4O3TB

Zymogen hgf-beta/met with zymogen activator peptide zap.14
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
525
structure length
499
Chain Sequence
KYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKINVRCLQHFYGPNHEHCFNRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/growth factor
total genus 114
structure length 499
sequence length 525
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o3tB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4o3tB02
3C75H 3I7NA 3SJLD 2Q7QA 5H1MA 4A0AA 3C99A 3JB9L 2VDQB 3RFGA 1XIPA 3RN1D 4A08B 5E6RB 4QRJA 2I0SA 3OW8A 2B5NA 4J0WA 3J81g 5IC7A 3VH0A 4CY3A 1MG3A 3HFQA 4HDJA 1JJUB 3GFCA 3RLMD 2H3XA 3PVWB 2UZYB 3C9CA 3EMHA 4I79A 4A0AB 4Z7OB 4NSXA 3UVLA 3RMZD 4UM9B 5FKRA 4J87A 2XL2A 1A0RB 2XYIA 3PSCB 3PE7A 4YVDA 4G56B 4ERZA 5EAPA 4ZOVA 4E54B 3SXTD 5JWZA 5I5IA 4D0KA 1U2VC 5FKSA 1N6FA 3I8CA 3EI1A 5FKQA 4IA9A 3UVNA 1PI6A 4PBZA 2P26A 4ERYA 2QC5A 3K27A 4U1EI 2P28A 2PM9A 2HJBA 4GGDA 4ZOZA 4CI8A 1SSLA 3BWSA 4WK0B 3MZLA 4WK2B 2P9KC 3N0DA 2IAAA 3EI1B 2UZXB 5IGQA 4X63B 3NIDB 2PM9B 2HYEA 3AH8B 4AOWA 2VDPB 4BH6A 1K8KC 3J80g 3U4YA 4L3HD 3B7FA 2GNQA 2VDKB 5EMMB 2CO0A 4PBYA 4CY1A 2VDOB 4Z7NB 2EBSA 4Z8LA 3IIWA 1N6DA 4WJKB 5E6UB 2HJ4A 4JT5C 3OL2A 2YNNA 3JZGA 3NVQA 5SXMA 4J0XA 2VDLB 4QQEA 2H13A 1SQ9A 5THAA 2PM6B 2P9PC 4WK4B 2XL3A 2PBIB 5H14A 5I5MA 3A0FA 3OL2B 1YFQA 3PSLA 4L9OA 4XYIA 5HDBB 4A2LA 4CZYA 2H9NA 4CY5A 4FHLA 3SBQA 2IUPA 4O1QD 4K3ID 1U8CB 5CXCA 3FCUB 3GREA 1P22A 3VI3B 3ZE0B 1QNIA 3SBPA 4J86A 3CIKB 1TYEB 5EM2A 3RSEC 5IJ8E 4FA1D 4ES0A 4QT8A 3DM0A 5EAMA 1S4UX 4GGCA 4GM3A 5CXCB 5EARA 5FKTA 3E0CA 2Z2OA 1YUKA 5HE1B 5EM2B 2H6KA 2HESX 2P9LC 4MK0B 3ZE2B 4O45A 4GQBB 3RFHA 4GQ1A 5C9ZB 2B5MA 3PXWD 5EMJB 4UM8B 3SVWD 2H9PA 4J84A 4IMMA 4H5IA 2H9MA 3SCYA 1ERJA 3ZDYB 2QXVA 3I7OA 4OWRA 3T3MB 3DWLC 4QL1A 5IGOA 3IJ0A 3CFVA 5FQDA 3AL9A 3PVUB 3L4OD 1SHYB 1K32A 4GGAA 3SWSD 4JT6C 5HE0B 2IWFA 5IJ7E 2G99A 2AGLA 2I0TA 3UVMA 1B9XA 2CE9A 1JMXB 4J77A 3VI4B 4J79A 3JZHA 3I2NA 3PXSD 3T3PB 4R7AB 4L1QD 2O9KA 2VDMB 4TZ4A 3SHFA 1GXRA 2YNPA 4XYHA 3MKQA 3ZWLB 3IKOA 3OTTA 1SQJA 1OLZA 4UM9D 1N6EA 1TBGA 5HQGA 4CI3A 3OKYA 2OIZA 5K19A 1JMZB 2AQ5A 4A7JA 2VDNB 4KFMB 4CY2A 1OMWB 2VC2B 4A11A 3L4MD 2AH1A 3UVKA 4JSXC 3JZNA 3OKYB 3BG1A 4FWWA 5AMSA 4O9DA 2AGXA 4A0BA 5GMKn 2BCJB 4GM9A 4J8GA 3AL8A 4J78A 4A11B 2B4EA 3DXMC 2OK4A 2PM7B 2H9LA 2OVQB 5A2Qg 3DXKC 1Q47A 2YMUA 4A0BB 2I3TA 4JSNC 2HKRA 2H6NA 3AL8B 5IT9g 2I3SA 2AGYA 2H6QA 2IWKA 1GOTB 3JRPA 3IJCA 3FGBA 3FM0A 2MTAH 4X61B 3N0EA 4ESGA 4Y7RA 3I8EA 2AH0A 5EALA 2BBKH 1PEVA 3I7KA 2J56H 1TYQC 3ZDXB 4UI9R 2VDRB 4LG9A 2YBAA 5AJAA 3SMRA 1L0QA 4Z7QB 3F3FA 4X3EA 3SFZA 3IIYA 4PXWA 3EI4A 2H68A 4JXMA 1MDAH 5TEFA 1NR0A 3EI3A 4FA4D 3SLED 4EWRA 3UKRC 2OVPB 4A2MA 3ODTA 2J57G 4JSVC 3EI2A 3EI4B 2CNXA 3JAMg 5TEEA 5KDOB 4J8BA 5GXIA 4D6VA 4J82A 4CC9A 2CN3A 3EI3B 1GG2B 3V9FA 3KRXB 4FAND 3MMYA 2I0RA 2P9SC 2H47A 4O3TB 1R5MA 3EI2B 3MZKA 5EMLB 3V5WB 3OKWA 3NIGB 4PC0A 2IUVA 4CZXA 5C2WB 3K26A 4K3JB 5GSAA 4FA9D 4E54A 4PSWB 1PGUA 4A09A 2YNOA 3RRMC 3UR4A 4GM8A 2Z2NA 3EU7A 5HYNB 3CFSB 1MG2A 3ORVD 4GZ8A 3I7PA 1PBYB 2P9NC 3RN0D 2CN2A 2H14A 5CXBA 4A09B 3MKSB 4JD2C 5I5JA 5CYKA 5AFU3 4BL0A 4FAVD 4JSPC 4Y5RD 5TDHB 3NIFB 4CI2A 1JOFA 3AFCA 4OZUA 2IUQA 1VYHC 5CXBB 2B5LA 5CYKB 4CZVA 4ZN4A 2GC7A 4FB1D 3I7HA 3DSMA 2CE8A 3V7DB 5GXHA 4PNKB 2OJYA 4N14A 2HXCA 5B4WA 4H5JA 4X60B 4E5ZA 4LG8A 5H17A 3EG6A 4J81A 4CI1A 1NEXB 4GQ2P 4O3UB 3MXXA 3NVXA 1XHMA 5HE2B 3W15A 3F3PA 4E5ZB 4ZOXA 5FLXg 1GP2B 3UKUC 3I89A 2G9AA 3SN6B 3EWEA 4U7AA 2YB8B 2OK6A 5K1CC 3ZDZB 4J73A 1U4CA 2J55H 3JROA 5FA5B 1B9YA 3ZE1B 1RI6A 5HE3B 4GMBA 3ULEC 2AGWA 4ERQA 4LGNA 2IURA 2TRCB 3FRXA 4AEZA 5TF2A 2P9IC 3NVNA 4BUJC 5EMKB 2OVRB 3SBRA 3UVOA 3KRWB 1XKSA 2XU7A 3JPXA 2W18A 3OKTA 3P4FA 3VA6A 2HKMA 4PSXB 4XEIC 5C2VB 2AGZA 3C5MA 2P9UC 4L3GD 5E6SB 2Z2PA 1FWXA 3I7LA 2GC4A 3VGZA 3BG0A 3F3GA 3IJ1A 5FXYA 4A08A 2CO0C 4FA5D 3PXTD 4ZOYA
