4O3VA

Crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
138
Chain Sequence
ANPYISVANIMLQNYVKQREKYNYDTLKEQFTFIKNASTSIVYMQFANFMNIDNSLSPVIRYQKLYRRSINIISINNINNNEATVTFESLAQNNTGEILENMLWEAKIGFIMDSISTNMPFHFIVTSYKLKLLRNKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VirB8-like protein of type IV secretion system
publication title Structural Insight into How Bacteria Prevent Interference between Multiple Divergent Type IV Secretion Systems.
pubmed doi rcsb
source organism Rickettsia typhi
molecule tags Protein transport
total genus 37
structure length 138
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.230 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o3vA00
4LSOA 4JF8A 4AKZA 4AKYA 5I97A 4NHFA 4O3VA 5JBSA 2CC3A 4KZ1A 4MEIA 2BHMA
chains in the Genus database with same CATH superfamily
3PCRA 3PGBA 3DY5A 1MOLA 1IVUA 3JVCA 4G1MB 1OACA 2GU3A 4HM2B 4MMZB 3NUVA 2MC8A 4LSOA 1EA2A 1RLSA 5IW9A 3MHEA 1W5ZA 2AADA 1T3BA 2ZA4A 4RBNA 1RGKA 2YX9A 3X41A 2Z76A 1S5AA 1FUTA 5G2GA 2CX0A 5ELUA 3T0UA 1TFKA 1FGQA 1LNHA 3V92A 5IG3A 1NDOB 3I553 3H3HA 1HKXA 1M1K4 3HX8A 1ISKA 1KWIA 1VQ43 1BSDA 1UCKA 2CIUA 2BNGA 1W6GA 3AHSA 1J2BA 3LTBA 4K1UA 1BRKA 1US1A 4EYCA 3CCS3 1RGGA 3FF0A 1DE3A 2CHCA 3X40A 2YFIB 2W56B 1Q9EA 1R4YA 3KSED 3E99A 1UW1A 1ASKA 3NV0A 3OWSA 1GD3A 1LRAA 1UI7A 4LMIA 2MF7A 1RTUA 1DMQA 1JB4A 1PYLA 3NXJA 1T5YA 3DGLA 4RNYA 3NBBA 2JQ5A 1M904 2F56A 2ML6A 3GAXA 1VQP3 4GB5A 1Q42A 2F5MA 4HZBB 1BNRA 3DH2A 3KZTA 1BAOA 3CCE3 1RNBA 3CMA3 3KN4A 4ILFA 5D81A 1MGRA 2B1XB 4MEIA 2W9PA 1X1XA 3SYUA 1X1WA 1SPUA 4EXRA 3KCHA 1W6CA 1WTHA 3IMAB 4FMBA 5G1KA 2W2CA 5KP1A 1I3FA 1RRHA 2F98A 3FG4A 1OHPA 1DMNA 4HOHA 4HM5B 5TGNA 2SARA 5RNTA 2BMQB 1I8VA 2RFRA 1UCLA 1YJN3 3NX0A 2KXGA 3EBTA 1VQ63 1JBRA 1NB3I 4HM4B 1ZS7A 3NQYA 1RN7A 3D5GA 3K0ZA 5EVHA 1JZDA 2K0MA 2K3DA 3AGNA 2YFJB 1GMQA 1O7PB 3Q3FA 3WHOA 2PZVA 3NQZA 1C54A 2CFGA 1L5GB 3WMDA 1UUWB 3PZWA 2OTL3 1UDII 5AIFA 4K61A 2H0IA 4ORLA 5LC7A 1MWTA 1RMSA 1JV2B 1LOXA 1B2MA 1OHSA 3PXMA 1LOYA 3BNCA 1Q7HA 2XR8B 5EEOA 1NWWA 4XDVA 4H3UA 2XFSA 3PCSA 2RNTA 3CCU3 3GZXB 3CCV3 2IUKA 2B24B 2W9QA 1WMOA 3S67A 4BIRA 4MMXB 2OCTA 5FGOA 1DVCA 4R1KA 1IQYA 5GSPA 1FUWA 1N5PA 3EF8A 1I70A 4N6TA 1W6YA 2JDIH 5AEWB 5AIHA 2GBWB 3EN1B 3X42A 3L0RA 1RDSA 3KIIA 1S723 2QIYA 1A67A 1BSCA 1JNQA 2J8XB 1CQSA 2HOHA 2F5WA 4XBTA 1TU5A 2QA43 3JUPA 7RNTA 3F8XA 1GY6A 4FMDA 4OVMA 2Z77A 1R4CA 1F8NA 1EKMA 1BRJA 1GY5A 1SJWA 2UUGC 1BSAA 3O8YA 2OTJ3 2QEX3 1M1XB 1SIHA 2HMJB 3DGMA 1AQZA 2CFDA 3B4PA 1FUSA 4N6OB 4JF8A 3FH1A 4RNZA 1KD14 5HOHA 3VF1A 4IPBA 1ULIB 2OQEA 5EQLA 2GXFA 1BRHA 1O7HB 3ALAA 2P0MA 3CCL3 1Q824 1CYUA 2GSPA 1JKGA 4HM7B 3CXC2 2XRXB 3HIGA 4WYKA 1B21A 2W6JH 4O2HA 4AEQA 2GEYA 4R9LA 2IYJA 3ZFZA 2W04A 4BTXA 4QWTA 1VQO3 3OWYA 4FCZA 1W2B2 5JPPA 3UNLA 1K734 3G16A 1VQQA 1ROVA 3DGOA 4HZ9B 1VQM3 3GSPA 3X3YA 5CF2A 2KF6A 3K63A 3NV0B 3SOYA 3D3LA 4L8OA 3WOFB 3ROBA 3BIRA 2H0GA 4U13A 1A90A 3AGOA 4GSPA 1RCKA 3FG3A 4CPKA 1C7HA 1UGHI 2LYXA 3DMCA 3HOHA 4GL6A 7GSPA 5KP3A 2QGUA 1UUGB 3JUOA 4KFEA 1RCLA 5M18A 1IT8A 4HKVB 1HZ1A 2HMNB 3EC9A 1YNVX 1OCVA 1Z1SA 4EV2A 1KQS2 3MG2A 1K8A4 8RNTA 3G4S3 1TIJA 2V1LA 2FGTA 2CFLA 4H61A 2WGOA 1JBSA 1AVKA 4LZIA 1KSIA 1TRQA 3CNMA 1EG9B 2L1SA 3EHCA 1I0VA 3G0KA 2IUJA 1FYSA 2INXA 3ER7A 1I2GA 1DETA 3V99A 5BIRA 4WP5A 5CF1A 2CG1A 3ECFA 1UGIA 3STDA 2CK3H 5IG5A 2RSXA 2O3OA 3LH4A 1Q864 1SARA 5AYRB 1PY3A 2OOVC 4O3VA 2HMOB 5IEOA 1VQ53 3N8BA 4LEHA 5BXQA 1BANA 1QJGA 2Z6BA 3DXOA 3G8ZA 3LXUX 4EW5A 1VQK3 3WR2A 6GSPA 5STDA 4RNTA 1N9JA 2F4YA 3KKGA 5FW5A 1RKYA 3QK9A 2WOHA 3LZAA 1EQKA 2P05A 4EV5A 1B27A 1DVDA 3RNTA 8CHOA 1B3SA 4XBXA 3DGYA 1BNSA 3EBYA 3GWRA 3LT9A 1G02A 3SX1A 