4O4BB

Crystal structure of an inositol hexakisphosphate kinase ehip6ka as a fusion protein with maltose binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
EENLYFQGSFTDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein family 1
publication title IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/transferase
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 2.7.4.21: Inositol-hexakisphosphate kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4o4bB00
2A98A 1W2CA 1W2FA 1W2DA 2IF8A 4O4BB 4FRFA 2IEWA 1TZDA 4O4FA 4O4CA 4O4DA 4O4EA 2AQXA
chains in the Genus database with same CATH superfamily
2A98A 2WQEA 5C8NA 1U5RA 3ZFMA 5CNOA 3IGGA 1E9HA 4L53A 2PMIA 3O8UA 3Q3BA 4CRSA 5BX0A 2X2KA 4GCJA 2J50A 4O1OA 2PWLA 4DLJA 3IGOA 3R8VA 4F4PA 4YLJA 4FKLA 4EKLA 2WELA 1ZYJA 4A9YA 3E7VA 1J1BA 3OCGA 2W05A 2YJRA 3T3VA 1WAKA 3SVVA 1BLXA 4BI0A 3QU0A 4U40A 1OKWA 3VJNA 2VWZA 5H8GA 4BDGA 1H25A 3EYGA 4NM3A 2GNGA 1JNKA 2FYSA 1R1WA 4FSMA 4IADA 2YACA 1FMOE 5B2MA 5LVPA 2R3OA 3LLTA 3CP9A 1KV1A 4FTRA 2XNMA 2ITTA 4DBNA 4JG6A 3FZTA 2ZJWA 4RIYB 5AAFA 4PX6A 3OFMA 2GS2A 3GI3A 2C6MA 1SMHA 4KSPA 4AGWA 4BCJA 1I09A 5I5ZA 3S1HA 4DGLC 1PXIA 4FMQA 4RJ3A 3WIGA 4L44A 3CPBA 4HGLA 4QP2A 3TI1A 4YJPA 2QO7A 4L7SA 5CI6A 2A1AB 4YZCA 3VRZA 4IAKA 3F7WA 2JBPA 3PZEA 2X7OA 5E8UA 3FHIA 3R8MA 4UWCA 4YC6A 3EKNA 2DS1A 3CQUA 3ZM4A 2UZDA 3G33A 2HY81 4APCA 4C36A 3LE6A 1MRYA 5BVKA 1PYXA 5DEYA 4F9WA 5FQDC 3DK7A 5E92A 3ZLWA 3IDBA 3KN6A 3TZ8A 4WG5A 1KE8A 1E1VA 3HV7A 4ZZOA 4YPSA 4TYHA 2IVSA 4ZTMA 3PYYA 4EH2A 2JIUA 2XIYA 3A4PA 4F1MA 4FNYA 2PZ5A 5AUWA 4O4EA 3A7FA 4AZTA 5HU3A 3LFAA 3CXWA 2Y4IB 5CWZA 3FL4A 3SQQA 3Q4ZA 5JGDA 2XYNA 4HVSA 2RGPA 3DU8A 4OTPA 1OIYA 2VAGA 1XH6A 1AGWA 3QUEA 4RFYA 4W8EA 2PL0A 1YOJA 2IF8A 2AC3A 4O6LA 4GT4A 2X8IA 2WTCA 3P78A 4CTCA 3C4EA 2C3IB 3IW5A 3JXWA 2QOOA 1M2PA 1O6LA 3UE4A 2IO6A 3ZBFA 4D58A 3ZC5A 5CF6A 2OW3A 1WBTA 3KXHA 2QO9A 4II5A 4C8BA 5DVRA 3U6JA 3OCBA 3MVLA 1KE7A 4TPTA 3LJ0A 4J1RA 5ANIA 2PZRA 2PVJA 4MNEB 5C27A 5JN2A 5EM8A 5L2TA 4KS7A 4V0GA 4X7QA 3QLGA 3C1XA 4FT0A 4U6RA 4X6QC 4FA2A 1YHVA 3QQHA 5FEQA 3QTZA 2C6EA 4PMTA 2UZTA 3UBDA 3VO3A 3D0EA 5JT2A 3DT1A 2XIKA 4RT7A 3FZ1A 4C3FA 2XKFA 3OY1A 3OT3A 4HNIA 5KKRB 3PXYA 5AR2A 3QD3A 2UZEA 4BYJA 3BBTB 4E73A 3ZXTA 3NNVA 3AD5A 3E63A 3TN8A 3CLYA 4UBAA 4AE9A 3IG7A 3KULA 4LUEA 3RTPA 4LGHA 3EQDA 4DFLA 2VWBA 5I9YA 4FK3A 4TW9A 3W10A 2QU5A 4IX6A 1H01A 5BUJA 2XJ2A 4O0TA 5IPJA 4NKSA 2FSTX 3HV3A 5J9ZA 4JAJA 1KE6A 4IWDA 4G31A 3V8SA 3DB6A 4BRXA 5IMXA 4FV9A 3KFAA 4MXZA 3KN5A 3PY0A 4D4YA 3FLWA 1H1WA 2F4JA 5HIEA 2ZMDA 4GV1A 2QODA 4BWPA 4JS8A 1CM8A 5DT3A 1O6KA 1YHSA 1W82A 2CGUA 2GTNA 4NTSA 4TYJA 3SW4A 2WKMA 3HEGA 3AOXA 5FP6A 1O6YA 3NNXA 3B2WA 3OHTA 4U44A 4N70A 3C4FA 3WZUA 5EG3A 3RZBA 4E3CA 4HCUA 2X2LA 4LYNA 1A9UA 3G9LX 3IOPA 3U4WA 3VW6A 5J5SA 3OT8A 1QPEA 4TYHB 4PL5A 3QTUA 1DAYA 3KGAA 4R5YA 3RPRA 1P5EA 3PWDA 1OL7A 3LQ5A 4RRVA 3RK9A 1NA7A 2WIPA 1OKVA 4EOLA 4B6LA 4EONA 2C47A 3ORMA 4QNYA 5G6VA 5AA8A 2P3GX 5K0KA 2W17A 3BWJA 2JFMA 3QHWA 2BR1A 5F4NA 2YZAA 3O2MA 4QMMA 2V7OA 3MY0A 3Q04A 4RFMA 5EM5A 4FKRA 3TUCA 1M2RA 4J52A 5FEDA 2BDJA 3F9NA 1H00A 1URWA 3PPKA 5J87A 3RM7A 3EL7A 4GFOA 3M2WA 5F9EA 2PMLX 4AGCA 4OTHA 4RJ5A 