chains in the Genus database with same CATH superfamily
3C75H 3I7NA 3SJLD 2Q7QA 4BP9A 5H1MA 4BCCA 4A0AA 3GD1I 2BKLA 4Z7OA 4UM9A 2WQ8A 3C99A 3JB9L 2VDQB 3RFGA 1XIPA 3RN1D 4A08B 5E6RB 5M5UA 3QI0A 2EIBA 4QRJA 2I0SA 3OW8A 2B5NA 4J0WA 3J81g 5IC7A 3VH0A 4CY3A 1MG3A 3HFQA 4HDJA 1JJUB 3GFCA 5M5RA 3RLMD 2H3XA 3PVWB 2UZYB 3C9CA 3EMHA 4I79A 4A0AB 4Z7OB 4NSXA 3UVLA 3RMZD 4UM9B 5FKRA 4J87A 2XL2A 3MUOA 1A0RB 3T3PA 2XYIA 3PSCB 3PE7A 4YVDA 4G56B 4ERZA 5EAPA 5M5TA 4ZOVA 4E54B 3SXTD 5JWZA 4WK0A 5I5IA 1VZ2A 1L5GA 4D0KA 4WK2A 1U2VC 4G1EA 5FKSA 3O4HA 1N6FA 3I8CA 3EI1A 5FKQA 4IA9A 3UVNA 1PI6A 4PBZA 2P26A 3NIDA 2QC5A 3K27A 4U1EI 4ERYA 2P28A 2PM9A 2HJBA 2VDPA 4GGDA 4ZOZA 4DNUA 4CI8A 1SSLA 3BWSA 4WK0B 3MZLA 4WK2B 2VDKA 2P9KC 3EQ8A 3N0DA 1O6GA 3GC3B 2IAAA 1C9LA 3EI1B 2UZXB 3V4VA 5IGQA 4X63B 4MMYA 4Z7NA 3NIDB 2PM9B 2HYEA 3AH8B 4AOWA 2VDPB 1QFSA 4WJKA 1K8KC 4BH6A 3J80g 3U4YA 5E6UA 4L3HD 3B7FA 2GNQA 2VDKB 5EMMB 3DDUA 2CO0A 4PBYA 4CY1A 1C9IA 2VDLA 2VDOB 4Z7NB 1JV2A 2EBSA 4Z8LA 3O4GA 3IIWA 1N6DA 4WK4A 4WJKB 1H2XA 5E6UB 2HJ4A 4JT5C 3OL2A 3IUMA 2YNNA 3JZGA 3NVQA 5SXMA 5HDBA 4J0XA 2VDLB 4QQEA 2H13A 1SQ9A 5THAA 1U8CA 2PM6B 3FCUA 2P9PC 3VI3A 3K72A 4WK4B 2XL3A 2PBIB 5H14A 5I5MA 3A0FA 3OL2B 1TYEA 2EICA 1YFQA 3PSLA 4L9OA 3MUNA 4XYIA 5HDBB 3IULA 4A2LA 4CZYA 2H9NA 4CY5A 4FHLA 3SBQA 2IUPA 4O1QD 1BPOA 4K3ID 4NBMA 1U8CB 5CXCA 3FCUB 3GREA 1P22A 3VI3B 4NENA 3EQ7A 3K6SA 3ZE0B 1QNIA 3SBPA 4J86A 3CIKB 4JHNA 2EIDA 5EM2A 1TYEB 3RSEC 5IJ8E 4FA1D 4ES0A 4MMXA 4QT8A 3DM0A 5EAMA 4DNVA 5M61A 1S4UX 4GGCA 2JKXA 2QZPA 4GM3A 4UM8A 5CXCB 5EARA 5FKTA 3E0CA 2Z2OA 3MVDK 1YUKA 5HE1B 4BP8A 5EM2B 3ZDYA 4NC4A 4AMYA 3T3MA 2H6KA 2HESX 2P9LC 4MK0B 3ZE2B 1M1XA 4GQBB 4O45A 4GQ1A 3RFHA 5C86A 5C9ZB 1E5TA 2B5MA 3KCIA 3PXWD 5EMJB 4AX4A 2XE4A 4UM8B 3SVWD 2H9PA 4J84A 4IMMA 2HU5A 4H5IA 2H9MA 3SCYA 1ERJA 4MMZA 3ZDYB 2QXVA 3I7OA 1GOFA 2JWHA 4OWRA 3T3MB 4AN1A 5M5VA 3DWLC 4QL1A 5IGOA 1JTDB 5C92A 3IJ0A 3CFVA 3VI4A 5FQDA 1A12A 3AL9A 3PVUB 3L4OD 1SHYB 1K32A 4GGAA 3SWSD 4JT6C 5HE0B 2IWFA 5IJ7E 2G99A 2AGLA 1UOOA 2I0TA 3UVMA 2VDMA 1B9XA 2CE9A 1JMXB 4J77A 3VI4B 4J79A 3JZHA 3I2NA 3PXSD 3T3PB 4R7AB 4L1QD 2O9KA 3FCSA 2VDMB 4TZ4A 3IUQA 3SHFA 1GXRA 2YNPA 4XYHA 3OF7A 3MKQA 1T2XA 3IVMA 3ZWLB 2VDNA 3IKOA 3OTTA 1GOHA 1SQJA 1OLZA 2VC2A 1QFMA 4UM9D 1N6EA 1TBGA 5HQGA 4CI3A 4RE5A 4AN0A 3OKYA 2OIZA 4D9SA 5K19A 1JMZB 2AQ5A 4A7JA 2VDNB 4KFMB 4CY2A 3K71A 1OMWB 2VC2B 4A11A 2VZ1A 3L4MD 2AH1A 3UVKA 4JSXC 3JZNA 3OKYB 3BG1A 4FWWA 5AMSA 4O9DA 2AGXA 3IUNA 4A0BA 1H2YA 5GMKn 2BCJB 4GM9A 4J8GA 3AL8A 4QAMA 1VZ3A 4J78A 4A11B 2B4EA 3DXMC 2OK4A 2PM7B 2H9LA 3IURA 2OVQB 4AMZA 5A2Qg 3DXKC 1Q47A 2YMUA 4A0BB 2I3TA 4JSNC 2HKRA 2H6NA 3AL8B 2VZ3A 5IT9g 2I3SA 3ZDXA 2AGYA 2VDRA 2XDWA 2H6QA 2IWKA 1GOTB 3JRPA 3IJCA 4DNWA 3FGBA 3FM0A 2MTAH 4X61B 3N0EA 4Z7QA 4ESGA 4Y7RA 3I8EA 1I2MB 2AH0A 5EALA 2BBKH 1PEVA 3I7KA 2QR5A 1E8NA 2J56H 1TYQC 2EIEA 3ZDXB 4UI9R 2VDRB 4LG9A 2YBAA 5AJAA 3SMRA 1L0QA 3V4PA 1UOPA 4Z7QB 3F3FA 4X3EA 3SFZA 3IIYA 4PXWA 3EI4A 2H68A 1K3IA 4JXMA 1MDAH 1YR2A 1H2WA 1VE6A 5TEFA 1NR0A 3EI3A 1E8MA 4FA4D 3SLED 4G55A 4EWRA 3UKRC 2OVPB 4A2MA 3ODTA 2J57G 2JWGA 4JSVC 3EI2A 3EI4B 4O2WA 2CNXA 3JAMg 5TEEA 5KDOB 4J8BA 3NIGA 5GXIA 4BCDA 4D6VA 4J82A 4CC9A 2CN3A 3EI3B 1GG2B 3V9FA 3KRXB 4FAND 3MMYA 4JHPC 2I0RA 2P9SC 2H47A 4O3TB 1R5MA 3EI2B 3MZKA 5EMLB 3V5WB 3OKWA 3NIGB 4PC0A 2IUVA 