4O32A

Structure of a malarial protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
b'NTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal structure and solution characterization of the thioredoxin-2 from Plasmodium falciparum, a constituent of an essential parasitic protein export complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4o32A00
3WGEA 1PL2A 4EDYA 4PGTA 1ZMAA 1U3IA 1SKSB 2H6ZA 1NHOA 3TKQA 4N11A 1SKRB 2MMZA 4KAEA 2VLUA 1XWCA 1ML6A 1XWAA 2X8HA 5DQSA 1LU4A 4GSSA 5G30A 3KMNA 1ZOFA 1I5GA 2MMOA 4ECBA 1GUMA 2E0QA 1BJXA 2H0IA 1SD8A 3DVWA 3KTBA 2G2QA 4EVMA 4ZB9A 2RLIA 4BWQA 4PUFC 8GSSA 2B1LA 1GNEA 4KCAA 1VF2A 2LS5A 4HOJA 4AGSA 1E2YA 2IIYA 4D73A 2KP2A 2RUEA 4ZL8A 14GSA 3C1RA 3ZMKA 4BWSA 3IV4A 4HDEA 3IXRA 3A2XA 5IM9A 2OE3A 1V40A 6GSWA 3E3EA 4OFNA 1O8WA 3U6VA 3VPQA 4J57E 1UN2A 1YEXA 2GT6A 4XCSA 4I5QA 2IPAA 3ERGA 4BVXA 3O76A 3VLNA 5G5FA 2IMDA 3LSZA 2OADA 2HNLA 5D9TA 4MZWA 4I8BA 5IOXA 5AISA 1QXHA 1ZGNA 2VD0A 3M9JA 3UL3A 4LL4B 3HY2A 4ECJA 4V1Ap 4EDZA 3UOMA 3D21A 3OR5A 2C3TA 5IMDA 3TOUA 4K7IA 2OBIA 3TRXA 5FHIA 2CA8A 4XS4A 3W8JA 4N0VA 3TKSE 5E4WA 2GTUA 2V6OA 2F8AA 2LJAA 2YANA 1M2DA 1XW5A 1SENA 4I2UA 2I81A 4ILFA 1K0OA 4K2DA 4QL7A 5J4UA 2H74A 4KE3A 2P0GA 5HR0A 1Y25A 4XHMA 4AJ6A 3TOTA 3UBKA 4ZBDA 3FZ9A 2L57A 5INYA 3HYPA 4HJ2A 2QC7A 3M8NA 5ID2A 5LCZA 5J41A 2DC5A 4KCEA 1F3BA 4MPGA 5D9VA 3GURA 2C4JA 4DVCA 4NHWA 5A4VA 2WJUA 3GSSA 1ST9A 1S3CA 3L9SA 2RM5A 2VD1A 3FY7A 1YY7A 5IO0A 3VK9A 4X43A 3FHKA 2L6DA 2H1DA 5DBQA 2H0HA 3LJRA 2O85A 2K8VA 5DCHA 1SU9A 3QCPA 3DIEA 3UARA 2R3XA 4EO3A 4O92A 1FHEA 3I9V2 2LTKA 2LRNA 4NAXA 3JCML 2DJ2A 4MDCA 2ON5A 1A23A 2PGTA 3G7IA 3EWLA 2D2ZA 2H76A 2LRCA 4L0WA 2VOCA 2JU5A 1GL8A 1OC9B 3TJFA 3L9UA 2ZUPA 2K9FA 2FWEA 4K7OA 5E59A 4HQZA 4RI7A 4IW9A 3TKSA 2HYXA 4WF5A 3FRCA 2VL2A 2CVDA 1O8XA 4O32A 1HNCA 3GHAA 5H5RA 3O6TA 2PPTA 4POKA 5A4WA 5D9WA 3GKNA 3F3QA 4KGIA 1AW9A 2YJ7A 2JSYA 5ECPB 3GKXA 4K1FA 5B7CA 4XRDA 1BX9A 1OKDA 5DDLA 5LNKe 5IMFA 3DD3A 2H6XA 3EMXA 3RHBA 2CT6A 3F3RA 1YZXA 2B5XA 4KSOA 3LFLA 5D8IA 2MMNA 3ED3A 5CAXA 1QFNA 4NV5A 4K7NA 1GTBA 2TIRA 2ZNMA 1PKZA 2KUCA 1YKAA 1AQXA 5J5NA 1VF3A 3IAS2 2WULA 3GFKA 2YWNA 1A0RP 4KX4A 3EURA 3GL3A 3H79A 2I9HA 1GNWA 3TCOA 3DWVA 3F9UA 4OCFA 4IJIA 4N0ZA 1AXDA 1K0AA 5F8BA 3CRTA 2H1BA 2GSRA 3HZ4A 4ISDA 4JRRA 3L9VA 1EOHA 3FR6A 2YNXA 2DBCA 1TRWA 3HJMA 1SJZA 4YQMA 3GX0A 3H8QA 1OAZA 3GMFA 1KTEA 4WF4A 2L4QA 2NBSA 4OO4A 5ECRB 2OJLA 1W4VA 1K3LA 3Q19A 1EEMA 3ZYWA 2LNTA 3RBTA 3KH7A 1GSYA 4IP1A 4JE1A 3GSTA 2B6MA 3VURA 2KOKA 1F6MC 4KDYA 4FIWA 5GSTA 3UJ1A 1T4YA 1FOVA 1DSBA 1TRUA 3HVSA 3KTLA 2P5QA 3EU3A 1THXA 10GSA 2A2RA 3H4KA 1HD2A 4X0XA 1GSUA 1F2EA 3C1SA 2B7JA 3IK9A 1GP1A 1PN9A 3O3TA 3CRUA 1K3OA 5L71A 18GSA 4HS1A 3F4SA 3MDKA 1SK1A 3J7Yb 3ZZXA 5G1LA 4XS1A 4LA1A 1JFUA 2C0DA 2ES7A 1EOGA 3M9KA 4JBBA 5DVBA 1WPIA 3PH9A 1ACVA 3E0UA 2AYTA 4O7HA 2H73A 5EL8A 2PVQA 2HSYA 4D73B 2GQKA 2VL9A 1OC3A 2E7PA 2VM1A 1GRXA 1T7PB 3LYPA 3G7JA 3IPZA 3VFIA 2XBQA 2P31A 3I6AA 17GSA 2YJHA 1BG5A 1FO5A 4V1Ag 4ZBAA 4PNGA 4WEYA 5EY6A 4RQXA 3WYWA 2R2JA 5EVOA 4L5LA 2B5YA 4HZ2A 5ECKB 2YP6A 1TI1A 2DIYA 4ZL9A 4CW9A 3WD6A 4TXOA 3SWLA 3D0ZA 1TKDB 1VGLA 2OACA 3PGTA 1VF4A 4CDOA 4I97A 2CZ2A 3GKKA 1QUWA 2VCTA 2X99A 4OMVA 2V2GA 1K0NA 2IL3A 3LQ7A 3CTFA 1Q98A 1TTZA 1EWXA 4MA9A 2LV3A 2LQOA 3HJOA 3C7MA 4TKYA 3QFAC 1GLPA 4K8MA 1G7OA 4Q5NA 3US3A 1PRXA 1X0RA 3EYTA 3VWVA 3NIVA 4XS4B 1ABAA 3UVTA 5ECIB 3VWXA 1EZKA 3NOFA 4KH7A 2VIMA 3HVXA 1S3AA 5HR1A 1BEDA 1DBYA 1SKWB 1XFLA 4KDXA 3ZITA 3DXBA 4K0GA 5A4UA 1PQNA 4XS6A 1MEKA 3CMIA 2WRTA 1KNGA 3DVXA 1VF1A 2HT9A 4TXVA 3H93A 2LJRA 4HUAA 2GQMA 2BTOT 1ILOA 5ID2B 4TR3A 4Z7XA 3NZNA 4G10A 1HNBA 4JZQA 2XPEA 1BYEA 1FB0A 1XCCA 3DRNA 4POBA 3FZ4A 1U3AA 1VRSD 1Q4JA 4JEDA 2M46A 22GSA 4TN8A 2WFCA 4QL9A 1B8XA 2YWIA 4BVYA 1TU8A 3UIWA 1KBNA 3UMAA 1WOUA 3KGKA 1I9DA 1MTCA 1PKWA 2O87A 5KN0A 1YJ6A 4GRFA 5KEJA 1AIUA 1ERTA 1EGOA 1U87A 2L5LA 4P3YB 4OFTA 1TW9A 2FD3A 5JWRB 3E9JB 2GSQA 1XOAA 3KH9A 2J23A 4TR0A 5KN1A 5ABRA 2QKEA 3WT2A 1XWGA 2JACA 4L5OA 1R7HA 1YKCA 2IMIA 3ZIVA 4GLTA 2CZ3A 1M2AA 4Q5FA 2KP1A 4J2FA 1X5DA 1PSQA 2H19A 3EVIA 5JCUA 2AHEA 3BBYA 4LMWA 3I69A 2N5FA 5A5KA 1XWKA 4GF0A 1GWCA 4IELA 3CYNA 3IC4A 1PD21 3LWAA 2GVPA 3QAWA 3CSHA 2MBSA 1EP8A 2XPDA 4PX1A 3ZMLA 3EINA 4N30A 3BCKA 3TKPA 1GULA 3APSA 3KJYA 5C04A 5GAND 4GWRA 5D96A 1GTIA 4K6XA 3F0IA 9GSSA 1IYIA 1SL1B 1K0DA 4MPFA 2IMEA 5AN1A 3FZ5A 1TJDA 4F03A 4K9ZA 3IE3A 4GTUA 4ZB6A 2O7KA 3ZVJA 3M1GA 2HXKA 1O85A 4LL1B 3GA4A 4LMVA 4GQFA 1SYXA 3A2VA 2YV7A 3RPPA 1G0TA 2DJ1A 4ZBBA 5D9XA 5GZZB 3G7YA 3IA1A 4G2EA 1A2JA 3HKRA 1GSFA 5G5EA 2PU9C 1MD4A 1MDKA 4MP4A 3PR8A 4ML1A 1UA5A 1OYJA 1E6BA 2HLSA 3ERFA 4H86A 1XXUA 3ISOA 1ZL9A 2EC4A 4HQSA 1LJRA 3UVHA 4EF0A 2L6CA 2VCZA 3F6FA 3HJPA 1UVZA 1M99A 3CSIA 2V32A 1M9AA 2H71A 2DJ0A 2LQQA 2XBIA 4ECCA 1TRSA 1QGVA 1XOBA 2H01A 4EUYA 2FA8A 3ME7A 5GSSA 5HR2A 1T00A 2IJYA 1PGTA 3CSJA 5ECLB 3ZTLA 2M80A 1GTAA 2JSZA 2HFDA 5J9BA 2CAIA 3QAGA 1FAAA 1NM3A 2ZCTA 1Z6MA 4JR6A 3C73A 2DIZA 4KA0A 3GN3A 2YCDA 1QQ2A 3ERWA 2WZ9A 3ZLPA 13GSA 4WBJA 4YQUA 4YH2A 2FWFA 4PNFA 4ML6A 3FKFA 1EEJA 2FY6A 3D5JA 2E2MA 2C3NA 1NSWA 5DQYA 1YDKA 1JLWA 4XTSA 4E8EA 2JADA 1T1VA 2FWHA 5C00A 3MWHA 2P5RA 4MABA 1GUKA 2C8UA 3A2WA 4IVFA 1FVKA 2AAWA 5CYYA 4ID0A 2JZRA 4GCIA 2DJ3A 3GKMA 4K0NA 3F6DA 2JZTA 1EGRA 3EMPA 2HRFA 2DMMA 2C0FA 2RM6A 5F07A 2VCQA 2IFQA 4V2LA 1TDIA 3D4TA 2H72A 5ECMB 1SD9A 2HZEA 4HEA2 2YZHA 2R5GA 4TXOB 4JU5A 3F4RA 4KB3A 5AIVA 3QPMA 3KP9A 1LBKA 1K3YA 3RAZA 4WXTA 1A8YA 5HR3A 3I43A 5H5QA 3DKSA 3UBLA 2G0FA 3TJKA 1PX6A 5IPGA 2KHPA 3TJGA 3AY8A 2M72A 3TJJA 4FH8A 3TGZA 2LNSA 4LLRA 4OO5A 1V57A 1V98A 1AC1A 2J9HA 4NXIA 4PQ1A 2VL3A 2NDOA 4NMUA 1ERWA 6GSSA 2L4CA 4Q5QA 1B48A 3HD5A 3FR9A 2YWOA 4NV2A 4IJ3A 5JWQB 3TJBA 3L0HA 5G2ZA 4OCEA 4IBPA 2IN3A 3D22A 4TVEA 1ZYEA 1AUCA 4I2TA 1T4ZA 2CVBA 2L59A 4KSMA 3QOUA 4NHZA 4POMA 1ZCPA 1K0BA 1Z6NA 1AQVA 1USBA 1WWJA 2FUG2 3HVVA 2YOIA 3TRQA 4ZIJA 3IBHA 4NWYA 1OE8A 11GSA 1G6WA 1TRVA 4CHSA 4RUVA 1URMA 1NW2A 4KNDA 2YPMA 2MZCA 3GX8A 5B6NA 3WGXA 1SK2A 1WRYA 3MSZA 1SJIA 5CNWA 3LGCA 4TW5A 1TI3A 4MF5A 3VWUA 4G19A 4F0CA 2WGRA 1J0FA 1F9MA 2LSTA 2VAFA 4DSQA 2DJKA 2WS2A 3VPTA 2WCIA 3FK8A 2VO4A 3Q6OA 2CVKA 3P8WA 1JLVA 5B6MA 2GZPA 3U5RE 4MF7A 3P7XA 1Y6EA 5DCGA 3KD0A 2F9SA 2LRTA 3EC3A 2LJKA 1X9WB 3WGDA 3LG6A 1J08A 5ELAA 4G9HA 3GV1A 3L78A 1U6TA 2H1GA 6GSVA 1N2AA 2V41A 1WP0A 1PL1A 1SL0B 1RK4A 2VUPA 3HA9A 3HZ8A 4WKWA 2YV9A 5ENUA 3IOSA 4KUNA 4QQ7A 1K0CA 1FW1A 2R6KA 3FR3A 3TDGA 1BAYA 5IMVA 6GSTA 2H6YA 2FNOA 3BD2A 2CV4A 4KW6A 2L5OA 2AB6A 1XWBA 3FZAA 5CREA 2MMAA 4MK3A 1M2BA 4AJ7A 2NVLA 2VCVA 5HFKA 1WJKA 5JCGA 1EV4A 1M9BA 1OC8A 4WR5A 4PQIA 1PA3A 4WETA 3ZIJA 4AF2A 1JZOA 1A8LA 3GH9A 3W6GA 4MJAA 2CQ9A 4V2MA 1SK0A 4V2NA 2DSAA 2V6KA 4IN0A 3H1NA 3LYKA 1MDJA 3QFBC 4IQAA 3TKRA 4ECIA 3PINA 19GSA 1GH2A 4XIHA 4PUAA 4EC0A 5KN3A 3ZFLA 5IMAA 3RHCA 2R37A 1B9XC 4MH2A 5ELGA 3GTUA 4X1UA 1ERUA 1TK0B 2H8LA 2TRXA 3RDWA 4F0BA 2GQLA 3LORA 1QK8A 3F8UA 1PX7A 1JHBA 1R5AA 5DAKA 2VCXA 3MAKA 4FYUA 5IMCA 3P90A 1WIKA 2C0EA 3TUEA 4DEJA 4YAVA 1B4PA 2K6VA 2WDUA 3EU4A 3K8NA 2R4VA 1M0UA 3QD9A 2BMXA 3ZFBA 4MJBA 1X5EA 4DSSA 1YF1A 5ECOB 5D93A 1XVQA 1ON4A 1DE1A 2FHEA 5B8BA 2JZSA 4TR1A 2RUFA 3C8EA 3GNJA 4FYBA 5D73A 5J3RA 3L4NA 5IQYA 1DE2A 2Z9SA 1M7TA 2QGVA 1OKTA 2RIIA 5DALA 3KM6A 2VM2A 3QR6A 5DJLA 2PERA 3UAPA 1YEPA 3GIXA 5H5SA 4POLA 3ZVJD 2C80A 1OVNA 1W89A 3VI5A 3TB2A 2F51A 3GH6A 3CTGA 4PURA 2HRNA 4F9ZA 1O6JA 1MDIA 3ZREA 2DMLA 4HJMA 1B4QA 4JR4A 3QDNA 1CQGA 4WR4A 3FYGA 5KN2A 4MJEA 2MYGA 2K8SA 2TRCP 1GTUA 2HE3A 3IDVA 4ZILA 2LUSA 2B7KA 4J56E 1ZYQB 2REMA 4MJCA 6GSYA 1Z9HA 2IFQB 2DLXA 1Z5YE 1O73A 5EPFA 3S9FA 2HZEB 3W8SA 4IGJA 2B5EA 1T8EB 2V1MA 1NHYA 5G31A 2H30A 2QSIA 2LEGA 4O5RA 1QMVA 1JZDA 1S3DA 4MLYA 1B9YC 16GSA 3R2QA 3KP8A 3QAVA 2GGTA 2YN1A 2GDRA 1V9WA 1HNAA 5CRHA 4MF6A 3D4MA 1EV9A 1TU7A 3KMOA 5J9CA 4Q5RA 3VI7A 1XW9A 2ALBA 1V58A 2HSHA 2IWTA 5LD0A 3IRAA 1GUHA 4FO5A 4MCUA 1R5PA 1XW6A 3KZQA 1XIYA 12GSA 3KIJA 2VLVA 2F3MA 4XRAA 2C1YA 4BPYA 2GSSA 3LXTA 5ECNB 1X5CA 1X9SB 1FB6A 4EE0A 3MNGA 1HYUA 1GLQA 1WMJA 3HDCA 2B3SA 2BJXA 4ZL7A 5CRWA 2YZUA 1V2AA 2EIRA 1H4OA 2H66A 2CX3A 3F63A 3P2AA 5CP1A 4F2IA 3D6IA 3KEBA 4OFMA 1YF0A 2OA7A 2KLXA 3Q18A 5B8AA 1TP9A 4MH3A 3N9JA 3ZRDA 3Q74A 1FVJA 2NPBA 1XZOA 1TOFA 5HQPA 2E2GA 1XBSA 5FWGA 5IIZA 3TRPA 2GS3A 4FYCA 1X9MB 1J9BA 2GLRA 5F0GA 2H0GA 3HCZA 4TR4A 5FT3A 3KXOA 4RQRA 2F8FA 4L8EA 1AAZA 5COHA 2GZYA 2MBTA 3GUSA 2PMTA 1HQOA 4ACSA 5ECSA 4HU9A 2A4VA 1K0MA 1O81A 4HI7A 1H75A 2X8CA 2IMKA 4ZB8A 4N10A 2AV4A 1GSEA 2FLSA 2HI7A 1T3BA 1RQMA 2YWMA 5G1KA 1ERVA 3FEUA 1WE0A 2EIOA 2PN8A 2PWJA 2X64A 2I4AA 2PBJA 2AJQB 3QMXA 3LEFA 4BL7A 1R26A 2FA4A 1A0FA 2FCHA 2I3YA 4IQ1A 3CXGA 2EIQA 2C3QA 5CO3A 5F06A 5HFGA 1XPVA 4PXOA 4KDUA 5JWOB 4MMMA 3WT1A 1OE7A 5IPHA 1DUGA 5AGYA 2OE0A 5IO2A 20GSA 1C72A 3J7Yk 1SL2B 2HZFA 3DGQA 2VLTA 1A2LA 1CQHA 4HZ4A 2H75A 4ULXA 4OWYA 2FWGA 1N8JA 1A24A 1O7UA 1TXXA 1KEBA 4RI6A 4HU7A 1JZRA 3IK7A 4NPBA 2C0GA 5F05A 1MD3A 5CRGA 4I6XA 2H70A 4IP6A 2N5AA 1F37A 5JCWA 2ON7A 4L0UA 3ME8A 5AIXA 2CAQA 1OC9A 1GSSA 3A5WA 2PVOC 3DMLA 3KCMA 4EXJA 2X8GA 3APQA 3GTUB 3A3TA 2CX4A 4ZXGA 5DJMA 4TRXA 2VCWA 3IHQA 3M0FA 1TK5B 4IS0A 3DEXA 2O8VB 5IOWA 1GSDA 2GSTA 4F82A 1F3AA 2GZZA 4GSTA 5DAKB 2O89A 1XVWA 2H1AA 3GRXA 3G9BA 4DSRA 3V1WA 4E8HA 3IAM2 1GSQA 3BCIA 1UC7A 1JZWA 4WBRD 1EP7A 1G6YA 3SBCA 4DSSB 1SYRA 3CBUA 2XHFA 3HXSA 2DJJA 3ZL5A 2IMFA 5GAPD 3GYKA 3IR4A 3TKSC 4TR1B 2A2SA 2GT5A 3N5OA 1G7EA 2VL2C 4EKZA 3VWWA 1BQ7A 3RPNA 1Z7RA 3GL5A 4OD7A 3C71A 1YQ1A 4MZCA 1IYHA 3BOAA 4PQHA 1THOA 1ZZYA 5DALB 4TOPA 2JL4A 7GSSA 4IHUA 4BA7A 5IMZA 2OBKA 3EE2A 2WB9A 4EL1A 2NTOA 4AJ8A 4MZBA 2K18A 4IKHA 3M3MA 4GSNA 2PUKC 1PMTA 6GSUA 2I1UA 3UEMA 2AUVA 1TK8B 3BJ5A 1U88A 3DYRA 2N5BA 5ECHB 2OKAA 4YQVA 1AQWA 1FG4A 1Z7PA 2OE1A 3LXZA 5CRDA 2B1KA 2FGXA 1A2MA 1R4WA 1RW1A 3HHVA 4GQCA 3F4TA 1SJ6A 1Z3EA 2XC2A 4YAPA 5HFIA 3FW2A 4GXZA 6GSXA 2LKUA 3APOA 5ECQB