3GB2A 4ERWA 5AP1A 4ID7A 1W0XC 2VN9A 4GG5A 4M7IA 3IQ7A 4EOQA 5BVOA 3JY9A 2Y6OA 2GMXA 3S95A 2XK6A 3WF5A 1BKXA 1BL6A 3RCDA 4I5CA 3ZRMA 2YIRA 3LCKA 3VUMA 3DKCA 3N9XA 4F7NA 4V0GB 4TL0A 4RGJA 4CZUA 3BGQA 2PZYA 4QQCA 4D9UA 1PXPA 3WE8A 4QYGA 4AA4A 2X8DA 4IX5A 3AXWA 2XRUA 2Q0NA 4TXCA 3D5VA 2J6MA 4GIIA 4IC8A 3R7UA 4D2TA 4RIWB 4KD1A 4F0FA 3ZFXA 5HX8A 3C0HA 5CYIA 2P2IA 5LARA 4N4SA 2X0PA 1F5QA 5D1JA 4E6QA 3FBVA 1TZDA 3CJGA 4BBEA 4P2KA 4AXAA 2HIWA 5E8WA 1JAMA 3KULB 4NK9A 4D1SA 3K2LA 5EYMA 3ROYA 4M66A 5FLFA 3HGKA 4CFNA 2C30A 4U42A 4D4SA 4G9RA 4M67A 5AM6A 5JZJA 3EFJA 5ETFA 3I60A 2PZIA 1UKIA 3F2AA 4AN2A 4EHEA 1WVYA 2WU6A 4FNXA 4N6ZA 5AX3A 4ANLA 3T8OA 3VBXA 3MW1A 3U6IA 2AC5A 2J9MA 2JITA 4F0GA 4S31A 3KRWA 4M84A 4YUQA 2NPQA 1ZMUA 1ZYSA 3V5WA 4EHGA 3R7GA 3Q52A 5KMNA 2C6OA 4D2SA 3VIDA 2Z2WA 4E1ZA 2QOHA 4C4IA 3PG3A 3NUNA 3SXSA 3R9NA 1V0OA 3FMMA 5IH6A 3SOCA 1KE5A 2R3LA 2QOQA 2GCDA 3I81A 1YDTE 5GJDA 4EC9A 1U46A 2JDOA 2W5HA 3QKKA 4Y46A 4GL9A 4I4EA 3II5A 2UVXA 3HMIA 2XB7A 4K0YA 4V04A 3E8EA 2XIZA 4RFZA 1UU8A 3TNHA 1PMUA 4L67A 3ZO2A 2VO7A 3BZ3A 5HNGA 3VHKA 4BI1A 3SAYA 4E93A 3P4KA 3G6GA 4AE6A 2CSNA 3PLSA 2ZYBA 4IMYA 5IEXA 4JVGA 2Y6MA 4O0RA 1URCA 5KHXA 1K9AA 2X0OA 1ZARA 2RFNA 2UZOA 5B2LA 3N51A 4FNZA 4LOQA 3W32A 4O0SA 3HRCA 4BHNA 2OFUA 1CKPA 1QPDA 3FMKA 4DG2E 1Q4LA 3EQFA 2IW8A 3WI6A 1LP4A 2BRBA 5LVNA 4QYFA 5EOBA 3PVUA 3TKHA 2QKWB 4I6HA 3V5QA 5HZNA 4F63A 4CFFA 3ANRA 4KKEA 3FLNC 1ZMWA 2Y4PA 4JAIA 5JH6A 4LRMA 1XH8A 3TTIA 4GVAA 1JQHA 2IW9A 4ANQA 4DH1A 2LGCA 3PY3A 3UYSA 3GCSA 2GNFA 2PMOX 4CKIA 1Y8YA 3OBGA 1BMKA 1UA2A 4XG4A 3GNIB 2C6LA 3LHJA 4G9CA 4M3QA 4BDEA 4FL1A 2VTRA 4IW0A 1ZY5A 2J4ZA 4LL5A 4XV9A 1SYKA 2IZSA 2X6EA 1YXTA 3Q5ZA 3ZXZA 2VO0A 4L01A 2X4ZA 2R7IA 4HYUA 4FZFB 3MBLA 4AZVA 2WO6A 2EXMA 3MSSA 4C33A 4RX5A 4J98A 3MVMA 3PIYA 4ANBA 2WMTA 4U81A 2BRMA 4FTIA 4ZSGA 3PJ8A 4C3PA 5JGAA 4CLJA 4P4CA 3HL7A 4QRCA 3LJ2A 2W1EA 3AC8A 3NR9A 4HYHA 2BKZA 4NEUA 4IDTA 4AW2A 4L9IA 1J3HA 1BI8A 4MD7E 3PJCA 5HCYA 2EWAA 4N0SA 4RX7A 5B2KA 4FVPA 4YJUA 4EUUA 3S3IA 4Q9SA 1SNXA 2OXYA 3PG1A 5J95A 3BPRA 3R9DA 3HP5A 2QO2A 4ASEA 4JX3A 4AU8A 4BI2A 4UWBA 3V5PA 2BAJA 3FMEA 4FGBA 4G3EA 5EDPA 3QTSA 3CS9A 1B38A 4GK4A 5T68A 4PQNA 3M1SA 4X2KA 1FVVA 3KQ7A 3DKFA 1YI3A 5L6PA 2XK9A 3OWKA 1REKA 3F5XA 2HOGA 3QTIA 2X7GA 5CXZA 3AT2A 4C58A 5ITAA 4A9SA 3AG9A 1WBWA 4MXCA 4JQEA 2AUHA 4JR7A 2OH0E 5D41A 4GYGA 3S2PA 4ANOA 5K4IA 4JLCA 3P86A 5FTQA 5TR6A 4ZTSA 1M7QA 2YIYA 2RFSA 3COMA 3NUYA 4QD6A 3H3CA 3VF9A 4EK4A 3R73A 4EOJA 3H0ZA 3OXIA 4HW7A 3R1YA 2W4JA 5CAUA 3R71A 4J71A 2WIHA 5DG5A 5JEBA 2CGVA 4UYAA 4D4RA 3VUHA 4BCIA 4U8ZA 4TWOA 1R3CA 3QTXA 2JKKA 3WE4A 1RW8A 3AC1A 3D14A 3DNEA 4U7ZA 4ZJJA 3PIXA 2R3JA 3TL8A 2WQBA 3LIJA 4L68A 5CSHA 3LFNA 5AV1A 5GZ9A 4CQGA 4AP7A 4FKPA 5M4IA 5JFXA 3G51A 4EQCA 5AUVA 5AIRA 4JDKA 1G5SA 3A8WA 2WMAA 2WMSA 5M4CA 4NM0A 4KKHA 3NW6A 4YNOA 4I94A 3QZFA 2UW5A 4FL3A 2B52A 1HOWA 5AMNA 2G1TA 4FX3A 2YM6A 1UVRA 4ZLYA 2V7AA 2UUEA 5GZAA 2R0IA 4W4XA 3QLFA 4GT3A 3R22A 3OBJA 1H28A 4CFUA 1PMNA 4PDOA 4P7EA 4PL4A 3LFEA 2JAMA 3FXWA 4PL3A 4PMMA 2HW6A 2R9SA 5KE0A 3A7HA 1ERKA 4FT3A 1Q5KA 1V1KA 1WCCA 4AT3A 3GENA 1Q8ZA 3V6RA 1BL7A 2V0DA 2WEVA 3Q5IA 3WOWA 1UWJA 3RWPA 5H3QA 4G16A 2YWPA 4ALWA 5HEZA 