3D5IA 3A76A 3Q1CA 2O9UX 3I563 2GBXB 1OF5A 2IY2A 1IQ8A 5CLKA 1GOYA 1MWUA 5AIGA 3HZPA 4BU4A 2UX0A 4NREA 3EX9A 5CXOA 5ELJA 4J5KA 2CX1A 2FXTA 1LQMB 2D42A 2XFTA 1ZX2A 5BU4A 2OOVA 1GOVA 3I0YA 2R41A 4BTWA 5M19A 1YIT3 1FA3A 1O7GB 2HMKB 3D4AA 2C10A 2XGLA 3ZG5A 4LGQA 1V74A 1KC84 2CW9A 1GYBA 1RHLA 2ML5A 3G6E3 3NBJA 3HIIA 1RSNA 1T2IA 4K90B 2Q07A 2E2TA 2W03A 4XDWA 1UCJA 4I4KA 1QVF2 3N9HA 2ZL8A 1E3VA 2Y74A 1STFI 3MSOA 3NHXA 4ZM8A 1B2UA 4HBRA 1YJ93 1I0XA 1V58A 4FMAA 1RGAA 2OQEC 1GOUA 1FGTA 2BMRB 4FCMA 4RZMA 2XEPA 3S28A 4L7KA 1MNLA 1JKGB 4N3VA 1W01A 4HM0B 1WNHA 4WYKB 3SOAA 3MPHA 1OGZA 3FG1A 1B2SA 1U5OA 1MGWA 1RGHA 4KVHA 5AEUB 1VQ93 3FF2A 3DUKA 5BVBA 3DGNA 1IYYA 1A2PA 1TJDA 4KFFA 4FCJA 4CCVA 1GMPA 1M9GA 1AVLA 5KP4A 5IG0A 3Q2PA 3MWZA 1Q40A 5AIIA 4X2OA 1D6ZA 2C11A 3CU3A 1VQL3 1VQ73 1W02A 4HAAA 3T8UA 3UJMA 1BOXA 3BNDA 2HMMB 6RNTA 3DM8A 1I2EA 1CEWI 2YFLB 1BRGA 1O7MB 3BU4A 3D9RA 4KFDA 3KSPA 2BU4A 5M1AA 4R9KA 3CME3 1TUHA 2BO9B 1IV7A 3WODG 4OUQA 1LQGC 1WMNA 5DREA 1AY7A 4NHFA 1NNVA 1ROAA 2XGNA 3LMLA 1OUNA 1LOVA 1V57A 1IVWA 2SBLA 1WQLB 3AHWA 3EQQB 3LTCA 4DKIA 1I2FA 1IT7A 2E2UA 3BLZA 3D79A 4J9AA 5G1LA 3SVAA 3ZG0A 1OHOA 1RGFA 1D6YA 1E3RA 3LYGA 1QVG2 1IVVA 1FGRA 2CWVA 3MG3A 5HGRA 2KRTA 3FSDA 3VSYA 1B2XA 3BB9A 1BNFA 2BMOB 3F40A 1TFOA 4NPBA 3K9MC 2BIRA 3LTDA 1DMMA 5IG4A 2I9WA 3T8NA 3V98A 2F99A 1BUJA 3RGRA 4O02B 3CC23 4WFOA 3LOYA 1STDA 3AMOA 2IMJA 3A5EA 1FW7A 1HYFA 5CK6A 3EB8A 1ZGXA 2UGIA 5IEPA 3DZLA 4HVNA 2FNQA 3OXAA 1MWRA 4KZ1A 3CCQ3 1LNIA 1X1YA 1CH0A 1OH0A 2P0XA 2CG0A 1IDPA 2Y73A 3MG1A 1BNGA 1IQXA 1O7NB 4AKYA 1GSPA 2H0HA 1GY7A 2LQVA 2R4IA 3KFQC 5D82A 3TDGA 4EC6A 1OF5B 1NJI4 1D6UA 3JUMA 1VZZA 4BL3A 1IVXA 2CFWA 4PEJA 5IERA 1E97A 4N6MA 1B20A 1YIJ3 2Z7AA 4N6LA 3UL6A 2GU1A 1UUVB 1VQ83 2CH9A 4L8PA 1JRQA 3CCM3 2KAAA 3F7XA 3HK4A 1JN5A 1BIRA 1OGXA 4HM1B 1YVSA 4MMYB 3SXXA 3G713 3WDGB 2E2VA 3CCJ3 1TTOA 5AYSC 3WA2X 3EN8A 4FMCA 1FGMA 3VGNA 1W00A 1IU7A 2BT3A 3H51A 3S27A 1BRNL 4WHAA 1YI23 3WOEB 1DYUA 1MWSA 4BTYA 1BNJA 3B4OA 3GRDA 1NO3A 3PS8A 4AKZA 1GD4A 3F8HA 1JB5A 3FCSB 1Q7Y4 4J8TA 2ZDJA 1N9EA 3JUNA 3CC43 1A2VA 1EEJA 1OPYA 2XF3A 3LTAA 3OWUA 1O7WB 1VQN3 2C4BA 1BRIA 3FLJA 1BVIA 1W4NA 3CPW2 1X1UA 4FR9A 1RN1A 1T2HA 1BNEA 2XSHB 4XBYA 1LVNA 3X3ZA 3K5TA 1YVBI 2M7OA 1K9M4 1NB5I 2RCDA 4O8SA 1IV9A 2CKFB 3CD63 1PU4A 5LC6A 2P38A 1K41A 1LOWA 2W0QA 3FKAA 4N6NB 2ZHXB 3JUQA 1W7CA 1YGWA 4HM6B 5AI1A 3F14A 2W56A 2WOFA 1RN4A 3RGAA 4K1VA 1Q40B 5IF6A 2KF3A 3J7Yd 1YJW3 2CWTA 3Q90A 1Y4KA 3LT8A 1QALA 2L4VA 2IA7A 4IT7A 1YHQ3 4I5QA 2GEXA 3IJEB 3MYTA 1AR0A 1BGSA 5JBSA 4HM8B 4MJDA 3GZRA 1QAFA 1JB2A 3SLUA 4N6UA 1AV4A 1FZUA 1ZO2A 4TX4A 3CC73 1Q814 6STDA 1BSEA 1LXEA 4N6V0 1RRLA 2P09A 1W2ZA 3CCR3 1YGEA 3UL5A 3GZYB 3NM7A 3RDEA 7STDA 1BRSA 4CDLA 4XB5A 2RBIA 1N5HA 3URPA 2PNCA 1GS3A 3BNEA 4R80A 1G0TA 2F86B 5D83A 1SIIA 2RGQA 4LYLB 1HU9A 3N54B 4JRFA 2KF5A 2WO0A 5IENA 1JZOA 1K28A 2AAEA 2WGQA 3WA3A 5DRVA 1CYVA 2CC3A 4J5GA 4Q53A 1N8QA 3U1WA 3FZWA 1B2ZA 3BNBA 1BSBA 5I97A 1I3IA 3K7CA 3B7CA 4KT3B 3AMOB 3FGYA 1IK3A 1PFPA 4WWUC 1QMAA 2K54A 3X3XA 4CJNA 2CWUA 3HI7A 9RNTA 1RGLA 1JJ22 3NM2A 4R4KA 3IPTA 1RGEA 3SEDA 2A15A 3OX9A 1NU3A 1FGOA 4IIAA 5A0OB 2KF4A 1G96A 3OV4A 3EE1A 3MKIA 1RGCA 1SQWA 4GHOA 4HM3B 3OW22 1GMRA 4STDA 4X2HA 4HJLB 1N8R4 3CNXA 2HMLB 1RNTA 1UCIA 1ULJB 2D1WA 3S5CA 3U97A 3S29A 4EBGA 2XH9A 4OK0A 1JN5B 3EJVA 3QRDA 1RJOA 1EUIC 2BHMA 2OWPA 1WMPA 2STDA 1BU4A 3M8CA 1TRPA 3PYJA 3KE7A 5JPUA 1BUQA 1A2KA 1QAKA 4HYZA 1JBTA 1U8CB 3B8LA 1TP6A 2KCDA 3CPOA 3F7SA 3GZBA 4XM4A 1BNIA 3NBRA 2CFKA 3UB1A 4BL2A 3F9SA 1UI8A 2XSOB
chains in the Genus database with same CATH topology