chains in the Genus database with same CATH superfamily
3WGEA 1PL2A 4EDYA 4PGTA 1ZMAA 1U3IA 1SKSB 2H6ZA 1NHOA 3TKQA 4N11A 1SKRB 2MMZA 4KAEA 2VLUA 1XWCA 1ML6A 1XWAA 2X8HA 5DQSA 1LU4A 4GSSA 5G30A 3KMNA 1ZOFA 1I5GA 2MMOA 4ECBA 1GUMA 2E0QA 1BJXA 2H0IA 4G0IA 1SD8A 3DVWA 3KTBA 2G2QA 4EVMA 4ZB9A 2RLIA 4BWQA 4PUFC 8GSSA 2B1LA 1GNEA 2R0PA 4KCAA 1VF2A 2LS5A 4HOJA 4AGSA 1E2YA 2IIYA 4D73A 2KP2A 2RUEA 4ZL8A 14GSA 3C1RA 3ZMKA 4BWSA 3IV4A 4HDEA 3HVNA 3IXRA 3A2XA 5IM9A 2OE3A 1V40A 6GSWA 3E3EA 4OFNA 1O8WA 3U6VA 3VPQA 4J57E 1UN2A 4BIKA 1YEXA 2GT6A 4XCSA 4I5QA 2IPAA 3ERGA 1S3RA 4BVXA 3O76A 3VLNA 5G5FA 2IMDA 3LSZA 2OADA 2UZ8A 2HNLA 5D9TA 4MZWA 4I8BA 5IOXA 5AISA 1QXHA 1ZGNA 2VD0A 3M9JA 3UL3A 4LL4B 3HY2A 4ECJA 4V1Ap 4EDZA 3UOMA 3D21A 3OR5A 2C3TA 5IMDA 3TOUA 4K7IA 2OBIA 3TRXA 5FHIA 2CA8A 4XS4A 3W8JA 4N0VA 3TKSE 5E4WA 2GTUA 2V6OA 2F8AA 2LJAA 2YANA 1M2DA 1XW5A 1SENA 4I2UA 2X49A 2I81A 4ILFA 1K0OA 4K2DA 4QL7A 5J4UA 1PN0A 2H74A 4KE3A 2P0GA 5HR0A 1Y25A 4XHMA 4AJ6A 3TOTA 3UBKA 4ZBDA 3FZ9A 2L57A 5INYA 3HYPA 4HJ2A 2QC7A 3M8NA 5ID2A 5LCZA 5J41A 2DC5A 4KCEA 1F3BA 4MPGA 5D9VA 3GURA 2C4JA 4BL7B 4DVCA 4NHWA 5A4VA 2WJUA 3GSSA 1ST9A 1S3CA 3L9SA 2RM5A 2VD1A 3FY7A 1YY7A 5IO0A 3VK9A 4X43A 3FHKA 2L6DA 2H1DA 5DBQA 2H0HA 3LJRA 2O85A 2K8VA 1PFOA 5DCHA 1SU9A 3QCPA 3DIEA 3UARA 2R3XA 4EO3A 1FOHA 4O92A 1FHEA 3I9V2 2LTKA 2LRNA 4NAXA 3JCML 2DJ2A 4MDCA 2ON5A 1A23A 2PGTA 3G7IA 3EWLA 2D2ZA 2H76A 2LRCA 4L0WA 2VOCA 2JU5A 1GL8A 1OC9B 3TJFA 3L9UA 2ZUPA 2K9FA 2FWEA 4K7OA 5E59A 4HQZA 3IC8A 4RI7A 4IW9A 3TKSA 2HYXA 4WF5A 3FRCA 2VL2A 4G0LA 2CVDA 1O8XA 4O32A 2QA2A 1HNCA 1M3IA 3GHAA 3O6TA 5H5RA 2PPTA 4POKA 5A4WA 5D9WA 3GKNA 3F3QA 4KGIA 1AW9A 2YJ7A 2JSYA 5ECPB 3GKXA 4K1FA 5B7CA 4XRDA 1BX9A 1OKDA 5DDLA 3CQFA 5LNKe 5IMFA 3DD3A 2H6XA 3EMXA 3RHBA 2CT6A 3F3RA 1YZXA 2B5XA 4KSOA 3LFLA 5D8IA 2MMNA 3ED3A 5CAXA 1QFNA 4NV5A 4K7NA 1GTBA 2TIRA 2ZNMA 1PKZA 2KUCA 1YKAA 1AQXA 5J5NA 1VF3A 3IAS2 2WULA 3GFKA 2YWNA 1A0RP 4KX4A 3EURA 4YKFA 3GL3A 3H79A 2I9HA 4Z2RA 1GNWA 3TCOA 3DWVA 3F9UA 4OCFA 4IJIA 4N0ZA 1AXDA 1K0AA 5F8BA 3CRTA 2H1BA 2GSRA 3HZ4A 4ISDA 4JRRA 3L9VA 1EOHA 3FR6A 2YNXA 2DBCA 1TRWA 3HJMA 1SJZA 4YQMA 3GX0A 3H8QA 1OAZA 3GMFA 1KTEA 4WF4A 2L4QA 2NBSA 4OO4A 5ECRB 2OJLA 1W4VA 1K3LA 3Q19A 1EEMA 3ZYWA 2LNTA 3RBTA 3KH7A 1GSYA 4IP1A 4JE1A 2HRAA 3GSTA 2B6MA 3VURA 2KOKA 1F6MC 4KDYA 4FIWA 5GSTA 3UJ1A 1T4YA 1FOVA 1DSBA 1TRUA 3HVSA 3KTLA 2P5QA 3EU3A 1THXA 10GSA 2A2RA 3H4KA 1HD2A 4X0XA 1GSUA 1F2EA 3C1SA 2B7JA 3IK9A 1GP1A 1PN9A 3O3TA 3CRUA 1K3OA 5L71A 18GSA 4HS1A 3F4SA 3MDKA 1SK1A 3J7Yb 3ZZXA 5G1LA 4XS1A 4LA1A 1JFUA 2C0DA 2ES7A 1EOGA 3M9KA 4JBBA 5DVBA 1WPIA 3PH9A 1ACVA 3E0UA 2AYTA 4O7HA 2H73A 5EL8A 2PVQA 2HSYA 4D73B 2GQKA 2VL9A 1OC3A 2E7PA 2VM1A 1GRXA 1T7PB 3LYPA 3G7JA 3IPZA 3VFIA 2XBQA 2P31A 3I6AA 17GSA 2YJHA 1BG5A 1FO5A 4V1Ag 4ZBAA 4PNGA 4WEYA 5EY6A 4RQXA 3WYWA 2R2JA 5EVOA 4L5LA 2B5YA 4HZ2A 5ECKB 2YP6A 1TI1A 2DIYA 4ZL9A 4CW9A 3WD6A 4TXOA 3SWLA 3D0ZA 1TKDB 1VGLA 2OACA 3PGTA 1VF4A 4CDOA 4I97A 2CZ2A 3GKKA 1QUWA 4K2XA 4BVXB 2VCTA 2X99A 4OMVA 2V2GA 1K0NA 2IL3A 3LQ7A 3CTFA 1Q98A 1TTZA 1EWXA 4MA9A 2LV3A 2LQOA 3HJOA 3C7MA 4TKYA 3QFAC 1GLPA 4K8MA 1G7OA 4Q5NA 3US3A 1PRXA 4YKGA 1X0RA 3EYTA 3VWVA 3NIVA 4XS4B 1ABAA 3UVTA 5ECIB 3VWXA 1EZKA 3NOFA 4KH7A 2VIMA 3HVXA 1S3AA 5HR1A 1BEDA 1DBYA 1SKWB 1XFLA 4KDXA 3ZITA 3DXBA 4K0GA 5A4UA 1PQNA 4XS6A 3A5IA 4O5QA 1MEKA 3CMIA 2WRTA 4CY8A 1KNGA 3DVXA 1VF1A 2HT9A 4TXVA 3H93A 2LJRA 4HUAA 2GQMA 2BTOT 1ILOA 5ID2B 4TR3A 4Z7XA 3NZNA 4G10A 1HNBA 4JZQA 2XPEA 1BYEA 1FB0A 1XCCA 3DRNA 4POBA 4HSCX 1M3JA 3FZ4A 1U3AA 1VRSD 1Q4JA 4JEDA 2M46A 22GSA 4TN8A 2WFCA 4QL9A 1B8XA 2YWIA 4BVYA 1TU8A 3UIWA 1KBNA 3UMAA 1WOUA 4K5SA 3KGKA 1I9DA 1MTCA 1PKWA 2O87A 5KN0A 1YJ6A 4GRFA 5KEJA 1AIUA 1ERTA 1EGOA 1U87A 2L5LA 4P3YB 4OFTA 1TW9A 2FD3A 5JWRB 3E9JB 2GSQA 1XOAA 3KH9A 2J23A 4TR0A 5KN1A 5ABRA 2QKEA 3WT2A 1XWGA 2JACA 4L5OA 1R7HA 1YKCA 2IMIA 3ZIVA 4GLTA 2CZ3A 1M2AA 4Q5FA 2KP1A 3IHGA 4J2FA 1X5DA 1PSQA 2H19A 3EVIA 5JCUA 2AHEA 3BBYA 4LMWA 3I69A 2N5FA 5A5KA 1XWKA 4GF0A 1GWCA 4IELA 3CYNA 3IC4A 4FQUA 1PD21 3LWAA 2GVPA 3QAWA 3CSHA 2MBSA 1EP8A 2XPDA 4PX1A 3ZMLA 3EINA 4N30A 3BCKA 3TKPA 1GULA 3APSA 3KJYA 5C04A 5GAND 4GWRA 4G0KA 5D96A 1GTIA 4K6XA 3F0IA 9GSSA 1IYIA 1SL1B 1K0DA 4MPFA 2IMEA 5AN1A 3FZ5A 1TJDA 4F03A 4K9ZA 3IE3A 4GTUA 4ZB6A 2O7KA 3ZVJA 3M1GA 2HXKA 1O85A 4LL1B 3GA4A 4LMVA 4GQFA 1SYXA 3A2VA 2YV7A 3RPPA 1G0TA 2DJ1A 4ZBBA 5D9XA 5GZZB 3G7YA 3IA1A 4G2EA 1A2JA 3HKRA 1GSFA 5G5EA 2PU9C 2DKHA 1MD4A 1MDKA 4MP4A 3PR8A 4ML1A 1UA5A 1OYJA 1E6BA 2HLSA 3ERFA 4H86A 1XXUA 3ISOA 1ZL9A 2EC4A 4HQSA 1LJRA 3UVHA 4EF0A 2L6CA 2VCZA 2HSMA 3F6FA 3HJPA 1UVZA 4USSA 1M99A 3CSIA 2V32A 1M9AA 2H71A 2DJ0A 2LQQA 2XBIA 4ECCA 1TRSA 1QGVA 1XOBA 2H01A 4EUYA 2FA8A 3ME7A 5GSSA 5HR2A 2DKIA 1T00A 2IJYA 1PGTA 3CSJA 5ECLB 3ZTLA 2M80A 1GTAA 2JSZA 2HFDA 5J9BA 2CAIA 3QAGA 1FAAA 1NM3A 2ZCTA 1Z6MA 3R3EA 4JR6A 3C73A 2DIZA 4KA0A 3GN3A 2YCDA 1QQ2A 3ERWA 2WZ9A 3ZLPA 13GSA 4WBJA 4YQUA 4YH2A 2FWFA 4PNFA 4ML6A 3FKFA 1EEJA 2FY6A 3D5JA 2E2MA 2C3NA 1NSWA 5DQYA 1YDKA 1JLWA 4XTSA 4E8EA 2JADA 1T1VA 2FWHA 5C00A 3MWHA 2P5RA 4MABA 1GUKA 2C8UA 3A2WA 4IVFA 1FVKA 2AAWA 5CYYA 4ID0A 2JZRA 4GCIA 2DJ3A 3GKMA 4K0NA 3F6DA 2JZTA 1EGRA 3EMPA 2HRFA 2DMMA 2C0FA 2RM6A 5F07A 2VCQA 2IFQA 4V2LA 1TDIA 3D4TA 2H72A 5ECMB 1SD9A 2HZEA 4HEA2 2YZHA 2R5GA 4TXOB 4JU5A 3F4RA 4KB3A 5AIVA 3QPMA 3KP9A 5KOXA 1LBKA 1K3YA 3RAZA 4WXTA 1A8YA 5HR3A 3I43A 5H5QA 3DKSA 3UBLA 2G0FA 3TJKA 1PX6A 5IPGA 2KHPA 3TJGA 3AY8A 2M72A 3TJJA 4Z2TA 4FH8A 3TGZA 2LNSA 4LLRA 4OO5A 1V57A 1V98A 1AC1A 2J9HA 4NXIA 4PQ1A 2VL3A 2NDOA 4NMUA 2R0GA 1ERWA 6GSSA 2L4CA 4Q5QA 1B48A 3HD5A 3FR9A 2YWOA 4NV2A 4IJ3A 5JWQB 3MYDA 3TJBA 3L0HA 5G2ZA 4CY6A 4OCEA 4Z2UA 4IBPA 2IN3A 3D22A 4TVEA 1ZYEA 1AUCA 4I2TA 1T4ZA 2CVBA 2L59A 4KSMA 3QOUA 4NHZA 4POMA 1ZCPA 1K0BA 1Z6NA 1AQVA 1USBA 1WWJA 2FUG2 3HVVA 2YOIA 3TRQA 4ZIJA 3IBHA 4NWYA 1OE8A 11GSA 1G6WA 1TRVA 4CHSA 4RUVA 1URMA 1NW2A 4KNDA 2YPMA 2MZCA 3GX8A 5B6NA 3WGXA 4KF9A 1SK2A 1WRYA 3MSZA 1SJIA 5CNWA 3LGCA 4TW5A 1TI3A 4MF5A 3VWUA 4G19A 4F0CA 2WGRA 1J0FA 1F9MA 2LSTA 2VAFA 4DSQA 1ZYNA 2DJKA 2WS2A 4BVYB 3VPTA 2WCIA 3FK8A 2VO4A 3Q6OA 2CVKA 3P8WA 1JLVA 5B6MA 2GZPA 3U5RE 4MF7A 3P7XA 1Y6EA 5DCGA 3KD0A 2F9SA 2LRTA 3EC3A 2LJKA 1X9WB 3WGDA 3LG6A 1J08A 5ELAA 4G9HA 3GV1A 3L78A 1U6TA 2H1GA 6GSVA 1N2AA 2V41A 1WP0A 1PL1A 1SL0B 1RK4A 2VUPA 3HA9A 3HZ8A 4WKWA 2YV9A 5ENUA 3IOSA 4KUNA 4QQ7A 1K0CA 1FW1A 2R6KA 3FR3A 3TDGA 1BAYA 5IMVA 6GSTA 2H6YA 2FNOA 3BD2A 2CV4A 4KW6A 2L5OA 2AB6A 1XWBA 3FZAA 5CREA 2MMAA 4MK3A 1M2BA 4AJ7A 2NVLA 2VCVA 5HFKA 1WJKA 5JCGA 1EV4A 1M9BA 1OC8A 4WR5A 4PQIA 1PA3A 4WETA 3ZIJA 4AF2A 1JZOA 1A8LA 3GH9A 3W6GA 4MJAA 2CQ9A 4V2MA 1SK0A 4V2NA 2DSAA 2V6KA 4IN0A 3H1NA 3LYKA 1MDJA 3QFBC 4IQAA 3TKRA 4ECIA 3PINA 19GSA 1GH2A 4XIHA 4PUAA 4EC0A 5KN3A 3ZFLA 5IMAA 3RHCA 2R37A 1B9XC 4MH2A 5ELGA 3GTUA 4X1UA 1ERUA 1TK0B 2H8LA 2TRXA 3RDWA 4F0BA 2GQLA 3LORA 4PTSA 1QK8A 3F8UA 1PX7A 1JHBA 2R0CA 1R5AA 5DAKA 2VCXA 2HRKA 3MAKA 4FYUA 5IMCA 3P90A 1WIKA 2C0EA 3TUEA 4DEJA 4YAVA 4O5UA 1B4PA 2K6VA 2WDUA 3EU4A 3K8NA 2R4VA 1M0UA 3QD9A 2BMXA 3ZFBA 4MJBA 1X5EA 4DSSA 1YF1A 5ECOB 5D93A 1XVQA 1ON4A 4EIPA 1DE1A 2FHEA 5B8BA 2JZSA 4TR1A 2RUFA 3C8EA 3GNJA 4FYBA 5D73A 1XG8A 5J3RA 3L4NA 5IQYA 1DE2A 2Z9SA 1M7TA 2QGVA 1OKTA 2RIIA 5DALA 3KM6A 2VM2A 3QR6A 5DJLA 2PERA 4X4JA 1YEPA 3GIXA 3UAPA 5H5SA 4POLA 3ZVJD 2C80A 1OVNA 1W89A 3VI5A 3TB2A 2F51A 3GH6A 3CTGA 4PURA 2HRNA 4F9ZA 1O6JA 1MDIA 3ZREA 2DMLA 4HJMA 1B4QA 4JR4A 3QDNA 1CQGA 4WR4A 3FYGA 5KN2A 3MIXA 4MJEA 2MYGA 2K8SA 2TRCP 1GTUA 2HE3A 3IDVA 4ZILA 2LUSA 2B7KA 4J56E 1ZYQB 2REMA 4MJCA 6GSYA 1Z9HA 2IFQB 2DLXA 1Z5YE 1O73A 5EPFA 3S9FA 2HZEB 3W8SA 4IGJA 2B5EA 1T8EB 4K5RA 2V1MA 1NHYA 5G31A 2H30A 2QSIA 2LEGA 4O5RA 1QMVA 1JZDA 1S3DA 4MLYA 1B9YC 16GSA 3R2QA 3KP8A 3QAVA 2GGTA 2YN1A 2GDRA 1V9WA 1HNAA 5CRHA 4MF6A 3D4MA 1EV9A 1TU7A 3KMOA 5J9CA 4Q5RA 3VI7A 1XW9A 2ALBA 1V58A 2HSHA 2IWTA 5LD0A 3IRAA 1GUHA 4FO5A 4MCUA 1R5PA 1XW6A 3KZQA 1XIYA 12GSA 3KIJA 2VLVA 2F3MA 4XRAA 2C1YA 4BPYA 2GSSA 3LXTA 5ECNB 1X5CA 1X9SB 1FB6A 4EE0A 3MNGA 1HYUA 1GLQA 1WMJA 3HDCA 2B3SA 2BJXA 4ZL7A 5CRWA 2YZUA 1V2AA 2EIRA 1H4OA 2H66A 2CX3A 3F63A 3P2AA 5CP1A 4F2IA 3FMWA 3D6IA 3EPTA 3KEBA 4OFMA 1YF0A 2OA7A 2KLXA 3Q18A 5B8AA 1TP9A 4MH3A 3N9JA 3ZRDA 3Q74A 1FVJA 2NPBA 1XZOA 1TOFA 5HQPA 2E2GA 1XBSA 4A5PA 5FWGA 5IIZA 3TRPA 2GS3A 4FYCA 1X9MB 1J9BA 2GLRA 5F0GA 2H0GA 3HCZA 4TR4A 5FT3A 4ICYA 3KXOA 4RQRA 2F8FA 4L8EA 1AAZA 5COHA 5KOWA 2GZYA 2MBTA 3GUSA 2PMTA 1HQOA 4ACSA 5ECSA 4HU9A 2A4VA 1K0MA 1O81A 4HI7A 1H75A 2X8CA 2IMKA 4ZB8A 4N10A 2AV4A 1GSEA 2FLSA 2HI7A 1T3BA 1RQMA 2YWMA 5G1KA 1ERVA 3PPUA 3FEUA 1WE0A 2EIOA 2PN8A 2PWJA 2X64A 2I4AA 2PBJA 2AJQB 3QMXA 3LEFA 4BL7A 1R26A 2FA4A 1A0FA 2FCHA 2I3YA 4IQ1A 3CXGA 2EIQA 2C3QA 5CO3A 5F06A 5HFGA 1XPVA 4PXOA 4KDUA 5JWOB 4MMMA 3WT1A 1OE7A 2X4AA 5IPHA 1DUGA 5AGYA 2OE0A 5IO2A 20GSA 1C72A 3J7Yk 1SL2B 2HZFA 3DGQA 2VLTA 1A2LA 1CQHA 4HZ4A 2H75A 4ULXA 4OWYA 2FWGA 1N8JA 1A24A 1O7UA 1TXXA 1KEBA 4RI6A 4HU7A 1JZRA 3IK7A 4NPBA 2C0GA 1MD3A 4I6XA 5CRGA 5F05A 2H70A 3LW9A 4IP6A 2N5AA 1F37A 5JCWA 2ON7A 4L0UA 3ME8A 5AIXA 2CAQA 1OC9A 1GSSA 3A5WA 2PVOC 3DMLA 3KCMA 4EXJA 2X8GA 3APQA 3GTUB 3A3TA 2CX4A 4ZXGA 5DJMA 4TRXA 2VCWA 3IHQA 3M0FA 1TK5B 4IS0A 3DEXA 2O8VB 5IOWA 1GSDA 2GSTA 4F82A 1F3AA 2GZZA 4GSTA 5DAKB 2O89A 1XVWA 2H1AA 3GRXA 3G9BA 4DSRA 3V1WA 4E8HA 3IAM2 1GSQA 3BCIA 1UC7A 1JZWA 1ZYPA 4WBRD 4MNNA 1EP7A 1G6YA 3SBCA 4DSSB 1SYRA 3CBUA 2XHFA 3HXSA 2DJJA 3ZL5A 2IMFA 5GAPD 3GYKA 3IR4A 3TKSC 4EIQA 4TR1B 2A2SA 2GT5A 3N5OA 1G7EA 2VL2C 4EKZA 3VWWA 1BQ7A 3RPNA 1Z7RA 3GL5A 5BRTA 4OD7A 3C71A 1YQ1A 4MZCA 1IYHA 3BOAA 4PQHA 1THOA 1ZZYA 5DALB 4TOPA 2JL4A 7GSSA 4IHUA 2A4HA 4BA7A 5IMZA 2OBKA 3EE2A 2WB9A 4EL1A 2NTOA 4AJ8A 4MZBA 2K18A 4IKHA 3M3MA 4GSNA 2PUKC 1PMTA 6GSUA 2I1UA 3UEMA 2AUVA 5BMUA 1TK8B 3BJ5A 2QA1A 1U88A 3DYRA 2N5BA 5ECHB 2OKAA 4YQVA 1AQWA 1FG4A 1Z7PA 2OE1A 3LXZA 5CRDA 2B1KA 2FGXA 1A2MA 1R4WA 2A2PA 1RW1A 3HHVA 4GQCA 3F4TA 1SJ6A 1Z3EA 2XC2A 4YAPA 5HFIA 3FW2A 4GXZA 6GSXA 2LKUA 3APOA 5ECQB