4CT2A 2OK1A 2I40A 4XP2A 4WIHA 2QURA 4FTQA 4EOSA 1ZXEA 3PWYA 4PY1A 4A7CA 3ZSHA 5IEVA 5JFWA 2I0VA 3FI4A 5AUXA 5AV2A 4RBLA 5CU0A 3R63A 4IQ6A 5EM6A 4MKCA 2CHLA 3QCYA 4PTEA 5HU9A 5HLWA 2J0MB 3CBLA 2WMVA 3NZ0A 4X3JA 4MYGA 3R02A 4IM3A 2VO3A 2WMRA 5EYCA 5BVEA 3UO5A 3EFWA 5JFSA 3DLSA 2BUJA 1S9JA 3TZ7A 3MY1A 5HX6A 3G2FA 3UVPA 5L3AA 5A9UA 5HORA 3V5TA 4DCEA 5AM7A 1PXOA 2HYYA 2ITXA 5E8VA 5J9LA 3FLQA 3NDMA 3BE9A 5TOZA 1XJDA 1DM2A 4AGUA 4YZBA 3W2QA 5B0XA 4G6OA 3L8VA 3C4CA 4JOAA 3NUXA 4FKJA 3W2CA 2FH9A 4M14A 2OF2A 4FTLA 4B8MA 4D0WA 2YCSA 5I4NA 4UB7A 1MRUA 2HZ4A 3KVXA 4OTFA 4Q2AA 4EOOA 2VNWA 5IUIA 3ORIA 1WZYA 1UNLA 3PA5A 2YCRA 5BMMA 5JQ8A 3BKBA 1FVTA 4PV0A 4JDIA 4O4DA 3GOKA 4M97A 3MS9A 5HQ0A 4FSZA 3TV4A 3JPVA 3CTQA 3UNJA 4BHZA 4ZSAA 5LCJA 2RG5A 4ZZNA 3Q32A 2O2UA 2QKRA 1IR3A 4RZVA 4AOTA 4E4MA 4EQMA 1JVPP 4DH3A 3BYOA 2VTTA 5E7RA 4EK8A 2C5XA 2NRUA 2B7AA 2W4KA 3LCSA 3MB6A 4FTCA 3BU6A 2C68A 3R9OA 4GIHA 1NXKA 4AZFA 1P2AA 3PP1A 4QTAA 4UXQA 2R64A 3VS0A 1J91A 4CKJA 2B54A 4FIEA 4O2ZA 3VNTA 4OAUC 2XNEA 3ORPA 2RL5A 1YXUA 1XH7A 3ZS5A 1MQBA 3SW7A 3PTGA 4IAIA 4FT5A 2EB3A 2BCJA 2BZHB 4NFMA 3ITZA 3KXXA 4IWOA 5D9HA 3RHKA 5G1XA 2QLUA 3TUBA 3CQEA 5BYZA 1ZOGA 1Q3WA 4BDKA 3CTHA 4YJQA 3A2CA 4QMPA 2WEIA 3R28A 5CENA 2WTDA 4EZ5A 3ZUVA 5FM2A 5IEYA 3ZHPC 4Z55A 2WTKC 2ONLA 1KE9A 4ACDA 2WMBA 2YM3A 5DNRA 5GJFA 4ASDA 5GHVA 2XNGA 1W2FA 4BCHA 4YTIA 4BF2A 3G90X 4DGMA 1BI7A 4XRJA 2XS0A 4RIOA 3SXFA 2PK9A 2BIKB 4ZJVA 3VF8A 4S30A 4JBVA 4NJ3A 2HWPA 3GFEA 4FK6A 4I0TA 4BTKA 1P4FA 2QD9A 2PVYA 3VS4A 5L8LA 3E64A 4IB0A 4U41A 5AADA 4HVIA 2QG5A 3UYTA 5BVDA 1OB3A 5BYYA 4NT4A 1KV2A 4CFVA 2Z7QA 5FRIA 4A9RA 2R3RA 3FAAA 1XQZA 3F2NA 4M15A 4QTCA 1OUKA 3AQVA 3QX2A 1FGKA 4J97A 4V01A 3LCTA 4M13A 3TWJA 4I20A 2OH4A 4XP3A 4NCTA 3A61A 4NW5A 3GCPA 4FG7A 5IA3A 1A06A 2Z60A 3DCVA 3EQRA 4FV6A 5CAQA 5HE3A 4J7BA 1GZNA 2PE0A 3IK3A 2G01A 3Q9YA 3TACA 3NUUA 4TYIA 1VEBA 2XEZA 3WZJA 4UX9A 3OF0A 1U54B 3HV4A 2BAKA 3HUBA 4L52A 3QGYA 4XUFA 3RAHA 2CLQA 5ANKA 1ZOHA 2YM7A 3GOPA 3MWUA 3D15A 4J53A 3ZO4A 4UMUA 4CMUA 4G17A 3E8NA 4CYJA 4ASZA 3VS7A 5E8SA 1Q62A 5C01A 1RQQA 2OIDA 5D7VA 2ZAZA 1XBBA 4ZTNA 2PVNA 3D2KA 5HE0A 3BHUA 4OTQA 4X2FA 3D4QA 3EQGA 5BVWA 2IZTA 4F7JA 1H1PA 4OT6A 4ZS0A 4NIFB 3K5UA 4JBQA 1FMKA 3ZEPA 2RKUA 1H1SA 2VWXA 2C6TA 4BBFA 4LL0A 4QQ5A 4NWMA 2WMQA 2A4LA 3K5VA 3D83A 4DLIA 1UU9A 4QP7A 2JAVA 3DAKA 2JGZA 4JT3A 4L45A 5EKNA 4YR8A 3I5NA 4USFA 4IJ9A 5C03A 4C62A 1REJA 3HNGA 4C3RA 4O0VA 3DGKA 3KRLA 2V22A 2VGPA 3HUCA 4FOCA 2P55A 4GEOA 3W2RA 4IWPA 4D5KA 4C7TA 3RPYA 3C7QA 4GSBA 2WQMA 4WKQA 4K6ZA 4BDDA 1S9IA 3ULIA 5L2SA 5HTIA 2O8YA 3QWKA 5E8XA 2P4IA 2OZOA 3BU5A 3MVHA 2F49A 4TWCA 4YJSA 4E6DA 3AC2A 3B2TA 3EFLA 3LFSA 3Q60A 4IZYA 4ZTRA 2C0TA 3TV7A 2ITPA 4EH4A 4X3FA 2GNHA 2UVYA 4LV5A 3Q6UA 2O0UA 4I21A 3ELJA 2EXEA 5DFPA 5FBNC 2PVKA 4O0YA 4QP3A 1O9UA 1DI9A 2VWUA 2PMNX 5FEEA 5LWMA 5M4UA 1ZZ2A 4DEDA 4IB3A 3FQHA 4BB4A 2XK8A 1ZYLA 3H9RA 4PDPA 2I0YA 3ZZWA 3AC3A 4MK0A 3CGFA 3FKNA 4RJ7A 5AUYA 2C4GA 4KIKA 4HPUE 5CU3A 1JSTA 4ENXA 3R7IA 1QPJA 1VZOA 4Y83A 3VUIA 3BQRA 1OL5A 3L8SA 2XKDA 2R7BA 3NAXA 4PMPA 3SKCA 2IVUA 2JD5A 2YJSA 2Y4IC 3MGYA 5BVNA 2A27A 1NY3A 3IECA 3O0GA 4MWHA 3QTWA 2F7ZE 2J0IA 4E5AX 5AV0A 2QONA 3BX5A 3QKMA 4CNHA 