA 4QM6A 2XAFA 1V7ZA 4FE7A 4BLRA 3QLUC 4FEEA 4NIMA 1XAJA 4EMUA 5BT8A 1NBIA 2D1SA 1M2OB 5DW3A 1CQZA 2IXGA 3C70A 1JHRA 1XU7A 4W4KA 3HB3B 2OL4A 2OHWA 2WWXA 2Y2UA 3H2KA 4GXTA 4O33A 4YYEA 1W0JA 1FEZA 1JKXA 2X8BA 3HCOA 3MWFA 4I5EA 1FXVA 1FYDA 3F5SA 4IJ5A 1R6VA 1QQBA 5HNKA 2IKQA 2XF2A 4DR5B 1C4WA 2C3MA 1QH1B 3H13A 5E7QA 1T43A 1O5TA 2V7WA 2Y9MB 1LK0A 3ANLA 1NMSA 3CLVA 5L3SB 4YRMA 3EODA 4LFAB 1AI5A 3HDGA 3GLIE 2PBFA 5DTIA 2P3SA 3MVEA 1MBZA 2CHSA 1V48A 2FR8A 3EORA 1Z4MA 2R6DA 1FRVA 2Z09A 3K12A 2XT6A 3OIVA 3TG2A 4CZZA 5ENVA 2GX6A 1M2VA 3I6ZA 4FSDA 2ZODA 1V1MB 1X8LA 5DXJA 4YV2A 4P34A 4E5NA 2VF8A 2W5UA 3M5DA 3ZNNA 3ON1A 2XXBA 3STZC 2BCCH 4K3VA 2REQA 2VYVA 3KIPA 1E6UA 3KT0A 4B31A 1NXWA 5EMNA 1B74A 2UZ4A 1MB4A 4BNIA 3LGSA 2YXNA 1INLA 5E95A 3C3KA 3O1JC 4XVQA 5EJIA 3Q0TA 1R9GA 5F1YA 5CEJA 3H1PA 5TF4A 5JNUA 3JQGB 5K3EA 3ILHA 1QD9A 2HK9A 3DCJA 4AWAA 4R8VA 2OFPA 1CQWA 4X7BA 4R1SA 3R76A 3AOGA 5FQNA 4GYCB 4N54A 2FFAA 3C2QA 2DFLA 4CS4A 4NCHA 5TEVA 4C03A 1RJ9A 1CVIA 2PTHA 1EZJA 3R5SA 3VPFA 4EY3A 5ICCA 5KVAA 1SVKA 3SC4A 4OHZA 4BNLA 2FKAA 4WZAE 2ZCJA 5CCBA 5BO5A 1BCRA 3JCUZ 1E2IA 4IGGA 2A88A 3KKKA 5LU8A 4JI7B 1FUYB 3D1VA 2JPDA 4I7ZB 1URPA 1H8HA 2CDBA 4W9RA 1MKYA 1I6WA 4MVUA 1NQ5A 1Y4SA 4TWAA 3RHSA 4BZQA 3PEWA 2WWYA 4KRXA 4JYZA 1AZSC 5F5LA 3GLKA 1UPGA 2PSJA 1JSXA 3E1YA 2VDRB 2RBKA 4BZWA 3ABMB 3LRTA 3LQ1A 3R77A 4RTPA 4JITA 4LI0A 3GUZA 1NMEA 2FFHA 5FL7A 2GPTA 1KYWA 1R0YA 4IX9A 3BOSA 4ND3A 2J5BA 1XVUA 4CQLA 2PJUA 2IEAA 4LTDA 2PUHA 2N75A 3DLCA 4OHRA 1XZDA 4QJFB 2IDKA 2ODQA 3QF4A 2FRDA 1VSTA 1L0NH 1IBMO 2PKEA 4RLQA 2FFJA 1H0HA 3DZBA 5BWMA 3FR7A 3OZDA 1Y9JA 4KO4S 5CM8B 5MGNA 3DD5A 2AFIB 3GNQA 2JGEA 1DXYA 2C2KA 3AB3A 4XM0A 5E1MA 3NU1A 4BPBA 4NU6A 2UYNB 2PXXA 4JLWA 4O4IB 2C2ZA 4DV4O 2GHRA 3SX2A 3TDKA 1ILEA 1GTJ1 3ND5A 4PG6A 1V26A 5A4JA 1RYYA 4MVOA 3WG9A 3CLTD 3CCQF 4CZ2A 1Z15A 1VGRA 4G2TA 2C2AA 1CZRA 1A8UA 1QR6A 2BBTA 2CMDA 2B4AA 1J42A 1FU7A 2G5GX 2GKGA 1PQYA 4L4RA 5A71A 4E3WA 3AR7A 1QJ4A 2BGNA 2CHEA 1NUSA 2WWVD 4R7GA 2APJA 4LDAA 3SYTA 4OAOA 2VVTA 2D2XA 2NVUB 3AG6A 1KPGA 3OUFA 3O6VA 5IN5A 3E8BA 3GPCA 4DUYB 4PSAA 4C6TA 4DV3B 5DHAA 4CBCA 1YRLA 4RF5A 1C9DB 5I4IA 3OR6C 3M6FA 3I9FA 2VPYA 3O4FA 4KQ1A 4PBTA 4RK4A 5CFOA 4C08A 5A9SA 4AY4A 1T6NA 2C0CA 1NM5C 4XSHA 2CKMA 4XD7A 3ZWWA 5AVOA 2OIEA 5B8FA 1JYEA 4QOSA 2KLHA 5LOVB 4Z4FA 1YS1X 2BGRA 1P4JA 4M46A 4BQPA 3KZ1E 2KG7B 4CV3A 1QCYA 2I3AA 2P68A 3BUSA 3I0NA 4OP2A 2OWDA 2CFOA 1L5GB 4Y2PA 1U43A 3I3FA 4Y9RA 2WSSG 4H16A 3FTCA 3TL6A 3K0GA 3CJHB 1R5NA 1NQXA 3FCXA 5HM6A 1REQA 1DTEA 1XD2B 4PD4F 2BGMA 1QLWA 3LWVC 1VPDA 5E6UB 4RJJA 1AGYA 2Z43A 1L5WA 4IKOA 3A4NA 5ERGB 1Z22A 5DLEA 5HF5A 5UKDA 4HNVA 3SYKA 4K9SA 1W73A 1XNJA 3GUHA 4LHEA 3WMGA 1SO8A 3TKYA 1KTIA 2IHUA 1LBQA 4L0CA 3WJ1A 1EDEA 2EFHB 4TQ9A 2E75B 4ZVMA 4CTNA 1L4NA 2FUEA 3CCLF 3W4IA 1FFYA 3NTUA 2Y1OA 4QOIA 1KIAA 2B98A 2C88A 3ZWXA 1DCKA 1AHHA 4LC0A 5D51S 4ZEMA 3REQB 1D5NA 2GF2A 3MRXA 3HAXD 4NQRA 4WPGA 2QGZA 3COVA 1BCCH 3TJTA 4FFOA 4HMOA 1O94D 3LT2A 4ODIA 4QQRA 5HUJA 1OTXA 4KSCA 4QPDA 3ZVMA 1WOMA 2IQ5A 1I4WA 4NWOB 5KVQA 2AHYA 4PHTA 4QOFA 4BWYA 2P75A 2AWOA 1KSJA 3HDYA 1G3IA 4QPJC 3UANA 4KFMA 4BMCA 4ZGBA 5B6IA 1V47A 5L53A 1KI4A 2DSTA 2PYDA 1DV1A 3FDZB 3PJFA 4D98A 1CR2A 3HB9A 4K9PA 4N23A 3ZN2A 4KU4A 3GMIA 5I4BA 4ZMSA 3D8UA 3BJIC 3G2LA 4CV1A 1PVDA 2HREA 