4CZXA 5C2WB 3K26A 4K3JB 5GSAA 4FA9D 4E54A 4PSWB 1PGUA 4IRZA 4A09A 2YNOA 3RRMC 3UR4A 4GM8A 2Z2NA 3EU7A 4L1MA 3NIFA 3CFSB 1MG2A 5HYNB 3ORVD 4GZ8A 3I7PA 1PBYB 2P9NC 1O6FA 1H2ZA 3RN0D 2CN2A 5FFOA 2H14A 5CXBA 4A09B 3MKSB 4JD2C 5I5JA 5CYKA 4G1MA 5AFU3 4BL0A 4FAVD 4JSPC 4Y5RD 5TDHB 3NIFB 3IUJA 4CI2A 1JOFA 3AFCA 4OZUA 2HU7A 2IUQA 1VYHC 5CXBB 2B5LA 3QHYB 5CYKB 4CZVA 4ZN4A 2HU8A 1GOGA 2GC7A 4FB1D 3I7HA 3DSMA 2CE8A 3V7DB 2VDOA 5GXHA 1UTCA 4PNKB 2OJYA 4N14A 1UOQA 4NAAA 2HXCA 4RE6A 5B4WA 4H5JA 4X60B 4E5ZA 4LG8A 5H17A 3EG6A 4J81A 4CI1A 1NEXB 3O4IA 4GQ2P 4O3UB 3MXXA 3NVXA 1VE7A 1XHMA 5HE2B 3W15A 3EQ9A 3F3PA 3ZDZA 4E5ZB 3ZE1A 4ZOXA 5FLXg 1GP2B 3UKUC 3I89A 4BCBA 2G9AA 3SN6B 3EWEA 4U7AA 2YB8B 3O4JA 2OK6A 5K1CC 3ZDZB 2XZGA 4J73A 1U4CA 2J55H 3JROA 5FA5B 1B9YA 3ZE1B 3ZE0A 1RI6A 5HE3B 4GMBA 3ULEC 2AGWA 4ERQA 4LGNA 2IURA 5E6SA 2TRCB 3FRXA 4AEZA 3IJEA 2P9IC 5TF2A 3NVNA 4BUJC 5EMKB 2OVRB 3SBRA 3UVOA 3KRWB 1XKSA 2XU7A 3JPXA 2W18A 3OKTA 3P4FA 3VA6A 2HKMA 4PSXB 4XEIC 5C2VB 2AGZA 3C5MA 2P9UC 4L3GD 5E6SB 3ZE2A 4O02A 2Z2PA 1FWXA 3I7LA 5FFGA 2GC4A 5M5SA 3VGZA 3BG0A 2VDQA 3F3GA 3IJ1A 5E6RA 5FXYA 4A08A 2CO0C 4FA5D 3PXTD 4ZOYA
chains in the Genus database with same CATH topology
3C75H 3I7NA 3SJLD 2Q7QA 5H1MA 4A0AA 3C99A 3JB9L 2VDQB 3RFGA 1XIPA 3RN1D 4A08B 5E6RB 4QRJA 2I0SA 3OW8A 2B5NA 4J0WA 3J81g 5IC7A 3VH0A 4CY3A 1MG3A 3HFQA 4HDJA 1JJUB 3GFCA 3RLMD 2H3XA 3PVWB 2UZYB 3C9CA 3EMHA 4I79A 4A0AB 4Z7OB 4NSXA 3UVLA 3RMZD 4UM9B 5FKRA 4J87A 2XL2A 1A0RB 2XYIA 3PSCB 3PE7A 4YVDA 4G56B 4ERZA 5EAPA 4ZOVA 4E54B 3SXTD 5JWZA 5I5IA 4D0KA 1U2VC 5FKSA 1N6FA 3I8CA 3EI1A 5FKQA 4IA9A 3UVNA 1PI6A 4PBZA 2P26A 4ERYA 2QC5A 3K27A 4U1EI 2P28A 2PM9A 2HJBA 4GGDA 4ZOZA 4CI8A 1SSLA 3BWSA 4WK0B 3MZLA 4WK2B 2P9KC 3N0DA 2IAAA 3EI1B 2UZXB 5IGQA 4X63B 3NIDB 2PM9B 2HYEA 3AH8B 4AOWA 2VDPB 4BH6A 1K8KC 3J80g 3U4YA 4L3HD 3B7FA 2GNQA 2VDKB 5EMMB 2CO0A 4PBYA 4CY1A 2VDOB 4Z7NB 2EBSA 4Z8LA 3IIWA 1N6DA 4WJKB 5E6UB 2HJ4A 4JT5C 3OL2A 2YNNA 3JZGA 3NVQA 5SXMA 4J0XA 2VDLB 4QQEA 2H13A 1SQ9A 5THAA 2PM6B 2P9PC 4WK4B 2XL3A 2PBIB 5H14A 5I5MA 3A0FA 3OL2B 1YFQA 3PSLA 4L9OA 4XYIA 5HDBB 4A2LA 4CZYA 2H9NA 4CY5A 4FHLA 3SBQA 2IUPA 4O1QD 4K3ID 1U8CB 5CXCA 3FCUB 3GREA 1P22A 3VI3B 3ZE0B 1QNIA 3SBPA 4J86A 3CIKB 1TYEB 5EM2A 3RSEC 5IJ8E 4FA1D 4ES0A 4QT8A 3DM0A 5EAMA 1S4UX 4GGCA 4GM3A 5CXCB 5EARA 5FKTA 3E0CA 2Z2OA 1YUKA 5HE1B 5EM2B 2H6KA 2HESX 2P9LC 4MK0B 3ZE2B 4O45A 4GQBB 3RFHA 4GQ1A 5C9ZB 2B5MA 3PXWD 5EMJB 4UM8B 3SVWD 2H9PA 4J84A 4IMMA 4H5IA 2H9MA 3SCYA 1ERJA 3ZDYB 2QXVA 3I7OA 2JWHA 4OWRA 3T3MB 3DWLC 4QL1A 5IGOA 3IJ0A 3CFVA 5FQDA 3AL9A 3PVUB 3L4OD 1SHYB 1K32A 4GGAA 3SWSD 4JT6C 5HE0B 2IWFA 5IJ7E 2G99A 2AGLA 2I0TA 3UVMA 1B9XA 2CE9A 1JMXB 4J77A 3VI4B 4J79A 3JZHA 3I2NA 3PXSD 3T3PB 4R7AB 4L1QD 2O9KA 2VDMB 4TZ4A 3SHFA 1GXRA 2YNPA 4XYHA 3MKQA 3ZWLB 3IKOA 3OTTA 1SQJA 1OLZA 4UM9D 1N6EA 1TBGA 5HQGA 4CI3A 3OKYA 2OIZA 5K19A 1JMZB 2AQ5A 4A7JA 2VDNB 4KFMB 4CY2A 1OMWB 2VC2B 4A11A 3L4MD 2AH1A 3UVKA 4JSXC 3JZNA 3OKYB 3BG1A 4FWWA 5AMSA 4O9DA 2AGXA 4A0BA 5GMKn 2BCJB 4GM9A 4J8GA 3AL8A 4J78A 4A11B 2B4EA 3DXMC 2OK4A 2PM7B 2H9LA 2OVQB 5A2Qg 3DXKC 1Q47A 2YMUA 4A0BB 2I3TA 4JSNC 2HKRA 2H6NA 3AL8B 5IT9g 2I3SA 2AGYA 2H6QA 2IWKA 1GOTB 3JRPA 3IJCA 3FGBA 3FM0A 2MTAH 4X61B 3N0EA 4ESGA 4Y7RA 3I8EA 2AH0A 5EALA 2BBKH 1PEVA 3I7KA 2J56H 1TYQC 3ZDXB 4UI9R 2VDRB 4LG9A 2YBAA 5AJAA 3SMRA 1L0QA 4Z7QB 3F3FA 4X3EA 3SFZA 3IIYA 4PXWA 3EI4A 2H68A 4JXMA 1MDAH 5TEFA 1NR0A 3EI3A 4FA4D 3SLED 4EWRA 3UKRC 2OVPB 4A2MA 3ODTA 2J57G 2JWGA 4JSVC 3EI2A 3EI4B 2CNXA 3JAMg 5TEEA 5KDOB 4J8BA 5GXIA 4D6VA 4J82A 4CC9A 2CN3A 3EI3B 1GG2B 3V9FA 3KRXB 4FAND 3MMYA 2I0RA 2P9SC 2H47A 