2W1IA 3G0EA 4BGQA 2YHVA 2E9OA 1UKHA 1HCKA 4EH7A 2X4FA 3PXKA 4MEDA 4NTTA 3TXOA 4RZWA 3GC8A 2J0JA 2Z7LA 4DG0E 4QTDA 1XWSA 2FGIA 4WRGA 1PXMA 1H08A 3QQLA 4E6CA 4O2PA 3VAPA 4ITJA 4KSQA 2F2UA 3KRRA 4WNPA 2G9XA 2VWYA 3GC9A 3RJCA 4BDIA 5IA2A 5A54A 3R1QA 4Q5EA 4GJ2A 3L9NA 3VUGA 1OVEA 4C0TA 2R3NA 4DGNA 3BRBA 1JLUE 5ANOA 1DS5A 5ANEA 5HBEA 4XS2A 4NFNA 3TNWA 5LVMA 1GZKA 5KKRC 3H0YA 3R0TA 2B4SB 4QYYA 4TYGA 4WD5A 3RPVA 1ZYCA 2ACXA 4ZZMA 4DH8A 2PE1A 4TN6A 4XH6A 4YNEA 3E3BX 2VTOA 1H4LA 2J0LA 3RMFA 3HX4A 5CI7A 2OZAA 3E3PA 3GT8A 3MFTA 3ANQA 3BHVA 1CTPE 4OBPA 4CEGA 5L8JA 1W7HA 4AF3A 2BFXA 2YIQA 4I0RA 3ZLSA 3FYJX 4FKVA 2FSMX 4KIPA 5HG8A 4FKQA 2XYUA 5FXRA 2X6DA 1ZYDA 4DEEA 4MAOA 3ODYX 4KS8A 4EZ7A 5D12A 3GC7A 3RHXA 4K8AA 4X3FB 4YSJA 4JRVA 5A4TA 5AV4A 3OWLA 5CEIA 4XEYA 4QQJA 3WILA 2R3GA 1W84A 3Q6WA 3IS5A 3QF9A 5EDQA 2QI8A 4ZSLA 1YWNA 5ETIA 3TZ9A 2JLDA 1XR1A 4PPCA 4MNFA 4XG2A 3FMNA 4ZXTA 4NM7A 4U0IA 4LRKA 3C50A 3OUNB 3LQ8A 3RBWA 4KIKB 5AP0A 4QMZA 2JC6A 3QQJA 4FG9A 3UQFA 4R3PA 3DZQA 3EZVA 2RFDA 3FPMA 2B9JA 3TZMA 3VRYA 5C26A 3AMBA 4I22A 5F95A 4EYJA 4EHZA 5H2UA 3AD6A 3QC4A 4IAFA 3E92A 3E87A 4I5HA 3W8QA 1OUYA 5ETCA 3UJGA 4IDVA 5IMEA 2FSLX 3R04A 5CSXA 5L2IA 2ITVA 1YVJA 2XNBA 3F61A 3PE1A 3M11A 2WMUA 3QCXA 2B9FA 4FSYA 5JZNA 2V55A 3H9OA 3D7ZA 4KIOA 4I41A 4LV8A 3WYXA 4MHAA 3SLSA 4H36A 5CS6A 3R1SA 2UW3A 2WD1A 3RPSA 4CZYB 4IZAA 1OKZA 2H96A 2EB2A 2R3MA 5J7HA 4XBRA 3OVVA 1CDKA 2ETMA 4GK3A 3A8XA 5J1WA 1IEPA 3UQCA 4R5SA 3OW3A 1GAGA 3OS3A 5A4CA 2OSCA 1F0QA 2OKRA 5CT0A 3GBZA 3V5LA 2P0CA 4W4YA 4TTHB 5KMMA 2VU3A 2IWIA 5JFVA 3GUBA 2RG6A 4U45A 4ZY4A 4FF8A 2X0GA 4E26A 4DEIA 3FJQE 5KZIA 1OPJA 3E88A 5A6NA 4YJTA 2P2HA 3MH3A 4YJOA 4OBOA 3DQWA 2OZAB 3HKOA 3EYHA 5IF1A 3C9WA 3NYVA 3CD3A 5DT4A 5EFQA 3W33A 4BCOA 4WG3A 3KK8A 5HIDA 3PIZA 3SDJA 1M14A 3U87A 1BYGA 4RVMA 2A2AA 4L7FA 5DH3A 3NGAA 4BFMA 2BFYA 2IJMA 1JKSA 3ODZX 5TT7A 4XG3A 4KRCA 3ZYAA 4C61A 2R3IA 4YGAA 3DV3A 3OOGA 4RJ4A 5FD2A 3QA0A 2JDSA 1JBPE 4DAWA 1WBOA 2WQOA 4EWHA 2WMWA 4ZEGA 2XNNA 3FXZA 1Q97A 2W1DA 4XP0A 3BYVA 5E91A 3MB7A 3LOKA 4AW5A 5AR3A 4P5QA 4DEHA 4MWIA 2F57A 3I6UA 4UMQA 5FXSA 3S00A 5I9WA 2G2HA 3PUPA 2BAQA 2Y9QA 2VTAA 3D5XA 3ERKA 4WNOA 3EWHA 4KIQA 3MPAA 3CEKA 4I92A 2G2FA 3NUPA 4LUDA 4YBJA 3COKA 4G5JA 4AT4A 3FSKA 3BELA 2B9HA 3KMUA 3VUTA 2A19B 2CGWA 2R5TA 4BCPA 5AUTA 1Q99A 4E4LA 2SRCA 4WUNA 2ZV9A 4UZHA 4G3CA 5E8ZA 1I44A 1ZOEA 4PTCA 3GXLA 4KBCA 2QVSE 4CD0A 3PY1A 1YDSE 4C34A 1W2DA 3I7BA 1LUFA 5C8KA 4LOOA 4X0MA 3ZUUA 4FIIA 1FINA 4QPMA 5EM7A 4AACA 2C3LA 3IKAA 5IDPA 4WUAA 5DRBA 4AUAA 2YFXA 4IM2A 3W2SA 4USDA 1JOWB 3ENHA 3A7GA 1QPCA 1OPKA 4XV1A 3FY0A 1V0BA 2UV2A 3GQLA 5LXMA 3VHEA 3LCDA 3U9CA 2P33A 1RE8A 5IA5A 2F7EE 4HZSA 4AA5A 3RPOA 2H8HA 1OGUA 2QR8A 1Z5MA 2XJ1A 3CQWA 3OWPA 1WBSA 4ZK5A 4ANNA 1OIQA 1MQ4A 4EEVA 3P08A 5KUPA 4F08A 2CGXA 1UU3A 2C6KA 3E5AA 3HVCA 2YIXA 3B8QA 4H3BA 5HCXA 3DBEA 5AP7A 4D0XA 2QOIA 3TKIA 3Q2MA 3HRFA 3FSFA 4V05A 2JKOA 5ACKA 4BTFA 2J7TA 2X39A 4JDHA 1YI4A 2W1GA 4DGGA 3LFDA 5HNBA 5BUIA 3P7CA 3C0IA 5JRSA 4XCUA 4ACCA 3RAKA 4C4EA 3UPZA 2R3FA 3GC0A 4RX9A 4RVKA 3HMNA 3HDNA 2YCFA 4MXOA 4FV5A 1STCE 4ENYA 3PP0A 3CD8A 3DXNA 5HVJA 3UGCA 3DA6A 4FTKA 3R7EA 3KXGA 4FT7A 3DBFA 2PTKA 3QD4A 2DQ7X 4NH1A 