4GC9A 4B8ZA 1MG5A 4ZIBA 3DULA 2FF7A 5EGNA 4B8YA 4JYCA 2R5NA 5TX7A 2I9KA 3ML1A 3HO6A 1P3JA 4JAAA 5A9RA 3AOEA 2CDNA 5JXIA 3K3WA 1OWMA 1SZDA 2AOTA 4JI1O 2XTNA 3CGWA 2WBLC 4YCSA 2IV3A 3ETQA 4NXMO 3BE6A 2GN1A 3CE2A 4OPAA 1K8AH 1MA0A 1R66A 2GI4A 2LQTA 4NJEA 2YR0A 4QU8A 5AXAA 5A6SB 4N7BA 3UW1A 1AD2A 4XGNA 4X3LA 1NV9A 3W7TA 4B5CA 2VDUE 3E2PA 1F8GA 5BN4A 3LWDA 3CCSF 2OC4A 2V9YA 3ZOPA 1TK2A 2OTJV 3RYFB 1FBTA 1HDGO 2FMHA 2OCAA 3H2HA 4PZCA 4HYQA 1YTFD 4TKUA 4D9BA 4AY3A 2WFLA 2EJ7A 2J0UA 2VZLA 4U00A 1ZQ1A 4DMLA 1L8DA 5BRAA 2F55A 1V3TA 1WQ4A 4M88A 1ZA2A 1T1IA 1UPUA 3NTOA 2VTBA 2R72A 1PDOA 2JI4A 2VP2A 2CF6A 2IKSA 3R4VA 1AK1A 1NUQA 1BYIA 1Z88A 3LU1A 1QLHA 4IW3B 1SUIA 2ON6A 2ZPTX 1Y76A 1QG2A 1S01A 2OZEA 1E1YA 2HU8A 1SQVH 2QAGA 1WM1A 1A04A 1N2JA 3CNNA 3M9XA 3O5AA 1AY0A 1OKKA 1RHMA 1UJMA 1K0UA 2GZDA 4CT4B 3H1FA 1HY3A 2BKXA 1XEFA 1DJPA 3QHAA 1XZKA 2EGUA 5KQSA 2O1XA 1N25A 1U1GA 1Y1PA 2YXDA 3B5IA 2H0QA 4RJLA 4Z1OA 1DRKA 4FDMA 3ZKAA 2WMYA 1PS0A 5CBPA 1DL5A 5J2UF 4D97A 4FOLA 3FFQA 1T9KA 5E1AC 3EC7A 2OHHA 4OL0A 4A92A 4X20A 3M1XA 1LK7A 2AI1A 2BFFA 3IKMB 4KGXA 2NPIA 1Y67A 1J06A 2UZ1B 5F76A 5IZ4A 3LT0A 5EIBC 5KUTA 3EPPA 1ZRMA 3EN0A 3I2IA 1A77A 2F3UA 3PWZA 4DKXA 4E07A 2GPWA 1VQNF 1XZCA 2Y3IA 3NB0A 4MW9A 2EULA 3P4XA 5EA2A 4JBHA 3T7JA 5CDGA 2JLSA 3OTQA 2EWVA 4MQUA 5EWRA 1P1JA 2IWHA 4TXHA 3QENA 3UT5B 1FP6A 3OESA 3AIIA 4R81A 2BOBC 1M1UA 4HHEA 4ZVRA 4MYCA 4OSOA 1QG6A 2LCFA 1SUSA 3OF2A 2IVFA 2YL2A 4J0FA 3HDVA 1PZNA 1CEYA 4KYTA 4A0RA 2XDWA 4DJFC 4YV7A 4QXRA 3GD5A 5D7BA 1Y81A 2XDQB 2RB9A 3KYCB 4GLBA 4IJMA 3LUTB 2D4AA 1CPYA 3J80N 1PZHA 2GCNA 2QV7A 4EJMA 5A62A 3ZW8A 4LF6B 1P2SA 4S0ZA 3TJMA 2C0QA 1NL3A 4FC7A 5M5BA 4HGYA 2W6CX 4DR3O 4YCBA 1HYEA 3ACBA 1CUAA 3HXLA 3GAMA 2YS8A 1TJPB 3QTBA 3S2IA 3VYVA 2EINC 3WMWA 3AK4A 3ZY5A 4D3XA 1OCOC 5JD6A 4J16A 4Q4LA 4DBZA 1XF9A 3NOQA 1SIBE 4FYIA 5KNBD 3J7AC 4EFBA 2JDID 3AEYA 4FJ0A 4HQFA 3HVJA 2WQ6A 3WLAA 3AHEA 4TLCA 2RHLA 1SXJD 4LKRA 1RXEA 4S1OA 2XGMA 3TSZA 3UH1A 3VJLA 1CTQA 1NXTA 2XEDA 2P2SA 5JD4A 1LTKA 3RT9A 2YXBA 3LG2A 3CRW1 5CJJA 2D7DA 4L5JA 1JEYA 1L0LH 1QE0A 1QU2A 1LBEA 2C98A 1C1HA 1O6CA 2GAJA 2YN2A 2XE6A 2O57A 1C41A 2PZGA 1BWRA 3V6MA 3K08A 2ZRHA 4QODA 3V4RA 5JJKA 3FKJA 1MIOB 1OLOA 5KREA 3GPLA 3WL8A 5K8TA 2ALJA 3LUHA 2O8DA 2JJYA 3HUEA 3K1AB 2J3MA 2H5IA 5EKSA 2JFUA 5DNUA 4GMDA 4IDDA 2G67A 1Z29A 3D36C 1I4DD 1ONPA 4C3ZA 4DSAA 4EL5A 1RVDA 4QUJA 4AIRA 1RXYA 2Q45A 4ZQIA 4RAOA 3QF4B 2GVIA 5J63A 2RQ6A 2X76A 1GM8A 3QVGA 1Y9DA 1F4VA 4L5IA 3H9BA 3ZMTA 1KZ9A 1NHGA 3R3JA 5DF1A 1SXPA 4C7UA 3V9PA 4IGEA 3BIJA 1U6KA 1V0JA 4J03A 4BLVA 1WZNA 1N2OA 2HWYA 3CONA 5AHKA 3BHPA 3MTGA 1SCIA 2O50A 2A35A 5EESA 3G9UA 5F7ZA 4DCUA 4OBXA 2FB5A 2F4VB 2FVXA 2DBVO 2AFHE 4EYSA 5LD2B 2VJKA 5D3KA 5JCJA 1NVBA 1II8A 1QGYA 3JYQA 1F14A 4EY4A 1T1EA 1J07A 4FSXA 4RYDA 4PLHA 2FHPA 3JASA 5GONB 1L7MA 2SCUA 2WTMA 3F6RA 3P5BA 1VI5A 3VHRA 2IW5A 1WDWB 4P6VF 4QGAA 3U7EB 4CT0A 3U6BA 1H5QA 1T9DA 1KO8A 2NZYA 3UA3A 2QRGA 5TIIA 3RGBA 3WAKA 4R51A 2QKSA 1JIIA 2F3PA 1U5BB 3K2QA 5JAOA 1JWLA 1PR1A 4NS1A 5EJFA 3S29A 1OX6A 1KNQA 3KOUA 4U2BA 2FW0A 4LV8B 1OXKB 4WFAV 3WQBA 2EFDB 2QYHA 4LGVA 5EHNA 1K6EA 3C1OA 3KV3O 3SIWA 5FEUA 3KCXA 2J7PA 1QRUA 1U7DA 3HPQA 3P9PA 3L41A 4HGQA 5K8UA 2R1ZA 1BAPA 4A5OA 3ROPA 3MAQA 3JCMM 1T9BA 1Z8FA 4LYHA 3VISA 4UTPA 5JJLA 3N3BC 2QLMA 