3PCRA 3PGBA 3DY5A 1MOLA 1IVUA 3JVCA 4G1MB 1OACA 2GU3A 4HM2B 4MMZB 3NUVA 2MC8A 4LSOA 1EA2A 5IW9A 3MHEA 1W5ZA 4RBNA 2YX9A 3X41A 2Z76A 1S5AA 5G2GA 5ELUA 3T0UA 1TFKA 1FGQA 1LNHA 3V92A 5IG3A 1NDOB 3I553 3H3HA 1HKXA 1M1K4 3HX8A 1ISKA 1KWIA 1VQ43 2CIUA 2BNGA 1W6GA 1J2BA 3LTBA 4K1UA 1US1A 4EYCA 3CCS3 3FF0A 2CHCA 3X40A 2YFIB 2W56B 3KSED 3E99A 1UW1A 1ASKA 3NV0A 3OWSA 1GD3A 1UI7A 4LMIA 2MF7A 1DMQA 1JB4A 3NXJA 1T5YA 3DGLA 4RNYA 3NBBA 2JQ5A 1M904 2ML6A 3GAXA 1VQP3 4GB5A 1Q42A 4HZBB 3KZTA 3CCE3 3CMA3 3KN4A 5D81A 2B1XB 4MEIA 2W9PA 1SPUA 4EXRA 1W6CA 1WTHA 3IMAB 4FMBA 2W2CA 5KP1A 2F98A 1RRHA 3FG4A 1OHPA 1DMNA 4HM5B 5TGNA 2BMQB 2RFRA 1YJN3 3NX0A 2KXGA 3EBTA 1VQ63 1NB3I 4HM4B 3NQYA 1RN7A 3K0ZA 5EVHA 2K0MA 2YFJB 1O7PB 2PZVA 3NQZA 2CFGA 1L5GB 3WMDA 1UUWB 3PZWA 2OTL3 5AIFA 4K61A 4ORLA 5LC7A 1JV2B 1LOXA 1OHSA 3PXMA 3BNCA 2XR8B 5EEOA 1NWWA 4XDVA 4H3UA 2XFSA 3PCSA 3CCU3 3GZXB 3CCV3 2IUKA 2B24B 2W9QA 1WMOA 3S67A 4MMXB 2OCTA 5FGOA 1DVCA 4R1KA 1IQYA 1FUWA 1N5PA 3EF8A 4N6TA 1W6YA 2JDIH 5AEWB 5AIHA 2GBWB 3EN1B 3X42A 3L0RA 3KIIA 1S723 2QIYA 1A67A 1JNQA 1CQSA 4XBTA 1TU5A 2QA43 3JUPA 3F8XA 1GY6A 4FMDA 4OVMA 2Z77A 1R4CA 1F8NA 1EKMA 1GY5A 1SJWA 3O8YA 2OTJ3 2QEX3 1M1XB 1SIHA 2HMJB 3DGMA 4N6OB 2CFDA 3B4PA 1KD14 4JF8A 3FH1A 4RNZA 3VF1A 4IPBA 1ULIB 2OQEA 5EQLA 2GXFA 1O7HB 3ALAA 2P0MA 3CCL3 1Q824 1CYUA 1JKGA 4HM7B 3CXC2 2XRXB 3HIGA 4WYKA 2W6JH 4O2HA 4AEQA 2GEYA 4R9LA 2W04A 4BTXA 4QWTA 1VQO3 3OWYA 4FCZA 1W2B2 5JPPA 3UNLA 1K734 3G16A 1ROVA 3DGOA 4HZ9B 1VQM3 3X3YA 5CF2A 3K63A 3NV0B 3SOYA 3D3LA 4L8OA 3WOFB 3ROBA 4U13A 1A90A 3FG3A 1C7HA 2LYXA 3DMCA 4GL6A 5KP3A 2QGUA 3JUOA 4KFEA 1IT8A 4HKVB 2HMNB 3EC9A 1OCVA 1Z1SA 4EV2A 1KQS2 3MG2A 1K8A4 3G4S3 1TIJA 2V1LA 2FGTA 2CFLA 4H61A 2WGOA 1AVKA 4LZIA 1KSIA 3CNMA 1EG9B 3EHCA 3G0KA 2IUJA 2INXA 3ER7A 3V99A 4WP5A 5CF1A 2CG1A 3ECFA 3STDA 2CK3H 5IG5A 2RSXA 2O3OA 3LH4A 1Q864 5AYRB 2OOVC 4O3VA 2HMOB 5IEOA 1VQ53 3N8BA 4LEHA 5BXQA 1QJGA 2Z6BA 3DXOA 3G8ZA 3LXUX 1VQK3 5STDA 1N9JA 3KKGA 5FW5A 1RKYA 3QK9A 2WOHA 3LZAA 1EQKA 2P05A 4EV5A 1DVDA 8CHOA 4XBXA 3GWRA 3EBYA 3SX1A 3LT9A 3A76A 3Q1CA 2O9UX 3I563 2GBXB 1OF5A 1IQ8A 5CLKA 5AIGA 3HZPA 2UX0A 4NREA 3EX9A 5CXOA 5ELJA 2FXTA 2D42A 2XFTA 1ZX2A 2OOVA 3I0YA 4BTWA 1YIT3 1FA3A 1O7GB 2HMKB 2C10A 2XGLA 4LGQA 1V74A 1KC84 2CW9A 1GYBA 2ML5A 3G6E3 3NBJA 3HIIA 4K90B 2Q07A 2E2TA 2W03A 4XDWA 4I4KA 1QVF2 3N9HA 2ZL8A 1E3VA 2Y74A 1STFI 3MSOA 3NHXA 4ZM8A 4HBRA 1YJ93 4FMAA 2OQEC 1FGTA 2BMRB 4FCMA 4RZMA 2XEPA 3S28A 4L7KA 1MNLA 1JKGB 4N3VA 1W01A 4HM0B 1WNHA 4WYKB 3SOAA 3MPHA 1OGZA 3FG1A 1U5OA 4KVHA 1VQ93 5AEUB 3FF2A 3DUKA 5BVBA 3DGNA 4KFFA 4FCJA 4CCVA 1M9GA 1AVLA 5KP4A 5IG0A 3Q2PA 3MWZA 1Q40A 5AIIA 4X2OA 1D6ZA 2C11A 3CU3A 1VQL3 1VQ73 1W02A 3UJMA 3T8UA 3BNDA 2HMMB 3DM8A 1CEWI 2YFLB 1O7MB 4KFDA 3D9RA 3KSPA 4R9KA 3CME3 1TUHA 2BO9B 1IV7A 3WODG 4OUQA 1WMNA 5DREA 4NHFA 1ROAA 2XGNA 3LMLA 1OUNA 1IVWA 2SBLA 1WQLB 3EQQB 3LTCA 2E2UA 1IT7A 3BLZA 4J9AA 3SVAA 1OHOA 1D6YA 1E3RA 3LYGA 1QVG2 1IVVA 1FGRA 2CWVA 3MG3A 5HGRA 2KRTA 3FSDA 3VSYA 3BB9A 2BMOB 3F40A 1TFOA 3K9MC 3LTDA 1DMMA 5IG4A 2I9WA 3T8NA 3V98A 2F99A 3RGRA 4O02B 3CC23 4WFOA 3LOYA 1STDA 3AMOA 2IMJA 5CK6A 3EB8A 5IEPA 3DZLA 4HVNA 2FNQA 3OXAA 4KZ1A 3CCQ3 1OH0A 2P0XA 2CG0A 1IDPA 2Y73A 3MG1A 1O7NB 1IQXA 4AKYA 1GY7A 2LQVA 2R4IA 3KFQC 5D82A 3TDGA 4EC6A 1OF5B 1NJI4 1D6UA 3JUMA 1VZZA 1IVXA 2CFWA 4PEJA 5IERA 1E97A 4N6MA 1YIJ3 2Z7AA 4N6LA 3UL6A 2GU1A 1UUVB 1VQ83 2CH9A 4L8PA 1JRQA 3CCM3 3F7XA 3HK4A 1JN5A 1OGXA 4HM1B 4MMYB 3SXXA 3G713 3WDGB 2E2VA 3CCJ3 5AYSC 3WA2X 3EN8A 4FMCA 1FGMA 3VGNA 1W00A 2BT3A 1IU7A 3H51A 3S27A 4WHAA 1YI23 3WOEB 1DYUA 4BTYA 3B4OA 3GRDA 1NO3A 3PS8A 4AKZA 1GD4A 3F8HA 1JB5A 3FCSB 1Q7Y4 4J8TA 2ZDJA 1N9EA 3JUNA 3CC43 1A2VA 1OPYA 2XF3A 3LTAA 