3ULZA 4L8MA 3ZRKA 1YXSA 4IZ7A 2VUWA 4A9UA 2YDJA 4IVDA 4IHPA 4X6RA 2J0KA 3RGFA 4MQ2A 4TNDA 5JMSA 5HNIX 4FL2A 3P0MA 4H1JA 3MJ2A 2J5EA 5F20A 5DT0A 5CT7A 4MXYA 4YLKA 4O91A 3UNKA 3QALE 4BGGA 3CTJA 1VYZA 4YPDA 4G3FA 2Y0AA 2HCKA 1XH9A 2QNJA 5A6OA 3FI2A 2OIQA 3U6HA 1DI8A 2X2MA 5HG5A 4XG8A 2WTJA 2UW4A 4M68A 4AN3A 3EMGA 4K1BA 1K3AA 3R21A 2VTSA 3F3UA 4IC7A 3DQXA 3U4UA 4ERKA 3IO7A 3CIKA 2PVLA 3PRIA 5DR9A 4Y5QA 2R0UA 3TJCA 3RAWA 4LMUA 3ORXA 2R3PA 3A99A 4I3ZA 5CQWA 4J8NA 5CQUA 2HXQA 4DEBA 3CC6A 1YDRE 3RP9A 4B4LA 3LXLA 3ACJA 4FKSA 5DWRA 5ETAA 4EOKA 3QZGA 3TTJA 4F65A 1UU7A 1TQPA 4JI9A 4CFWA 5LMKC 5BMSA 3QQFA 3AT4A 3POZA 5FP5A 4TY1A 2UZVA 3NCZA 2WTWA 3M42A 1ZWSA 4FIGA 3DY7A 4YZNA 4EC8A 4Z16A 4IAYA 3GVUA 4PF4A 4B8LA 4F0IA 1YQJA 2VV9A 2WFYA 4K9YA 2NO3A 1BUHA 2UZNA 4C2WA 1M2QA 2VTMA 2XEYA 5AAEA 3OUKA 1Q3DA 5CSWA 2YABA 2G2IA 3PVGA 3PJ1A 4FZAB 4UN0C 1H1RA 3NAYA 4LG4A 3ZCLA 5BPYA 2W7XA 5JSMA 4XMOA 4O38A 4CSVA 3ALNA 4BZDA 1FOTA 2IVVA 4BIBA 5CU6A 3BYSA 4YURA 4ACHA 2GS7A 2KULA 2QLQA 4EBVA 1OKYA 3QQUA 4UZDA 2O5KA 5JKGA 4S32A 2ITYA 3QD0A 3Q4CA 2B9IA 3V51A 1TQIA 5M51A 3ZMMA 4D2VA 4LRJA 2JDRA 4LI5A 4F6UA 1Q8UA 4I5PA 3R30A 3QRIA 2PHKA 1PW2A 3FC1X 3RNIA 4RVLA 4JDJA 5DPVA 1NVRA 2ITNA 4FEQA 1CMKE 1OIUA 4I4FA 5KZ0A 3I7CA 4F7LA 4X2JA 4EK3A 3OMVA 3WZDA 5C8MA 1TQMA 3EN9A 3NNUA 3ORLA 3QRUA 4U9AA 2GU8A 1ZLTA 1WVXA 1JKLA 1XH4A 2W9ZB 4BN1A 1Z9XA 3DJ7A 3FKLA 2ZM3A 3OC1A 4IANA 3KXZA 3O23A 1H24A 3HRBA 3H4JA 4BVUA 2GFSA 2UZLA 3DK3A 3HMPA 4U3ZA 4UYNA 4CKRA 2W96B 4IX3A 3NRMA 5AP6A 3BGZA 5FTOA 4GRBA 3FY2A 2ZVAA 3BEAA 4U43A 3MPMA 1KSWA 3I0QA 5ANDA 3LMGA 4CRLA 3BI6A 4G2FA 4R1YA 1PKGA 2C1AA 2Z7RA 4A9TA 2XCHA 3EB0A 3DB8A 4HOKA 4D9TA 2XM8A 4G5PA 5HVYA 1PY5A 4FSRA 3UOKA 1JSVA 2QOKA 1WFCA 5HLPA 4BWXA 4EI4A 2WOUA 1APME 3NIEA 4BZNA 2OJ9A 4QMLA 3TV6A 4EOIA 3EFKA 3LXPA 3F3WA 1UNGA 4YC3A 3UVRA 4FSWA 4JBOA 1Q61A 2HK5A 5TF9A 3EQCA 4OBQA 4DC2A 3MTLA 2OFVA 4PRJA 4Q5HA 3ZSGA 5K9IA 3ALOA 4FOBA 5GJGA 4JQ7A 4YMJA 1YRPA 1QMZA 3RVGA 4W4WA 2O63A 2YIWA 5TO8A 4IXPA 2ITOA 1FGIA 4OUCA 3VS2A 3NW5A 3PJ3A 3PE2A 3UG1A 4ZLOA 3DAJA 4Z3VA 2VO6A 1JKKA 3R2BA 4R6VA 4BBMA 3LFFA 2UW7A 3ZFYA 5I0BA 3EIDA 2O3PA 4D2PA 4MTAA 3NPCA 2IZRA 2J2IB 2OBJA 3MH2A 1P4OA 4QNAA 4ALUA 1U4DA 3O7LB 4EH5A 2AYPA 4FKWA 3BQCA 4MF1A 4KBKA 3PPJA 3NYNA 1PYEA 2W1CA 3ACKA 4GU6A 2X7FA 4B0GA 5I9XA 3QUDA 3WF7A 1V0PA 2XJ0A 2ZV2A 4XG6A 4DH7A 4M0ZA 2ZM1A 3UIUA 5AA9A 2JIVA 4NJDA 4O21A 5DRDA 2GQGA 4KINA 3FPQA 1GY3A 3O8TA 4RG0A 4MCVA 5AAGA 2ERKA 2JDTA 4RJ6A 2QHNA 3BYMA 5AV3A 2W5BA 4ALVA 5EK7A 2ITWA 2XIXA 3O71A 3QRTA 4E7WA 5HBHA 3GP0A 4C4GA 2ZV8A 5DBXA 3S0OA 2VX1A 4JX7A 2OJIA 2B53A 2ZB1A 3FZSA 2C69A 1Q8TA 4LGGA 2UW8A 2HZIA 3P5KA 3TIYA 3VBVA 4BTMA 4Y8DA 4F9YA 3W8LA 2VRXA 3D9VA 3QX4A 3V01A 2BZJA 4QP1A 4R3CA 2R4BA 4WHZA 2OIBA 5CU2A 3O51A 4IZ5A 4C2VA 2C3KA 4FKIA 3BHHA 1AQ1A 1VYWA 1Y57A 4I6FA 4RA5A 5M56A 4EH8A 2RF9A 3R01A 5K5NA 3RI1A 5E1SA 5E8YA 4L3LA 3VS6A 2QOCA 2YDIA 3VVHA 4BDJA 3BCEA 3VBTA 4QQTA 3W2OA 2HZ0A 3WARA 5FG8A 3QZHA 4XG7A 5HCZA 4QMUA 3ZH8A 3RK7A 5J79A 4KABA 3UG2A 4HCTA 4E20A 3HV6A 5ACBC 3LFBA 1ZAOA 1OECA 1JPAA 1SM2A 3IW7A 4K33A 3SX9A 4B7TA 3ZTXA 3EN5A 4YZMA 2WTIA 3PA3A 3RCJA 3TNQB 3UZPA 4BIDA 4L42A 2XNPA 3FE3A 4U97A 2CKEA 