5AP9A 3TCNA 3KKOA 4QDKA 3B36A 3T4ZA 1W8DA 3ZZUA 3EASA 3RAGA 2SBTA 4DUYO 3L40A 4XJVA 3G7UA 1Q82H 3GAAA 2O7SA 1TYAE 2PRYA 3J80A 1CNEA 1HTWA 4W5NA 4FEGA 4C2UA 5DNDA 4Z49A 1N92A 2FPOA 5IDQA 1NZFA 5B4VA 4C7KA 1VQLF 2A86A 5T5QA 1YJNV 1TZMA 2X9VA 4ALNA 4KQ2A 5CLJA 2XA9A 5EAIA 1QOPB 2JDIA 3ISTA 5IUJC 3L43A 3KYIB 4BVQA 1EBUA 4ML3A 3TUIC 2XSZD 3PQ6A 3WMFA 1TGOA 3PRKE 4OXQA 1HGXA 1BXRB 4FHZA 2GPNA 2Y77A 3BSYA 3VJKA 1DEXA 4QDXA 3AU9A 4XUGB 3W6UA 1P2TA 4BX9A 1ML3A 4R9SA 1EINA 1Y98A 2XJ4A 1Y3FE 2RIRA 4X90A 5T67A 4FM9A 3EJWA 1K9SA 4C7OA 4XQEA 2PGGA 1A8SA 1T5BA 1OASA 3TYXA 4V2IA 3G59A 1W19A 3DSQA 1CZKA 1NVVQ 4MVSA 1T9HA 4FLZA 1NXOA 2PX5A 4L8LA 1WJZA 4II3A 3WLRA 4Z4HA 2BTQA 3H0EA 2P9CA 5EVJA 5F33A 4E2LA 1E3WA 1GXSA 1SQQH 2NR5A 3RJMA 5BNIA 1XQYA 1OFUX 1THTA 2GCEA 1JFTA 3X0DA 5DX0A 3CZPA 3OLVA 2J07A 4DZTA 2XXAB 1G8GA 1R5OA 1N75A 1F51E 5HKLA 5F2NA 1QFJA 3ZUPA 3UMYA 3MQ2A 4DA4A 2VXOA 3BQMB 4FX2A 3GA7A 4PAOA 3WRYA 3IMFA 4R98A 3LA8A 3QXXA 4F4JA 4JJEA 3IRUA 4YP1A 4RVOA 1MX9A 4CG3A 4CDRA 4BDTA 3I7TA 4JOQA 4X1OA 4RFSB 1SOAA 2HD4A 4QUKA 3WLLA 4JYAO 2WNSA 1YJCA 4P4LA 4B80A 3UMMA 3S7ZA 5DJ5A 1G17A 4PM4A 4JDPA 2B5VA 3FSEA 3CLSC 5BV2P 4LSGA 2ILMA 3MRSA 5JEDA 4DLWA 1FNNA 5D84A 1I6LA 2VS0A 1NQUA 1QG4A 2G06A 4KYIB 3WWYA 4CT5A 5IT4A 3WWZA 4B3XA 1UP6A 3CPHA 4EBBA 1Y63A 3FN4A 4UPDA 3U1TA 2WVAA 2WALA 5KDOA 1UKAA 5H82A 3X1DA 1MX3A 4HN4B 5TGZA 1UBHS 2CV0A 3VBBA 2G9QA 2LBTA 1C30B 2JFQA 3GUYA 5JDCA 1JL3A 3KXDA 4PZPA 2O8CB 1YQQA 1H85A 1G291 4X62O 2IHVA 4I6EA 5HRUA 4JLAA 3AUSA 3E5RA 2QTCA 1JFVA 1N7GA 3OLQA 3BT7A 1DO0A 1CRQA 3QLVA 1TM2A 4Q4AB 1TEHA 2VPZA 2BSKA 3ERNA 1F6DA 2ZDGA 2XUGA 4IS2A 4JAVA 3HRHA 3O8OA 4AO8A 1E3QA 5GY7A 2PO7A 5SZHB 5EJ6A 3G7NA 1AXGA 3D4NA 4MKGA 2ONJA 2ID7A 4J0JA 4RD6A 3V4PB 4OJKA 1CF2O 2PGLA 2ADPA 4N3CA 3DLAA 2JEZA 4U9IS 3UMRA 4R2WA 1U2DC 2JRCA 4BO5A 3HYNA 4BFTA 2GILA 5DGDA 2PWAA 1GZ3A 1K98A 3HN2A 3JD4A 3GRRA 3JSLA 2B6NA 2XQVA 1GA4A 1WCYA 2SKDA 3G85A 5B7QA 1EN6A 2YIMA 3ENKA 4X6LA 2JLQA 4PR0A 3ZIAD 4QDUA 8OHMA 1EFRG 3OTOB 3B1XA 2HRCA 3UWPA 2ZZKA 3CH4B 3T7CA 1Y3CE 2O2DA 2X13A 4UTZA 1KEKA 3U61B 1UZNA 1B23P 1E0AA 1QIMA 3PSAA 1J22A 1JNYA 2QYOA 4UDNA 4CQMA 1E6EA 1QLEC 1E59A 3C74A 3ITEA 5BURA 2EBFX 3B3GA 4AJEA 5JRJA 2DX7A 3G8BA 5FNZA 3ZYZA 3OOYA 2JS5A 1ESDA 4G4GA 4GM0A 4WDQA 5BSMA 1TA4A 1C9EA 4LJYA 5LL6P 1F51A 1NFQA 2ZIAA 3DDUA 4ZOCA 2ZXUA 2IS1A 3PUJA 4WMLA 3WKBA 1FDTA 1GGEA 2OBXA 2PZEA 2MSEB 3MTDA 3O8BA 5FXMA 3VKHA 3P4UA 3BEDA 3NALA 4MYRA 5TLSA 3VSAA 1L5QA 3IIEA 1RRPA 2VGMA 3B1KA 3EMDA 3GPIA 1XMQB 3IQFA 1YVEI 2PHZA 3COWA 3QVTA 4TLAA 5BOVA 1HC7A 3INTA 4TXLA 4B4OA 5LNK1 5JJEB 1KP2A 1PQPA 4NR1A 2VRNA 4UM8B 3AX6A 4YDSA 3CRVA 5DM60 2W71A 4IGFA 1RC1A 3L77A 2PMFA 3R2JA 5F5XA 3S5JA 3KG2A 1P7CA 4C6RA 2ET6A 5TARA 1H8EA 1QNLA 2QW1A 3K0HA 3BF8A 5ARDA 4TN5A 3FYHA 4G0WA 3F6CA 1KI8A 4TROA 1VQ8F 1CW2B 1OV6A 1VPVA 5ETJA 4DF3A 8ADHA 5GADl 2HCJB 5KEIA 4BZXA 5HZMA 5K8VA 1OA1A 4LWQA 4Y2UA 4B3TO 1JQ3A 4ENQA 1UQTA 3I30X 3U19A 1ORQC 4BCDA 2PUBA 4JQCA 1Z0FA 1P33A 1EHYA 1QO0A 2Q3LA 1ODLA 3UN1A 3ZTWA 3QOYA 5AOCA 1IRXA 1FP4A 4NP6A 3OU6A 3P9SA 2G8LA 2X8LA 1AS0A 5KC8A 1S6YA 2O2JA 3D6JA 2P90A 1JN1A 2KJQA 3I6IA 4UB6Z 4YI3A 2HO4A 4WW0A 421PA 4RD4A 3VHXA 1G0OA 1NQOA 3AY0A 2G7MC 2JLCA 4DGQA 3DZJA 4XVRA 4N03A 5IP5A 2P0AA 3DJYA 3MWYW 4ZCMA 1YB1A 1PNOA 1KUQA 2ZSBA 