3OWUA 1O7WB 1VQN3 3FLJA 1W4NA 3CPW2 4FR9A 2XSHB 4XBYA 1LVNA 3X3ZA 3K5TA 1YVBI 2M7OA 1K9M4 1NB5I 2RCDA 4O8SA 1IV9A 2CKFB 3CD63 1PU4A 5LC6A 2P38A 1K41A 2W0QA 4N6NB 3FKAA 3JUQA 1W7CA 4HM6B 5AI1A 3F14A 2W56A 2WOFA 3RGAA 5IF6A 4K1VA 1Q40B 3J7Yd 1YJW3 2CWTA 3Q90A 1Y4KA 3LT8A 1QALA 2L4VA 2IA7A 4IT7A 1YHQ3 2GEXA 3IJEB 3MYTA 1AR0A 5JBSA 4HM8B 4MJDA 3GZRA 1QAFA 1JB2A 3SLUA 4N6UA 1AV4A 1ZO2A 4TX4A 3CC73 1Q814 6STDA 1LXEA 4N6V0 1RRLA 2P09A 1W2ZA 3CCR3 1YGEA 3UL5A 3GZYB 3NM7A 3RDEA 7STDA 4CDLA 4XB5A 1N5HA 2PNCA 1GS3A 3BNEA 4R80A 2F86B 5D83A 1SIIA 2RGQA 1HU9A 3N54B 4JRFA 2WO0A 5IENA 1K28A 2WGQA 3WA3A 5DRVA 1CYVA 2CC3A 4Q53A 1N8QA 3U1WA 3FZWA 3BNBA 5I97A 3K7CA 3B7CA 3AMOB 3FGYA 1IK3A 1PFPA 4WWUC 1QMAA 2K54A 3X3XA 2CWUA 3HI7A 1JJ22 3NM2A 4R4KA 3IPTA 3SEDA 2A15A 3OX9A 1NU3A 1FGOA 4IIAA 5A0OB 1G96A 3OV4A 3EE1A 3MKIA 1SQWA 4HM3B 3OW22 4STDA 4X2HA 4HJLB 1N8R4 3CNXA 2HMLB 2D1WA 1ULJB 3S5CA 3U97A 3S29A 4EBGA 2XH9A 4OK0A 1JN5B 3EJVA 3QRDA 1RJOA 2BHMA 2OWPA 2STDA 1WMPA 3M8CA 3PYJA 1BUQA 5JPUA 3KE7A 1A2KA 1QAKA 4HYZA 1U8CB 3B8LA 1TP6A 2KCDA 3CPOA 3F7SA 3GZBA 4XM4A 3NBRA 3UB1A 2CFKA 3F9SA 1UI8A 2XSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSO A;  4JF8 A;  4AKZ A;  4AKY A;  5I97 A;  4NHF A;  4O3V A;  5JBS A;  2CC3 A;  4KZ1 A;  4MEI A;  2BHM A; 
#chains in the Genus database with same CATH topology
 3PCR A;  3PGB A;  3DY5 A;  1MOL A;  1IVU A;  3JVC A;  4G1M B;  1OAC A;  2GU3 A;  4HM2 B;  4MMZ B;  3NUV A;  2MC8 A;  4LSO A;  1EA2 A;  1RLS A;  5IW9 A;  3MHE A;  1W5Z A;  2AAD A;  1T3B A;  2ZA4 A;  4RBN A;  1RGK A;  2YX9 A;  3X41 A;  2Z76 A;  1S5A A;  1FUT A;  5G2G A;  2CX0 A;  5ELU A;  3T0U A;  1TFK A;  1FGQ A;  1LNH A;  3V92 A;  5IG3 A;  1NDO B;  3I55 3;  3H3H A;  1HKX A;  1M1K 4;  3HX8 A;  1ISK A;  1KWI A;  1VQ4 3;  1BSD A;  1UCK A;  2CIU A;  2BNG A;  1W6G A;  3AHS A;  1J2B A;  3LTB A;  4K1U A;  1BRK A;  1US1 A;  4EYC A;  3CCS 3;  1RGG A;  3FF0 A;  1DE3 A;  2CHC A;  3X40 A;  2YFI B;  2W56 B;  1Q9E A;  1R4Y A;  3KSE D;  3E99 A;  1UW1 A;  1ASK A;  3NV0 A;  3OWS A;  1GD3 A;  1LRA A;  1UI7 A;  4LMI A;  2MF7 A;  1RTU A;  1DMQ A;  1JB4 A;  1PYL A;  3NXJ A;  1T5Y A;  3DGL A;  4RNY A;  3NBB A;  2JQ5 A;  1M90 4;  2F56 A;  2ML6 A;  3GAX A;  1VQP 3;  4GB5 A;  1Q42 A;  2F5M A;  4HZB B;  1BNR A;  3DH2 A;  3KZT A;  1BAO A;  3CCE 3;  1RNB A;  3CMA 3;  3KN4 A;  4ILF A;  5D81 A;  1MGR A;  2B1X B;  4MEI A;  2W9P A;  1X1X A;  3SYU A;  1X1W A;  1SPU A;  4EXR A;  3KCH A;  1W6C A;  1WTH A;  3IMA B;  4FMB A;  5G1K A;  2W2C A;  5KP1 A;  1I3F A;  1RRH A;  2F98 A;  3FG4 A;  1OHP A;  1DMN A;  4HOH A;  4HM5 B;  5TGN A;  2SAR A;  5RNT A;  2BMQ B;  1I8V A;  2RFR A;  1UCL A;  1YJN 3;  3NX0 A;  2KXG A;  3EBT A;  1VQ6 3;  1JBR A;  1NB3 I;  4HM4 B;  1ZS7 A;  3NQY A;  1RN7 A;  3D5G A;  3K0Z A;  5EVH A;  1JZD A;  2K0M A;  2K3D A;  3AGN A;  2YFJ B;  1GMQ A;  1O7P B;  3Q3F A;  3WHO A;  2PZV A;  3NQZ A;  1C54 A;  2CFG A;  1L5G B;  3WMD A;  1UUW B;  3PZW A;  2OTL 3;  1UDI I;  5AIF A;  4K61 A;  2H0I A;  4ORL A;  5LC7 A;  1MWT A;  1RMS A;  1JV2 B;  1LOX A;  1B2M A;  1OHS A;  3PXM A;  1LOY A;  3BNC A;  1Q7H A;  2XR8 B;  5EEO A;  1NWW A;  4XDV A;  4H3U A;  2XFS A;  3PCS A;  2RNT A;  3CCU 3;  3GZX B;  3CCV 3;  2IUK A;  2B24 B;  2W9Q A;  1WMO A;  3S67 A;  4BIR A;  4MMX B;  2OCT A;  5FGO A;  1DVC A;  4R1K A;  1IQY A;  5GSP A;  1FUW A;  1N5P A;  3EF8 A;  1I70 A;  4N6T A;  1W6Y A;  2JDI H;  5AEW B;  5AIH A;  2GBW B;  3EN1 B;  3X42 A;  3L0R A;  1RDS A;  3KII A;  1S72 3;  2QIY A;  1A67 A;  1BSC A;  1JNQ A;  2J8X B;  1CQS A;  2HOH A;  2F5W A;  4XBT A;  1TU5 A;  2QA4 3;  3JUP A;  7RNT A;  3F8X A;  1GY6 A;  