4O3TB 1R5MA 3EI2B 3MZKA 5EMLB 3V5WB 3OKWA 3NIGB 4PC0A 2IUVA 4CZXA 5C2WB 3K26A 4K3JB 5GSAA 4FA9D 4E54A 4PSWB 1PGUA 4A09A 2YNOA 3RRMC 3UR4A 4GM8A 2Z2NA 3EU7A 5HYNB 3CFSB 1MG2A 3ORVD 4GZ8A 3I7PA 1PBYB 2P9NC 3RN0D 2CN2A 2H14A 5CXBA 4A09B 3MKSB 4JD2C 5I5JA 5CYKA 5AFU3 4BL0A 4FAVD 4JSPC 4Y5RD 5TDHB 3NIFB 4CI2A 1JOFA 3AFCA 4OZUA 2IUQA 1VYHC 5CXBB 2B5LA 5CYKB 4CZVA 4ZN4A 2GC7A 4FB1D 3I7HA 3DSMA 2CE8A 3V7DB 5GXHA 4PNKB 2OJYA 4N14A 2HXCA 5B4WA 4H5JA 4X60B 4E5ZA 4LG8A 5H17A 3EG6A 4J81A 4CI1A 1NEXB 4GQ2P 4O3UB 3MXXA 3NVXA 1XHMA 5HE2B 3W15A 3F3PA 4E5ZB 4ZOXA 5FLXg 1GP2B 3UKUC 3I89A 2G9AA 3SN6B 3EWEA 4U7AA 2YB8B 2OK6A 5K1CC 3ZDZB 4J73A 1U4CA 2J55H 3JROA 5FA5B 1B9YA 3ZE1B 1RI6A 5HE3B 4GMBA 3ULEC 2AGWA 4ERQA 4LGNA 2IURA 2TRCB 3FRXA 4AEZA 5TF2A 2P9IC 3NVNA 4BUJC 5EMKB 2OVRB 3SBRA 3UVOA 3KRWB 1XKSA 2XU7A 3JPXA 2W18A 3OKTA 3P4FA 3VA6A 2HKMA 4PSXB 4XEIC 5C2VB 2AGZA 3C5MA 2P9UC 4L3GD 5E6SB 2Z2PA 1FWXA 3I7LA 2GC4A 3VGZA 3BG0A 3F3GA 3IJ1A 5FXYA 4A08A 2CO0C 4FA5D 3PXTD 4ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C75 H;  3I7N A;  3SJL D;  2Q7Q A;  5H1M A;  4A0A A;  3C99 A;  3JB9 L;  2VDQ B;  3RFG A;  1XIP A;  3RN1 D;  4A08 B;  5E6R B;  4QRJ A;  2I0S A;  3OW8 A;  2B5N A;  4J0W A;  3J81 g;  5IC7 A;  3VH0 A;  4CY3 A;  1MG3 A;  3HFQ A;  4HDJ A;  1JJU B;  3GFC A;  3RLM D;  2H3X A;  3PVW B;  2UZY B;  3C9C A;  3EMH A;  4I79 A;  4A0A B;  4Z7O B;  4NSX A;  3UVL A;  3RMZ D;  4UM9 B;  5FKR A;  4J87 A;  2XL2 A;  1A0R B;  2XYI A;  3PSC B;  3PE7 A;  4YVD A;  4G56 B;  4ERZ A;  5EAP A;  4ZOV A;  4E54 B;  3SXT D;  5JWZ A;  5I5I A;  4D0K A;  1U2V C;  5FKS A;  1N6F A;  3I8C A;  3EI1 A;  5FKQ A;  4IA9 A;  3UVN A;  1PI6 A;  4PBZ A;  2P26 A;  4ERY A;  2QC5 A;  3K27 A;  4U1E I;  2P28 A;  2PM9 A;  2HJB A;  4GGD A;  4ZOZ A;  4CI8 A;  1SSL A;  3BWS A;  4WK0 B;  3MZL A;  4WK2 B;  2P9K C;  3N0D A;  2IAA A;  3EI1 B;  2UZX B;  5IGQ A;  4X63 B;  3NID B;  2PM9 B;  2HYE A;  3AH8 B;  4AOW A;  2VDP B;  4BH6 A;  1K8K C;  3J80 g;  3U4Y A;  4L3H D;  3B7F A;  2GNQ A;  2VDK B;  5EMM B;  2CO0 A;  4PBY A;  4CY1 A;  2VDO B;  4Z7N B;  2EBS A;  4Z8L A;  3IIW A;  1N6D A;  4WJK B;  5E6U B;  2HJ4 A;  4JT5 C;  3OL2 A;  2YNN A;  3JZG A;  3NVQ A;  5SXM A;  4J0X A;  2VDL B;  4QQE A;  2H13 A;  1SQ9 A;  5THA A;  2PM6 B;  2P9P C;  4WK4 B;  2XL3 A;  2PBI B;  5H14 A;  5I5M A;  3A0F A;  3OL2 B;  1YFQ A;  3PSL A;  4L9O A;  4XYI A;  5HDB B;  4A2L A;  4CZY A;  2H9N A;  4CY5 A;  4FHL A;  3SBQ A;  2IUP A;  4O1Q D;  4K3I D;  1U8C B;  5CXC A;  3FCU B;  3GRE A;  1P22 A;  3VI3 B;  3ZE0 B;  1QNI A;  3SBP A;  4J86 A;  3CIK B;  1TYE B;  5EM2 A;  3RSE C;  5IJ8 E;  4FA1 D;  4ES0 A;  4QT8 A;  3DM0 A;  5EAM A;  1S4U X;  4GGC A;  4GM3 A;  5CXC B;  5EAR A;  5FKT A;  3E0C A;  2Z2O A;  1YUK A;  5HE1 B;  5EM2 B;  2H6K A;  2HES X;  2P9L C;  4MK0 B;  3ZE2 B;  4O45 A;  4GQB B;  3RFH A;  4GQ1 A;  5C9Z B;  2B5M A;  3PXW D;  5EMJ B;  4UM8 B;  3SVW D;  2H9P A;  4J84 A;  4IMM A;  4H5I A;  2H9M A;  3SCY A;  1ERJ A;  3ZDY B;  2QXV A;  3I7O A;  4OWR A;  3T3M B;  3DWL C;  4QL1 A;  5IGO A;  3IJ0 A;  3CFV A;  5FQD A;  3AL9 A;  3PVU B;  3L4O D;  1SHY B;  1K32 A;  4GGA A;  3SWS D;  4JT6 C;  5HE0 B;  2IWF A;  5IJ7 E;  2G99 A;  2AGL A;  2I0T A;  3UVM A;  1B9X A;  2CE9 A;  1JMX B;  4J77 A;  3VI4 B;  4J79 A;  3JZH A;  3I2N A;  3PXS D;  3T3P B;  4R7A B;  4L1Q D;  2O9K A;  2VDM B;  4TZ4 A;  3SHF A;  1GXR A;  2YNP A;  4XYH A;  3MKQ A;  3ZWL B;  3IKO A;  3OTT A;  1SQJ A;  1OLZ A;  4UM9 D;  1N6E A;  1TBG A;  5HQG A;  4CI3 A;  3OKY A;  2OIZ A;  5K19 A;  1JMZ B;  2AQ5 A;  4A7J A;  2VDN B;  4KFM B;  4CY2 A;  1OMW B;  2VC2 B;  4A11 