3V48A 2HUPA 5AVJA 4ZYLA 1DZ3A 5AK6A 3A9RA 3VO2A 1OJ7A 5HXZA 4FMDF 3NATA 2IZZA 3N2KB 3I56F 1ONBA 1TNDA 4WFBV 1UM9B 1EFTA 1O95D 2O4UX 3EGDA 1Y5LA 2WMOB 3JQRA 3EPLA 3AVWA 3ZRSA 1SGWA 5JECA 5KYKA 1IK6A 3VI6A 4D4JA 1SU8A 4U1RA 2H5JA 3JYCA 5JVDB 3PLRA 3ZH9B 1C3VA 2IDMA 3RSZA 5BSRA 2PVCA 4E5VA 9ATCA 5JBIA 3KC2A 3KUCA 1ITZA 2X9LA 3PPIA 4XDZA 1S4QA 3LT5A 2ZM5A 1KKLA 3UPUA 3RADC 1JFFB 3B40A 3MWJA 5ALSA 2OAQ1 3E86A 3EULA 4MW4A 1XTIA 3E53A 4BV2A 3DYIA 1T8RA 2EERA 3QE4A 3JWJA 2ATKC 2LNDA 3LDCA 1UQUA 1N2GA 3ANNA 2JHCA 2VQSA 4LYAA 1TKCA 3ZMSA 4FWIB 4C1BA 2D06A 1Y8QB 1EX9A 2FFRA 3ABKB 2O3TA 1WP9A 1VLLA 1B0PA 1W0KA 5EO3A 1F5SA 3JVUA 4BNUA 4Q7QA 2R8PA 4IIHA 3H3JA 1XHXA 3PYMA 2OCIA 3FSJX 3ZWQA 1ENZA 3R3WA 2GLXA 2RAVA 4C5CA 3B1JA 3AP2A 5J23A 3KJQA 4PZUA 2O2CA 4QVIA 5FPKA 3RBXA 1U96A 4YDRA 1J23A 1CT9A 1KF0A 4TXNA 4Y6OA 4JX9A 1E0KA 2H2HA 3CM0A 3CURA 4H3VA 3UK7A 2Z0AA 3VOBA 1RVV1 2VNJA 4Q7LA 4GKJB 4RK0A 3T3MB 2J85A 1IURA 3O85A 1ZONA 3MYYA 3N8IA 4FMCF 4M9XA 5EERA 1Y1TA 4A7PA 1JN0A 3EEYA 3CF4G 1PT6A 4HNSA 4R2LA 3KSUA 4WZBB 1VG0B 1MJHA 3N2KA 3ABQB 5BW6B 4CF4A 4O6VA 5HDQA 1B2RA 4ZVQA 3M5PA 1AKRA 1I36A 4GPEA 3UJ7A 3HKDB 4BU1A 2RGWA 2EJTA 2VH5R 1EFPB 3GCXA 1OJHA 2F95B 4G2KA 1GN4A 1ZK3A 2C29D 3HUTA 3UA4A 4KAXA 3WRXC 5AW4A 3DDSA 2FE4A 4KUEA 2VSOA 3RBZA 3PR3A 1CVLA 2YC0A 4X7MA 4XFJA 5J2UA 2WF7A 1BOOA 2W2TA 3R6GA 5CYPA 4P86A 1Q57A 4C01A 4D4KA 5BUCA 4FDUA 1X13A 1GUAA 2X8WA 5ALJA 3DXZA 1BMTA 3WRWA 5CFPA 2IG8A 1IBCA 3QO5A 3LFTA 3ER6A 4MV1A 2CXQA 2AK2A 1L5OA 4K87A 5HMLA 4FVMA 2QTLA 4MVJH 4F3KA 3OT1A 5C8XA 5FLXA 4NJOA 4UCVA 1XZAA 4GPBA 5JNWA 5F9FA 1YRAA 3OIUA 4IV5A 4I9QA 4LNUA 2OHIA 4C30A 4YACA 3G2JA 3ZKWB 2NO9A 3PT5A 1MRZA 2WILA 1T3ZA 3CKLA 1K9VF 2CMGA 1PW5A 4IO1A 4YT8A 4PWTA 4WFGA 2ONKA 6ADHA 4A26A 1KGDA 1MXFA 3TIVA 1DDIA 4MVZA 1TF7A 1QQ7A 2D5CA 4IV8A 3P0RA 4MPDA 2CHFA 4O2AB 4RZ3A 4DJDC 3H3XA 1UEIA 1IHYA 3OG9A 3O4IA 3UPTA 1FFCA 5HA5A 2UXCB 2CDAA 2WU4A 4HAWA 3LVBA 4TT3D 1JR3A 1RWQA 5FEMA 3S5UA 3VQTA 4CLOA 2FWJA 2X6AA 1JDSA 1BS2A 3EIWA 4D57A 4KPFC 4XFDA 3SDBA 1V8OA 4Y1GA 2GRUA 3GRYA 1HBJA 1NW7A 1V4VA 2QWXA 3IDZA 4LYDA 4OQZA 1CERA 4ARSA 3RYHA 3QELB 4P3XA 3T54A 5E9WA 2POQX 1JQAA 2XTJA 3WJ7A 4Y2HA 1TUEB 1E1RA 5G3YA 2XRMA 1N6IA 1J2TA 4JLNA 1O2DA 4CH6A 1U7WA 2ETXA 1CEEA 3NOXA 1SHKA 1X70A 2G25A 1HYGA 1FVXA 1N8RW 3AHDA 1C3EA 3GUVA 5IBRA 2JFOA 4ND2A 4HH1A 4LY9A 5EC2C 1XEAA 2PEYA 4EECA 1IV4A 1PVOA 2Z5FA 2OXEA 4EB6A 1C29B 2WLSA 4Q4JB 1A88A 1QGAA 5DSXA 3D1JA 5EPOA 4DM4A 1Z5VA 4KV7A 3QK7A 2DP4E 2IHTA 1OSNA 3BTSA 3R75A 4D9GA 4DCGA 1GL3A 1Q74A 3KYBA 3LSUA 1GM5A 2CNWA 3LH5A 1VPLA 4JU8A 5IM5A 3D3JA 5HGXA 4LKOA 1QLJA 3F98A 2B94A 3TZLA 3AI3A 3NC4A 4HDSA 4N21A 4U8GA 1BVYF 5CX1A 3H0KA 4PQYA 5DASA 2YXLA 1V8ZA 1G9XA 3M81A 4AZ0A 2Y67A 2EIMC 1KKDA 4KI0A 1S5HC 3OM8A 2A58A 1JAIA 4R2HA 4WBNF 2P6RA 3ETGA 4AD8A 3RVKA 1G8JA 1JI3A 4NI5A 1K5QA 2CGOA 3E9YA 1W40A 4Y7DA 3U4QA 5AKIA 1F2DA 4RTQA 4X65O 4MKZA 3FTDA 3PKJA 1R3KC 2DUNA 1M0SA 3KL4A 2YYYA 1QHHA 2NTEA 5LD2C 2JEUA 1LUAA 1VJDA 3LC1O 5C2JB 2G82A 4LYFA 4ZV7A 1PLKA 2GUWA 4YV1A 1WVGA 2BN4A 2HIHA 2OSBA 2CGEA 4H18A 4TUYB 2XSZA 2O8BA 5GZ6A 1NG1A 4S04A 1U4NA 4KIGA 1TAEA 5G1PA 2V4ZA 1IH8A 4TYPA 3OA0A 2R7MA 3OOHA 1ZBDA 3ADBA 2O3UA 5DN6G 2F9FA 1E1CA 2B69A 4I0XA 4IWXA 1UANA 1QTQA 1E5XA 3QBVA 5K0FA 2Z57A 2SNIE 2HJ9A 3U4AA 