5IH4A 4DYMA 5AUUA 4JIAA 1CKJA 3C51A 3F5PA 4GUBA 3R83A 3CKWA 3MTFA 4F09A 3OEFX 4AG8A 3EQHA 2ETRA 4IVAA 5J5TA 4C4HA 3TNIA 4O4CA 5F94A 3U9NA 3KB7A 4EK5A 5C9CA 4XLVA 4FTNA 2BIYA 4QMYA 1OITA 2OGVA 3ROCA 3EOCA 4Y73A 3R7OA 4AT5A 4A07A 5KMLA 2XK7A 2ONLC 3MV5A 4J95A 3HMMA 4X2GA 3WF8A 4PP7A 4QP8A 1GZOA 4GFMA 4I93A 5HO7A 5LWNA 3FZPA 3QRJA 4YHFA 2HAKA 3D5WA 3WIKA 2OWBA 4CCUA 3FMJA 4O0WA 5A4EA 3EN7A 5HE2A 4AGDA 3E8CA 4IFGA 3WF9A 1YWVA 4EK6A 3D5UA 3FUPA 4XJ0A 5CX9A 1MRVA 4MD9E 2X1NA 1YKRA 2W5AA 4JRNA 3FMHA 4PTGA 4BKYA 4DEAA 1T45A 1H0VA 4BC6A 4Z7GA 4GJ3A 4ZAUA 2CMWA 2ITZA 4I1ZA 3FV8A 1Q8WA 5M57A 5GZ8A 4S2ZA 3KF4A 3QZIA 4BKJA 2PZPA 4NCTC 2ESMA 2JDVA 1IRKA 4G6NA 5H8EA 3V8WA 2YLFA 5AR5A 3GCQA 4G3DA 3D94A 5AR4A 4HVGA 4RQVA 5KMKA 1OZ1A 3K3IA 4G34A 4IWQA 3DK6A 4R1VA 2WQNA 3I6WA 4R3RA 2VD5A 4X21A 1E1XA 2W99B 2VGOA 4QMQA 2YITA 3WZEA 2BDWA 2W1ZA 4FSNA 4ONAA 4F1OA 4YTFA 5FDPA 3LVPA 2B55A 5FDXA 3CCNA 4Z7HA 1GOLA 3RINA 5IU2A 4FKUA 4QYEA 4BCMA 1K2PA 2CN8A 5AP5A 1YOMA 2R3QA 3FDNA 4AZWA 4GT5A 3FLZA 3HMOA 3TIZA 3MFUA 4EHVA 3U51A 4IE9A 4FC0A 5L8KA 4XOYA 1SVEA 4XNEA 3VWAA 3OP5A 5AP3A 4YU2A 2OICA 3FQSA 5D10A 2X81A 3O96A 1M7NA 2VNYA 2J5FA 3WZKA 5HD4A 3F82A 3MFSA 4O0XA 4C38A 4AQCA 4ITHA 4EKKA 2ZDTA 3HA8A 4FVRA 3L9MA 4YSMA 4WBBB 4D55A 2E9VA 1G3NA 4FUYA 4YTHA 2GNIA 2UVZA 3VUKA 4CQEA 4D5HA 3R2YA 1EH4A 3PXFA 4ACMA 4EQUA 3FQEA 2VTIA 3OY3A 1GIHA 1PKDA 3Q4TA 4CTBA 3A7IA 5IZFA 3CY3A 4O4BB 1LEZA 2A0CX 2VTQA 1UNHA 3EQPA 3FLSA 3MH0A 4FYOA 4MNEA 4EORA 4FT9A 5LJJA 4CLIA 2R2PA 5JGBA 5IH5A 3FMDA 5AWMA 1WVWA 2ZOQA 1OIRA 2XKCA 2WPAA 2CPKE 2OU7A 3DNDA 3I0OA 3EH9A 2EU9A 3OG7A 3QRKA 2UZBA 4IVCA 4X3FC 5FM3A 3UC3A 5H9BA 4YTCA 4AW0A 5CANA 3DKOA 4FSTA 2GHGA 4HJOA 4AW1A 4FYNA 3HV5A 4CV9A 5J9YA 5AEPA 4QMTA 3R8LA 5EHYA 4IM0A 4R8QA 3UODA 1LEWA 4E8AA 5IA1A 4OTIA 4BCKA 3E8DA 4S33A 5HG7A 3QAME 3I1AA 3G0FA 3NLBA 2CCIA 4ZTQA 3P7BA 1M17A 1R78A 4I5MA 2WB8A 4RPVA 3SV0A 1YI6A 1W98A 1KWPA 4I0SA 3COIA 4BYIA 3O50A 5AUZA 2JFLA 4FKGA 2FA2A 5KMOA 4HNFA 3CGOA 3DLZA 3KVWA 4HGEA 3BWFA 2CN5A 5LVLA 4CVAA 3BBWA 3LCOA 5K4JA 5J1VA 4OTGA 4BDBA 4F6WA 3UZTA 3VQUA 3BLHA 3KK9A 1TKIA 2XK4A 1XBAA 4RC4A 5CLPA 4LMNA 4BTJA 3COHA 2E9UA 3QQKA 1PXJA 4KWPA 4K11A 5EI8A 2GFCA 5CSVA 5DOSA 4TWNA 5CZIA 3P79A 4RQKA 2W4OA 4CYIA 2PVFA 3F5GA 4F70A 4RC2A 3HP2A 4AZEA 1T46A 4QP4A 5BVFA 3C0GA 3NX8A 5IKWA 2BDFA 2VWWA 4FKOA 4L46A 1H07A 3H9FA 4CMOA 3O7LD 4UMPA 3F3ZA 2O65A 2VX3A 4NW6A 3T9TA 2Y8OA 3Q9XA 2RIOA 2UW0A 2QOBA 2IZUA 3OW4A 4J8MA 3R1NA 4DFNA 4A4XA 4FV3A 5CAVA 2HWOA 5LVOA 5FWKK 4PMSA 2NP8A 5A4QA 3L1SA 2XF0A 3F3VA 2VZ6A 3EJ1A 3OEZA 4KA3A 4EZ3A 3DFAA 3GU6A 4FV0A 5JQ5A 4QTBA 3MI9A 2YISA 3SRVA 4DITA 4NKAA 3L8XA 2V62A 2OJGA 3AC4A 3VC4A 3A4OX 3KL8A 3QC9A 3KCKA 4JIKA 4AX8A 1FPUA 1JWHA 2C5YA 4H58A 2BALA 3BHTA 3UIMA 2BRNA 4HGTA 5HKMA 3ORNA 4HYIA 3WBLA 2BTSA 3UO6A 2IVTA 3DDPA 4FV1A 4RWJA 3QCSA 3V04A 2XM9A 2EVAA 4RIWA 3R7VA 3VS1A 4F9AA 4TYEA 3OTUA 5AP4A 5CALA 4OT5A 3DBCA 4CCBA 4AFJA 4C37A 2VWIA 4Q9ZA 3DTCA 3QYZA 3QA8A 4OTRA 3O17A 3MIAA 3PSDA 2GS6A 2ITQA 3LXKA 2XH5A 4CFMA 4E5BA 4UMRA 1H27A 4F99A 3BGPA 3KC3A 3FMLA 4XV2A 4EH3A 3EKKA 3CE3A 3NYOA 4FV2A 3L8PA 3TUDA 1IG1A 2OXDA 3C4XA 3LXNA 3V3VA 3DS6A 5CU4A 4GH2A 4ZY6A 5HO8A 3UP2A 