A;  3L4M D;  2AH1 A;  3UVK A;  4JSX C;  3JZN A;  3OKY B;  3BG1 A;  4FWW A;  5AMS A;  4O9D A;  2AGX A;  4A0B A;  5GMK n;  2BCJ B;  4GM9 A;  4J8G A;  3AL8 A;  4J78 A;  4A11 B;  2B4E A;  3DXM C;  2OK4 A;  2PM7 B;  2H9L A;  2OVQ B;  5A2Q g;  3DXK C;  1Q47 A;  2YMU A;  4A0B B;  2I3T A;  4JSN C;  2HKR A;  2H6N A;  3AL8 B;  5IT9 g;  2I3S A;  2AGY A;  2H6Q A;  2IWK A;  1GOT B;  3JRP A;  3IJC A;  3FGB A;  3FM0 A;  2MTA H;  4X61 B;  3N0E A;  4ESG A;  4Y7R A;  3I8E A;  2AH0 A;  5EAL A;  2BBK H;  1PEV A;  3I7K A;  2J56 H;  1TYQ C;  3ZDX B;  4UI9 R;  2VDR B;  4LG9 A;  2YBA A;  5AJA A;  3SMR A;  1L0Q A;  4Z7Q B;  3F3F A;  4X3E A;  3SFZ A;  3IIY A;  4PXW A;  3EI4 A;  2H68 A;  4JXM A;  1MDA H;  5TEF A;  1NR0 A;  3EI3 A;  4FA4 D;  3SLE D;  4EWR A;  3UKR C;  2OVP B;  4A2M A;  3ODT A;  2J57 G;  4JSV C;  3EI2 A;  3EI4 B;  2CNX A;  3JAM g;  5TEE A;  5KDO B;  4J8B A;  5GXI A;  4D6V A;  4J82 A;  4CC9 A;  2CN3 A;  3EI3 B;  1GG2 B;  3V9F A;  3KRX B;  4FAN D;  3MMY A;  2I0R A;  2P9S C;  2H47 A;  4O3T B;  1R5M A;  3EI2 B;  3MZK A;  5EML B;  3V5W B;  3OKW A;  3NIG B;  4PC0 A;  2IUV A;  4CZX A;  5C2W B;  3K26 A;  4K3J B;  5GSA A;  4FA9 D;  4E54 A;  4PSW B;  1PGU A;  4A09 A;  2YNO A;  3RRM C;  3UR4 A;  4GM8 A;  2Z2N A;  3EU7 A;  5HYN B;  3CFS B;  1MG2 A;  3ORV D;  4GZ8 A;  3I7P A;  1PBY B;  2P9N C;  3RN0 D;  2CN2 A;  2H14 A;  5CXB A;  4A09 B;  3MKS B;  4JD2 C;  5I5J A;  5CYK A;  5AFU 3;  4BL0 A;  4FAV D;  4JSP C;  4Y5R D;  5TDH B;  3NIF B;  4CI2 A;  1JOF A;  3AFC A;  4OZU A;  2IUQ A;  1VYH C;  5CXB B;  2B5L A;  5CYK B;  4CZV A;  4ZN4 A;  2GC7 A;  4FB1 D;  3I7H A;  3DSM A;  2CE8 A;  3V7D B;  5GXH A;  4PNK B;  2OJY A;  4N14 A;  2HXC A;  5B4W A;  4H5J A;  4X60 B;  4E5Z A;  4LG8 A;  5H17 A;  3EG6 A;  4J81 A;  4CI1 A;  1NEX B;  4GQ2 P;  4O3U B;  3MXX A;  3NVX A;  1XHM A;  5HE2 B;  3W15 A;  3F3P A;  4E5Z B;  4ZOX A;  5FLX g;  1GP2 B;  3UKU C;  3I89 A;  2G9A A;  3SN6 B;  3EWE A;  4U7A A;  2YB8 B;  2OK6 A;  5K1C C;  3ZDZ B;  4J73 A;  1U4C A;  2J55 H;  3JRO A;  5FA5 B;  1B9Y A;  3ZE1 B;  1RI6 A;  5HE3 B;  4GMB A;  3ULE C;  2AGW A;  4ERQ A;  4LGN A;  2IUR A;  2TRC B;  3FRX A;  4AEZ A;  5TF2 A;  2P9I C;  3NVN A;  4BUJ C;  5EMK B;  2OVR B;  3SBR A;  3UVO A;  3KRW B;  1XKS A;  2XU7 A;  3JPX A;  2W18 A;  3OKT A;  3P4F A;  3VA6 A;  2HKM A;  4PSX B;  4XEI C;  5C2V B;  2AGZ A;  3C5M A;  2P9U C;  4L3G D;  5E6S B;  2Z2P A;  1FWX A;  3I7L A;  2GC4 A;  3VGZ A;  3BG0 A;  3F3G A;  3IJ1 A;  5FXY A;  4A08 A;  2CO0 C;  4FA5 D;  3PXT D;  4ZOY A; 
#chains in the Genus database with same CATH topology
 3C75 H;  3I7N A;  3SJL D;  2Q7Q A;  4BP9 A;  5H1M A;  4BCC A;  4A0A A;  3GD1 I;  2BKL A;  4Z7O A;  4UM9 A;  2WQ8 A;  3C99 A;  3JB9 L;  2VDQ B;  3RFG A;  1XIP A;  3RN1 D;  4A08 B;  5E6R B;  5M5U A;  3QI0 A;  2EIB A;  4QRJ A;  2I0S A;  3OW8 A;  2B5N A;  4J0W A;  3J81 g;  5IC7 A;  3VH0 A;  4CY3 A;  1MG3 A;  3HFQ A;  4HDJ A;  1JJU B;  3GFC A;  5M5R A;  3RLM D;  2H3X A;  3PVW B;  2UZY B;  3C9C A;  3EMH A;  4I79 A;  4A0A B;  4Z7O B;  4NSX A;  3UVL A;  3RMZ D;  4UM9 B;  5FKR A;  4J87 A;  2XL2 A;  3MUO A;  1A0R B;  3T3P A;  2XYI A;  3PSC B;  3PE7 A;  4YVD A;  4G56 B;  4ERZ A;  5EAP A;  5M5T A;  4ZOV A;  4E54 B;  3SXT D;  5JWZ A;  4WK0 A;  5I5I A;  1VZ2 A;  1L5G A;  4D0K A;  4WK2 A;  1U2V C;  4G1E A;  5FKS A;  3O4H A;  1N6F A;  3I8C A;  3EI1 A;  5FKQ A;  4IA9 A;  3UVN A;  1PI6 A;  4PBZ A;  2P26 A;  3NID A;  2QC5 A;  3K27 A;  4U1E I;  4ERY A;  2P28 A;  2PM9 A;  2HJB A;  2VDP A;  4GGD A;  4ZOZ A;  4DNU A;  4CI8 A;  1SSL A;  3BWS A;  4WK0 B;  3MZL A;  4WK2 B;  2VDK A;  2P9K C;  