4FMD A;  4OVM A;  2Z77 A;  1R4C A;  1F8N A;  1EKM A;  1BRJ A;  1GY5 A;  1SJW A;  2UUG C;  1BSA A;  3O8Y A;  2OTJ 3;  2QEX 3;  1M1X B;  1SIH A;  2HMJ B;  3DGM A;  1AQZ A;  2CFD A;  3B4P A;  1FUS A;  4N6O B;  4JF8 A;  3FH1 A;  4RNZ A;  1KD1 4;  5HOH A;  3VF1 A;  4IPB A;  1ULI B;  2OQE A;  5EQL A;  2GXF A;  1BRH A;  1O7H B;  3ALA A;  2P0M A;  3CCL 3;  1Q82 4;  1CYU A;  2GSP A;  1JKG A;  4HM7 B;  3CXC 2;  2XRX B;  3HIG A;  4WYK A;  1B21 A;  2W6J H;  4O2H A;  4AEQ A;  2GEY A;  4R9L A;  2IYJ A;  3ZFZ A;  2W04 A;  4BTX A;  4QWT A;  1VQO 3;  3OWY A;  4FCZ A;  1W2B 2;  5JPP A;  3UNL A;  1K73 4;  3G16 A;  1VQQ A;  1ROV A;  3DGO A;  4HZ9 B;  1VQM 3;  3GSP A;  3X3Y A;  5CF2 A;  2KF6 A;  3K63 A;  3NV0 B;  3SOY A;  3D3L A;  4L8O A;  3WOF B;  3ROB A;  3BIR A;  2H0G A;  4U13 A;  1A90 A;  3AGO A;  4GSP A;  1RCK A;  3FG3 A;  4CPK A;  1C7H A;  1UGH I;  2LYX A;  3DMC A;  3HOH A;  4GL6 A;  7GSP A;  5KP3 A;  2QGU A;  1UUG B;  3JUO A;  4KFE A;  1RCL A;  5M18 A;  1IT8 A;  4HKV B;  1HZ1 A;  2HMN B;  3EC9 A;  1YNV X;  1OCV A;  1Z1S A;  4EV2 A;  1KQS 2;  3MG2 A;  1K8A 4;  8RNT A;  3G4S 3;  1TIJ A;  2V1L A;  2FGT A;  2CFL A;  4H61 A;  2WGO A;  1JBS A;  1AVK A;  4LZI A;  1KSI A;  1TRQ A;  3CNM A;  1EG9 B;  2L1S A;  3EHC A;  1I0V A;  3G0K A;  2IUJ A;  1FYS A;  2INX A;  3ER7 A;  1I2G A;  1DET A;  3V99 A;  5BIR A;  4WP5 A;  5CF1 A;  2CG1 A;  3ECF A;  1UGI A;  3STD A;  2CK3 H;  5IG5 A;  2RSX A;  2O3O A;  3LH4 A;  1Q86 4;  1SAR A;  5AYR B;  1PY3 A;  2OOV C;  4O3V A;  2HMO B;  5IEO A;  1VQ5 3;  3N8B A;  4LEH A;  5BXQ A;  1BAN A;  1QJG A;  2Z6B A;  3DXO A;  3G8Z A;  3LXU X;  4EW5 A;  1VQK 3;  3WR2 A;  6GSP A;  5STD A;  4RNT A;  1N9J A;  2F4Y A;  3KKG A;  5FW5 A;  1RKY A;  3QK9 A;  2WOH A;  3LZA A;  1EQK A;  2P05 A;  4EV5 A;  1B27 A;  1DVD A;  3RNT A;  8CHO A;  1B3S A;  4XBX A;  3DGY A;  1BNS A;  3EBY A;  3GWR A;  3LT9 A;  1G02 A;  3SX1 A;  3D5I A;  3A76 A;  3Q1C A;  2O9U X;  3I56 3;  2GBX B;  1OF5 A;  2IY2 A;  1IQ8 A;  5CLK A;  1GOY A;  1MWU A;  5AIG A;  3HZP A;  4BU4 A;  2UX0 A;  4NRE A;  3EX9 A;  5CXO A;  5ELJ A;  4J5K A;  2CX1 A;  2FXT A;  1LQM B;  2D42 A;  2XFT A;  1ZX2 A;  5BU4 A;  2OOV A;  1GOV A;  3I0Y A;  2R41 A;  4BTW A;  5M19 A;  1YIT 3;  1FA3 A;  1O7G B;  2HMK B;  3D4A A;  2C10 A;  2XGL A;  3ZG5 A;  4LGQ A;  1V74 A;  1KC8 4;  2CW9 A;  1GYB A;  1RHL A;  2ML5 A;  3G6E 3;  3NBJ A;  3HII A;  1RSN A;  1T2I A;  4K90 B;  2Q07 A;  2E2T A;  2W03 A;  4XDW A;  1UCJ A;  4I4K A;  1QVF 2;  3N9H A;  2ZL8 A;  1E3V A;  2Y74 A;  1STF I;  3MSO A;  3NHX A;  4ZM8 A;  1B2U A;  4HBR A;  1YJ9 3;  1I0X A;  1V58 A;  4FMA A;  1RGA A;  2OQE C;  1GOU A;  1FGT A;  2BMR B;  4FCM A;  4RZM A;  2XEP A;  3S28 A;  4L7K A;  1MNL A;  1JKG B;  4N3V A;  1W01 A;  4HM0 B;  1WNH A;  4WYK B;  3SOA A;  3MPH A;  1OGZ A;  3FG1 A;  1B2S A;  1U5O A;  1MGW A;  1RGH A;  4KVH A;  5AEU B;  1VQ9 3;  3FF2 A;  3DUK A;  5BVB A;  3DGN A;  1IYY A;  1A2P A;  1TJD A;  4KFF A;  4FCJ A;  4CCV A;  1GMP A;  1M9G A;  1AVL A;  5KP4 A;  5IG0 A;  3Q2P A;  3MWZ A;  1Q40 A;  5AII A;  4X2O A;  1D6Z A;  2C11 A;  3CU3 A;  1VQL 3;  1VQ7 3;  1W02 A;  4HAA A;  3T8U A;  3UJM A;  1BOX A;  3BND A;  2HMM B;  6RNT A;  3DM8 A;  1I2E A;  1CEW I;  2YFL B;  1BRG A;  1O7M B;  3BU4 A;  3D9R A;  4KFD A;  3KSP A;  2BU4 A;  5M1A A;  4R9K A;  3CME 3;  1TUH A;  2BO9 B;  1IV7 A;  3WOD G;  4OUQ A;  1LQG C;  1WMN A;  5DRE A;  1AY7 A;  4NHF A;  1NNV A;  1ROA A;  2XGN A;  3LML A;  1OUN A;  1LOV A;  1V57 A;  1IVW A;  2SBL A;  1WQL B;  3AHW A;  3EQQ B;  3LTC A;  4DKI A;  1I2F A;  1IT7 A;  2E2U A;  3BLZ A;  3D79 A;  4J9A A;  5G1L A;  3SVA A;  3ZG0 A;  1OHO A;  