4O4FA 5I9VA 3RKBA 1IA8A 5L6OA 4FKTA 1CKIA 4H1MA 4OGRA 3RZFA 3THBA 3Q96A 5HD7A 4H3QA 2XMYA 3P7AA 3GCUA 5M55A 4LOPA 3RM6A 4O22A 4YO4A 3JYAA 4AOIA 3FYKX 3LPBA 2F2CB 1JSUA 2IEWA 3G5DA 5DA3A 3KCFA 3KY2A 2E2BA 2OI4X 4ZJIA 2H6DA 4EOMA 4JL9A 3I5ZA 2I0EA 5CEPA 3CPCA 4DH5A 4XBUA 4XG9A 3R8ZA 4ASXA 1SNUA 4FBXA 5HGIA 3MN3A 4KB8A 4YZ9A 3BEGA 4FIHA 2WMXA 2Z8CA 4MF0A 1H1QA 4AA0A 4AOJA 2PY3A 1HCLA 3NW7A 4JG8A 3BHYA 4OW8A 4UXLA 5HBJA 5IG1A 3I4BA 2Y7JA 4MBJA 1Q24A 3NSZA 4FNWA 3NS9A 3ZONA 2DWBA 4BKZA 1B6CB 4JNWA 4MBLA 4FSQA 3AC5A 3QGWA 4DFZE 5J7BA 1QL6A 2JIIA 3W55A 3CY2A 2BTRA 2GSFA 3PSCA 2XKEA 3TEIA 3UC4A 5TE0A 3ZOSA 4EH9A 5KMJA 2PUUA 3EL8A 3QUPA 4IJPA 5HVKA 3IDPA 3AT3A 4IBMA 5HOAA 3O8PA 4NM5A 5CEQA 3UVQA 5AP2A 4U80A 2UW6A 3NCGA 2YCQA 4HCVA 4B99A 3Q53A 3SRVB 2XZSA 5M53A 5I3RA 4USEA 1OL6A 5HG9A 1JKTA 4WSQA 5D7AA 4I23A 4NUSA 5EOLA 4DGOA 5DR6A 4FV4A 4GG7A 4JQ8A 2XBJA 2OXXA 2UZUE 2WAJA 2FO0A 5HLNA 4WG4A 4F9BA 4GYIA 3LW0A 3ZSIA 4FODA 3EN6A 2ZV7A 4W4VA 1UV5A 4PNKA 2H9VA 1WBPA 5ICPA 4ZTLA 3LM0A 5HTCA 3MA3A 2GDOA 3VUDA 4KNBA 4GFGA 3UP7A 2H34A 2R3KA 4EWQA 1XO2B 5DEWA 4DTKA 3R6XA 1YW2A 2W0JA 4FI1A 4FV7A 2JKMA 4OTDA 4XOZA 3OOMA 3P1AA 2W06A 5M44A 1W2CA 2WGJA 4FTTA 3FI3A 2F7XE 3FZRA 4KAOA 5KO1A 3H10A 4YP8A 1H8FA 1X8BA 4W9XA 3D2IA 4TZRA 2FUMA 4D4VA 1LR4A 3C13A 3V5JA 3D7TA 1OM1A 4FRFA 4QMOA 2WOTA 4RVTA 2VWVA 2BHEA 4BIEA 4MD8E 5B7VA 1R0EA 2EXCX 3QL8A 4ZY5A 3SA0A 1SVGA 1Y91A 1WMKA 2RSVA 5AJQA 4AN9A 5KX8A 1OI9A 3DAEA 5IA4A 4EBWA 1PHKA 4O0UA 4FTJA 3DOGA 3SXRA 4M69A 4GW8A 4AAAA 3KF7A 5BUEA 4PNIA 2REIA 4GUEA 4QPAA 3RAIA 2OJFE 2FVDA 3VN9A 3B8RA 3A62A 3G6HA 4O1PA 1CSNA 2XCKA 5LCKA 3V6SA 4QP6A 4ZP5A 4BDHA 2HW7A 2UW9A 4FZDB 3OCSA 3T3UA 4IB5A 4MX9A 2PE2A 3BLQA 3QBNA 4NU1A 4PPBA 3K3JA 4Y5HA 5EYDA 3SD0A 3W2PA 3BYUA 4FICA 3DFCB 3HA6A 3ZO3A 4D1XA 1PMVA 4AWIA 2X9EA 3K54A 3MY5A 3WYYA 4EL9A 2I0HA 4CXAA 3FL5A 3R9HA 4P5ZA 4ARKA 3UIXA 2XRWA 1M52A 5FBOA 3DJ5A 3EZRA 5CEKA 5CF8A 3JVRA 4FUXA 2X0QA 3TCPA 3GU7A 4RJ8A 4C02A 2WU7A 3Q9ZA 4HZRA 2VTLA 1MP8A 4PUZA 4YJNA 5DI1A 5FGKA 5M4FA 5E1EA 5H8BA 4A4LA 3F69A 3F5UA 2WZJA 4L00A 4NSTA 4WBOA 4Z9LA 2FB8A 4IEBA 5LOHA 4XLIA 4K18A 4O27B 4GMYA 5CSPA 3E7OA 2GNLA 4M0YA 4G1WA 5EW8A 5CVFA 5CAPA 5LMKA 1Q41A 3FZOA 1GNGA 1ZMVA 4IVBA 3ZDUA 4ZTHA 5L6WL 4S34A 2ZB0A 3PJ2A 4K77A 2YN8A 4RIXA 4IAZA 2YAKA 1SZMA 4F7SA 4HVDA 1Z57A 5IUGA 5AR8A 4C59A 3DKGA 1ZY4A 4QP9A 2WTVA 5C1QB 4LFIA 2XP2A 3P23A 3QKLA 3ZUTA 3H30A 4EOPA 3C4ZA 3UO4A 3ZU7A 4FZ7A 1OPLA 2X9FA 4FIFA 4GS6A 4AS0A 5A4LA 4OAVB 4C57A 3REPA 2XK3A 3T9IA 2YEXA 4TWPA 2VTPA 3IDCA 1F3MC 1RDQE 4H39A 1YWRA 3R8PA 4WNKA 2ERZE 5DIAA 3POOA 5K3YA 2BRHA 4XYFA 2YA9A 1DAWA 3KXMA 3NUSA 4QMSA 3NIZA 3VBYA 5IISA 5EDRA 5EW9A 2CJMA 2ETKA 5IUHA 3PZHA 5D11A 5EHOA 3BE2A 3UOHA 4ZLZA 5ANJA 1W83A 4E4NA 2HENA 4OTWA 2HXLA 3MVJA 3PA4A 3D7TB 4ITIA 4RLKA 3U8WA 5CEOA 1PXNA 2PVMA 4DHFA 3FWQA 4F64A 3QYWA 4I24A 3FHRA 2QCSA 2YM8A 5DGZA 4MQ1A 4BICA 4IFCA 4RLLA 4YBKA 1H0WA 5EW3A 5A14A 2ZDUA 2XA4A 3QWJA 4E6AA 4M69B 5CF4A 2WNTA 3OTVA 5E90A 4WOVA 4Y85A 3GEQA 4JBPA 3EQBA 3HLLA 2XNOA 4FV8A 4WSYA 4CZTA 4RWKA 4HYSA 2Q0BA 2HY0A 3V8TA 1ZZLA 4FIJA 4FG8A 2YM5A 2C1BA 3NWWA 4EYMA 3RK5A 4JJRA 4D28A 3UQGA 4J99A 3UDBA 3TT0A 4UMTA 3NEWA 2IN6A 