3EQ8 A;  3N0D A;  1O6G A;  3GC3 B;  2IAA A;  1C9L A;  3EI1 B;  2UZX B;  3V4V A;  5IGQ A;  4X63 B;  4MMY A;  4Z7N A;  3NID B;  2PM9 B;  2HYE A;  3AH8 B;  4AOW A;  2VDP B;  1QFS A;  4WJK A;  1K8K C;  4BH6 A;  3J80 g;  3U4Y A;  5E6U A;  4L3H D;  3B7F A;  2GNQ A;  2VDK B;  5EMM B;  3DDU A;  2CO0 A;  4PBY A;  4CY1 A;  1C9I A;  2VDL A;  2VDO B;  4Z7N B;  1JV2 A;  2EBS A;  4Z8L A;  3O4G A;  3IIW A;  1N6D A;  4WK4 A;  4WJK B;  1H2X A;  5E6U B;  2HJ4 A;  4JT5 C;  3OL2 A;  3IUM A;  2YNN A;  3JZG A;  3NVQ A;  5SXM A;  5HDB A;  4J0X A;  2VDL B;  4QQE A;  2H13 A;  1SQ9 A;  5THA A;  1U8C A;  2PM6 B;  3FCU A;  2P9P C;  3VI3 A;  3K72 A;  4WK4 B;  2XL3 A;  2PBI B;  5H14 A;  5I5M A;  3A0F A;  3OL2 B;  1TYE A;  2EIC A;  1YFQ A;  3PSL A;  4L9O A;  3MUN A;  4XYI A;  5HDB B;  3IUL A;  4A2L A;  4CZY A;  2H9N A;  4CY5 A;  4FHL A;  3SBQ A;  2IUP A;  4O1Q D;  1BPO A;  4K3I D;  4NBM A;  1U8C B;  5CXC A;  3FCU B;  3GRE A;  1P22 A;  3VI3 B;  4NEN A;  3EQ7 A;  3K6S A;  3ZE0 B;  1QNI A;  3SBP A;  4J86 A;  3CIK B;  4JHN A;  2EID A;  5EM2 A;  1TYE B;  3RSE C;  5IJ8 E;  4FA1 D;  4ES0 A;  4MMX A;  4QT8 A;  3DM0 A;  5EAM A;  4DNV A;  5M61 A;  1S4U X;  4GGC A;  2JKX A;  2QZP A;  4GM3 A;  4UM8 A;  5CXC B;  5EAR A;  5FKT A;  3E0C A;  2Z2O A;  3MVD K;  1YUK A;  5HE1 B;  4BP8 A;  5EM2 B;  3ZDY A;  4NC4 A;  4AMY A;  3T3M A;  2H6K A;  2HES X;  2P9L C;  4MK0 B;  3ZE2 B;  1M1X A;  4GQB B;  4O45 A;  4GQ1 A;  3RFH A;  5C86 A;  5C9Z B;  1E5T A;  2B5M A;  3KCI A;  3PXW D;  5EMJ B;  4AX4 A;  2XE4 A;  4UM8 B;  3SVW D;  2H9P A;  4J84 A;  4IMM A;  2HU5 A;  4H5I A;  2H9M A;  3SCY A;  1ERJ A;  4MMZ A;  3ZDY B;  2QXV A;  3I7O A;  1GOF A;  2JWH A;  4OWR A;  3T3M B;  4AN1 A;  5M5V A;  3DWL C;  4QL1 A;  5IGO A;  1JTD B;  5C92 A;  3IJ0 A;  3CFV A;  3VI4 A;  5FQD A;  1A12 A;  3AL9 A;  3PVU B;  3L4O D;  1SHY B;  1K32 A;  4GGA A;  3SWS D;  4JT6 C;  5HE0 B;  2IWF A;  5IJ7 E;  2G99 A;  2AGL A;  1UOO A;  2I0T A;  3UVM A;  2VDM A;  1B9X A;  2CE9 A;  1JMX B;  4J77 A;  3VI4 B;  4J79 A;  3JZH A;  3I2N A;  3PXS D;  3T3P B;  4R7A B;  4L1Q D;  2O9K A;  3FCS A;  2VDM B;  4TZ4 A;  3IUQ A;  3SHF A;  1GXR A;  2YNP A;  4XYH A;  3OF7 A;  3MKQ A;  1T2X A;  3IVM A;  3ZWL B;  2VDN A;  3IKO A;  3OTT A;  1GOH A;  1SQJ A;  1OLZ A;  2VC2 A;  1QFM A;  4UM9 D;  1N6E A;  1TBG A;  5HQG A;  4CI3 A;  4RE5 A;  4AN0 A;  3OKY A;  2OIZ A;  4D9S A;  5K19 A;  1JMZ B;  2AQ5 A;  4A7J A;  2VDN B;  4KFM B;  4CY2 A;  3K71 A;  1OMW B;  2VC2 B;  4A11 A;  2VZ1 A;  3L4M D;  2AH1 A;  3UVK A;  4JSX C;  3JZN A;  3OKY B;  3BG1 A;  4FWW A;  5AMS A;  4O9D A;  2AGX A;  3IUN A;  4A0B A;  1H2Y A;  5GMK n;  2BCJ B;  4GM9 A;  4J8G A;  3AL8 A;  4QAM A;  1VZ3 A;  4J78 A;  4A11 B;  2B4E A;  3DXM C;  2OK4 A;  2PM7 B;  2H9L A;  3IUR A;  2OVQ B;  4AMZ A;  5A2Q g;  3DXK C;  1Q47 A;  2YMU A;  4A0B B;  2I3T A;  4JSN C;  2HKR A;  2H6N A;  3AL8 B;  2VZ3 A;  5IT9 g;  2I3S A;  3ZDX A;  2AGY A;  2VDR A;  2XDW A;  2H6Q A;  2IWK A;  1GOT B;  3JRP A;  3IJC A;  4DNW A;  3FGB A;  3FM0 A;  2MTA H;  4X61 B;  3N0E A;  4Z7Q A;  4ESG A;  4Y7R A;  3I8E A;  1I2M B;  2AH0 A;  5EAL A;  2BBK H;  1PEV A;  3I7K A;  2QR5 A;  1E8N A;  2J56 H;  1TYQ C;  2EIE A;  3ZDX B;  4UI9 R;  2VDR B;  4LG9 A;  2YBA A;  5AJA A;  3SMR A;  1L0Q A;  3V4P A;  1UOP A;  4Z7Q B;  3F3F A;  4X3E A;  3SFZ A;  3IIY A;  4PXW A;  3EI4 A;  2H68 A;  1K3I A;  4JXM A;  1MDA H;  1YR2 A;  1H2W A;  1VE6 A;  5TEF A;  1NR0 A;  3EI3 A;  1E8M A;  4FA4 D;  3SLE D;  4G55 A;  4EWR A;  3UKR C;  2OVP B;  4A2M A;  3ODT A;  2J57 G;  2JWG A;  4JSV C;  3EI2 A;  3EI4 B;  4O2W A;  2CNX A;  3JAM g;  5TEE A;  