chains in the Genus database with same CATH topology
3WGEA 1PL2A 4EDYA 4PGTA 1ZMAA 1U3IA 1SKSB 2H6ZA 1NHOA 3TKQA 4N11A 1SKRB 2MMZA 4KAEA 2VLUA 1XWCA 1ML6A 1XWAA 2X8HA 5DQSA 1LU4A 4GSSA 5G30A 3KMNA 1ZOFA 1I5GA 2MMOA 4ECBA 1GUMA 2E0QA 1BJXA 2H0IA 4G0IA 1SD8A 3DVWA 3KTBA 2G2QA 4EVMA 4ZB9A 2RLIA 4BWQA 4PUFC 8GSSA 2B1LA 1GNEA 2R0PA 4KCAA 1VF2A 2LS5A 4HOJA 4AGSA 1E2YA 2IIYA 4D73A 2KP2A 2RUEA 4ZL8A 14GSA 3C1RA 3ZMKA 4BWSA 3IV4A 4HDEA 3IXRA 3A2XA 5IM9A 2OE3A 1V40A 6GSWA 3E3EA 4OFNA 1O8WA 3U6VA 3VPQA 4J57E 1UN2A 1YEXA 2GT6A 4XCSA 4I5QA 2IPAA 3ERGA 4BVXA 3O76A 3VLNA 5G5FA 2IMDA 3LSZA 2OADA 2UZ8A 2HNLA 5D9TA 4MZWA 4I8BA 5IOXA 5AISA 1QXHA 1ZGNA 2VD0A 3M9JA 3UL3A 4LL4B 3HY2A 4ECJA 4V1Ap 4EDZA 3UOMA 3D21A 3OR5A 2C3TA 5IMDA 3TOUA 4K7IA 2OBIA 3TRXA 5FHIA 2CA8A 4XS4A 3W8JA 4N0VA 3TKSE 5E4WA 2GTUA 2V6OA 2F8AA 2LJAA 2YANA 1M2DA 1XW5A 1SENA 4I2UA 2X49A 2I81A 4ILFA 1K0OA 4K2DA 4QL7A 5J4UA 1PN0A 2H74A 4KE3A 2P0GA 5HR0A 1Y25A 4XHMA 4AJ6A 3TOTA 3UBKA 4ZBDA 3FZ9A 2L57A 5INYA 3HYPA 4HJ2A 2QC7A 3M8NA 5ID2A 5LCZA 5J41A 2DC5A 4KCEA 1F3BA 4MPGA 5D9VA 3GURA 2C4JA 4BL7B 4DVCA 4NHWA 5A4VA 2WJUA 3GSSA 1ST9A 1S3CA 3L9SA 2RM5A 2VD1A 3FY7A 1YY7A 5IO0A 3VK9A 4X43A 3FHKA 2L6DA 2H1DA 5DBQA 2H0HA 3LJRA 2O85A 2K8VA 5DCHA 1SU9A 3QCPA 3DIEA 3UARA 2R3XA 4EO3A 1FOHA 4O92A 1FHEA 3I9V2 2LTKA 2LRNA 4NAXA 3JCML 2DJ2A 4MDCA 2ON5A 1A23A 2PGTA 3G7IA 3EWLA 2D2ZA 2H76A 2LRCA 4L0WA 2VOCA 2JU5A 1GL8A 1OC9B 3TJFA 3L9UA 2ZUPA 2K9FA 2FWEA 4K7OA 5E59A 4HQZA 3IC8A 4RI7A 4IW9A 3TKSA 2HYXA 4WF5A 3FRCA 2VL2A 4G0LA 2CVDA 1O8XA 4O32A 2QA2A 1HNCA 3GHAA 5H5RA 3O6TA 2PPTA 4POKA 5A4WA 5D9WA 3GKNA 3F3QA 4KGIA 1AW9A 2YJ7A 2JSYA 5ECPB 3GKXA 4K1FA 5B7CA 4XRDA 1BX9A 1OKDA 5DDLA 5LNKe 5IMFA 3DD3A 2H6XA 3EMXA 3RHBA 2CT6A 3F3RA 1YZXA 2B5XA 4KSOA 3LFLA 5D8IA 2MMNA 3ED3A 5CAXA 1QFNA 4NV5A 4K7NA 1GTBA 2TIRA 2ZNMA 1PKZA 2KUCA 1YKAA 1AQXA 5J5NA 1VF3A 3IAS2 2WULA 3GFKA 2YWNA 1A0RP 4KX4A 3EURA 4YKFA 3GL3A 3H79A 2I9HA 4Z2RA 1GNWA 3TCOA 3DWVA 3F9UA 4OCFA 4IJIA 4N0ZA 1AXDA 1K0AA 5F8BA 3CRTA 2H1BA 2GSRA 3HZ4A 4ISDA 4JRRA 3L9VA 1EOHA 3FR6A 2YNXA 2DBCA 1TRWA 3HJMA 1SJZA 4YQMA 3GX0A 3H8QA 1OAZA 3GMFA 1KTEA 4WF4A 2L4QA 2NBSA 4OO4A 5ECRB 2OJLA 1W4VA 1K3LA 3Q19A 1EEMA 3ZYWA 2LNTA 3RBTA 3KH7A 1GSYA 4IP1A 4JE1A 2HRAA 3GSTA 2B6MA 3VURA 2KOKA 1F6MC 4KDYA 4FIWA 5GSTA 3UJ1A 1T4YA 1FOVA 1DSBA 1TRUA 3HVSA 3KTLA 2P5QA 3EU3A 1THXA 10GSA 2A2RA 3H4KA 1HD2A 4X0XA 1GSUA 1F2EA 3C1SA 2B7JA 3IK9A 1GP1A 1PN9A 3O3TA 3CRUA 1K3OA 5L71A 18GSA 4HS1A 3F4SA 3MDKA 1SK1A 3J7Yb 3ZZXA 5G1LA 4XS1A 4LA1A 1JFUA 2C0DA 2ES7A 1EOGA 3M9KA 4JBBA 5DVBA 1WPIA 3PH9A 1ACVA 3E0UA 2AYTA 4O7HA 2H73A 5EL8A 2PVQA 2HSYA 4D73B 2GQKA 2VL9A 1OC3A 2E7PA 2VM1A 1GRXA 1T7PB 3LYPA 3G7JA 3IPZA 3VFIA 2XBQA 2P31A 3I6AA 17GSA 2YJHA 1BG5A 1FO5A 4V1Ag 4ZBAA 4PNGA 4WEYA 5EY6A 4RQXA 3WYWA 2R2JA 5EVOA 4L5LA 2B5YA 4HZ2A 5ECKB 2YP6A 1TI1A 2DIYA 4ZL9A 4CW9A 3WD6A 4TXOA 3SWLA 3D0ZA 1TKDB 1VGLA 2OACA 3PGTA 1VF4A 4CDOA 4I97A 2CZ2A 3GKKA 1QUWA 4K2XA 4BVXB 2VCTA 2X99A 4OMVA 2V2GA 1K0NA 2IL3A 3LQ7A 3CTFA 1Q98A 1TTZA 1EWXA 4MA9A 2LV3A 2LQOA 3HJOA 3C7MA 4TKYA 3QFAC 1GLPA 4K8MA 1G7OA 4Q5NA 3US3A 1PRXA 4YKGA 1X0RA 3EYTA 3VWVA 3NIVA 4XS4B 1ABAA 3UVTA 5ECIB 3VWXA 1EZKA 3NOFA 4KH7A 2VIMA 3HVXA 1S3AA 5HR1A 1BEDA 1DBYA 1SKWB 1XFLA 4KDXA 3ZITA 3DXBA 4K0GA 5A4UA 1PQNA 4XS6A 3A5IA 4O5QA 1MEKA 3CMIA 2WRTA 4CY8A 1KNGA 3DVXA 1VF1A 2HT9A 4TXVA 3H93A 2LJRA 4HUAA 2GQMA 2BTOT 1ILOA 5ID2B 4TR3A 4Z7XA 3NZNA 4G10A 1HNBA 4JZQA 2XPEA 1BYEA 1FB0A 1XCCA 3DRNA 4POBA 3FZ4A 1U3AA 1VRSD 1Q4JA 4JEDA 2M46A 22GSA 4TN8A 2WFCA 4QL9A 1B8XA 2YWIA 4BVYA 1TU8A 3UIWA 1KBNA 3UMAA 1WOUA 4K5SA 3KGKA 1I9DA 1MTCA 1PKWA 2O87A 5KN0A 1YJ6A 4GRFA 5KEJA 1AIUA 1ERTA 1EGOA 1U87A 2L5LA 4P3YB 4OFTA 1TW9A 2FD3A 5JWRB 3E9JB 2GSQA 1XOAA 3KH9A 2J23A 4TR0A 5KN1A 5ABRA 2QKEA 3WT2A 1XWGA 2JACA 4L5OA 1R7HA 1YKCA 2IMIA 3ZIVA 4GLTA 2CZ3A 1M2AA 4Q5FA 2KP1A 3IHGA 4J2FA 1X5DA 1PSQA 2H19A 3EVIA 5JCUA 2AHEA 3BBYA 4LMWA 3I69A 2N5FA 5A5KA 1XWKA 4GF0A 1GWCA 4IELA 3CYNA 3IC4A 4FQUA 1PD21 3LWAA 2GVPA 3QAWA 3CSHA 2MBSA 1EP8A 2XPDA 4PX1A 3ZMLA 3EINA 4N30A 3BCKA 3TKPA 1GULA 3APSA 3KJYA 5C04A 5GAND 4GWRA 4G0KA 5D96A 1GTIA 4K6XA 3F0IA 9GSSA 1IYIA 1SL1B 1K0DA 4MPFA 2IMEA 5AN1A 3FZ5A 1TJDA 4F03A 4K9ZA 3IE3A 4GTUA 4ZB6A 2O7KA 3ZVJA 3M1GA 2HXKA 1O85A 4LL1B 3GA4A 4LMVA 4GQFA 1SYXA 3A2VA 2YV7A 3RPPA 1G0TA 2DJ1A 4ZBBA 5D9XA 5GZZB 3G7YA 3IA1A 4G2EA 1A2JA 3HKRA 1GSFA 5G5EA 2PU9C 2DKHA 1MD4A 1MDKA 4MP4A 3PR8A 4ML1A 1UA5A 1OYJA 1E6BA 2HLSA 3ERFA 4H86A 1XXUA 3ISOA 1ZL9A 2EC4A 4HQSA 1LJRA 3UVHA 4EF0A 2L6CA 2VCZA 2HSMA 3F6FA 3HJPA 1UVZA 4USSA 1M99A 3CSIA 2V32A 1M9AA 2H71A 2DJ0A 2LQQA 2XBIA 4ECCA 1TRSA 1QGVA 1XOBA 2H01A 4EUYA 2FA8A 3ME7A 5GSSA 5HR2A 2DKIA 1T00A 2IJYA 1PGTA 3CSJA 5ECLB 3ZTLA 2M80A 1GTAA 2JSZA 2HFDA 5J9BA 2CAIA 3QAGA 1FAAA 1NM3A 2ZCTA 1Z6MA 3R3EA 4JR6A 3C73A 2DIZA 4KA0A 3GN3A 2YCDA 1QQ2A 3ERWA 2WZ9A 3ZLPA 13GSA 4WBJA 4YQUA 4YH2A 2FWFA 4PNFA 4ML6A 3FKFA 1EEJA 2FY6A 3D5JA 2E2MA 2C3NA 1NSWA 5DQYA 1YDKA 1JLWA 4XTSA 4E8EA 2JADA 1T1VA 2FWHA 5C00A 3MWHA 2P5RA 4MABA 1GUKA 2C8UA 3A2WA 4IVFA 1FVKA 2AAWA 5CYYA 4ID0A 2JZRA 4GCIA 2DJ3A 3GKMA 4K0NA 3F6DA 2JZTA 1EGRA 3EMPA 2HRFA 2DMMA 2C0FA 2RM6A 5F07A 2VCQA 2IFQA 4V2LA 1TDIA 3D4TA 2H72A 5ECMB 1SD9A 2HZEA 4HEA2 2YZHA 2R5GA 4TXOB 4JU5A 3F4RA 4KB3A 5AIVA 3QPMA 3KP9A 5KOXA 1LBKA 1K3YA 3RAZA 4WXTA 1A8YA 5HR3A 3I43A 5H5QA 3DKSA 3UBLA 2G0FA 3TJKA 1PX6A 5IPGA 2KHPA 3TJGA 3AY8A 2M72A 3TJJA 4Z2TA 4FH8A 3TGZA 2LNSA 4LLRA 4OO5A 1V57A 1V98A 1AC1A 2J9HA 4NXIA 4PQ1A 2VL3A 2NDOA 4NMUA 2R0GA 1ERWA 6GSSA 2L4CA 4Q5QA 1B48A 3HD5A 3FR9A 2YWOA 4NV2A 4IJ3A 5JWQB 3MYDA 3TJBA 3L0HA 5G2ZA 4CY6A 4OCEA 4Z2UA 4IBPA 2IN3A 3D22A 4TVEA 1ZYEA 1AUCA 4I2TA 1T4ZA 2CVBA 2L59A 4KSMA 3QOUA 4NHZA 4POMA 1ZCPA 1K0BA 1Z6NA 1AQVA 1USBA 1WWJA 2FUG2 3HVVA 2YOIA 3TRQA 4ZIJA 3IBHA 4NWYA 1OE8A 11GSA 1G6WA 1TRVA 4CHSA 4RUVA 1URMA 1NW2A 4KNDA 2YPMA 2MZCA 3GX8A 5B6NA 3WGXA 4KF9A 1SK2A 1WRYA 3MSZA 1SJIA 5CNWA 3LGCA 4TW5A 1TI3A 4MF5A 3VWUA 4G19A 4F0CA 2WGRA 1J0FA 1F9MA 2LSTA 2VAFA 4DSQA 1ZYNA 2DJKA 2WS2A 4BVYB 3VPTA 2WCIA 3FK8A 2VO4A 3Q6OA 2CVKA 3P8WA 1JLVA 5B6MA 2GZPA 3U5RE 4MF7A 3P7XA 1Y6EA 5DCGA 3KD0A 2F9SA 2LRTA 3EC3A 2LJKA 1X9WB 3WGDA 3LG6A 1J08A 5ELAA 4G9HA 3GV1A 3L78A 1U6TA 2H1GA 6GSVA 1N2AA 2V41A 1WP0A 1PL1A 1SL0B 1RK4A 2VUPA 3HA9A 3HZ8A 4WKWA 2YV9A 5ENUA 3IOSA 4KUNA 4QQ7A 1K0CA 1FW1A 2R6KA 3FR3A 3TDGA 1BAYA 5IMVA 6GSTA 2H6YA 2FNOA 3BD2A 2CV4A 4KW6A 2L5OA 2AB6A 1XWBA 3FZAA 5CREA 2MMAA 4MK3A 1M2BA 4AJ7A 2NVLA 2VCVA 5HFKA 1WJKA 5JCGA 1EV4A 1M9BA 1OC8A 4WR5A 4PQIA 1PA3A 4WETA 3ZIJA 4AF2A 1JZOA 1A8LA 3GH9A 3W6GA 4MJAA 2CQ9A 4V2MA 1SK0A 4V2NA 2DSAA 2V6KA 4IN0A 3H1NA 3LYKA 1MDJA 3QFBC 4IQAA 3TKRA 4ECIA 3PINA 19GSA 1GH2A 4XIHA 4PUAA 4EC0A 5KN3A 3ZFLA 5IMAA 3RHCA 2R37A 1B9XC 4MH2A 5ELGA 3GTUA 4X1UA 1ERUA 1TK0B 2H8LA 2TRXA 3RDWA 4F0BA 2GQLA 3LORA 4PTSA 1QK8A 3F8UA 1PX7A 1JHBA 2R0CA 1R5AA 5DAKA 2VCXA 2HRKA 3MAKA 4FYUA 5IMCA 3P90A 1WIKA 2C0EA 3TUEA 4DEJA 4YAVA 4O5UA 1B4PA 2K6VA 2WDUA 3EU4A 3K8NA 2R4VA 1M0UA 3QD9A 2BMXA 3ZFBA 4MJBA 1X5EA 4DSSA 1YF1A 5ECOB 5D93A 1XVQA 1ON4A 4EIPA 1DE1A 2FHEA 5B8BA 2JZSA 4TR1A 2RUFA 3C8EA 3GNJA 4FYBA 5D73A 5J3RA 3L4NA 5IQYA 1DE2A 2Z9SA 1M7TA 2QGVA 1OKTA 2RIIA 5DALA 3KM6A 2VM2A 3QR6A 5DJLA 2PERA 4X4JA 1YEPA 3GIXA 3UAPA 5H5SA 4POLA 3ZVJD 2C80A 1OVNA 1W89A 3VI5A 3TB2A 2F51A 3GH6A 3CTGA 4PURA 2HRNA 4F9ZA 1O6JA 1MDIA 3ZREA 2DMLA 4HJMA 1B4QA 4JR4A 3QDNA 1CQGA 4WR4A 3FYGA 5KN2A 3MIXA 4MJEA 2MYGA 2K8SA 2TRCP 1GTUA 2HE3A 3IDVA 4ZILA 2LUSA 2B7KA 4J56E 1ZYQB 2REMA 4MJCA 6GSYA 1Z9HA 2IFQB 2DLXA 1Z5YE 1O73A 5EPFA 3S9FA 2HZEB 3W8SA 4IGJA 2B5EA 1T8EB 4K5RA 2V1MA 1NHYA 5G31A 2H30A 2QSIA 2LEGA 4O5RA 1QMVA 1JZDA 1S3DA 4MLYA 1B9YC 16GSA 3R2QA 3KP8A 3QAVA 2GGTA 2YN1A 2GDRA 1V9WA 1HNAA 5CRHA 4MF6A 3D4MA 1EV9A 1TU7A 3KMOA 5J9CA 4Q5RA 3VI7A 1XW9A 2ALBA 1V58A 2HSHA 2IWTA 5LD0A 3IRAA 1GUHA 4FO5A 4MCUA 1R5PA 1XW6A 3KZQA 