2KWIA 3HFGA 2CKDA 2IUTA 3UMSA 1J7JA 1Z18A 2WV9A 4TZTA 2WIKA 4FHGA 4CIVA 4OATA 1T8TA 1DRJA 3G49A 1W0KG 1S3FA 1VCMA 1SKYB 2ONCA 2Y4OA 3BYZA 1RU3A 1C50A 1U6JA 3N0RA 3QXHA 4GSYA 4LWSA 4ZU6X 1WA5A 4HSGA 1SVSA 2ZWPA 4GI5A 3F6BX 2EIKC 3ROEA 1R3JC 1VE1A 3QTTA 3VYRB 4DG8A 3IXMA 4YUWA 5HFNA 1FNMA 2Q0XA 4JJ6A 4DCTA 1JG1A 1IZ9A 1PG2A 3P9YA 3VOAA 3OBIA 2PF4E 1Z16A 5TY0A 5KTSA 4HG2A 3LWQC 3WK4A 2QLFA 1T13A 4UZEA 4L08A 4P1ZA 4D43A 4M36A 4U63A 1W4LA 3RV3A 3GF4A 4B62A 3R44A 4TL9A 4AUNA 5AD1A 1SCAA 1MC5A 5ER6A 3QYPA 1FLAA 1I7PA 4BMXA 4MGHA 1E60A 4ECAA 1WR8A 1CY6A 5CLQA 2BAGA 1JXAA 4DBVO 2IJHA 1CEZA 5G53C 1V55B 2HOQA 4P4UA 1HSOA 1GXSB 1XQWA 1WG8A 2X7HA 2QROA 2Y05A 1IUPA 1TQDA 3KLNA 4FI3C 5CPBA 5TGDA 4MO2A 4FZ5A 4DCPA 4FMPA 3ABLC 5ES3A 3NM5A 2HK8A 2JBWA 4MWZA 2JAXA 2AEMA 5BORA 1ZMXA 4NTYA 1EA5A 1UWCA 2TRSB 3PGVA 4MVJM 3SQLA 1ZN2A 5E3JA 1VYTA 3N53A 1TC1A 1AH2A 3L0SA 1OZ0A 1QR9A 1X7ZA 2M6RA 3DVAB 5CLLA 2Y0BA 1E2JA 1HW7A 2ZQ5A 3ERCA 3ANXA 2PH1A 5AQEA 3C7CB 1F6BA 2AEJA 3WO1A 2AD5A 2BHSA 3K1JA 4UOEA 4DUZO 4P4GA 3HBAA 1NUTA 4QOGA 4MZDA 4BNXA 8GPBA 1EYZA 2ODWA 3SLRA 1FC0A 2BFBA 5KX5B 1G6Q1 3C87A 3GI1A 1KE1A 3A28A 5K3DA 3PQ2A 3FSGD 2X0NA 3MQ4A 4UE2A 4C4ZA 5BW8A 3IKJA 4ZPJA 4B6GA 1A4XA 1NHWA 3IHWA 3MJDA 2XWBF 3Q5GA 2H31A 1NKTA 2HU2A 4GQIA 2Q4TA 3BULA 3Q9LA 2OA0A 2M32A 3B2QA 3K9NA 2PZJA 3MGAA 3W5HA 3PA6A 3D8SA 4O3FA 4BJHB 4QHYA 5HS4A 3ZVLA 1RAGA 3PDHA 1JYSA 1IHXA 5JPCA 2E21A 4H2DA 3UT0A 3UV3A 4BWAA 1WDMA 1IHOA 4J2HA 1QK3A 3CHYA 4DV5B 2BYTA 1SG6A 4M6WB 4DA9A 2QWNB 4CM3A 3G0CA 2XUAA 4B6RA 1BJRE 1NVMB 5IYZB 3NYQA 3RSLA 4BQNA 1PR2A 3SP1A 3DO5A 3WNDA 5L40A 4DW1A 4MIKA 2JG3A 1QBZA 2EZPA 5IJ9B 1NBHA 3OQPA 3QVLA 4OL9A 5D3MB 3AGKA 1PTJA 1N8RH 4AZTA 4HT3B 1KIMA 2V7UA 4V1CB 4G01B 4QUIA 4UM7A 4QRDA 4TSRA 3L4KA 1KO1A 4WIAA 3CX4A 2JA2A 4N01A 3EVEA 4CMGA 4F1KA 3WO0A 2WD8A 2CXHA 3AL2A 4BVEA 1N6LA 4F3TA 5DP2A 5DHTA 1MABG 3I2KA 5K3CA 2PGNA 4Q16A 3X1JA 5I47A 1V41E 2HQSA 3CTMA 1MPXA 2WJ4A 3DLIA 3GJRA 2FMFA 1NQWA 3HCPA 4G1UC 4GPIB 3AHCA 3QX7A 4FS3A 2FPIB 1WS6A 2NV6A 3D0OA 3R3UA 1FCJA 1Y1RA 3IAM6 2QQGA 4NFLA 5F2OA 5KJEA 3Q9SA 4MKFA 4A8JA 5TQ0A 1X1RA 2R66A 3B7PA 3FWNA 3CX8A 1RLMA 2PX3A 4KLCA 4JXXA 4W1RA 1HTTA 2JS3A 5EINA 1YEWA 5CB4B 1F0NA 5JARA 5DMXA 2NU8B 5KKNB 1I13A 3NTXA 3QMWA 2W6ZA 2XD9A 4W99A 3ORSA 3F7NA 1PFKA 1QM5A 4KK3A 2PMCA 4NOJA 4W8GA 3S2FA 5C7OO 3FVVA 2KW5A 1QIGA 3NYWA 1CCWA 3QXSA 5JWPA 5GAJA 3KJKA 1FU8A 3VSBA 3ZCPA 2HWUA 2VGNA 4DARA 1A8IA 3CNBA 5ICMA 3P9QA 2M7WA 2YVQA 1OQAA 1HLFA 1SUDA 1XZBA 4L9SA 4Z1MA 4ESVA 3KOZA 3ILYA 2IH5A 1M5UA 1TUIA 5KSPA 1CIPA 1ENOA 2ZNJA 1CLEA 3MS7A 4PFSA 5B5EZ 4K6GA 4TS3A 3VAZA 3GLIA 2G40A 4CM1A 3HDTA 1E6CA 4G1MB 3UWSA 2IIQA 2W8ZA 5IAAA 1MOQA 1ZXBA 4QE7A 3B8MA 1JX9A 3L07A 1JDPA 1L4BA 1MO3A 2PJZA 3IOEA 1ZM9A 3PLNA 2YY6A 4XSGA 5M29A 2QTFA 3EVBA 1WNTA 1U40A 3ZU4A 4DDVA 3B8HA 1M2VB 2WZDA 5MF6A 4WFJA 4B3BA 4LWOA 3A9SA 1E2FA 4PX9A 5I9IA 3CC2F 4J0HA 2UYQA 2C59A 3NYRA 3WG7C 3MOSA 2VTKA 5IFKA 2PX2A 4ZC1A 1DJQA 3ANMA 5GINC 4S2EA 3GLFE 1H2KA 3EUEA 4ICGA 4LYYA 4DJEC 3S2UA 3S8YA 3MDSA 2C00A 3BWMA 3DE2X 2QJFA 3KLMX 4KX5A 2ZVPX 2ZYAA 4PU0A 3TE7A 4MXDA 3WS7A 2GARA 2B7BA 3KTOA 5J2TA 4MLCA 2OXTA 1XE3A 3V1NA 1P2VA 2VH2A 2W8BB 3DA8A 5BNWA 3WL6A 1ZGHA 4LX8A 5JCXA 2N05A 1Q77A 1XLVA 4DLRA 3PK0A 2AMLA 3VGPA 2IBTA 3X2QB 3CCJF 2HDNB 4U0JA 