5KDO B;  4J8B A;  3NIG A;  5GXI A;  4BCD A;  4D6V A;  4J82 A;  4CC9 A;  2CN3 A;  3EI3 B;  1GG2 B;  3V9F A;  3KRX B;  4FAN D;  3MMY A;  4JHP C;  2I0R A;  2P9S C;  2H47 A;  4O3T B;  1R5M A;  3EI2 B;  3MZK A;  5EML B;  3V5W B;  3OKW A;  3NIG B;  4PC0 A;  2IUV A;  4CZX A;  5C2W B;  3K26 A;  4K3J B;  5GSA A;  4FA9 D;  4E54 A;  4PSW B;  1PGU A;  4IRZ A;  4A09 A;  2YNO A;  3RRM C;  3UR4 A;  4GM8 A;  2Z2N A;  3EU7 A;  4L1M A;  3NIF A;  3CFS B;  1MG2 A;  5HYN B;  3ORV D;  4GZ8 A;  3I7P A;  1PBY B;  2P9N C;  1O6F A;  1H2Z A;  3RN0 D;  2CN2 A;  5FFO A;  2H14 A;  5CXB A;  4A09 B;  3MKS B;  4JD2 C;  5I5J A;  5CYK A;  4G1M A;  5AFU 3;  4BL0 A;  4FAV D;  4JSP C;  4Y5R D;  5TDH B;  3NIF B;  3IUJ A;  4CI2 A;  1JOF A;  3AFC A;  4OZU A;  2HU7 A;  2IUQ A;  1VYH C;  5CXB B;  2B5L A;  3QHY B;  5CYK B;  4CZV A;  4ZN4 A;  2HU8 A;  1GOG A;  2GC7 A;  4FB1 D;  3I7H A;  3DSM A;  2CE8 A;  3V7D B;  2VDO A;  5GXH A;  1UTC A;  4PNK B;  2OJY A;  4N14 A;  1UOQ A;  4NAA A;  2HXC A;  4RE6 A;  5B4W A;  4H5J A;  4X60 B;  4E5Z A;  4LG8 A;  5H17 A;  3EG6 A;  4J81 A;  4CI1 A;  1NEX B;  3O4I A;  4GQ2 P;  4O3U B;  3MXX A;  3NVX A;  1VE7 A;  1XHM A;  5HE2 B;  3W15 A;  3EQ9 A;  3F3P A;  3ZDZ A;  4E5Z B;  3ZE1 A;  4ZOX A;  5FLX g;  1GP2 B;  3UKU C;  3I89 A;  4BCB A;  2G9A A;  3SN6 B;  3EWE A;  4U7A A;  2YB8 B;  3O4J A;  2OK6 A;  5K1C C;  3ZDZ B;  2XZG A;  4J73 A;  1U4C A;  2J55 H;  3JRO A;  5FA5 B;  1B9Y A;  3ZE1 B;  3ZE0 A;  1RI6 A;  5HE3 B;  4GMB A;  3ULE C;  2AGW A;  4ERQ A;  4LGN A;  2IUR A;  5E6S A;  2TRC B;  3FRX A;  4AEZ A;  3IJE A;  2P9I C;  5TF2 A;  3NVN A;  4BUJ C;  5EMK B;  2OVR B;  3SBR A;  3UVO A;  3KRW B;  1XKS A;  2XU7 A;  3JPX A;  2W18 A;  3OKT A;  3P4F A;  3VA6 A;  2HKM A;  4PSX B;  4XEI C;  5C2V B;  2AGZ A;  3C5M A;  2P9U C;  4L3G D;  5E6S B;  3ZE2 A;  4O02 A;  2Z2P A;  1FWX A;  3I7L A;  5FFG A;  2GC4 A;  5M5S A;  3VGZ A;  3BG0 A;  2VDQ A;  3F3G A;  3IJ1 A;  5E6R A;  5FXY A;  4A08 A;  2CO0 C;  4FA5 D;  3PXT D;  4ZOY A; 
#chains in the Genus database with same CATH homology
 3C75 H;  3I7N A;  3SJL D;  2Q7Q A;  5H1M A;  4A0A A;  3C99 A;  3JB9 L;  2VDQ B;  3RFG A;  1XIP A;  3RN1 D;  4A08 B;  5E6R B;  4QRJ A;  2I0S A;  3OW8 A;  2B5N A;  4J0W A;  3J81 g;  5IC7 A;  3VH0 A;  4CY3 A;  1MG3 A;  3HFQ A;  4HDJ A;  1JJU B;  3GFC A;  3RLM D;  2H3X A;  3PVW B;  2UZY B;  3C9C A;  3EMH A;  4I79 A;  4A0A B;  4Z7O B;  4NSX A;  3UVL A;  3RMZ D;  4UM9 B;  5FKR A;  4J87 A;  2XL2 A;  1A0R B;  2XYI A;  3PSC B;  3PE7 A;  4YVD A;  4G56 B;  4ERZ A;  5EAP A;  4ZOV A;  4E54 B;  3SXT D;  5JWZ A;  5I5I A;  4D0K A;  1U2V C;  5FKS A;  1N6F A;  3I8C A;  3EI1 A;  5FKQ A;  4IA9 A;  3UVN A;  1PI6 A;  4PBZ A;  2P26 A;  4ERY A;  2QC5 A;  3K27 A;  4U1E I;  2P28 A;  2PM9 A;  2HJB A;  4GGD A;  4ZOZ A;  4CI8 A;  1SSL A;  3BWS A;  4WK0 B;  3MZL A;  4WK2 B;  2P9K C;  3N0D A;  2IAA A;  3EI1 B;  2UZX B;  5IGQ A;  4X63 B;  3NID B;  2PM9 B;  2HYE A;  3AH8 B;  4AOW A;  2VDP B;  4BH6 A;  1K8K C;  3J80 g;  3U4Y A;  4L3H D;  3B7F A;  2GNQ A;  2VDK B;  5EMM B;  2CO0 A;  4PBY A;  4CY1 A;  2VDO B;  4Z7N B;  2EBS A;  4Z8L A;  3IIW A;  1N6D A;  4WJK B;  5E6U B;  2HJ4 A;  4JT5 C;  3OL2 A;  2YNN A;  3JZG A;  3NVQ A;  5SXM A;  4J0X A;  2VDL B;  4QQE A;  2H13 A;  1SQ9 A;  5THA A;  2PM6 B;  2P9P C;  4WK4 B;  2XL3 A;  2PBI B;  5H14 A;  5I5M A;  3A0F A;  3OL2 B;  1YFQ A;  3PSL A;  4L9O A;  4XYI A;  5HDB B;  4A2L A;  4CZY A;  2H9N A;  4CY5 A;  4FHL A;  3SBQ A;  2IUP A;  4O1Q D;  4K3I D;  1U8C B;  5CXC A;  3FCU B;  3GRE A;  1P22 A;  3VI3 B;  3ZE0 B;  1QNI A;  3SBP A;  4J86 A;  3CIK B;  1TYE B;  5EM2 