1RGF A;  1D6Y A;  1E3R A;  3LYG A;  1QVG 2;  1IVV A;  1FGR A;  2CWV A;  3MG3 A;  5HGR A;  2KRT A;  3FSD A;  3VSY A;  1B2X A;  3BB9 A;  1BNF A;  2BMO B;  3F40 A;  1TFO A;  4NPB A;  3K9M C;  2BIR A;  3LTD A;  1DMM A;  5IG4 A;  2I9W A;  3T8N A;  3V98 A;  2F99 A;  1BUJ A;  3RGR A;  4O02 B;  3CC2 3;  4WFO A;  3LOY A;  1STD A;  3AMO A;  2IMJ A;  3A5E A;  1FW7 A;  1HYF A;  5CK6 A;  3EB8 A;  1ZGX A;  2UGI A;  5IEP A;  3DZL A;  4HVN A;  2FNQ A;  3OXA A;  1MWR A;  4KZ1 A;  3CCQ 3;  1LNI A;  1X1Y A;  1CH0 A;  1OH0 A;  2P0X A;  2CG0 A;  1IDP A;  2Y73 A;  3MG1 A;  1BNG A;  1IQX A;  1O7N B;  4AKY A;  1GSP A;  2H0H A;  1GY7 A;  2LQV A;  2R4I A;  3KFQ C;  5D82 A;  3TDG A;  4EC6 A;  1OF5 B;  1NJI 4;  1D6U A;  3JUM A;  1VZZ A;  4BL3 A;  1IVX A;  2CFW A;  4PEJ A;  5IER A;  1E97 A;  4N6M A;  1B20 A;  1YIJ 3;  2Z7A A;  4N6L A;  3UL6 A;  2GU1 A;  1UUV B;  1VQ8 3;  2CH9 A;  4L8P A;  1JRQ A;  3CCM 3;  2KAA A;  3F7X A;  3HK4 A;  1JN5 A;  1BIR A;  1OGX A;  4HM1 B;  1YVS A;  4MMY B;  3SXX A;  3G71 3;  3WDG B;  2E2V A;  3CCJ 3;  1TTO A;  5AYS C;  3WA2 X;  3EN8 A;  4FMC A;  1FGM A;  3VGN A;  1W00 A;  1IU7 A;  2BT3 A;  3H51 A;  3S27 A;  1BRN L;  4WHA A;  1YI2 3;  3WOE B;  1DYU A;  1MWS A;  4BTY A;  1BNJ A;  3B4O A;  3GRD A;  1NO3 A;  3PS8 A;  4AKZ A;  1GD4 A;  3F8H A;  1JB5 A;  3FCS B;  1Q7Y 4;  4J8T A;  2ZDJ A;  1N9E A;  3JUN A;  3CC4 3;  1A2V A;  1EEJ A;  1OPY A;  2XF3 A;  3LTA A;  3OWU A;  1O7W B;  1VQN 3;  2C4B A;  1BRI A;  3FLJ A;  1BVI A;  1W4N A;  3CPW 2;  1X1U A;  4FR9 A;  1RN1 A;  1T2H A;  1BNE A;  2XSH B;  4XBY A;  1LVN A;  3X3Z A;  3K5T A;  1YVB I;  2M7O A;  1K9M 4;  1NB5 I;  2RCD A;  4O8S A;  1IV9 A;  2CKF B;  3CD6 3;  1PU4 A;  5LC6 A;  2P38 A;  1K41 A;  1LOW A;  2W0Q A;  3FKA A;  4N6N B;  2ZHX B;  3JUQ A;  1W7C A;  1YGW A;  4HM6 B;  5AI1 A;  3F14 A;  2W56 A;  2WOF A;  1RN4 A;  3RGA A;  4K1V A;  1Q40 B;  5IF6 A;  2KF3 A;  3J7Y d;  1YJW 3;  2CWT A;  3Q90 A;  1Y4K A;  3LT8 A;  1QAL A;  2L4V A;  2IA7 A;  4IT7 A;  1YHQ 3;  4I5Q A;  2GEX A;  3IJE B;  3MYT A;  1AR0 A;  1BGS A;  5JBS A;  4HM8 B;  4MJD A;  3GZR A;  1QAF A;  1JB2 A;  3SLU A;  4N6U A;  1AV4 A;  1FZU A;  1ZO2 A;  4TX4 A;  3CC7 3;  1Q81 4;  6STD A;  1BSE A;  1LXE A;  4N6V 0;  1RRL A;  2P09 A;  1W2Z A;  3CCR 3;  1YGE A;  3UL5 A;  3GZY B;  3NM7 A;  3RDE A;  7STD A;  1BRS A;  4CDL A;  4XB5 A;  2RBI A;  1N5H A;  3URP A;  2PNC A;  1GS3 A;  3BNE A;  4R80 A;  1G0T A;  2F86 B;  5D83 A;  1SII A;  2RGQ A;  4LYL B;  1HU9 A;  3N54 B;  4JRF A;  2KF5 A;  2WO0 A;  5IEN A;  1JZO A;  1K28 A;  2AAE A;  2WGQ A;  3WA3 A;  5DRV A;  1CYV A;  2CC3 A;  4J5G A;  4Q53 A;  1N8Q A;  3U1W A;  3FZW A;  1B2Z A;  3BNB A;  1BSB A;  5I97 A;  1I3I A;  3K7C A;  3B7C A;  4KT3 B;  3AMO B;  3FGY A;  1IK3 A;  1PFP A;  4WWU C;  1QMA A;  2K54 A;  3X3X A;  4CJN A;  2CWU A;  3HI7 A;  9RNT A;  1RGL A;  1JJ2 2;  3NM2 A;  4R4K A;  3IPT A;  1RGE A;  3SED A;  2A15 A;  3OX9 A;  1NU3 A;  1FGO A;  4IIA A;  5A0O B;  2KF4 A;  1G96 A;  3OV4 A;  3EE1 A;  3MKI A;  1RGC A;  1SQW A;  4GHO A;  4HM3 B;  3OW2 2;  1GMR A;  4STD A;  4X2H A;  4HJL B;  1N8R 4;  3CNX A;  2HML B;  1RNT A;  1UCI A;  1ULJ B;  2D1W A;  3S5C A;  3U97 A;  3S29 A;  4EBG A;  2XH9 A;  4OK0 A;  1JN5 B;  3EJV A;  3QRD A;  1RJO A;  1EUI C;  2BHM A;  2OWP A;  1WMP A;  2STD A;  1BU4 A;  3M8C A;  1TRP A;  3PYJ A;  3KE7 A;  5JPU A;  1BUQ A;  1A2K A;  1QAK A;  4HYZ A;  1JBT A;  1U8C B;  3B8L A;  1TP6 A;  2KCD A;  3CPO A;  3F7S A;  3GZB A;  4XM4 A;  1BNI A;  3NBR A;  2CFK A;  3UB1 A;  4BL2 A;  3F9S A;  1UI8 A;  2XSO B; 
#chains in the Genus database with same CATH homology