3GEDA 4S24A 2VTDA 3B1FA 4FJCC 1DIRA 3IDAA 1IY1A 2OXFA 4ZRMA 3GFGA 3CCMV 2XUFA 3JPYA 3ZWOA 4BX8A 3X2QC 1J5XA 2YW2A 1XA3A 2LDBA 3K4QA 3M84A 1T8SA 4KXXA 4JI0B 4KAFA 3U1BA 1M0EA 1RZUA 4Z5XA 3SHTA 1WB5A 4ONEA 5TVKA 4PDMA 3DFMA 3VPHA 1BJKA 5B1BB 4LSZA 5CYFA 3SE7A 3Q5EA 2PKQP 2Q1YA 3GJ6A 1NASA 3WNVA 1YNSA 1ZCBA 1IBRA 3MRTA 3QU2A 3ZDFA 3ELCA 3PG5A 4UCWA 1VCHA 2ZQMA 2SECE 4FFLA 3WGKA 1QIFA 5JPIA 5BN5A 2OENG 4D74A 4D4HA 4EF5A 3RAPR 2OP0A 3IESA 4KWHA 1NI8A 1YHZA 4MQFB 3VR4D 4XRRA 1N3YA 1E2HA 3FE2A 5C51B 1NLZA 1ISJA 3TETA 2IYWA 3HJAA 4EGFA 4C89A 2RB4A 4KIWA 4JV5O 1M7GA 3S0HA 2X6TA 1TJ5A 1K3EA 5H70A 2I2XB 1E2UA 4RE5A 3VPDA 4YH1A 1TQ6A 1I5XA 3ICCA 2C5GA 1YIOA 2ZBFA 4H0NA 4OB7A 4HNAB 5DECA 3SHQA 3ZHCA 4BQRA 4D3YA 5BYBA 3I0ZA 1OXSC 1G41A 1T4DA 3T4XA 2P1RA 1UPAA 2WC1A 1YULA 2WHPA 4MUAA 4QQKA 4YONB 3SEFA 2Q7HA 4BQOA 1VQ4V 2BJWA 5D5PA 1Z6TA 3M6WA 3NNDA 2Q3MA 2HT6A 2LD4A 3WIUA 3Q3GE 1Q7YW 4Q7EA 1E1RG 3D6UA 1AZTA 2GUGA 1D6NA 2ZJ8A 5F78A 4A0GA 4P0QB 3FTPA 4FYMA 1RTTA 2LFRA 1TUBA 3AY7A 6CHYA 3HY6A 1SWVA 1KMHA 2VDMB 3CXUA 4QASA 3KOXA 3O03A 1T10A 1JDBC 3RREA 1W36B 2IXDA 2YXYA 1U2RA 1FE8A 3C6MA 4P4TA 1QRTA 1YF3A 1C9JA 1C7FA 4EAQA 3PZBA 5CTJA 5ALEA 3UAOA 3H84A 4PE5B 1IZ8A 1ISSA 1JR2A 3OFKA 4OYHA 4BO0A 2I91A 4MNTA 1CDDA 2PVPA 1C8KA 5MN6A 1JLRA 2FVYA 1O4VA 5J5CA 4RXTA 4D25A 1BS3A 1SBCA 1IN4A 2II6A 3C1TA 3L0YA 1AQLA 5A7HA 4PIMA 4DQDA 3QPUA 1EAYA 1EFVB 4IVPA 1N5JA 4XD2A 3NANA 4QYMA 1EP3B 2QVGA 3IDQA 4ZI2A 1EB9A 9LDTA 1R1MA 2WTBA 4JVMA 1PT7A 2O0HA 3UJPA 2UYPA 3R66A 4IIFA 1LC3A 1YACA 4BRZA 4JR2A 1GPUA 1VQLV 2Q3JA 4RA6A 1BEEA 2AR0A 4Z0PA 5GONF 5BRNA 5C37A 1FMFA 4EQ6B 1VLQA 2VIIA 1HRKA 4DIDA 4U3JB 1L5LA 4ZYWA 4K9DA 4OJQA 3ZHOA 3VQWA 5B3JC 4ZT4A 1WXGA 4PO9A 1GM9A 1KNJA 3GLHA 3AG7A 5HCIA 5K4AA 3N0XA 1E92A 1WN7A 2YICA 2FTKA 1S8NA 4PZZA 4RY2A 4E15A 1RFYA 4ES6A 3BD6A 3EISA 3LCVB 4XEHA 1BJTA 1VYVA 4PNZA 2WD7A 2G4VA 3FPGA 1A7UA 1O8BA 2B37A 1QFYA 5IK2D 2ADMA 3IEIA 3GHHA 2FRVA 4DR1B 4Q5IA 1QFZA 3TI7A 3UOAB 2OCXA 4X6XA 2DPMA 2WG0A 1V3VA 2BFEB 2C4NA 3L1IA 3MTIA 3OMWA 3IPAA 4FD2A 2HY7A 3FAVA 2P9FA 2I1VB 3HCCA 2NZ8A 3GJZA 3IT1A 4WVLA 2TMGA 3VFDA 4CLRA 2BMWA 3CSXA 1K4YA 2Y66A 3ITNA 1EP9A 1MA3A 3QA3E 4HFRA 4TXJA 5E6RA 4EF4A 3OQJA 2ORYA 4E0BA 1EI9A 4ZOQI 2IU6A 3HH8A 3V7EA 4C20A 3H1JH 3L8DA 3H87A 3ZWDA 4D45A 2Z6VA 1D2DA 3IO5A 3Q98A 5A2QN 1UAGA 5F7JA 3FPAA 3T7RA 3GJSA 2P4VA 1QV7A 2I3GA 2EHJA 4UVDA 1FSZA 2Z9BA 1W0KD 1P8AA 4G5RA 5ULLA 4CWAA 3PYLA 1WP8A 3AW8A 4YECA 1IXSB 3WHKA 3AU8A 4RQBA 3OX3A 4IGAA 4LNUB 4LVUA 3QLJA 1ZRHA 5BWBA 1GEGA 5AVMA 3BB1A 3DKRA 2AGAA 1HR0O 2YTZA 4YJDA 1WB7A 4Y9UA 3CP1A 3ZEIA 4YP0A 3FCEA 3CCVF 4D9FA 5JROA 1H6AA 4UU1A 4DWJA 2WV7A 4NUTA 3OQBA 2FZ4A 3BKWA 2YOGA 3PXUA 2FPLA 2OFXA 1OH7A 5CFNA 1EQAA 3EDYA 3FUWA 1RT9A 3AERA 4CIXA 3QY0A 1OGYA 3TD6A 1TM1E 1FVFA 3PHIA 2AUTA 4UHJA 1F2TA 3AR5A 3KEFA 4RIIA 4DO2A 1NVEA 5AM0A 4AZ3A 2C2MA 5B1NA 3ONNA 4QDTA 4TUYF 4UARA 4G5QA 4FM2A 1ECBA 1ZH6A 3AUKA 1L7DA 1I2MA 2EZ4A 2X8AA 3AETB 1KEEA 4OLHA 1KO7A 5T4BA 1OT5A 1PK9A 4ZOEA 5LDHA 1HXHA 3AV0B 1V35A 1YR7A 2I33A 1O6ZA 1RMYA 2LIPA 1TF5A 3A36A 4D56A 2WTAA 1RJDA 1PT5A 4G25A 3ABSB 3SMVA 3CF0A 1A27A 1D6JA 1VQ9V 1DKMA 2R79A 5CA0B 3UM7A 1IQPA 4JI6O 1EUDA 2IYUA 1EH5A 3CZ5A 3DE4X 4FKMA 4HDQB 4HH3C 4UJ3A 2GZLA 1IB0A 2HQBA 3K9BA 4BY9E 3LQ2A 2W90A 4GBGA 4KQKA 