A;  3RSE C;  5IJ8 E;  4FA1 D;  4ES0 A;  4QT8 A;  3DM0 A;  5EAM A;  1S4U X;  4GGC A;  4GM3 A;  5CXC B;  5EAR A;  5FKT A;  3E0C A;  2Z2O A;  1YUK A;  5HE1 B;  5EM2 B;  2H6K A;  2HES X;  2P9L C;  4MK0 B;  3ZE2 B;  4O45 A;  4GQB B;  3RFH A;  4GQ1 A;  5C9Z B;  2B5M A;  3PXW D;  5EMJ B;  4UM8 B;  3SVW D;  2H9P A;  4J84 A;  4IMM A;  4H5I A;  2H9M A;  3SCY A;  1ERJ A;  3ZDY B;  2QXV A;  3I7O A;  2JWH A;  4OWR A;  3T3M B;  3DWL C;  4QL1 A;  5IGO A;  3IJ0 A;  3CFV A;  5FQD A;  3AL9 A;  3PVU B;  3L4O D;  1SHY B;  1K32 A;  4GGA A;  3SWS D;  4JT6 C;  5HE0 B;  2IWF A;  5IJ7 E;  2G99 A;  2AGL A;  2I0T A;  3UVM A;  1B9X A;  2CE9 A;  1JMX B;  4J77 A;  3VI4 B;  4J79 A;  3JZH A;  3I2N A;  3PXS D;  3T3P B;  4R7A B;  4L1Q D;  2O9K A;  2VDM B;  4TZ4 A;  3SHF A;  1GXR A;  2YNP A;  4XYH A;  3MKQ A;  3ZWL B;  3IKO A;  3OTT A;  1SQJ A;  1OLZ A;  4UM9 D;  1N6E A;  1TBG A;  5HQG A;  4CI3 A;  3OKY A;  2OIZ A;  5K19 A;  1JMZ B;  2AQ5 A;  4A7J A;  2VDN B;  4KFM B;  4CY2 A;  1OMW B;  2VC2 B;  4A11 A;  3L4M D;  2AH1 A;  3UVK A;  4JSX C;  3JZN A;  3OKY B;  3BG1 A;  4FWW A;  5AMS A;  4O9D A;  2AGX A;  4A0B A;  5GMK n;  2BCJ B;  4GM9 A;  4J8G A;  3AL8 A;  4J78 A;  4A11 B;  2B4E A;  3DXM C;  2OK4 A;  2PM7 B;  2H9L A;  2OVQ B;  5A2Q g;  3DXK C;  1Q47 A;  2YMU A;  4A0B B;  2I3T A;  4JSN C;  2HKR A;  2H6N A;  3AL8 B;  5IT9 g;  2I3S A;  2AGY A;  2H6Q A;  2IWK A;  1GOT B;  3JRP A;  3IJC A;  3FGB A;  3FM0 A;  2MTA H;  4X61 B;  3N0E A;  4ESG A;  4Y7R A;  3I8E A;  2AH0 A;  5EAL A;  2BBK H;  1PEV A;  3I7K A;  2J56 H;  1TYQ C;  3ZDX B;  4UI9 R;  2VDR B;  4LG9 A;  2YBA A;  5AJA A;  3SMR A;  1L0Q A;  4Z7Q B;  3F3F A;  4X3E A;  3SFZ A;  3IIY A;  4PXW A;  3EI4 A;  2H68 A;  4JXM A;  1MDA H;  5TEF A;  1NR0 A;  3EI3 A;  4FA4 D;  3SLE D;  4EWR A;  3UKR C;  2OVP B;  4A2M A;  3ODT A;  2J57 G;  2JWG A;  4JSV C;  3EI2 A;  3EI4 B;  2CNX A;  3JAM g;  5TEE A;  5KDO B;  4J8B A;  5GXI A;  4D6V A;  4J82 A;  4CC9 A;  2CN3 A;  3EI3 B;  1GG2 B;  3V9F A;  3KRX B;  4FAN D;  3MMY A;  2I0R A;  2P9S C;  2H47 A;  4O3T B;  1R5M A;  3EI2 B;  3MZK A;  5EML B;  3V5W B;  3OKW A;  3NIG B;  4PC0 A;  2IUV A;  4CZX A;  5C2W B;  3K26 A;  4K3J B;  5GSA A;  4FA9 D;  4E54 A;  4PSW B;  1PGU A;  4A09 A;  2YNO A;  3RRM C;  3UR4 A;  4GM8 A;  2Z2N A;  3EU7 A;  5HYN B;  3CFS B;  1MG2 A;  3ORV D;  4GZ8 A;  3I7P A;  1PBY B;  2P9N C;  3RN0 D;  2CN2 A;  2H14 A;  5CXB A;  4A09 B;  3MKS B;  4JD2 C;  5I5J A;  5CYK A;  5AFU 3;  4BL0 A;  4FAV D;  4JSP C;  4Y5R D;  5TDH B;  3NIF B;  4CI2 A;  1JOF A;  3AFC A;  4OZU A;  2IUQ A;  1VYH C;  5CXB B;  2B5L A;  5CYK B;  4CZV A;  4ZN4 A;  2GC7 A;  4FB1 D;  3I7H A;  3DSM A;  2CE8 A;  3V7D B;  5GXH A;  4PNK B;  2OJY A;  4N14 A;  2HXC A;  5B4W A;  4H5J A;  4X60 B;  4E5Z A;  4LG8 A;  5H17 A;  3EG6 A;  4J81 A;  4CI1 A;  1NEX B;  4GQ2 P;  4O3U B;  3MXX A;  3NVX A;  1XHM A;  5HE2 B;  3W15 A;  3F3P A;  4E5Z B;  4ZOX A;  5FLX g;  1GP2 B;  3UKU C;  3I89 A;  2G9A A;  3SN6 B;  3EWE A;  4U7A A;  2YB8 B;  2OK6 A;  5K1C C;  3ZDZ B;  4J73 A;  1U4C A;  2J55 H;  3JRO A;  5FA5 B;  1B9Y A;  3ZE1 B;  1RI6 A;  5HE3 B;  4GMB A;  3ULE C;  2AGW A;  4ERQ A;  4LGN A;  2IUR A;  2TRC B;  3FRX A;  4AEZ A;  5TF2 A;  2P9I C;  3NVN A;  4BUJ C;  5EMK B;  2OVR B;  3SBR A;  3UVO A;  3KRW B;  1XKS A;  2XU7 A;  3JPX A;  2W18 A;  3OKT A;  3P4F A;  3VA6 A;  2HKM A;  4PSX B;  4XEI C;  5C2V B;  2AGZ A;  3C5M A;  2P9U C;  4L3G D;  5E6S B;  2Z2P A;  1FWX A;  3I7L A;  2GC4 A;  3VGZ A;  3BG0 A;  3F3G A;  3IJ1 A;  5FXY A;  4A08 A;  2CO0 C;  4FA5 D;  3PXT D;  4ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...