 3PCR A;  3PGB A;  3DY5 A;  1MOL A;  1IVU A;  3JVC A;  4G1M B;  1OAC A;  2GU3 A;  4HM2 B;  4MMZ B;  3NUV A;  2MC8 A;  4LSO A;  1EA2 A;  5IW9 A;  3MHE A;  1W5Z A;  4RBN A;  2YX9 A;  3X41 A;  2Z76 A;  1S5A A;  5G2G A;  5ELU A;  3T0U A;  1TFK A;  1FGQ A;  1LNH A;  3V92 A;  5IG3 A;  1NDO B;  3I55 3;  3H3H A;  1HKX A;  1M1K 4;  3HX8 A;  1ISK A;  1KWI A;  1VQ4 3;  2CIU A;  2BNG A;  1W6G A;  1J2B A;  3LTB A;  4K1U A;  1US1 A;  4EYC A;  3CCS 3;  3FF0 A;  2CHC A;  3X40 A;  2YFI B;  2W56 B;  3KSE D;  3E99 A;  1UW1 A;  1ASK A;  3NV0 A;  3OWS A;  1GD3 A;  1UI7 A;  4LMI A;  2MF7 A;  1DMQ A;  1JB4 A;  3NXJ A;  1T5Y A;  3DGL A;  4RNY A;  3NBB A;  2JQ5 A;  1M90 4;  2ML6 A;  3GAX A;  1VQP 3;  4GB5 A;  1Q42 A;  4HZB B;  3KZT A;  3CCE 3;  3CMA 3;  3KN4 A;  5D81 A;  2B1X B;  4MEI A;  2W9P A;  1SPU A;  4EXR A;  1W6C A;  1WTH A;  3IMA B;  4FMB A;  2W2C A;  5KP1 A;  2F98 A;  1RRH A;  3FG4 A;  1OHP A;  1DMN A;  4HM5 B;  5TGN A;  2BMQ B;  2RFR A;  1YJN 3;  3NX0 A;  2KXG A;  3EBT A;  1VQ6 3;  1NB3 I;  4HM4 B;  3NQY A;  1RN7 A;  3K0Z A;  5EVH A;  2K0M A;  2YFJ B;  1O7P B;  2PZV A;  3NQZ A;  2CFG A;  1L5G B;  3WMD A;  1UUW B;  3PZW A;  2OTL 3;  5AIF A;  4K61 A;  4ORL A;  5LC7 A;  1JV2 B;  1LOX A;  1OHS A;  3PXM A;  3BNC A;  2XR8 B;  5EEO A;  1NWW A;  4XDV A;  4H3U A;  2XFS A;  3PCS A;  3CCU 3;  3GZX B;  3CCV 3;  2IUK A;  2B24 B;  2W9Q A;  1WMO A;  3S67 A;  4MMX B;  2OCT A;  5FGO A;  1DVC A;  4R1K A;  1IQY A;  1FUW A;  1N5P A;  3EF8 A;  4N6T A;  1W6Y A;  2JDI H;  5AEW B;  5AIH A;  2GBW B;  3EN1 B;  3X42 A;  3L0R A;  3KII A;  1S72 3;  2QIY A;  1A67 A;  1JNQ A;  1CQS A;  4XBT A;  1TU5 A;  2QA4 3;  3JUP A;  3F8X A;  1GY6 A;  4FMD A;  4OVM A;  2Z77 A;  1R4C A;  1F8N A;  1EKM A;  1GY5 A;  1SJW A;  3O8Y A;  2OTJ 3;  2QEX 3;  1M1X B;  1SIH A;  2HMJ B;  3DGM A;  4N6O B;  2CFD A;  3B4P A;  1KD1 4;  4JF8 A;  3FH1 A;  4RNZ A;  3VF1 A;  4IPB A;  1ULI B;  2OQE A;  5EQL A;  2GXF A;  1O7H B;  3ALA A;  2P0M A;  3CCL 3;  1Q82 4;  1CYU A;  1JKG A;  4HM7 B;  3CXC 2;  2XRX B;  3HIG A;  4WYK A;  2W6J H;  4O2H A;  4AEQ A;  2GEY A;  4R9L A;  2W04 A;  4BTX A;  4QWT A;  1VQO 3;  3OWY A;  4FCZ A;  1W2B 2;  5JPP A;  3UNL A;  1K73 4;  3G16 A;  1ROV A;  3DGO A;  4HZ9 B;  1VQM 3;  3X3Y A;  5CF2 A;  3K63 A;  3NV0 B;  3SOY A;  3D3L A;  4L8O A;  3WOF B;  3ROB A;  4U13 A;  1A90 A;  3FG3 A;  1C7H A;  2LYX A;  3DMC A;  4GL6 A;  5KP3 A;  2QGU A;  3JUO A;  4KFE A;  1IT8 A;  4HKV B;  2HMN B;  3EC9 A;  1OCV A;  1Z1S A;  4EV2 A;  1KQS 2;  3MG2 A;  1K8A 4;  3G4S 3;  1TIJ A;  2V1L A;  2FGT A;  2CFL A;  4H61 A;  2WGO A;  1AVK A;  4LZI A;  1KSI A;  3CNM A;  1EG9 B;  3EHC A;  3G0K A;  2IUJ A;  2INX A;  3ER7 A;  3V99 A;  4WP5 A;  5CF1 A;  2CG1 A;  3ECF A;  3STD A;  2CK3 H;  5IG5 A;  2RSX A;  2O3O A;  3LH4 A;  1Q86 4;  5AYR B;  2OOV C;  4O3V A;  2HMO B;  5IEO A;  1VQ5 3;  3N8B A;  4LEH A;  5BXQ A;  1QJG A;  2Z6B A;  3DXO A;  3G8Z A;  3LXU X;  1VQK 3;  5STD A;  1N9J A;  3KKG A;  5FW5 A;  1RKY A;  3QK9 A;  2WOH A;  3LZA A;  1EQK A;  2P05 A;  4EV5 A;  1DVD A;  8CHO A;  4XBX A;  3GWR A;  3EBY A;  3SX1 A;  3LT9 A;  3A76 A;  3Q1C A;  2O9U X;  3I56 3;  2GBX B;  1OF5 A;  1IQ8 A;  5CLK A;  5AIG A;  3HZP A;  2UX0 A;  4NRE A;  3EX9 A;  5CXO A;  5ELJ A;  2FXT A;  2D42 A;  2XFT A;  1ZX2 A;  2OOV A;  3I0Y A;  4BTW A;  1YIT 3;  1FA3 A;  1O7G B;  2HMK B;  2C10 A;  2XGL A;  4LGQ A;  1V74 A;  1KC8 4;  2CW9 A;  1GYB A;  2ML5 A;  3G6E 3;  3NBJ A;  3HII A;  4K90 B;  2Q07 A;  2E2T A;  2W03 A;  4XDW A;  4I4K A;  1QVF 2;  3N9H A;  2ZL8 A;  1E3V A;  2Y74 A;  1STF I;  3MSO A;  3NHX A;  4ZM8 A;  4HBR A;  1YJ9 3;  4FMA A;  2OQE C;  1FGT A;  2BMR B;  4FCM A;  4RZM