1XIYA 12GSA 3KIJA 2VLVA 2F3MA 4XRAA 2C1YA 4BPYA 2GSSA 3LXTA 5ECNB 1X5CA 1X9SB 1FB6A 4EE0A 3MNGA 1HYUA 1GLQA 1WMJA 3HDCA 2B3SA 2BJXA 4ZL7A 5CRWA 2YZUA 1V2AA 2EIRA 1H4OA 2H66A 2CX3A 3F63A 3P2AA 5CP1A 4F2IA 3FMWA 3D6IA 3EPTA 3KEBA 4OFMA 1YF0A 2OA7A 2KLXA 3Q18A 5B8AA 1TP9A 4MH3A 3N9JA 3ZRDA 3Q74A 1FVJA 2NPBA 1XZOA 1TOFA 5HQPA 2E2GA 1XBSA 4A5PA 5FWGA 5IIZA 3TRPA 2GS3A 4FYCA 1X9MB 1J9BA 2GLRA 5F0GA 2H0GA 3HCZA 4TR4A 5FT3A 4ICYA 3KXOA 4RQRA 2F8FA 4L8EA 1AAZA 5COHA 5KOWA 2GZYA 2MBTA 3GUSA 2PMTA 1HQOA 4ACSA 5ECSA 4HU9A 2A4VA 1K0MA 1O81A 4HI7A 1H75A 2X8CA 2IMKA 4ZB8A 4N10A 2AV4A 1GSEA 2FLSA 2HI7A 1T3BA 1RQMA 2YWMA 5G1KA 1ERVA 3PPUA 3FEUA 1WE0A 2EIOA 2PN8A 2PWJA 2X64A 2I4AA 2PBJA 2AJQB 3QMXA 3LEFA 4BL7A 1R26A 2FA4A 1A0FA 2FCHA 2I3YA 4IQ1A 3CXGA 2EIQA 2C3QA 5CO3A 5F06A 5HFGA 1XPVA 4PXOA 4KDUA 5JWOB 4MMMA 3WT1A 1OE7A 2X4AA 5IPHA 1DUGA 5AGYA 2OE0A 5IO2A 20GSA 1C72A 3J7Yk 1SL2B 2HZFA 3DGQA 2VLTA 1A2LA 1CQHA 4HZ4A 2H75A 4ULXA 4OWYA 2FWGA 1N8JA 1A24A 1O7UA 1TXXA 1KEBA 4RI6A 4HU7A 1JZRA 3IK7A 4NPBA 2C0GA 1MD3A 4I6XA 5CRGA 5F05A 2H70A 3LW9A 4IP6A 2N5AA 1F37A 5JCWA 2ON7A 4L0UA 3ME8A 5AIXA 2CAQA 1OC9A 1GSSA 3A5WA 2PVOC 3DMLA 3KCMA 4EXJA 2X8GA 3APQA 3GTUB 3A3TA 2CX4A 4ZXGA 5DJMA 4TRXA 2VCWA 3IHQA 3M0FA 1TK5B 4IS0A 3DEXA 2O8VB 5IOWA 1GSDA 2GSTA 4F82A 1F3AA 2GZZA 4GSTA 5DAKB 2O89A 1XVWA 2H1AA 3GRXA 3G9BA 4DSRA 3V1WA 4E8HA 3IAM2 1GSQA 3BCIA 1UC7A 1JZWA 1ZYPA 4WBRD 4MNNA 1EP7A 1G6YA 3SBCA 4DSSB 1SYRA 3CBUA 2XHFA 3HXSA 2DJJA 3ZL5A 2IMFA 5GAPD 3GYKA 3IR4A 3TKSC 4EIQA 4TR1B 2A2SA 2GT5A 3N5OA 1G7EA 2VL2C 4EKZA 3VWWA 1BQ7A 3RPNA 1Z7RA 3GL5A 5BRTA 4OD7A 3C71A 1YQ1A 4MZCA 1IYHA 3BOAA 4PQHA 1THOA 1ZZYA 5DALB 4TOPA 2JL4A 7GSSA 4IHUA 2A4HA 4BA7A 5IMZA 2OBKA 3EE2A 2WB9A 4EL1A 2NTOA 4AJ8A 4MZBA 2K18A 4IKHA 3M3MA 4GSNA 2PUKC 1PMTA 6GSUA 2I1UA 3UEMA 2AUVA 5BMUA 1TK8B 3BJ5A 2QA1A 1U88A 3DYRA 2N5BA 5ECHB 2OKAA 4YQVA 1AQWA 1FG4A 1Z7PA 2OE1A 3LXZA 5CRDA 2B1KA 2FGXA 1A2MA 1R4WA 2A2PA 1RW1A 3HHVA 4GQCA 3F4TA 1SJ6A 1Z3EA 2XC2A 4YAPA 5HFIA 3FW2A 4GXZA 6GSXA 2LKUA 3APOA 5ECQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGE A;  1PL2 A;  4EDY A;  4PGT A;  1ZMA A;  1U3I A;  1SKS B;  2H6Z A;  1NHO A;  3TKQ A;  4N11 A;  1SKR B;  2MMZ A;  4KAE A;  2VLU A;  1XWC A;  1ML6 A;  1XWA A;  2X8H A;  5DQS A;  1LU4 A;  4GSS A;  5G30 A;  3KMN A;  1ZOF A;  1I5G A;  2MMO A;  4ECB A;  1GUM A;  2E0Q A;  1BJX A;  2H0I A;  1SD8 A;  3DVW A;  3KTB A;  2G2Q A;  4EVM A;  4ZB9 A;  2RLI A;  4BWQ A;  4PUF C;  8GSS A;  2B1L A;  1GNE A;  4KCA A;  1VF2 A;  2LS5 A;  4HOJ A;  4AGS A;  1E2Y A;  2IIY A;  4D73 A;  2KP2 A;  2RUE A;  4ZL8 A;  14GS A;  3C1R A;  3ZMK A;  4BWS A;  3IV4 A;  4HDE A;  3IXR A;  3A2X A;  5IM9 A;  2OE3 A;  1V40 A;  6GSW A;  3E3E A;  4OFN A;  1O8W A;  3U6V A;  3VPQ A;  4J57 E;  1UN2 A;  1YEX A;  2GT6 A;  4XCS A;  4I5Q A;  2IPA A;  3ERG A;  4BVX A;  3O76 A;  3VLN A;  5G5F A;  2IMD A;  3LSZ A;  2OAD A;  2HNL A;  5D9T A;  4MZW A;  4I8B A;  5IOX A;  5AIS A;  1QXH A;  1ZGN A;  2VD0 A;  3M9J A;  3UL3 A;  4LL4 B;  3HY2 A;  4ECJ A;  4V1A p;  4EDZ A;  3UOM A;  3D21 A;  3OR5 A;  2C3T A;  5IMD A;  3TOU A;  4K7I A;  2OBI A;  3TRX A;  5FHI A;  2CA8 A;  4XS4 A;  3W8J A;  4N0V A;  3TKS E;  5E4W A;  2GTU A;  2V6O A;  2F8A A;  2LJA A;  2YAN A;  1M2D A;  1XW5 A;  1SEN A;  4I2U A;  2I81 A;  4ILF A;  1K0O A;  4K2D A;  4QL7 A;  5J4U A;  2H74 A;  4KE3 A;  2P0G A;  5HR0 A;  1Y25 A;  4XHM A;  4AJ6 A;  3TOT A;  3UBK A;  4ZBD A;  3FZ9 A;  2L57 A;  5INY A;  3HYP A;  4HJ2 A;  2QC7 A;  3M8N A;  5ID2 A;  5LCZ A;  5J41 A;  2DC5 A;  4KCE A;  1F3B A;  4MPG A;  5D9V A;  3GUR A;  2C4J A;  4DVC A;  4NHW A;  5A4V A;  2WJU A;  3GSS A;  1ST9 A;  1S3C A;  3L9S A;  2RM5 A;  2VD1 A;  3FY7 A;  1YY7 A;  5IO0 A;  3VK9 A;  4X43 A;  3FHK A;  2L6D A;  2H1D A;  5DBQ A;  2H0H A;  3LJR A;  2O85 A;  2K8V A;  5DCH A;  1SU9 A;  3QCP A;  3DIE A;  3UAR A;  2R3X A;  4EO3 A;  4O92 A;  1FHE A;  3I9V 2;  2LTK A;  2LRN A;  4NAX A;  3JCM L;  2DJ2 A;  4MDC A;  2ON5 A;  1A23 A;  2PGT A;  3G7I A;  3EWL A;  2D2Z A;  2H76 A;  2LRC A;  4L0W A;  2VOC A;  2JU5 A;  1GL8 A;  1OC9 B;  3TJF A;  3L9U A;  2ZUP A;  2K9F A;  2FWE A;  4K7O A;  5E59 A;  4HQZ A;  4RI7 A;  4IW9 A;  3TKS A;  2HYX A;  4WF5 A;  3FRC A;  2VL2 A;  2CVD A;  1O8X A;  4O32 A;  1HNC A;  3GHA A;  5H5R A;  3O6T A;  2PPT A;  4POK A;  5A4W A;  5D9W A;  3GKN A;  3F3Q A;  4KGI A;  1AW9 A;  2YJ7 A;  2JSY A;  5ECP B;  3GKX A;  4K1F A;  5B7C A;  4XRD A;  1BX9 A;  1OKD A;  5DDL A;  5LNK e;  5IMF A;  3DD3 A;  2H6X A;  3EMX A;  3RHB A;  2CT6 A;  3F3R A;  1YZX A;  2B5X A;  4KSO A;  3LFL A;  5D8I A;  2MMN A;  3ED3 A;  5CAX A;  1QFN A;  4NV5 A;  4K7N A;  1GTB A;  2TIR A;  2ZNM A;  1PKZ A;  2KUC A;  1YKA A;  1AQX A;  5J5N A;  1VF3 A;  3IAS 2;  2WUL A;  3GFK A;  2YWN A;  1A0R P;  4KX4 A;  3EUR A;  3GL3 A;  3H79 A;  2I9H A;  1GNW A;  3TCO A;  3DWV A;  3F9U A;  4OCF A;  4IJI A;  4N0Z A;  1AXD A;  1K0A A;  5F8B A;  3CRT A;  2H1B A;  2GSR A;  3HZ4 A;  4ISD A;  4JRR A;  3L9V A;  1EOH A;  3FR6 A;  2YNX A;  2DBC A;  1TRW A;  3HJM A;  1SJZ A;  4YQM A;  3GX0 A;  3H8Q A;  1OAZ A;  3GMF A;  1KTE A;  4WF4 A;  2L4Q A;  2NBS A;  4OO4 A;  5ECR B;  2OJL A;  1W4V A;  1K3L A;  3Q19 A;  1EEM A;  3ZYW A;  2LNT A;  3RBT A;  3KH7 A;  1GSY A;  4IP1 A;  4JE1 A;  3GST A;  2B6M A;  3VUR A;  2KOK A;  1F6M C;  4KDY A;  4FIW A;  5GST A;  3UJ1 A;  1T4Y A;  1FOV A;  1DSB A;  1TRU A;  3HVS A;  3KTL A;  2P5Q A;  3EU3 A;  1THX A;  10GS A;  2A2R A;  3H4K A;  1HD2 A;  4X0X A;  1GSU A;  1F2E A;  3C1S A;  2B7J A;  3IK9 A;  1GP1 A;  1PN9 A;  3O3T A;  3CRU A;  1K3O A;  5L71 A;  18GS A;  4HS1 A;  3F4S A;  3MDK A;  1SK1 A;  3J7Y b;  3ZZX A;  5G1L A;  4XS1 A;  4LA1 A;  1JFU A;  2C0D A;  2ES7 A;  1EOG A;  3M9K A;  4JBB A;  5DVB A;  1WPI A;  3PH9 A;  1ACV A;  3E0U A;  2AYT A;  4O7H A;  2H73 A;  5EL8 A;  2PVQ A;  2HSY A;  4D73 B;  2GQK A;  2VL9 A;  1OC3 A;  2E7P A;  2VM1 A;  1GRX A;  1T7P B;  3LYP A;  3G7J A;  3IPZ A;  3VFI A;  2XBQ A;  2P31 A;  3I6A A;  17GS A;  2YJH A;  1BG5 A;  1FO5 A;  4V1A g;  4ZBA A;  4PNG A;  4WEY A;  5EY6 A;  4RQX A;  3WYW A;  2R2J A;  5EVO A;  4L5L A;  2B5Y A;  4HZ2 A;  5ECK B;  2YP6 A;  1TI1 A;  2DIY A;  4ZL9 A;  4CW9 A;  3WD6 A;  4TXO A;  3SWL A;  3D0Z A;  1TKD B;  1VGL A;  2OAC A;  3PGT A;  1VF4 A;  4CDO A;  4I97 A;  2CZ2 A;  3GKK A;  1QUW A;  2VCT A;  2X99 A;  4OMV A;  2V2G A;  1K0N A;  2IL3 A;  3LQ7 A;  3CTF A;  1Q98 A;  1TTZ A;  1EWX A;  4MA9 A;  2LV3 A;  2LQO A;  3HJO A;  3C7M A;  4TKY A;  3QFA C;  1GLP A;  4K8M A;  1G7O A;  4Q5N A;  3US3 A;  1PRX A;  1X0R A;  3EYT A;  3VWV A;  3NIV A;  4XS4 B;  1ABA A;  3UVT A;  5ECI B;  3VWX A;  1EZK A;  3NOF A;  4KH7 A;  2VIM A;  3HVX A;  1S3A A;  5HR1 A;  1BED A;  1DBY A;  1SKW B;  1XFL A;  4KDX A;  3ZIT A;  3DXB A;  4K0G A;  5A4U A;  1PQN A;  4XS6 A;  1MEK A;  3CMI A;  2WRT A;  1KNG A;  3DVX A;  1VF1 A;  2HT9 A;  4TXV A;  3H93 A;  2LJR A;  4HUA A;  2GQM A;  2BTO T;  1ILO A;  5ID2 B;  4TR3 A;  4Z7X A;  3NZN A;  4G10 A;  1HNB A;  4JZQ A;  2XPE A;  1BYE A;  1FB0 A;  1XCC A;  3DRN A;  4POB A;  3FZ4 A;  1U3A A;  1VRS D;  1Q4J A;  4JED A;  2M46 A;  22GS A;  4TN8 A;  2WFC A;  4QL9 A;  1B8X A;  2YWI A;  4BVY A;  1TU8 A;  3UIW A;  1KBN A;  3UMA A;  1WOU A;  3KGK A;  1I9D A;  1MTC A;  1PKW A;  2O87 A;  5KN0 A;  1YJ6 A;  4GRF A;  5KEJ A;  1AIU A;  1ERT A;  1EGO A;  1U87 A;  2L5L A;  4P3Y B;  4OFT A;  1TW9 A;  2FD3 A;  5JWR B;  3E9J B;  2GSQ A;  1XOA A;  3KH9 A;  2J23 A;  4TR0 A;  5KN1 A;  5ABR A;  2QKE A;  3WT2 A;  1XWG A;  2JAC A;  4L5O A;  1R7H A;  1YKC A;  2IMI A;  3ZIV A;  4GLT A;  2CZ3 A;  1M2A A;  4Q5F A;  2KP1 A;  4J2F A;  1X5D A;  1PSQ A;  2H19 A;  3EVI A;  5JCU A;  2AHE A;  3BBY A;  4LMW A;  3I69 A;  2N5F A;  5A5K A;  1XWK A;  4GF0 A;  1GWC A;  4IEL A;  3CYN A;  3IC4 A;  1PD2 1;  3LWA A;  2GVP A;  3QAW A;  3CSH A;  2MBS A;  1EP8 A;  2XPD A;  4PX1 A;  3ZML A;  3EIN A;  4N30 A;  3BCK A;  3TKP A;  1GUL A;  3APS A;  3KJY A;  5C04 A;  5GAN D;  4GWR A;  5D96 A;  1GTI A;  4K6X A;  3F0I A;  9GSS A;  1IYI A;  1SL1 B;  1K0D A;  4MPF A;  2IME A;  5AN1 A;  3FZ5 A;  1TJD A;  4F03 A;  4K9Z A;  3IE3 A;  4GTU A;  4ZB6 A;  2O7K A;  3ZVJ A;  3M1G A;  2HXK A;  1O85 A;  4LL1 B;  3GA4 A;  4LMV A;  4GQF A;  1SYX A;  3A2V A;  2YV7 A;  3RPP A;  1G0T A;  2DJ1 A;  4ZBB A;  5D9X A;  5GZZ B;  3G7Y A;  3IA1 A;  4G2E A;  1A2J A;  3HKR A;  1GSF A;  5G5E A;  2PU9 C;  1MD4 A;  1MDK A;  4MP4 A;  3PR8 A;  4ML1 A;  1UA5 A;  1OYJ A;  1E6B A;  2HLS A;  3ERF A;  4H86 A;  1XXU A;  3ISO A;  1ZL9 A;  2EC4 A;  4HQS A;  1LJR A;  3UVH A;  4EF0 A;  2L6C A;  2VCZ A;  3F6F A;  3HJP A;  1UVZ A;  1M99 A;  3CSI A;  2V32 A;  1M9A A;  2H71 A;  2DJ0 A;  2LQQ A;  2XBI A;  4ECC A;  1TRS A;  1QGV A;  1XOB A;  2H01 A;  4EUY A;  2FA8 A;  3ME7 A;  5GSS A;  5HR2 A;  1T00 A;  2IJY A;  1PGT A;  3CSJ A;  5ECL B;  3ZTL A;  2M80 A;  1GTA A;  2JSZ A;  2HFD A;  5J9B A;  2CAI A;  3QAG A;  1FAA A;  1NM3 A;  2ZCT A;  1Z6M A;  4JR6 A;  3C73 A;  2DIZ A;  4KA0 A;  3GN3 A;  2YCD A;  1QQ2 A;  3ERW A;  2WZ9 A;  3ZLP A;  13GS A;  4WBJ A;  4YQU A;  4YH2 A;  2FWF A;  4PNF A;  4ML6 A;  3FKF A;  1EEJ A;  2FY6 A;  3D5J A;  2E2M A;  2C3N A;  1NSW A;  5DQY A;  1YDK A;  1JLW A;  4XTS A;  