4XGQA 3IKEA 5B3SB 3AFHA 4M53A 4DJTA 3THXA 3P2IA 3OAAG 3DXXA 2PZKA 2YC2C 1EWKA 4M0DA 4AJ4A 2J4FA 2FPPB 1J2UA 1V39A 2LVBA 4JJFA 3KV1A 1EWYA 3EXIA 4N3BA 4Q24A 1GFSA 2IUEA 3I2JA 2I5PO 2WJWA 2Z2IA 4AULA 4BFYA 2YKGA 4EG6A 2QUKA 3ZJZA 3IKVA 4EX6A 5HUQA 2F1RA 1TU4A 2P77A 1IX9A 1IZ0A 2YJTD 4QXPA 1WAMA 4DCSA 5IT0A 4BLSA 3NP7A 1A5BB 4KL8S 3JQPA 5L3BA 5CGQB 3CRCA 2V5VA 3R5KA 4YMGA 4Q7JB 1I2AA 1Q7YH 2R6JA 5CIYA 1YTUA 3U0ZA 2L6LA 1BDMA 5GW7A 1GQRA 4QBIA 3QUQA 3VYSB 5B1IA 3JQFC 4HVLA 5CBKA 1JHZA 4NY1A 4OI4A 2GFHA 1WUYA 2BFDB 2VNHA 1DTOA 5EC8A 821PA 2DLDA 5EIHA 4Z4GA 4EG0A 4CNBA 3AERB 2R9IA 2DU8A 1AZLA 1LBTA 2N1MA 3ABZA 2NU6A 2QTVA 1HDXA 1RZVA 2A9KA 2VDJA 2ZZNA 121PA 3TDNA 1E32A 2E74B 4ZFNA 3N4YA 3CPSA 3MXTA 1YJ9F 2ORIA 5DM1A 1GSHA 4E5DA 1OOEA 2QL7A 1L8XA 2VPWA 3CYQA 4JLDA 1P49A 2JVDA 3JAWB 5GTIZ 1CZOA 1E7QA 2SKEA 1Z6ZA 2JIZA 2XPCA 3FJYA 3R6TA 2Q8VA 1ULZA 1WDLA 2C9DA 1OI4A 2VI5A 4E13A 1FQOA 1HQDA 2CH7B 1SQPH 1YI2F 2DQ3A 1DKOA 1R18A 4G0XA 4P2GA 3VR3D 5KNDD 1NZDA 4A23A 4HDNB 4YJHA 4EO7A 1QVGU 1VQ6V 2FWMX 1YR2A 4OX9O 2KB1A 4RNDB 2W2XA 3NHKA 3PUYA 4I6GA 2QJ1A 1RJEA 1ZGAA 2XLBA 4XW2A 1L9XA 2CUGA 1V3QE 4YCDA 4DQLA 4ZCQA 2CNWD 3KETA 3FWKA 3KJGA 2G5CA 3GUUA 3GZJA 3PEEA 4AQYB 4OIMA 1N2CE 4TZ6A 1F0KA 2BONA 2JCXA 5DWVA 4OUKX 2Q5LA 4UE3S 1GGNA 5CBHA 1L5HA 1H9AA 4Z9XA 1QB7A 3BIOA 1Y1QA 3EARA 3CRAA 1IWOA 1SM4A 4URZR 3RIMA 4RTOA 3HXPA 4YB8A 5KOJB 1T34A 3GWZA 3RI3A 4QRHA 4TXMA 5KOYA 1KQFA 4L50A 5KCMA 3S99A 3PBKA 1GDHA 1VM6A 1ZM3A 3VR4H 3I01M 2GCOB 4LZJA 4DILA 3ZXSA 2AH5A 3R9WA 2JIDA 3SHOA 5HUHA 4RL4A 2G0AA 1Y3BE 3B6NA 3O74A 3PUKA 5EY5B 3T9BA 1F4LA 2E85A 3QLTA 3LVQE 2MYTA 3VSEA 1WTAA 2CC2A 4IO0A 3H11B 5FULA 1WSBA 1SKAA 2CLIB 3CIOA 1YK1A 5JI3E 2HAEA 4YRFA 1IEWA 2HFJA 2I54A 3CIFA 1U2ZA 4LISA 1X7HA 5CYOA 4YI5A 3RROA 1DK1A 4YP6A 4D9IA 2B35A 5K3OA 3THXB 1N3IA 5JY1A 2EFEB 5K8LA 4PR3A 5JXHA 3K0BA 4B9EA 1YRWA 1M2HA 4IRUB 1PNTA 5LBUA 2Q67A 1EFHA 2WU3A 3C6XA 1I10A 3ZJ5A 5MFZA 3G6WA 4DXHA 5I7WA 4P81A 4C2TA 4R40B 3LP5A 4IIYA 2RH9B 5AUPB 3VNAA 3F6MA 3EEIA 4GG1A 2UZAA 2CD7A 3P2KA 2NTJA 2Q4EA 4CLOB 1WE2A 2FMUA 5IF9A 4FZRA 2FHSA 2PVSA 2CUTA 4XQ9A 5FCDA 1J25A 2XZPA 3NW9A 4ZKDA 3GJXC 3OE5A 5C1BA 3GVHA 3R3HA 4NWIA 4ZAGA 1ZHFA 1N4CA 1OZHA 4QE9A 1SFRA 3WBFA 3ZE0B 3SC2A 4AG3A 3UW3A 3K9FC 3FNFA 2XRFA 4P8RA 1QR2A 2WA1A 2Y71A 3NHWA 2P7HA 4N5HX 4GCZA 5JO9A 4GXNA 3WL3A 3AI2A 2A9FA 2YOHA 5HF9A 1VQ8V 4D9EA 3C3PA 2ILTA 1CX9B 2MMCA 3UXHA 1ECPA 2BBSA 2P8SA 2Y1FA 3PDIB 5REQA 3FD6A 5H2FZ 5E0OA 2P9QA 4F04A 5KB3A 3DXRB 4M6WA 4K2HA 5BVGB 3WICA 5F73A 4KH1A 3CVXA 3OQHA 1DOAA 2ID8A 4RTKA 2GMWA 3HY3A 3OZ7A 4BVBA 3UAXA 3C3BA 1T29A 1AC5A 2J46A 3IBCA 3L0ZA 2O8FA 1GX1A 1GN6A 5CR9A 4PVDA 3CUTA 2F1HA 2GZMA 1DF5A 4DV1B 4GE0A 2ADQB 1PWXA 2P3LA 2XCUA 1IOVA 1D2EA 4FW8A 4IXNA 1IAVA 1PJAA 1FP1D 2FDRA 4LF9B 2FPRA 3D6AA 3EOAI 3GDFA 1Z8HA 3IFSA 4ZVUA 1NS1A 4PBSA 3TR0A 5HRAA 1N34B 4GQAA 3CCMF 2A5FA 2WDPA 3MIIA 3BF7A 2IEIA 3QNMA 4H4DA 1JR9A 5E7MA 3F5TA 3QRWA 3ZHTA 1VKHA 2W2VA 5GJCA 2KPOA 4ADSG 5HHTA 2VRCA 4IIVA 2Z6AA 3UAYA 1P3DA 2BFEA 4LTMA 1T9CA 2D0OB 2NO4A 1WEKA 4DM3A 2ZRJA 5DCUA 5M7EA 3E22B 2HP0B 1LB1B 1U8UA 3TCXB 1UBOS 4FXPA 1FMTA 2A57A 5KMGB 5IK2A 1XDSA 3PC2A 1P17A 3FPFA 3LA6A 3C5CA 4YCJA 5HGJA 5HWEA 2B34A 2AZMA 2JGMA 1X80A 4N6GA 3E6AA 1PHRA 3EMBA 4FE3A 4BATA 2DECA 5TDHA 5JV5A 