A;  2XEP A;  3S28 A;  4L7K A;  1MNL A;  1JKG B;  4N3V A;  1W01 A;  4HM0 B;  1WNH A;  4WYK B;  3SOA A;  3MPH A;  1OGZ A;  3FG1 A;  1U5O A;  4KVH A;  1VQ9 3;  5AEU B;  3FF2 A;  3DUK A;  5BVB A;  3DGN A;  4KFF A;  4FCJ A;  4CCV A;  1M9G A;  1AVL A;  5KP4 A;  5IG0 A;  3Q2P A;  3MWZ A;  1Q40 A;  5AII A;  4X2O A;  1D6Z A;  2C11 A;  3CU3 A;  1VQL 3;  1VQ7 3;  1W02 A;  3UJM A;  3T8U A;  3BND A;  2HMM B;  3DM8 A;  1CEW I;  2YFL B;  1O7M B;  4KFD A;  3D9R A;  3KSP A;  4R9K A;  3CME 3;  1TUH A;  2BO9 B;  1IV7 A;  3WOD G;  4OUQ A;  1WMN A;  5DRE A;  4NHF A;  1ROA A;  2XGN A;  3LML A;  1OUN A;  1IVW A;  2SBL A;  1WQL B;  3EQQ B;  3LTC A;  2E2U A;  1IT7 A;  3BLZ A;  4J9A A;  3SVA A;  1OHO A;  1D6Y A;  1E3R A;  3LYG A;  1QVG 2;  1IVV A;  1FGR A;  2CWV A;  3MG3 A;  5HGR A;  2KRT A;  3FSD A;  3VSY A;  3BB9 A;  2BMO B;  3F40 A;  1TFO A;  3K9M C;  3LTD A;  1DMM A;  5IG4 A;  2I9W A;  3T8N A;  3V98 A;  2F99 A;  3RGR A;  4O02 B;  3CC2 3;  4WFO A;  3LOY A;  1STD A;  3AMO A;  2IMJ A;  5CK6 A;  3EB8 A;  5IEP A;  3DZL A;  4HVN A;  2FNQ A;  3OXA A;  4KZ1 A;  3CCQ 3;  1OH0 A;  2P0X A;  2CG0 A;  1IDP A;  2Y73 A;  3MG1 A;  1O7N B;  1IQX A;  4AKY A;  1GY7 A;  2LQV A;  2R4I A;  3KFQ C;  5D82 A;  3TDG A;  4EC6 A;  1OF5 B;  1NJI 4;  1D6U A;  3JUM A;  1VZZ A;  1IVX A;  2CFW A;  4PEJ A;  5IER A;  1E97 A;  4N6M A;  1YIJ 3;  2Z7A A;  4N6L A;  3UL6 A;  2GU1 A;  1UUV B;  1VQ8 3;  2CH9 A;  4L8P A;  1JRQ A;  3CCM 3;  3F7X A;  3HK4 A;  1JN5 A;  1OGX A;  4HM1 B;  4MMY B;  3SXX A;  3G71 3;  3WDG B;  2E2V A;  3CCJ 3;  5AYS C;  3WA2 X;  3EN8 A;  4FMC A;  1FGM A;  3VGN A;  1W00 A;  2BT3 A;  1IU7 A;  3H51 A;  3S27 A;  4WHA A;  1YI2 3;  3WOE B;  1DYU A;  4BTY A;  3B4O A;  3GRD A;  1NO3 A;  3PS8 A;  4AKZ A;  1GD4 A;  3F8H A;  1JB5 A;  3FCS B;  1Q7Y 4;  4J8T A;  2ZDJ A;  1N9E A;  3JUN A;  3CC4 3;  1A2V A;  1OPY A;  2XF3 A;  3LTA A;  3OWU A;  1O7W B;  1VQN 3;  3FLJ A;  1W4N A;  3CPW 2;  4FR9 A;  2XSH B;  4XBY A;  1LVN A;  3X3Z A;  3K5T A;  1YVB I;  2M7O A;  1K9M 4;  1NB5 I;  2RCD A;  4O8S A;  1IV9 A;  2CKF B;  3CD6 3;  1PU4 A;  5LC6 A;  2P38 A;  1K41 A;  2W0Q A;  4N6N B;  3FKA A;  3JUQ A;  1W7C A;  4HM6 B;  5AI1 A;  3F14 A;  2W56 A;  2WOF A;  3RGA A;  5IF6 A;  4K1V A;  1Q40 B;  3J7Y d;  1YJW 3;  2CWT A;  3Q90 A;  1Y4K A;  3LT8 A;  1QAL A;  2L4V A;  2IA7 A;  4IT7 A;  1YHQ 3;  2GEX A;  3IJE B;  3MYT A;  1AR0 A;  5JBS A;  4HM8 B;  4MJD A;  3GZR A;  1QAF A;  1JB2 A;  3SLU A;  4N6U A;  1AV4 A;  1ZO2 A;  4TX4 A;  3CC7 3;  1Q81 4;  6STD A;  1LXE A;  4N6V 0;  1RRL A;  2P09 A;  1W2Z A;  3CCR 3;  1YGE A;  3UL5 A;  3GZY B;  3NM7 A;  3RDE A;  7STD A;  4CDL A;  4XB5 A;  1N5H A;  2PNC A;  1GS3 A;  3BNE A;  4R80 A;  2F86 B;  5D83 A;  1SII A;  2RGQ A;  1HU9 A;  3N54 B;  4JRF A;  2WO0 A;  5IEN A;  1K28 A;  2WGQ A;  3WA3 A;  5DRV A;  1CYV A;  2CC3 A;  4Q53 A;  1N8Q A;  3U1W A;  3FZW A;  3BNB A;  5I97 A;  3K7C A;  3B7C A;  3AMO B;  3FGY A;  1IK3 A;  1PFP A;  4WWU C;  1QMA A;  2K54 A;  3X3X A;  2CWU A;  3HI7 A;  1JJ2 2;  3NM2 A;  4R4K A;  3IPT A;  3SED A;  2A15 A;  3OX9 A;  1NU3 A;  1FGO A;  4IIA A;  5A0O B;  1G96 A;  3OV4 A;  3EE1 A;  3MKI A;  1SQW A;  4HM3 B;  3OW2 2;  4STD A;  4X2H A;  4HJL B;  1N8R 4;  3CNX A;  2HML B;  2D1W A;  1ULJ B;  3S5C A;  3U97 A;  3S29 A;  4EBG A;  2XH9 A;  4OK0 A;  1JN5 B;  3EJV A;  3QRD A;  1RJO A;  2BHM A;  2OWP A;  2STD A;  1WMP A;  3M8C A;  3PYJ A;  1BUQ A;  5JPU A;  3KE7 A;  1A2K A;  1QAK A;  4HYZ A;  1U8C B;  3B8L A;  1TP6 A;  2KCD A;  3CPO A;  3F7S A;  3GZB A;  4XM4 A;  3NBR A;  3UB1 A;  2CFK A;  3F9S A;  1UI8 A;  2XSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...