4E8E A;  2JAD A;  1T1V A;  2FWH A;  5C00 A;  3MWH A;  2P5R A;  4MAB A;  1GUK A;  2C8U A;  3A2W A;  4IVF A;  1FVK A;  2AAW A;  5CYY A;  4ID0 A;  2JZR A;  4GCI A;  2DJ3 A;  3GKM A;  4K0N A;  3F6D A;  2JZT A;  1EGR A;  3EMP A;  2HRF A;  2DMM A;  2C0F A;  2RM6 A;  5F07 A;  2VCQ A;  2IFQ A;  4V2L A;  1TDI A;  3D4T A;  2H72 A;  5ECM B;  1SD9 A;  2HZE A;  4HEA 2;  2YZH A;  2R5G A;  4TXO B;  4JU5 A;  3F4R A;  4KB3 A;  5AIV A;  3QPM A;  3KP9 A;  1LBK A;  1K3Y A;  3RAZ A;  4WXT A;  1A8Y A;  5HR3 A;  3I43 A;  5H5Q A;  3DKS A;  3UBL A;  2G0F A;  3TJK A;  1PX6 A;  5IPG A;  2KHP A;  3TJG A;  3AY8 A;  2M72 A;  3TJJ A;  4FH8 A;  3TGZ A;  2LNS A;  4LLR A;  4OO5 A;  1V57 A;  1V98 A;  1AC1 A;  2J9H A;  4NXI A;  4PQ1 A;  2VL3 A;  2NDO A;  4NMU A;  1ERW A;  6GSS A;  2L4C A;  4Q5Q A;  1B48 A;  3HD5 A;  3FR9 A;  2YWO A;  4NV2 A;  4IJ3 A;  5JWQ B;  3TJB A;  3L0H A;  5G2Z A;  4OCE A;  4IBP A;  2IN3 A;  3D22 A;  4TVE A;  1ZYE A;  1AUC A;  4I2T A;  1T4Z A;  2CVB A;  2L59 A;  4KSM A;  3QOU A;  4NHZ A;  4POM A;  1ZCP A;  1K0B A;  1Z6N A;  1AQV A;  1USB A;  1WWJ A;  2FUG 2;  3HVV A;  2YOI A;  3TRQ A;  4ZIJ A;  3IBH A;  4NWY A;  1OE8 A;  11GS A;  1G6W A;  1TRV A;  4CHS A;  4RUV A;  1URM A;  1NW2 A;  4KND A;  2YPM A;  2MZC A;  3GX8 A;  5B6N A;  3WGX A;  1SK2 A;  1WRY A;  3MSZ A;  1SJI A;  5CNW A;  3LGC A;  4TW5 A;  1TI3 A;  4MF5 A;  3VWU A;  4G19 A;  4F0C A;  2WGR A;  1J0F A;  1F9M A;  2LST A;  2VAF A;  4DSQ A;  2DJK A;  2WS2 A;  3VPT A;  2WCI A;  3FK8 A;  2VO4 A;  3Q6O A;  2CVK A;  3P8W A;  1JLV A;  5B6M A;  2GZP A;  3U5R E;  4MF7 A;  3P7X A;  1Y6E A;  5DCG A;  3KD0 A;  2F9S A;  2LRT A;  3EC3 A;  2LJK A;  1X9W B;  3WGD A;  3LG6 A;  1J08 A;  5ELA A;  4G9H A;  3GV1 A;  3L78 A;  1U6T A;  2H1G A;  6GSV A;  1N2A A;  2V41 A;  1WP0 A;  1PL1 A;  1SL0 B;  1RK4 A;  2VUP A;  3HA9 A;  3HZ8 A;  4WKW A;  2YV9 A;  5ENU A;  3IOS A;  4KUN A;  4QQ7 A;  1K0C A;  1FW1 A;  2R6K A;  3FR3 A;  3TDG A;  1BAY A;  5IMV A;  6GST A;  2H6Y A;  2FNO A;  3BD2 A;  2CV4 A;  4KW6 A;  2L5O A;  2AB6 A;  1XWB A;  3FZA A;  5CRE A;  2MMA A;  4MK3 A;  1M2B A;  4AJ7 A;  2NVL A;  2VCV A;  5HFK A;  1WJK A;  5JCG A;  1EV4 A;  1M9B A;  1OC8 A;  4WR5 A;  4PQI A;  1PA3 A;  4WET A;  3ZIJ A;  4AF2 A;  1JZO A;  1A8L A;  3GH9 A;  3W6G A;  4MJA A;  2CQ9 A;  4V2M A;  1SK0 A;  4V2N A;  2DSA A;  2V6K A;  4IN0 A;  3H1N A;  3LYK A;  1MDJ A;  3QFB C;  4IQA A;  3TKR A;  4ECI A;  3PIN A;  19GS A;  1GH2 A;  4XIH A;  4PUA A;  4EC0 A;  5KN3 A;  3ZFL A;  5IMA A;  3RHC A;  2R37 A;  1B9X C;  4MH2 A;  5ELG A;  3GTU A;  4X1U A;  1ERU A;  1TK0 B;  2H8L A;  2TRX A;  3RDW A;  4F0B A;  2GQL A;  3LOR A;  1QK8 A;  3F8U A;  1PX7 A;  1JHB A;  1R5A A;  5DAK A;  2VCX A;  3MAK A;  4FYU A;  5IMC A;  3P90 A;  1WIK A;  2C0E A;  3TUE A;  4DEJ A;  4YAV A;  1B4P A;  2K6V A;  2WDU A;  3EU4 A;  3K8N A;  2R4V A;  1M0U A;  3QD9 A;  2BMX A;  3ZFB A;  4MJB A;  1X5E A;  4DSS A;  1YF1 A;  5ECO B;  5D93 A;  1XVQ A;  1ON4 A;  1DE1 A;  2FHE A;  5B8B A;  2JZS A;  4TR1 A;  2RUF A;  3C8E A;  3GNJ A;  4FYB A;  5D73 A;  5J3R A;  3L4N A;  5IQY A;  1DE2 A;  2Z9S A;  1M7T A;  2QGV A;  1OKT A;  2RII A;  5DAL A;  3KM6 A;  2VM2 A;  3QR6 A;  5DJL A;  2PER A;  3UAP A;  1YEP A;  3GIX A;  5H5S A;  4POL A;  3ZVJ D;  2C80 A;  1OVN A;  1W89 A;  3VI5 A;  3TB2 A;  2F51 A;  3GH6 A;  3CTG A;  4PUR A;  2HRN A;  4F9Z A;  1O6J A;  1MDI A;  3ZRE A;  2DML A;  4HJM A;  1B4Q A;  4JR4 A;  3QDN A;  1CQG A;  4WR4 A;  3FYG A;  5KN2 A;  4MJE A;  2MYG A;  2K8S A;  2TRC P;  1GTU A;  2HE3 A;  3IDV A;  4ZIL A;  2LUS A;  2B7K A;  4J56 E;  1ZYQ B;  2REM A;  4MJC A;  6GSY A;  1Z9H A;  2IFQ B;  2DLX A;  1Z5Y E;  1O73 A;  5EPF A;  3S9F A;  2HZE B;  3W8S A;  4IGJ A;  2B5E A;  1T8E B;  2V1M A;  1NHY A;  5G31 A;  2H30 A;  2QSI A;  2LEG A;  4O5R A;  1QMV A;  1JZD A;  1S3D A;  4MLY A;  1B9Y C;  16GS A;  3R2Q A;  3KP8 A;  3QAV A;  2GGT A;  2YN1 A;  2GDR A;  1V9W A;  1HNA A;  5CRH A;  4MF6 A;  3D4M A;  1EV9 A;  1TU7 A;  3KMO A;  5J9C A;  4Q5R A;  3VI7 A;  1XW9 A;  2ALB A;  1V58 A;  2HSH A;  2IWT A;  5LD0 A;  3IRA A;  1GUH A;  4FO5 A;  4MCU A;  1R5P A;  1XW6 A;  3KZQ A;  1XIY A;  12GS A;  3KIJ A;  2VLV A;  2F3M A;  4XRA A;  2C1Y A;  4BPY A;  2GSS A;  3LXT A;  5ECN B;  1X5C A;  1X9S B;  1FB6 A;  4EE0 A;  3MNG A;  1HYU A;  1GLQ A;  1WMJ A;  3HDC A;  2B3S A;  2BJX A;  4ZL7 A;  5CRW A;  2YZU A;  1V2A A;  2EIR A;  1H4O A;  2H66 A;  2CX3 A;  3F63 A;  3P2A A;  5CP1 A;  4F2I A;  3D6I A;  3KEB A;  4OFM A;  1YF0 A;  2OA7 A;  2KLX A;  3Q18 A;  5B8A A;  1TP9 A;  4MH3 A;  3N9J A;  3ZRD A;  3Q74 A;  1FVJ A;  2NPB A;  1XZO A;  1TOF A;  5HQP A;  2E2G A;  1XBS A;  5FWG A;  5IIZ A;  3TRP A;  2GS3 A;  4FYC A;  1X9M B;  1J9B A;  2GLR A;  5F0G A;  2H0G A;  3HCZ A;  4TR4 A;  5FT3 A;  3KXO A;  4RQR A;  2F8F A;  4L8E A;  1AAZ A;  5COH A;  2GZY A;  2MBT A;  3GUS A;  2PMT A;  1HQO A;  4ACS A;  5ECS A;  4HU9 A;  2A4V A;  1K0M A;  1O81 A;  4HI7 A;  1H75 A;  2X8C A;  2IMK A;  4ZB8 A;  4N10 A;  2AV4 A;  1GSE A;  2FLS A;  2HI7 A;  1T3B A;  1RQM A;  2YWM A;  5G1K A;  1ERV A;  3FEU A;  1WE0 A;  2EIO A;  2PN8 A;  2PWJ A;  2X64 A;  2I4A A;  2PBJ A;  2AJQ B;  3QMX A;  3LEF A;  4BL7 A;  1R26 A;  2FA4 A;  1A0F A;  2FCH A;  2I3Y A;  4IQ1 A;  3CXG A;  2EIQ A;  2C3Q A;  5CO3 A;  5F06 A;  5HFG A;  1XPV A;  4PXO A;  4KDU A;  5JWO B;  4MMM A;  3WT1 A;  1OE7 A;  5IPH A;  1DUG A;  5AGY A;  2OE0 A;  5IO2 A;  20GS A;  1C72 A;  3J7Y k;  1SL2 B;  2HZF A;  3DGQ A;  2VLT A;  1A2L A;  1CQH A;  4HZ4 A;  2H75 A;  4ULX A;  4OWY A;  2FWG A;  1N8J A;  1A24 A;  1O7U A;  1TXX A;  1KEB A;  4RI6 A;  4HU7 A;  1JZR A;  3IK7 A;  4NPB A;  2C0G A;  5F05 A;  1MD3 A;  5CRG A;  4I6X A;  2H70 A;  4IP6 A;  2N5A A;  1F37 A;  5JCW A;  2ON7 A;  4L0U A;  3ME8 A;  5AIX A;  2CAQ A;  1OC9 A;  1GSS A;  3A5W A;  2PVO C;  3DML A;  3KCM A;  4EXJ A;  2X8G A;  3APQ A;  3GTU B;  3A3T A;  2CX4 A;  4ZXG A;  5DJM A;  4TRX A;  2VCW A;  3IHQ A;  3M0F A;  1TK5 B;  4IS0 A;  3DEX A;  2O8V B;  5IOW A;  1GSD A;  2GST A;  4F82 A;  1F3A A;  2GZZ A;  4GST A;  5DAK B;  2O89 A;  1XVW A;  2H1A A;  3GRX A;  3G9B A;  4DSR A;  3V1W A;  4E8H A;  3IAM 2;  1GSQ A;  3BCI A;  1UC7 A;  1JZW A;  4WBR D;  1EP7 A;  1G6Y A;  3SBC A;  4DSS B;  1SYR A;  3CBU A;  2XHF A;  3HXS A;  2DJJ A;  3ZL5 A;  2IMF A;  5GAP D;  3GYK A;  3IR4 A;  3TKS C;  4TR1 B;  2A2S A;  2GT5 A;  3N5O A;  1G7E A;  2VL2 C;  4EKZ A;  3VWW A;  1BQ7 A;  3RPN A;  1Z7R A;  3GL5 A;  4OD7 A;  3C71 A;  1YQ1 A;  4MZC A;  1IYH A;  3BOA A;  4PQH A;  1THO A;  1ZZY A;  5DAL B;  4TOP A;  2JL4 A;  7GSS A;  4IHU A;  4BA7 A;  5IMZ A;  2OBK A;  3EE2 A;  2WB9 A;  4EL1 A;  2NTO A;  4AJ8 A;  4MZB A;  2K18 A;  4IKH A;  3M3M A;  4GSN A;  2PUK C;  1PMT A;  6GSU A;  2I1U A;  3UEM A;  2AUV A;  1TK8 B;  3BJ5 A;  1U88 A;  3DYR A;  2N5B A;  5ECH B;  2OKA A;  4YQV A;  1AQW A;  1FG4 A;  1Z7P A;  2OE1 A;  3LXZ A;  5CRD A;  2B1K A;  2FGX A;  1A2M A;  1R4W A;  1RW1 A;  3HHV A;  4GQC A;  3F4T A;  1SJ6 A;  1Z3E A;  2XC2 A;  4YAP A;  5HFI A;  3FW2 A;  4GXZ A;  6GSX A;  2LKU A;  3APO A;  5ECQ B; 
#chains in the Genus database with same CATH topology
 3WGE A;  1PL2 A;  4EDY A;  4PGT A;  1ZMA A;  1U3I A;  1SKS B;  2H6Z A;  1NHO A;  3TKQ A;  4N11 A;  1SKR B;  2MMZ A;  4KAE A;  2VLU A;  1XWC A;  1ML6 A;  1XWA A;  2X8H A;  5DQS A;  1LU4 A;  4GSS A;  5G30 A;  3KMN A;  1ZOF A;  1I5G A;  2MMO A;  4ECB A;  1GUM A;  2E0Q A;  1BJX A;  2H0I A;  4G0I A;  1SD8 A;  3DVW A;  3KTB A;  2G2Q A;  4EVM A;  4ZB9 A;  2RLI A;  4BWQ A;  4PUF C;  8GSS A;  2B1L A;  1GNE A;  2R0P A;  4KCA A;  1VF2 A;  2LS5 A;  4HOJ A;  4AGS A;  1E2Y A;  2IIY A;  4D73 A;  2KP2 A;  2RUE A;  4ZL8 A;  14GS A;  3C1R A;  3ZMK A;  4BWS A;  3IV4 A;  4HDE A;  3HVN A;  3IXR A;  3A2X A;  5IM9 A;  2OE3 A;  1V40 A;  6GSW A;  3E3E A;  4OFN A;  1O8W A;  3U6V A;  3VPQ A;  4J57 E;  1UN2 A;  4BIK A;  1YEX A;  2GT6 A;  4XCS A;  4I5Q A;  2IPA A;  3ERG A;  1S3R A;  4BVX A;  3O76 A;  3VLN A;  5G5F A;  2IMD A;  3LSZ A;  2OAD A;  2UZ8 A;  2HNL A;  5D9T A;  4MZW A;  4I8B A;  5IOX A;  5AIS A;  1QXH A;  1ZGN A;  2VD0 A;  3M9J A;  3UL3 A;  4LL4 B;  3HY2 A;  4ECJ A;  4V1A p;  4EDZ A;  3UOM A;  3D21 A;  3OR5 A;  2C3T A;  5IMD A;  3TOU A;  4K7I A;  2OBI A;  3TRX A;  5FHI A;  2CA8 A;  4XS4 A;  3W8J A;  4N0V A;  3TKS E;  5E4W A;  2GTU A;  2V6O A;  2F8A A;  2LJA A;  2YAN A;  1M2D A;  1XW5 A;  1SEN A;  4I2U A;  2X49 A;  2I81 A;  4ILF A;  1K0O A;  4K2D A;  4QL7 A;  5J4U A;  1PN0 A;  2H74 A;  4KE3 A;  2P0G A;  5HR0 A;  1Y25 A;  4XHM A;  4AJ6 A;  3TOT A;  3UBK A;  4ZBD A;  3FZ9 A;  2L57 A;  5INY A;  3HYP A;  4HJ2 A;  2QC7 A;  3M8N A;  5ID2 A;  5LCZ A;  5J41 A;  2DC5 A;  4KCE A;  1F3B A;  4MPG A;  5D9V A;  3GUR A;  2C4J A;  4BL7 B;  4DVC A;  4NHW A;  5A4V A;  2WJU A;  3GSS A;  1ST9 A;  1S3C A;  3L9S A;  2RM5 A;  2VD1 A;  3FY7 A;  1YY7 A;  5IO0 A;  3VK9 A;  4X43 A;  3FHK A;  2L6D A;  2H1D A;  5DBQ A;  2H0H A;  3LJR A;  2O85 A;  2K8V A;  1PFO A;  5DCH A;  1SU9 A;  3QCP A;  3DIE A;  3UAR A;  2R3X A;  4EO3 A;  1FOH A;  4O92 A;  1FHE A;  3I9V 2;  2LTK A;  2LRN A;  4NAX A;  3JCM L;  2DJ2 A;  4MDC A;  2ON5 A;  1A23 A;  2PGT A;  3G7I A;  3EWL A;  2D2Z A;  2H76 A;  2LRC A;  4L0W A;  2VOC A;  