3KDSE 1FPMA 4H1TA 1B04A 2J3JA 4OKSA 3FYEB 7YASA 5IVPA 1YE8A 4C0XA 3V33A 5G41A 3AM1A 1U9ZA 2X6BA 1MORA 3FIJA 5TPZD 3TRIA 1RFLA 4D3DA 3ZE1B 5LQDA 4H6VA 1WQ1R 3F9RA 2WLJA 1IHPA 3IPXA 3WIVA 2E4XA 3LXXA 2A92A 2X5NA 2QSJA 5FH9A 1PYGA 2AFIE 2ERYA 1G4YB 2VYQA 3HP4A 1H2WA 4JENA 2CW4A 1EIZA 4NAVA 3VX4A 3ZZMA 2FTKE 3E61A 4MUEA 3KPJA 2VT2A 4M1EA 1DTSA 4RADA 1T2CA 2C4WA 4GI1A 4EZBA 1WW3A 1D2GA 1NAIA 2B33A 1NYTA 3UQZA 1UFOA 2O2HA 4OJTA 5DW0A 3V3KA 3KHKA 4QEDA 3KKYA 5DLQC 4WCDA 3EGXB 3WE7A 4AJHA 4J2OA 4RYLA 4FJ2A 4W7SA 2OD9A 2RH4A 2H8KA 2XUQA 5B3JA 5L3ZA 4D1YA 3RC8A 2H3OA 2AN4A 2R6AA 3KEOA 5FWXB 3F4BA 3GJ4A 4N47A 4LA4A 3APOA 3U10A 4P7JA 1WPXA 5EG5A 1BDHA 4XB6B 3L7QA 4RUFA 4J0CA 1PL4A 1NULA 4BWFB 3ESBA 3E89A 4V0MA 4HVCA 4QG3A 2QTSA 2Q5QA 3RV4A 2FEKA 4H59A 3B70A 1Y4MA 1W1UA 3HZHA 3JX9A 2ZFUA 4O2RA 3BFVA 4DS3A 5CVTA 1FXWA 4EEKA 4Y9SA 5ISMA 3C6YA 1L3IA 1PXWA 3L1JA 1DO2A 1MX5A 2FDCA 3I62A 1J2YA 1O0CA 1NNLA 1QOZA 2ZSIA 1OAAA 1XKTA 3E18A 2QTRA 4LXIA 4PXAA 3C5WP 1RQGA 2WLIB 1M73E 3OZAA 4TTVA 4NCXA 3W9BA 3E4CA 3AVVA 3ESAA 2PQ0A 1TFRA 1KMIY 3PPYA 1VJGA 4NCBA 1HM5A 2FX2A 1NLMA 3CLUC 3LO5A 4U5QA 3OPNA 5LP6F 1NVDA 4FMTA 4EVSA 1ORRA 4JC4A 1EDZA 4OUDB 3MCTA 4OMCA 4AB1A 4ERXA 3BGSA 5EAZA 3F5FA 3ETEA 4QQ8A 2J3IA 1ZHHA 1CUZA 4PY2A 5AJTA 5P8WA 4DE5A 4OHYA 1ZSNA 4UMEA 4DCCA 4ZTZB 3UMGA 2W2KB 1E9EA 4RTRA 1MT3A 3FOZA 4FCVA 1E1QD 3GWKC 2BF7A 1Q15A 1GNVA 2O0LA 3IBFA 1OYVA 3LDAA 4N8EA 4DFDA 4MT8A 2HDHA 4XLZA 1E2LA 1OXUA 5IYDO 1EM8A 2GXUA 1ZJ5A 3N7TA 2H0AA 4CF6A 4ETNA 1R8QA 5AJHA 2M2IA 3GCZA 3TQCA 1D2HA 4BKOA 5BR7A 2BY4A 2W98A 4GI3A 4GW3A 3LAWA 1HSZA 2ZAIA 3PU6A 3ZXUB 1P80A 4DLLA 2TYSB 3V4FA 5ALOA 2J9RA 2DETA 5LP6A 1TZCA 1ZITA 3GLFB 1VSBA 4US2R 1YVRA 2W0MA 3VU1A 3ZTYA 1ZAYA 3OIWA 7AT1A 4L95C 5D3ZA 3EEFA 1E3DA 1YS9A 1GEEA 1IM5A 1QOQB 1Q91A 5M34A 2CXTA 1AUQA 3AUTA 5CVCA 3VR3A 2DRIA 4BOYA 3VR5H 4E31A 4HWPA 4ID9A 1W9HA 4BB6A 5BR4A 5HQTA 2RDMA 1XQ6A 4MS4A 2PMWB 4BE4A 2PJRA 2ZJFA 1XK6A 2NNUA 1L0BA 1EBOA 1QGOA 3OX2A 4IMRA 3RW9A 1U9CA 4KE8A 4NE2A 1S5JA 2IU0A 1EFCA 4OI2A 4AQYO 3DXFA 4WLVA 3OSZA 1WP7A 5THQA 1GKYA 2WK1A 2IXTA 2KSQA 1LRLA 2ZETA 3DNFA 4WA7A 3VU9A 3KWFA 2YHIA 4XVHA 2WABA 2YMMA 4MYTA 3LRPA 3MINA 1KNKA 1Q1BA 4JOSA 3NWBA 3STVA 1KFCB 1KEZA 4I5IA 3S8EA 1SCDA 5AT1A 3RU7A 1EVEA 1RCTE 1R8YA 3NWOA 2W6NA 4QE3A 3W1WA 3CD6V 1GNPA 4L7VA 3GZ4A 3I09A 3QEJA 4PPGA 5T8KC 3VNSA 5JRZA 3DQQA 3UMJA 2FEMA 4UTRA 1KJIA 1SWWA 2I4NA 3UG6A 3HCAA 4IG9A 4FGLA 4P30A 5I7UA 4I81A 3HJUA 4XJSA 3KSRA 4G0ZA 1ZS9A 1UZLA 3H1KH 3ZS9A 3CC7F 2VBFA 1PLLA 4C0HA 5HQ3A 1TD1A 2XVZA 1V25A 3VR2D 3CRMA 5JRDS 5ESDA 4CKEA 1LF5A 2P9TA 4PLZA 4BMYA 1MHTA 1OCCC 3QPDA 3BMNA 3V1TC 4B32A 4MWEA 1DPGA 1QIJA 5GIPE 1WV1A 3A32A 1H4SA 1K5DA 4B08A 1R0SA 3BH7A 3UOGA 221PA 5ARCA 3KKQA 3MT0A 5K3AA 2YXPX 4CF3A 2CLHB 2PZLA 2SHKA 1P0QA 1FFAA 1RLTA 3N74A 1YAHA 3CKMA 3OZBA 1S0UA 2Z5LA 3PEUA 1DO8A 4G0NA 2VDLB 5U4QA 4GM4A 1W9MA 2H00A 1XJQA 3GX1A 4N4AA 4J0EA 3NVDA 4ILKA 4WFFA 4L8VA 1JQBA 4LJ8A 2FSIA 3L4EA 2FPGA 1UMDA 2JIPA 3IBTA 1DSSG 4U4AA 3Q7EA 5EJMA 2Z8YA 1VL8A 1JZQA 3I3SR 3HFRA 4LHSA 3ZUGA 4I1IA 2GUZA 4C2AA 2V8OA 4OFBA 2QTBA 3HACA 3FZGA 4DAEA 1B3QA 1KRXA 1XXLA 2H1VA 3GVMA 2ANBA 5G2OA 1L7NA 1U4OA 2FZCA 2GA9A 5FWAA 3U4GA 5H4GA 3IL2A 3AM3A 5CH3A 3G71V 2BOVA 2B4QA 1B00A 4FINA 2MMGA 1NLFA 4HK4A 3OZRA 4JI3O 1GTL1