2JU5 A;  1GL8 A;  1OC9 B;  3TJF A;  3L9U A;  2ZUP A;  2K9F A;  2FWE A;  4K7O A;  5E59 A;  4HQZ A;  3IC8 A;  4RI7 A;  4IW9 A;  3TKS A;  2HYX A;  4WF5 A;  3FRC A;  2VL2 A;  4G0L A;  2CVD A;  1O8X A;  4O32 A;  2QA2 A;  1HNC A;  1M3I A;  3GHA A;  3O6T A;  5H5R A;  2PPT A;  4POK A;  5A4W A;  5D9W A;  3GKN A;  3F3Q A;  4KGI A;  1AW9 A;  2YJ7 A;  2JSY A;  5ECP B;  3GKX A;  4K1F A;  5B7C A;  4XRD A;  1BX9 A;  1OKD A;  5DDL A;  3CQF A;  5LNK e;  5IMF A;  3DD3 A;  2H6X A;  3EMX A;  3RHB A;  2CT6 A;  3F3R A;  1YZX A;  2B5X A;  4KSO A;  3LFL A;  5D8I A;  2MMN A;  3ED3 A;  5CAX A;  1QFN A;  4NV5 A;  4K7N A;  1GTB A;  2TIR A;  2ZNM A;  1PKZ A;  2KUC A;  1YKA A;  1AQX A;  5J5N A;  1VF3 A;  3IAS 2;  2WUL A;  3GFK A;  2YWN A;  1A0R P;  4KX4 A;  3EUR A;  4YKF A;  3GL3 A;  3H79 A;  2I9H A;  4Z2R A;  1GNW A;  3TCO A;  3DWV A;  3F9U A;  4OCF A;  4IJI A;  4N0Z A;  1AXD A;  1K0A A;  5F8B A;  3CRT A;  2H1B A;  2GSR A;  3HZ4 A;  4ISD A;  4JRR A;  3L9V A;  1EOH A;  3FR6 A;  2YNX A;  2DBC A;  1TRW A;  3HJM A;  1SJZ A;  4YQM A;  3GX0 A;  3H8Q A;  1OAZ A;  3GMF A;  1KTE A;  4WF4 A;  2L4Q A;  2NBS A;  4OO4 A;  5ECR B;  2OJL A;  1W4V A;  1K3L A;  3Q19 A;  1EEM A;  3ZYW A;  2LNT A;  3RBT A;  3KH7 A;  1GSY A;  4IP1 A;  4JE1 A;  2HRA A;  3GST A;  2B6M A;  3VUR A;  2KOK A;  1F6M C;  4KDY A;  4FIW A;  5GST A;  3UJ1 A;  1T4Y A;  1FOV A;  1DSB A;  1TRU A;  3HVS A;  3KTL A;  2P5Q A;  3EU3 A;  1THX A;  10GS A;  2A2R A;  3H4K A;  1HD2 A;  4X0X A;  1GSU A;  1F2E A;  3C1S A;  2B7J A;  3IK9 A;  1GP1 A;  1PN9 A;  3O3T A;  3CRU A;  1K3O A;  5L71 A;  18GS A;  4HS1 A;  3F4S A;  3MDK A;  1SK1 A;  3J7Y b;  3ZZX A;  5G1L A;  4XS1 A;  4LA1 A;  1JFU A;  2C0D A;  2ES7 A;  1EOG A;  3M9K A;  4JBB A;  5DVB A;  1WPI A;  3PH9 A;  1ACV A;  3E0U A;  2AYT A;  4O7H A;  2H73 A;  5EL8 A;  2PVQ A;  2HSY A;  4D73 B;  2GQK A;  2VL9 A;  1OC3 A;  2E7P A;  2VM1 A;  1GRX A;  1T7P B;  3LYP A;  3G7J A;  3IPZ A;  3VFI A;  2XBQ A;  2P31 A;  3I6A A;  17GS A;  2YJH A;  1BG5 A;  1FO5 A;  4V1A g;  4ZBA A;  4PNG A;  4WEY A;  5EY6 A;  4RQX A;  3WYW A;  2R2J A;  5EVO A;  4L5L A;  2B5Y A;  4HZ2 A;  5ECK B;  2YP6 A;  1TI1 A;  2DIY A;  4ZL9 A;  4CW9 A;  3WD6 A;  4TXO A;  3SWL A;  3D0Z A;  1TKD B;  1VGL A;  2OAC A;  3PGT A;  1VF4 A;  4CDO A;  4I97 A;  2CZ2 A;  3GKK A;  1QUW A;  4K2X A;  4BVX B;  2VCT A;  2X99 A;  4OMV A;  2V2G A;  1K0N A;  2IL3 A;  3LQ7 A;  3CTF A;  1Q98 A;  1TTZ A;  1EWX A;  4MA9 A;  2LV3 A;  2LQO A;  3HJO A;  3C7M A;  4TKY A;  3QFA C;  1GLP A;  4K8M A;  1G7O A;  4Q5N A;  3US3 A;  1PRX A;  4YKG A;  1X0R A;  3EYT A;  3VWV A;  3NIV A;  4XS4 B;  1ABA A;  3UVT A;  5ECI B;  3VWX A;  1EZK A;  3NOF A;  4KH7 A;  2VIM A;  3HVX A;  1S3A A;  5HR1 A;  1BED A;  1DBY A;  1SKW B;  1XFL A;  4KDX A;  3ZIT A;  3DXB A;  4K0G A;  5A4U A;  1PQN A;  4XS6 A;  3A5I A;  4O5Q A;  1MEK A;  3CMI A;  2WRT A;  4CY8 A;  1KNG A;  3DVX A;  1VF1 A;  2HT9 A;  4TXV A;  3H93 A;  2LJR A;  4HUA A;  2GQM A;  2BTO T;  1ILO A;  5ID2 B;  4TR3 A;  4Z7X A;  3NZN A;  4G10 A;  1HNB A;  4JZQ A;  2XPE A;  1BYE A;  1FB0 A;  1XCC A;  3DRN A;  4POB A;  4HSC X;  1M3J A;  3FZ4 A;  1U3A A;  1VRS D;  1Q4J A;  4JED A;  2M46 A;  22GS A;  4TN8 A;  2WFC A;  4QL9 A;  1B8X A;  2YWI A;  4BVY A;  1TU8 A;  3UIW A;  1KBN A;  3UMA A;  1WOU A;  4K5S A;  3KGK A;  1I9D A;  1MTC A;  1PKW A;  2O87 A;  5KN0 A;  1YJ6 A;  4GRF A;  5KEJ A;  1AIU A;  1ERT A;  1EGO A;  1U87 A;  2L5L A;  4P3Y B;  4OFT A;  1TW9 A;  2FD3 A;  5JWR B;  3E9J B;  2GSQ A;  1XOA A;  3KH9 A;  2J23 A;  4TR0 A;  5KN1 A;  5ABR A;  2QKE A;  3WT2 A;  1XWG A;  2JAC A;  4L5O A;  1R7H A;  1YKC A;  2IMI A;  3ZIV A;  4GLT A;  2CZ3 A;  1M2A A;  4Q5F A;  2KP1 A;  3IHG A;  4J2F A;  1X5D A;  1PSQ A;  2H19 A;  3EVI A;  5JCU A;  2AHE A;  3BBY A;  4LMW A;  3I69 A;  2N5F A;  5A5K A;  1XWK A;  4GF0 A;  1GWC A;  4IEL A;  3CYN A;  3IC4 A;  4FQU A;  1PD2 1;  3LWA A;  2GVP A;  3QAW A;  3CSH A;  2MBS A;  1EP8 A;  2XPD A;  4PX1 A;  3ZML A;  3EIN A;  4N30 A;  3BCK A;  3TKP A;  1GUL A;  3APS A;  3KJY A;  5C04 A;  5GAN D;  4GWR A;  4G0K A;  5D96 A;  1GTI A;  4K6X A;  3F0I A;  9GSS A;  1IYI A;  1SL1 B;  1K0D A;  4MPF A;  2IME A;  5AN1 A;  3FZ5 A;  1TJD A;  4F03 A;  4K9Z A;  3IE3 A;  4GTU A;  4ZB6 A;  2O7K A;  3ZVJ A;  3M1G A;  2HXK A;  1O85 A;  4LL1 B;  3GA4 A;  4LMV A;  4GQF A;  1SYX A;  3A2V A;  2YV7 A;  3RPP A;  1G0T A;  2DJ1 A;  4ZBB A;  5D9X A;  5GZZ B;  3G7Y A;  3IA1 A;  4G2E A;  1A2J A;  3HKR A;  1GSF A;  5G5E A;  2PU9 C;  2DKH A;  1MD4 A;  1MDK A;  4MP4 A;  3PR8 A;  4ML1 A;  1UA5 A;  1OYJ A;  1E6B A;  2HLS A;  3ERF A;  4H86 A;  1XXU A;  3ISO A;  1ZL9 A;  2EC4 A;  4HQS A;  1LJR A;  3UVH A;  4EF0 A;  2L6C A;  2VCZ A;  2HSM A;  3F6F A;  3HJP A;  1UVZ A;  4USS A;  1M99 A;  3CSI A;  2V32 A;  1M9A A;  2H71 A;  2DJ0 A;  2LQQ A;  2XBI A;  4ECC A;  1TRS A;  1QGV A;  1XOB A;  2H01 A;  4EUY A;  2FA8 A;  3ME7 A;  5GSS A;  5HR2 A;  2DKI A;  1T00 A;  2IJY A;  1PGT A;  3CSJ A;  5ECL B;  3ZTL A;  2M80 A;  1GTA A;  2JSZ A;  2HFD A;  5J9B A;  2CAI A;  3QAG A;  1FAA A;  1NM3 A;  2ZCT A;  1Z6M A;  3R3E A;  4JR6 A;  3C73 A;  2DIZ A;  4KA0 A;  3GN3 A;  2YCD A;  1QQ2 A;  3ERW A;  2WZ9 A;  3ZLP A;  13GS A;  4WBJ A;  4YQU A;  4YH2 A;  2FWF A;  4PNF A;  4ML6 A;  3FKF A;  1EEJ A;  2FY6 A;  3D5J A;  2E2M A;  2C3N A;  1NSW A;  5DQY A;  1YDK A;  1JLW A;  4XTS A;  4E8E A;  2JAD A;  1T1V A;  2FWH A;  5C00 A;  3MWH A;  2P5R A;  4MAB A;  1GUK A;  2C8U A;  3A2W A;  4IVF A;  1FVK A;  2AAW A;  5CYY A;  4ID0 A;  2JZR A;  4GCI A;  2DJ3 A;  3GKM A;  4K0N A;  3F6D A;  2JZT A;  1EGR A;  3EMP A;  2HRF A;  2DMM A;  2C0F A;  2RM6 A;  5F07 A;  2VCQ A;  2IFQ A;  4V2L A;  1TDI A;  3D4T A;  2H72 A;  5ECM B;  1SD9 A;  2HZE A;  4HEA 2;  2YZH A;  2R5G A;  4TXO B;  4JU5 A;  3F4R A;  4KB3 A;  5AIV A;  3QPM A;  3KP9 A;  5KOX A;  1LBK A;  1K3Y A;  3RAZ A;  4WXT A;  1A8Y A;  5HR3 A;  3I43 A;  5H5Q A;  3DKS A;  3UBL A;  2G0F A;  3TJK A;  1PX6 A;  5IPG A;  2KHP A;  3TJG A;  3AY8 A;  2M72 A;  3TJJ A;  4Z2T A;  4FH8 A;  3TGZ A;  2LNS A;  4LLR A;  4OO5 A;  1V57 A;  1V98 A;  1AC1 A;  2J9H A;  4NXI A;  4PQ1 A;  2VL3 A;  2NDO A;  4NMU A;  2R0G A;  1ERW A;  6GSS A;  2L4C A;  4Q5Q A;  1B48 A;  3HD5 A;  3FR9 A;  2YWO A;  4NV2 A;  4IJ3 A;  5JWQ B;  3MYD A;  3TJB A;  3L0H A;  5G2Z A;  4CY6 A;  4OCE A;  4Z2U A;  4IBP A;  2IN3 A;  3D22 A;  4TVE A;  1ZYE A;  1AUC A;  4I2T A;  1T4Z A;  2CVB A;  2L59 A;  4KSM A;  3QOU A;  4NHZ A;  4POM A;  1ZCP A;  1K0B A;  1Z6N A;  1AQV A;  1USB A;  1WWJ A;  2FUG 2;  3HVV A;  2YOI A;  3TRQ A;  4ZIJ A;  3IBH A;  4NWY A;  1OE8 A;  11GS A;  1G6W A;  1TRV A;  4CHS A;  4RUV A;  1URM A;  1NW2 A;  4KND A;  2YPM A;  2MZC A;  3GX8 A;  5B6N A;  3WGX A;  4KF9 A;  1SK2 A;  1WRY A;  3MSZ A;  1SJI A;  5CNW A;  3LGC A;  4TW5 A;  1TI3 A;  4MF5 A;  3VWU A;  4G19 A;  4F0C A;  2WGR A;  1J0F A;  1F9M A;  2LST A;  2VAF A;  4DSQ A;  1ZYN A;  2DJK A;  2WS2 A;  4BVY B;  3VPT A;  2WCI A;  3FK8 A;  2VO4 A;  3Q6O A;  2CVK A;  3P8W A;  1JLV A;  5B6M A;  2GZP A;  3U5R E;  4MF7 A;  3P7X A;  1Y6E A;  5DCG A;  3KD0 A;  2F9S A;  2LRT A;  3EC3 A;  2LJK A;  1X9W B;  3WGD A;  3LG6 A;  1J08 A;  5ELA A;  4G9H A;  3GV1 A;  3L78 A;  1U6T A;  2H1G A;  6GSV A;  1N2A A;  2V41 A;  1WP0 A;  1PL1 A;  1SL0 B;  1RK4 A;  2VUP A;  3HA9 A;  3HZ8 A;  4WKW A;  2YV9 A;  5ENU A;  3IOS A;  4KUN A;  4QQ7 A;  1K0C A;  1FW1 A;  2R6K A;  3FR3 A;  3TDG A;  1BAY A;  5IMV A;  6GST A;  2H6Y A;  2FNO A;  3BD2 A;  2CV4 A;  4KW6 A;  2L5O A;  2AB6 A;  1XWB A;  3FZA A;  5CRE A;  2MMA A;  4MK3 A;  1M2B A;  4AJ7 A;  2NVL A;  2VCV A;  5HFK A;  1WJK A;  5JCG A;  1EV4 A;  1M9B A;  1OC8 A;  4WR5 A;  4PQI A;  1PA3 A;  4WET A;  3ZIJ A;  4AF2 A;  1JZO A;  1A8L A;  3GH9 A;  3W6G A;  4MJA A;  2CQ9 A;  4V2M A;  1SK0 A;  4V2N A;  2DSA A;  2V6K A;  4IN0 A;  3H1N A;  3LYK A;  1MDJ A;  3QFB C;  4IQA A;  3TKR A;  4ECI A;  3PIN A;  19GS A;  1GH2 A;  4XIH A;  4PUA A;  4EC0 A;  5KN3 A;  3ZFL A;  5IMA A;  3RHC A;  2R37 A;  1B9X C;  4MH2 A;  5ELG A;  3GTU A;  4X1U A;  1ERU A;  1TK0 B;  2H8L A;  2TRX A;  3RDW A;  4F0B A;  2GQL A;  3LOR A;  4PTS A;  1QK8 A;  3F8U A;  1PX7 A;  1JHB A;  2R0C A;  1R5A A;  5DAK A;  2VCX A;  2HRK A;  3MAK A;  4FYU A;  5IMC A;  3P90 A;  1WIK A;  2C0E A;  3TUE A;  4DEJ A;  4YAV A;  4O5U A;  1B4P A;  2K6V A;  2WDU A;  3EU4 A;  3K8N A;  2R4V A;  1M0U A;  3QD9 A;  2BMX A;  3ZFB A;  4MJB A;  1X5E A;  4DSS A;  1YF1 A;  5ECO B;  5D93 A;  1XVQ A;  1ON4 A;  4EIP A;  1DE1 A;  2FHE A;  5B8B A;  2JZS A;  4TR1 A;  2RUF A;  3C8E A;  3GNJ A;  4FYB A;  5D73 A;  1XG8 A;  5J3R A;  3L4N A;  5IQY A;  1DE2 A;  2Z9S A;  1M7T A;  2QGV A;  1OKT A;  2RII A;  5DAL A;  3KM6 A;  2VM2 A;  3QR6 A;  5DJL A;  2PER A;  4X4J A;  1YEP A;  3GIX A;  3UAP A;  5H5S A;  4POL A;  3ZVJ D;  2C80 A;  1OVN A;  1W89 A;  3VI5 A;  3TB2 A;  2F51 A;  3GH6 A;  3CTG A;  4PUR A;  2HRN A;  4F9Z A;  1O6J A;  1MDI A;  3ZRE A;  2DML A;  4HJM A;  1B4Q A;  4JR4 A;  3QDN A;  1CQG A;  4WR4 A;  3FYG A;  5KN2 A;  3MIX A;  4MJE A;  2MYG A;  2K8S A;  2TRC P;  1GTU A;  2HE3 A;  3IDV A;  4ZIL A;  2LUS A;  2B7K A;  4J56 E;  1ZYQ B;  2REM A;  4MJC A;  6GSY A;  1Z9H A;  2IFQ B;  2DLX A;  1Z5Y E;  1O73 A;  5EPF A;  3S9F A;  2HZE B;  3W8S A;  4IGJ A;  2B5E A;  1T8E B;  4K5R A;  2V1M A;  1NHY A;  5G31 A;  2H30 A;  2QSI A;  2LEG A;  4O5R A;  1QMV A;  1JZD A;  1S3D A;  4MLY A;  1B9Y C;  16GS A;  3R2Q A;  3KP8 A;  3QAV A;  2GGT A;  2YN1 A;  2GDR A;  1V9W A;  1HNA A;  5CRH A;  4MF6 A;  3D4M A;  1EV9 A;  1TU7 A;  3KMO A;  5J9C A;  4Q5R A;  3VI7 A;  1XW9 A;  2ALB A;  1V58 A;  2HSH A;  2IWT A;  5LD0 A;  3IRA A;  1GUH A;  4FO5 A;  4MCU A;  1R5P A;  1XW6 A;  3KZQ A;  1XIY A;  12GS A;  3KIJ A;  2VLV A;  2F3M A;  4XRA A;  2C1Y A;  4BPY A;  2GSS A;  3LXT A;  5ECN B;  1X5C A;  1X9S B;  1FB6 A;  4EE0 A;  3MNG A;  1HYU A;  1GLQ A;  1WMJ A;  3HDC A;  2B3S A;  2BJX A;  4ZL7 A;  5CRW A;  2YZU A;  1V2A A;  2EIR A;  1H4O A;  2H66 A;  2CX3 A;  3F63 A;  3P2A A;  5CP1 A;  4F2I A;  3FMW A;  3D6I A;  3EPT A;  3KEB A;  4OFM A;  1YF0 A;  2OA7 A;  2KLX A;  3Q18 A;  5B8A A;  1TP9 A;  4MH3 A;  3N9J A;  3ZRD A;  3Q74 A;  1FVJ A;  2NPB A;  1XZO A;  1TOF A;  5HQP A;  2E2G A;  1XBS A;  4A5P A;  5FWG A;  5IIZ A;  3TRP A;  2GS3 A;  4FYC A;  1X9M B;  1J9B A;  2GLR A;  5F0G A;  2H0G A;  3HCZ A;  4TR4 A;  5FT3 A;  4ICY A;  3KXO A;  4RQR A;  2F8F A;  4L8E A;  1AAZ A;  5COH A;  5KOW A;  2GZY A;  2MBT A;  3GUS A;  2PMT A;  1HQO A;  4ACS A;  5ECS A;  4HU9 A;  2A4V A;  1K0M A;  1O81 A;  4HI7 A;  1H75 A;  2X8C A;  2IMK A;  4ZB8 A;  4N10 A;  2AV4 A;  1GSE A;  2FLS A;  2HI7 A;  1T3B A;  1RQM A;  2YWM A;  5G1K A;  1ERV A;  3PPU A;  3FEU A;  1WE0 A;  2EIO A;  2PN8 A;  2PWJ A;  2X64 A;  2I4A A;  2PBJ A;  2AJQ B;  3QMX A;  3LEF A;  4BL7 A;  1R26 A;  2FA4 A;  1A0F A;  2FCH A;  2I3Y A;  4IQ1 A;  3CXG A;  2EIQ A;  2C3Q A;  5CO3 A;  5F06 A;  5HFG A;  1XPV A;  4PXO A;  4KDU A;  5JWO B;  4MMM A;  3WT1 A;  1OE7 A;  2X4A A;  5IPH A;  1DUG A;  5AGY A;  2OE0 A;  5IO2 A;  20GS A;  1C72 A;  3J7Y k;  1SL2 B;  2HZF A;  3DGQ A;  2VLT A;  1A2L A;  1CQH A;  4HZ4 A;  2H75 A;  4ULX A;  4OWY A;  2FWG A;  1N8J A;  1A24 A;  1O7U A;  1TXX A;  1KEB A;  4RI6 A;  4HU7 A;  1JZR A;  3IK7 A;  4NPB A;  2C0G A;  1MD3 A;  4I6X A;  5CRG A;  5F05 A;  2H70 A;  3LW9 A;  4IP6 A;  2N5A A;  1F37 A;  5JCW A;  2ON7 A;  4L0U A;  3ME8 A;  5AIX A;  2CAQ A;  1OC9 A;  1GSS A;  3A5W A;  2PVO C;  3DML A;  3KCM A;  4EXJ A;  2X8G A;  3APQ A;  3GTU B;  3A3T A;  2CX4 A;  4ZXG A;  5DJM A;  4TRX A;  2VCW A;  3IHQ A;  3M0F A;  1TK5 B;  4IS0 A;  3DEX A;  2O8V B;  5IOW A;  1GSD A;  2GST A;  4F82 A;  1F3A A;  2GZZ A;  4GST A;  5DAK B;  2O89 A;  1XVW A;  2H1A A;  3GRX A;  3G9B A;  4DSR A;  3V1W A;  4E8H A;  3IAM 2;  1GSQ A;  3BCI A;  1UC7 A;  1JZW A;  1ZYP A;  4WBR D;  4MNN A;  1EP7 A;  1G6Y A;  3SBC A;  4DSS B;  1SYR A;  3CBU A;  2XHF A;  3HXS A;  2DJJ A;  3ZL5 A;  2IMF A;  5GAP D;  3GYK A;  3IR4 A;  3TKS C;  4EIQ A;  4TR1 B;  2A2S A;  2GT5 A;  3N5O A;  1G7E A;  2VL2 C;  4EKZ A;  3VWW A;  1BQ7 A;  3RPN A;  1Z7R A;  3GL5 A;  5BRT A;  4OD7 A;  3C71 A;  1YQ1 A;  4MZC A;  1IYH A;  3BOA A;  4PQH A;  1THO A;  1ZZY A;  5DAL B;  4TOP A;  2JL4 A;  7GSS A;  4IHU A;  2A4H A;  4BA7 A;  5IMZ A;  2OBK A;  3EE2 A;  2WB9 A;  4EL1 A;  2NTO A;  4AJ8 A;  4MZB A;  2K18 A;  4IKH A;  3M3M A;  4GSN A;  2PUK C;  1PMT A;  6GSU A;  2I1U A;  3UEM A;  2AUV A;  5BMU A;  1TK8 B;  3BJ5 A;  2QA1 A;  1U88 A;  3DYR A;  2N5B A;  5ECH B;  2OKA A;  4YQV A;  1AQW A;  1FG4 A;  1Z7P A;  2OE1 A;  3LXZ A;  5CRD A;  2B1K A;  2FGX A;  1A2M A;  1R4W A;  2A2P A;  1RW1 A;  3HHV A;  4GQC A;  3F4T A;  1SJ6 A;  1Z3E A;  2XC2 A;  4YAP A;  5HFI A;  3FW2 A;  4GXZ A;  6GSX A;  2LKU A;  3APO A;  5ECQ B; 
#chains in the Genus database with same CATH homology
 3WGE A;  1PL2 A;  4EDY A;  4PGT A;  1ZMA A;  1U3I A;  1SKS B;  2H6Z A;  1NHO A;  3TKQ A;  4N11 A;  1SKR B;  2MMZ A;  4KAE A;  2VLU A;  1XWC A;  1ML6 A;  1XWA A;  2X8H A;  5DQS A;  1LU4 A;  4GSS A;  5G30 A;  3KMN A;  1ZOF A;  1I5G A;  2MMO A;  4ECB A;  1GUM A;  2E0Q A;  1BJX A;  2H0I A;  4G0I A;  1SD8 A;  3DVW A;  3KTB A;  2G2Q A;  4EVM A;  4ZB9 A;  2RLI A;  4BWQ A;  4PUF C;  8GSS A;  2B1L A;  1GNE A;  2R0P A;  4KCA A;  1VF2 A;  2LS5 A;  4HOJ A;  4AGS A;  1E2Y A;  2IIY A;  4D73 A;  2KP2 A;  2RUE A;  4ZL8 A;  14GS A;  3C1R A;  3ZMK A;  4BWS A;  3IV4 A;  4HDE A;  3IXR A;  3A2X A;  5IM9 A;  2OE3 A;  1V40 A;  6GSW A;  3E3E A;  4OFN A;  1O8W A;  3U6V A;  3VPQ A;  4J57 E;  1UN2 A;  1YEX A;  2GT6 A;  4XCS A;  4I5Q A;  2IPA A;  3ERG A;  4BVX A;  3O76 A;  3VLN A;  5G5F A;  2IMD A;  3LSZ A;  2OAD A;  2UZ8 A;  2HNL A;  5D9T A;  4MZW A;  4I8B A;  5IOX A;  5AIS A;  1QXH A;  1ZGN A;  2VD0 A;  3M9J A;  3UL3 A;  4LL4 B;  3HY2 A;  4ECJ A;  4V1A p;  4EDZ A;  3UOM A;  3D21 A;  3OR5 A;  2C3T A;  5IMD A;  3TOU A;  4K7I A;  2OBI A;  3TRX A;  5FHI A;  2CA8 A;  4XS4 A;  3W8J A;  4N0V A;  3TKS E;  5E4W A;  2GTU A;  2V6O A;  2F8A A;  2LJA A;  2YAN A;  1M2D A;  1XW5 A;  1SEN A;  4I2U A;  2X49 A;  2I81 A;  4ILF A;  1K0O A;  4K2D A;  4QL7 A;  5J4U A;  1PN0 A;  2H74 A;  4KE3 A;  2P0G A;  5HR0 A;  1Y25 A;  4XHM A;  4AJ6 A;  3TOT A;  3UBK A;  4ZBD A;  3FZ9 A;  2L57 A;  5INY A;  3HYP A;  4HJ2 A;  2QC7 A;  3M8N A;  5ID2 A;  5LCZ A;  5J41 A;  2DC5 A;  4KCE A;  1F3B A;  4MPG A;  5D9V A;  3GUR A;  2C4J A;  4BL7 B;  4DVC A;  4NHW A;  5A4V A;  2WJU A;  3GSS A;  1ST9 A;  1S3C A;  3L9S A;  2RM5 A;  2VD1 A;  3FY7 A;  1YY7 A;  5IO0 A;  3VK9 A;  4X43 A;  3FHK A;  2L6D A;  2H1D A;  5DBQ A;  2H0H A;  3LJR A;  2O85 A;  2K8V A;  5DCH A;  1SU9 A;  3QCP A;  3DIE A;  3UAR A;  2R3X A;  4EO3 A;  1FOH A;  4O92 A;  1FHE A;  3I9V 2;  2LTK A;  2LRN A;  4NAX A;  3JCM L;  2DJ2 A;  4MDC A;  2ON5 A;  1A23 A;  2PGT A;  3G7I A;  3EWL A;  2D2Z A;  2H76 A;  2LRC A;  4L0W A;  2VOC A;  2JU5 A;  1GL8 A;  1OC9 B;  3TJF A;  3L9U A;  2ZUP A;  2K9F A;  2FWE A;  4K7O A;  5E59 A;  4HQZ A;  3IC8 A;  4RI7 A;  4IW9 A;  3TKS A;  2HYX A;  4WF5 A;  3FRC A;  2VL2 A;  4G0L A;  2CVD A;  1O8X A;  4O32 A;  2QA2 A;  1HNC A;  3GHA A;  5H5R A;  3O6T A;  2PPT A;  4POK A;  5A4W A;  5D9W A;  3GKN A;  3F3Q A;  4KGI A;  1AW9 A;  2YJ7 A;  2JSY A;  5ECP B;  3GKX A;  4K1F A;  5B7C A;  4XRD A;  1BX9 A;  1OKD A;  5DDL A;  5LNK e;  5IMF A;  3DD3 A;  2H6X A;  3EMX A;  3RHB A;  2CT6 A;  3F3R A;  1YZX A;  2B5X A;  4KSO A;  3LFL A;  5D8I A;  2MMN A;  3ED3 A;  5CAX A;  1QFN A;  4NV5 A;  4K7N A;  1GTB A;  2TIR A;  2ZNM A;  1PKZ A;  2KUC A;  1YKA A;  1AQX A;  5J5N A;  1VF3 A;  3IAS 2;  2WUL A;  3GFK A;  2YWN A;  1A0R P;  4KX4 A;  3EUR A;  4YKF A;  3GL3 A;  3H79 A;  2I9H A;  4Z2R A;  1GNW A;  3TCO A;  3DWV A;  3F9U A;  4OCF A;  4IJI A;  4N0Z A;  1AXD A;  1K0A A;  5F8B A;  3CRT A;  2H1B A;  2GSR A;  3HZ4 A;  4ISD A;  4JRR A;  3L9V A;  1EOH A;  3FR6 A;  2YNX A;  2DBC A;  1TRW A;  3HJM A;  1SJZ A;  4YQM A;  3GX0 A;  3H8Q A;  1OAZ A;  3GMF A;  1KTE A;  4WF4 A;  2L4Q A;  2NBS A;  4OO4 A;  5ECR B;  2OJL A;  1W4V A;  1K3L A;  3Q19 A;  1EEM A;  3ZYW A;  2LNT A;  3RBT A;  3KH7 A;  1GSY A;  4IP1 A;  4JE1 A;  2HRA A;  3GST A;  2B6M A;  3VUR A;  2KOK A;  1F6M C;  4KDY A;  4FIW A;  5GST A;  3UJ1 A;  1T4Y A;  1FOV A;  1DSB A;  1TRU A;  3HVS A;  3KTL A;  2P5Q A;  3EU3 A;  1THX A;  10GS A;  2A2R A;  3H4K A;  1HD2 A;  4X0X A;  1GSU A;  1F2E A;  3C1S A;  2B7J A;  3IK9 A;  1GP1 A;  1PN9 A;  3O3T A;  3CRU A;  1K3O A;  5L71 A;  18GS A;  4HS1 A;  3F4S A;  3MDK A;  1SK1 A;  3J7Y b;  3ZZX A;  5G1L A;  4XS1 A;  4LA1 A;  1JFU A;  2C0D A;  2ES7 A;  1EOG A;  3M9K A;  4JBB A;  5DVB A;  1WPI A;  3PH9 A;  1ACV A;  3E0U A;  2AYT A;  4O7H A;  2H73 A;  5EL8 A;  2PVQ A;  2HSY A;  4D73 B;  2GQK A;  2VL9 A;  1OC3 A;  2E7P A;  2VM1 A;  1GRX A;  1T7P B;  3LYP A;  3G7J A;  3IPZ A;  3VFI A;  2XBQ A;  2P31 A;  3I6A A;  17GS A;  2YJH A;  1BG5 A;  1FO5 A;  4V1A g;  4ZBA A;  4PNG A;  4WEY A;  5EY6 A;  4RQX A;  3WYW A;  2R2J A;  5EVO A;  4L5L A;  2B5Y A;  4HZ2 A;  5ECK B;  2YP6 A;  1TI1 A;  2DIY A;  4ZL9 A;  4CW9 A;  3WD6 A;  4TXO A;  3SWL A;  3D0Z A;  1TKD B;  1VGL A;  2OAC A;  3PGT A;  1VF4 A;  4CDO A;  4I97 A;  2CZ2 A;  3GKK A;  1QUW A;  4K2X A;  4BVX B;  2VCT A;  2X99 A;  4OMV A;  2V2G A;  1K0N A;  2IL3 A;  3LQ7 A;  3CTF A;  1Q98 A;  1TTZ A;  1EWX A;  4MA9 A;  2LV3 A;  2LQO A;  3HJO A;  3C7M A;  4TKY A;  3QFA C;  1GLP A;  4K8M A;  1G7O A;  4Q5N A;  3US3 A;  1PRX A;  4YKG A;  1X0R A;  3EYT A;  3VWV A;  3NIV A;  4XS4 B;  1ABA A;  3UVT A;  5ECI B;  3VWX A;  1EZK A;  3NOF A;  4KH7 A;  2VIM A;  3HVX A;  1S3A A;  5HR1 A;  1BED A;  1DBY A;  1SKW B;  1XFL A;  4KDX A;  3ZIT A;  3DXB A;  4K0G A;  5A4U A;  1PQN A;  4XS6 A;  3A5I A;  4O5Q A;  1MEK A;  3CMI A;  2WRT A;  4CY8 A;  1KNG A;  3DVX A;  1VF1 A;  2HT9 A;  4TXV A;  3H93 A;  2LJR A;  4HUA A;  2GQM A;  2BTO T;  1ILO A;  5ID2 B;  4TR3 A;  4Z7X A;  3NZN A;  4G10 A;  1HNB A;  4JZQ A;  2XPE A;  1BYE A;  1FB0 A;  1XCC A;  3DRN A;  4POB A;  3FZ4 A;  1U3A A;  1VRS D;  1Q4J A;  4JED A;  2M46 A;  22GS A;  4TN8 A;  2WFC A;  4QL9 A;  1B8X A;  2YWI A;  4BVY A;  1TU8 A;  3UIW A;  1KBN A;  3UMA A;  1WOU A;  4K5S A;  3KGK A;  1I9D A;  1MTC A;  1PKW A;  2O87 A;  5KN0 A;  1YJ6 A;  4GRF A;  5KEJ A;  1AIU A;  1ERT A;  1EGO A;  1U87 A;  2L5L A;  4P3Y B;  4OFT A;  1TW9 A;  2FD3 A;  5JWR B;  3E9J B;  2GSQ A;  1XOA A;  3KH9 A;  2J23 A;  4TR0 A;  5KN1 A;  5ABR A;  2QKE A;  3WT2 A;  1XWG A;  2JAC A;  4L5O A;  1R7H A;  1YKC A;  2IMI A;  3ZIV A;  4GLT A;  2CZ3 A;  1M2A A;  4Q5F A;  2KP1 A;  3IHG A;  4J2F A;  1X5D A;  1PSQ A;  2H19 A;  3EVI A;  5JCU A;  2AHE A;  3BBY A;  4LMW A;  3I69 A;  2N5F A;  5A5K A;  1XWK A;  4GF0 A;  1GWC A;  4IEL A;  3CYN A;  3IC4 A;  4FQU A;  1PD2 1;  3LWA A;  2GVP A;  3QAW A;  3CSH A;  2MBS A;  1EP8 A;  2XPD A;  4PX1 A;  3ZML A;  3EIN A;  4N30 A;  3BCK A;  3TKP A;  1GUL A;  3APS A;  3KJY A;  5C04 A;  5GAN D;  4GWR A;  4G0K A;  5D96 A;  1GTI A;  4K6X A;  3F0I A;  9GSS A;  1IYI A;  1SL1 B;  1K0D A;  4MPF A;  2IME A;  5AN1 A;  3FZ5 A;  1TJD A;  4F03 A;  4K9Z A;  3IE3 A;  4GTU A;  4ZB6 A;  2O7K A;  3ZVJ A;  3M1G A;  2HXK A;  1O85 A;  4LL1 B;  3GA4 A;  4LMV A;  4GQF A;  1SYX A;  3A2V A;  2YV7 A;  3RPP A;  1G0T A;  2DJ1 A;  4ZBB A;  5D9X A;  5GZZ B;  3G7Y A;  3IA1 A;  4G2E A;  1A2J A;  3HKR A;  1GSF A;  5G5E A;  2PU9 C;  2DKH A;  1MD4 A;  1MDK A;  4MP4 A;  3PR8 A;  4ML1 A;  1UA5 A;  1OYJ A;  1E6B A;  2HLS A;  3ERF A;  4H86 A;  1XXU A;  3ISO A;  1ZL9 A;  2EC4 A;  4HQS A;  1LJR A;  3UVH A;  4EF0 A;  2L6C A;  2VCZ A;  2HSM A;  3F6F A;  3HJP A;  1UVZ A;  4USS A;  1M99 A;  3CSI A;  2V32 A;  1M9A A;  2H71 A;  2DJ0 A;  2LQQ A;  2XBI A;  4ECC A;  1TRS A;  1QGV A;  1XOB A;  2H01 A;  4EUY A;  2FA8 A;  3ME7 A;  5GSS A;  5HR2 A;  2DKI A;  1T00 A;  2IJY A;  1PGT A;  3CSJ A;  5ECL B;  3ZTL A;  2M80 A;  1GTA A;  2JSZ A;  2HFD A;  5J9B A;  2CAI A;  3QAG A;  1FAA A;  1NM3 A;  2ZCT A;  1Z6M A;  3R3E A;  4JR6 A;  3C73 A;  2DIZ A;  4KA0 A;  3GN3 A;  2YCD A;  1QQ2 A;  3ERW A;  2WZ9 A;  3ZLP A;  13GS A;  4WBJ A;  4YQU A;  4YH2 A;  2FWF A;  4PNF A;  4ML6 A;  3FKF A;  1EEJ A;  2FY6 A;  3D5J A;  2E2M A;  2C3N A;  1NSW A;  5DQY A;  1YDK A;  1JLW A;  4XTS A;  4E8E A;  2JAD A;  1T1V A;  2FWH A;  5C00 A;  3MWH A;  2P5R A;  4MAB A;  1GUK A;  2C8U A;  3A2W A;  4IVF A;  1FVK A;  2AAW A;  5CYY A;  4ID0 A;  2JZR A;  4GCI A;  2DJ3 A;  3GKM A;  4K0N A;  3F6D A;  2JZT A;  1EGR A;  3EMP A;  2HRF A;  2DMM A;  2C0F A;  2RM6 A;  5F07 A;  2VCQ A;  2IFQ A;  4V2L A;  1TDI A;  3D4T A;  2H72 A;  5ECM B;  1SD9 A;  2HZE A;  4HEA 2;  2YZH A;  2R5G A;  4TXO B;  4JU5 A;  3F4R A;  4KB3 A;  5AIV A;  3QPM A;  3KP9 A;  5KOX A;  1LBK A;  1K3Y A;  3RAZ A;  4WXT A;  1A8Y A;  5HR3 A;  3I43 A;  5H5Q A;  3DKS A;  3UBL A;  2G0F A;  3TJK A;  1PX6 A;  5IPG A;  2KHP A;  3TJG A;  3AY8 A;  2M72 A;  3TJJ A;  4Z2T A;  4FH8 A;  3TGZ A;  2LNS A;  4LLR A;  4OO5 A;  1V57 A;  1V98 A;  1AC1 A;  2J9H A;  4NXI A;  4PQ1 A;  2VL3 A;  2NDO A;  4NMU A;  2R0G A;  1ERW A;  6GSS A;  2L4C A;  4Q5Q A;  1B48 A;  3HD5 A;  3FR9 A;  2YWO A;  4NV2 A;  4IJ3 A;  5JWQ B;  3MYD A;  3TJB A;  3L0H A;  5G2Z A;  4CY6 A;  4OCE A;  4Z2U A;  4IBP A;  2IN3 A;  3D22 A;  4TVE A;  1ZYE A;  1AUC A;  4I2T A;  1T4Z A;  2CVB A;  2L59 A;  4KSM A;  3QOU A;  4NHZ A;  4POM A;  1ZCP A;  1K0B A;  1Z6N A;  1AQV A;  1USB A;  1WWJ A;  2FUG 2;  3HVV A;  2YOI A;  3TRQ A;  4ZIJ A;  3IBH A;  4NWY A;  1OE8 A;  11GS A;  1G6W A;  1TRV A;  4CHS A;  4RUV A;  1URM A;  1NW2 A;  4KND A;  2YPM A;  2MZC A;  3GX8 A;  5B6N A;  3WGX A;  4KF9 A;  1SK2 A;  1WRY A;  3MSZ A;  1SJI A;  5CNW A;  3LGC A;  4TW5 A;  1TI3 A;  4MF5 A;  3VWU A;  4G19 A;  4F0C A;  2WGR A;  1J0F A;  1F9M A;  2LST A;  2VAF A;  4DSQ A;  1ZYN A;  2DJK A;  2WS2 A;  4BVY B;  3VPT A;  2WCI A;  3FK8 A;  2VO4 A;  3Q6O A;  2CVK A;  3P8W A;  1JLV A;  5B6M A;  2GZP A;  3U5R E;  4MF7 A;  3P7X A;  1Y6E A;  5DCG A;  3KD0 A;  2F9S A;  2LRT A;  3EC3 A;  2LJK A;  1X9W B;  3WGD A;  3LG6 A;  1J08 A;  5ELA A;  4G9H A;  3GV1 A;  3L78 A;  1U6T A;  2H1G A;  6GSV A;  1N2A A;  2V41 A;  1WP0 A;  1PL1 A;  1SL0 B;  1RK4 A;  2VUP A;  3HA9 A;  3HZ8 A;  4WKW A;  2YV9 A;  5ENU A;  3IOS A;  4KUN A;  4QQ7 A;  1K0C A;  1FW1 A;  2R6K A;  3FR3 A;  3TDG A;  1BAY A;  5IMV A;  6GST A;  2H6Y A;  2FNO A;  3BD2 A;  2CV4 A;  4KW6 A;  2L5O A;  2AB6 A;  1XWB A;  3FZA A;  5CRE A;  2MMA A;  4MK3 A;  1M2B A;  4AJ7 A;  2NVL A;  2VCV A;  5HFK A;  1WJK A;  5JCG A;  1EV4 A;  1M9B A;  1OC8 A;  4WR5 A;  4PQI A;  1PA3 A;  4WET A;  3ZIJ A;  4AF2 A;  1JZO A;  1A8L A;  3GH9 A;  3W6G A;  4MJA A;  2CQ9 A;  4V2M A;  1SK0 A;  4V2N A;  2DSA A;  2V6K A;  4IN0 A;  3H1N A;  3LYK A;  1MDJ A;  3QFB C;  4IQA A;  3TKR A;  4ECI A;  3PIN A;  19GS A;  1GH2 A;  4XIH A;  4PUA A;  4EC0 A;  5KN3 A;  3ZFL A;  5IMA A;  3RHC A;  2R37 A;  1B9X C;  4MH2 A;  5ELG A;  3GTU A;  4X1U A;  1ERU A;  1TK0 B;  2H8L A;  2TRX A;  3RDW A;  4F0B A;  2GQL A;  3LOR A;  4PTS A;  1QK8 A;  3F8U A;  1PX7 A;  1JHB A;  2R0C A;  1R5A A;  5DAK A;  2VCX A;  2HRK A;  3MAK A;  4FYU A;  5IMC A;  3P90 A;  1WIK A;  2C0E A;  3TUE A;  4DEJ A;  4YAV A;  4O5U A;  1B4P A;  2K6V A;  2WDU A;  3EU4 A;  3K8N A;  2R4V A;  1M0U A;  3QD9 A;  2BMX A;  3ZFB A;  4MJB A;  1X5E A;  4DSS A;  1YF1 A;  5ECO B;  5D93 A;  1XVQ A;  1ON4 A;  4EIP A;  1DE1 A;  2FHE A;  5B8B A;  2JZS A;  4TR1 A;  2RUF A;  3C8E A;  3GNJ A;  4FYB A;  5D73 A;  5J3R A;  3L4N A;  5IQY A;  1DE2 A;  2Z9S A;  1M7T A;  2QGV A;  1OKT A;  2RII A;  5DAL A;  3KM6 A;  2VM2 A;  3QR6 A;  5DJL A;  2PER A;  4X4J A;  1YEP A;  3GIX A;  3UAP A;  5H5S A;  4POL A;  3ZVJ D;  2C80 A;  1OVN A;  1W89 A;  3VI5 A;  3TB2 A;  2F51 A;  3GH6 A;  3CTG A;  4PUR A;  2HRN A;  4F9Z A;  1O6J A;  1MDI A;  3ZRE A;  2DML A;  4HJM A;  1B4Q A;  4JR4 A;  3QDN A;  1CQG A;  4WR4 A;  3FYG A;  5KN2 A;  3MIX A;  4MJE A;  2MYG A;  2K8S A;  2TRC P;  1GTU A;  2HE3 A;  3IDV A;  4ZIL A;  2LUS A;  2B7K A;  4J56 E;  1ZYQ B;  2REM A;  4MJC A;  6GSY A;  1Z9H A;  2IFQ B;  2DLX A;  1Z5Y E;  1O73 A;  5EPF A;  3S9F A;  2HZE B;  3W8S A;  4IGJ A;  2B5E A;  1T8E B;  4K5R A;  2V1M A;  1NHY A;  5G31 A;  2H30 A;  2QSI A;  2LEG A;  4O5R A;  1QMV A;  1JZD A;  1S3D A;  4MLY A;  1B9Y C;  16GS A;  3R2Q A;  3KP8 A;  3QAV A;  2GGT A;  2YN1 A;  2GDR A;  1V9W A;  1HNA A;  5CRH A;  4MF6 A;  3D4M A;  1EV9 A;  1TU7 A;  3KMO A;  5J9C A;  4Q5R A;  3VI7 A;  1XW9 A;  2ALB A;  1V58 A;  2HSH A;  2IWT A;  5LD0 A;  3IRA A;  1GUH A;  4FO5 A;  4MCU A;  1R5P A;  1XW6 A;  3KZQ A;  1XIY A;  12GS A;  3KIJ A;  2VLV A;  2F3M A;  4XRA A;  2C1Y A;  4BPY A;  2GSS A;  3LXT A;  5ECN B;  1X5C A;  1X9S B;  1FB6 A;  4EE0 A;  3MNG A;  1HYU A;  1GLQ A;  1WMJ A;  3HDC A;  2B3S A;  2BJX A;  4ZL7 A;  5CRW A;  2YZU A;  1V2A A;  2EIR A;  1H4O A;  2H66 A;  2CX3 A;  3F63 A;  3P2A A;  5CP1 A;  4F2I A;  3FMW A;  3D6I A;  3EPT A;  3KEB A;  4OFM A;  1YF0 A;  2OA7 A;  2KLX A;  3Q18 A;  5B8A A;  1TP9 A;  4MH3 A;  3N9J A;  3ZRD A;  3Q74 A;  1FVJ A;  2NPB A;  1XZO A;  1TOF A;  5HQP A;  2E2G A;  1XBS A;  4A5P A;  5FWG A;  5IIZ A;  3TRP A;  2GS3 A;  4FYC A;  1X9M B;  1J9B A;  2GLR A;  5F0G A;  2H0G A;  3HCZ A;  4TR4 A;  5FT3 A;  4ICY A;  3KXO A;  4RQR A;  2F8F A;  4L8E A;  1AAZ A;  5COH A;  5KOW A;  2GZY A;  2MBT A;  3GUS A;  2PMT A;  1HQO A;  4ACS A;  5ECS A;  4HU9 A;  2A4V A;  1K0M A;  1O81 A;  4HI7 A;  1H75 A;  2X8C A;  2IMK A;  4ZB8 A;  4N10 A;  2AV4 A;  1GSE A;  2FLS A;  2HI7 A;  1T3B A;  1RQM A;  2YWM A;  5G1K A;  1ERV A;  3PPU A;  3FEU A;  1WE0 A;  2EIO A;  2PN8 A;  2PWJ A;  2X64 A;  2I4A A;  2PBJ A;  2AJQ B;  3QMX A;  3LEF A;  4BL7 A;  1R26 A;  2FA4 A;  1A0F A;  2FCH A;  2I3Y A;  4IQ1 A;  3CXG A;  2EIQ A;  2C3Q A;  5CO3 A;  5F06 A;  5HFG A;  1XPV A;  4PXO A;  4KDU A;  5JWO B;  4MMM A;  3WT1 A;  1OE7 A;  2X4A A;  5IPH A;  1DUG A;  5AGY A;  2OE0 A;  5IO2 A;  20GS A;  1C72 A;  3J7Y k;  1SL2 B;  2HZF A;  3DGQ A;  2VLT A;  1A2L A;  1CQH A;  4HZ4 A;  2H75 A;  4ULX A;  4OWY A;  2FWG A;  1N8J A;  1A24 A;  1O7U A;  1TXX A;  1KEB A;  4RI6 A;  4HU7 A;  1JZR A;  3IK7 A;  4NPB A;  2C0G A;  1MD3 A;  4I6X A;  5CRG A;  5F05 A;  2H70 A;  3LW9 A;  4IP6 A;  2N5A A;  1F37 A;  5JCW A;  2ON7 A;  4L0U A;  3ME8 A;  5AIX A;  2CAQ A;  1OC9 A;  1GSS A;  3A5W A;  2PVO C;  3DML A;  3KCM A;  4EXJ A;  2X8G A;  3APQ A;  3GTU B;  3A3T A;  2CX4 A;  4ZXG A;  5DJM A;  4TRX A;  2VCW A;  3IHQ A;  3M0F A;  1TK5 B;  4IS0 A;  3DEX A;  2O8V B;  5IOW A;  1GSD A;  2GST A;  4F82 A;  1F3A A;  2GZZ A;  4GST A;  5DAK B;  2O89 A;  1XVW A;  2H1A A;  3GRX A;  3G9B A;  4DSR A;  3V1W A;  4E8H A;  3IAM 2;  1GSQ A;  3BCI A;  1UC7 A;  1JZW A;  1ZYP A;  4WBR D;  4MNN A;  1EP7 A;  1G6Y A;  3SBC A;  4DSS B;  1SYR A;  3CBU A;  2XHF A;  3HXS A;  2DJJ A;  3ZL5 A;  2IMF A;  5GAP D;  3GYK A;  3IR4 A;  3TKS C;  4EIQ A;  4TR1 B;  2A2S A;  2GT5 A;  3N5O A;  1G7E A;  2VL2 C;  4EKZ A;  3VWW A;  1BQ7 A;  3RPN A;  1Z7R A;  3GL5 A;  5BRT A;  4OD7 A;  3C71 A;  1YQ1 A;  4MZC A;  1IYH A;  3BOA A;  4PQH A;  1THO A;  1ZZY A;  5DAL B;  4TOP A;  2JL4 A;  7GSS A;  4IHU A;  2A4H A;  4BA7 A;  5IMZ A;  2OBK A;  3EE2 A;  2WB9 A;  4EL1 A;  2NTO A;  4AJ8 A;  4MZB A;  2K18 A;  4IKH A;  3M3M A;  4GSN A;  2PUK C;  1PMT A;  6GSU A;  2I1U A;  3UEM A;  2AUV A;  5BMU A;  1TK8 B;  3BJ5 A;  2QA1 A;  1U88 A;  3DYR A;  2N5B A;  5ECH B;  2OKA A;  4YQV A;  1AQW A;  1FG4 A;  1Z7P A;  2OE1 A;  3LXZ A;  5CRD A;  2B1K A;  2FGX A;  1A2M A;  1R4W A;  2A2P A;  1RW1 A;  3HHV A;  4GQC A;  3F4T A;  1SJ6 A;  1Z3E A;  2XC2 A;  4YAP A;  5HFI A;  3FW2 A;  4GXZ A;  6GSX A;  2LKU A;  3APO A;  5ECQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...