1OL1A 5DE2A 2GHMA 3AD4A 1PF8A 2E9PA 5I9ZA 5AR7A 4OLIA 3KA0A 1FQ1B 4L43A 4YLLA 5F1ZA 5EYKA 3OCTA 2BRGA 1J1CA 3KRJA 3OROA 4FSUA 4MXXA 5TKDA 4BDAA 4DN5A 3KRXA 3VS3A 4DG3E 4W9WA 5GNKA 4RWLA 1Q8YA 2J51A 2C0OA 4UV0A 4EJNA 5CXHA 3VJOA 1TVOA 2BVAA 4TKSA 3UPXA 5HICA 3VQHA 4CFXA 5K5XA 4TNBA 3F3TA 4K2RA 4BGHA 3EQIA 2XIRA 2EUFB 4I6BA 4UEUA 4QO9A 4BDFA 3IW6A 5DHJA 2DYLA 4FR4A 4XV3A 5HIBA 3WF6A 4RIXB 1OMWA 2PVRA 3IW8A 5CEMA 3ORTA 2GHLA 5CY3A 1QCFA 2OJJA 3FC2A 3NYXA 4I6QA 1NVQA 3R8UA 1U59A 4QPSA 3VS5A 4RSSA 2WHBA 3VW8A 2G15A 5EH0A 3TG1A 3ZO1A 5I3OA 3ZC6A 1Y6AA 5HO6A 3FLYA 3PSBA 2C5VA 5KCVA 5JK3A 3BLRA 2BROA 5L2QA 3IW4A 5EKOA 2C5OA 4B9DA 1VR2A 3HYHA 1GJOA 3MIYA 3OXZA 2W9FB 4BCGA 4QMVA 4UY9A 4BCQA 4CT1A 5L2WA 5J8IA 2OF4A 5KNJA 3C5UA 4KBAA 4ZIMA 3SC1A 5LMBA 1YXVA 3ZDIA 3L9PA 4MXAA 3LAUA 3DBQA 4GU9A 3KKVA 3OD6X 4P90A 3R7YA 4CV8A 3C4WA 1U5QA 4IX4A 3ORKA 4Y72A 5CVHA 5HESA 1KOBA 4KKGA 4IAAA 2C6DA 3RNYA 1MUOA 3JUHA 1IASA 4JR3A 3IPHA 3RALA 1B39A 4YC8A 3TKUA 4QYHA 2QQ7A 4GK2A 3MA6A 5CF5A 3S4QA 4G6LA 3TNPC 5A3XA 3W18A 3UMWA 5BQ0A 1KOAA 1VJYA 2JEDA 2XBAA 4IIRA 4HVHA 2OO8X 5CVGA 3TJDA 2XVDA 2W1HA 1NVSA 1U54A 5I9UA 5AIKA 3MPTA 2E9NA 2KTYA 2BZKB 3A60A 3AMYA 5CZHA 2AQXA 3F66A 4IACA 3DZOA 3SHEA 4KRDA 2PVHA 1YHWA 4RA4A 3AGMA 5HI2A 4E5WA 3E93A 3QXOA 1FVRA 2C6IA 3PXRA 3DJ6A 3F6XA 4J96A 5A46A 3GGFA 3W1FA 3OWJA 1P14A 3BV2A 2BMCA 1UWHA 3KMWA 3NNWA 4QMXA 4DFYA 5JRQA 4M12A 2VTJA 2YAAA 2Z7SA 3P9JA 5DN3A 1BX6A 5ANGA 1R39A 3ZBXA 2BHHA 4PDSA 4FZ6A 4APPA 1XHAA 3G9NA 1PXKA 3HECA 4NIFA 4X2NA 4QOXA 4QMWA 2GTMA 4MH7A 4UWYA 3R00A 3PPZA 1H26A 2FSOX 3FXXA 4YZDA 1SVHA 4C4FA 2X8EA 5T6KA 3CR0A 4XHKB 4EUTA 2BILB 4F6SA 3DPKA 5KBRA 5HTBA 1OL2A 4G3GA 2BZIB 5AX9A 4BL1A 4U5JA 5BNJA 4PPAA 4ZSJA 3JVSA 4LM5A 3LFQA 3F7ZA 4FTAA 1PMEA 2QU6A 2C3JA 2HZNA 3SOAA 4WRSA 4D2RA 4AFEA 3ENMA 4DFXE 4FVQA 5KMIA 2ZM4A 4HGSA 5EI2A 3KU2A 5T3QA 3UIBA 2VTHA 3EHAA 3LM5A 3BIZA 2LAVA 4RC3A 4AZSA 4L3PA 3PXQA 4MVFA 5DR2A 3PFQA 5KBQA 5HHWA 4FTOA 3IONA 3VBQA 1L3RE 3MDYA 5IA0A 4OR5A 4YJVA 4C4JA 5EHLA 4F9CA 3HZTA 5E8TA 3KXNA 4WT6A 1RJBA 2CLXA 3FKOA 3CKXA 3W16A 1R0PA 2YLEA 3QHRA 4RWIA 4O96A 3QXPA 4A06A 2B1PA 3GCVA 4ANMA 4W8DA 3AMAA 3LZBA 4ACGA 2JBOA 4HPTE 3Q4UA 1YXXA 3L9LA 2R3HA 3DDQA 4N6YA 4PWNA 4BCNA 4RX8A 2YERA 3ETAA 4GVJA 4U3YA 4YO6A 3QD2B 4JXFA 4F1TA 2ITUA 3JY0A 4R7HA 5IDNA 3ZLYA 4LQMA 4JG7A 4XRLA 2VX0A 3KEXA 2J90A 4DINA 4E4XA 1GIIA 2CCHA 2GPHA 3GU4A 2VTNA 2QC6A 2PSQA 4TRLA 2C0IA 4LGDA 2QHMA 4QTEA 3AGLA 3UOLA 2JKQA 4U79A 4Y95A 3MYGA 5DMZA 4IH8A 4ZSEA 3PXZA 5LMAA 3UTOA 3A7JA 3I79A 3PVBA 4R7IA 3MJ1A 1XKKA 4RIYA 4BZOA 3ZLXA 4BDCA 3UNZA 4FTMA 3ORZA 2O64A 2QOFA 2BPMA 2RFEA 3BV3A 3EN4A 3GU5A 4MBIA 4IB1A 4NZWB 3VULA 5K0XA 2GNJA 4RMZA 4WA9A 2WTKB 3DBDA 3DTWA 3KMMA 2NRYA 5DLSA 4O6EA 4BWKA 4QT1A 2I1MA 4M8TA 4WO5A 5CAOA 3UOJA 4YJRA 2W1FA 2I6LA 3QTRA 1Y6BA 2WXVA 3MH1A 3E62A 3OZ6A 3F88A 3LFCA 2QOLA 4L6QA 4UALA 3ZZEA 2C5NA 4ANSA 3GFWA 4D2WA 2F9GA 3RWQA 1ZRZA 4QMNA 1GZ8A 4CMTA 3QCQA 5FXQA 4A4OA 2IW6A 4C35A 1Y8GA 3ZRLA 4EH6A 4DEGA 4XX9A 4YHTA 2CDZA 5CASA 5L4QA 1LPUA 1WBNA 1XBCA 1XH5A 3BU3A 3HDMA 3QTQA 4ZOGA 1YOLA 4H3PA 4BCFA 1GIJA 4TT7A 3GQIA 3QQGA 4D1ZA 3VBWA 1W8CA 2V5QA 2XUUA 2ZMCA 3LJ1A 3UMXA 3ZEWA 1AD5A 5HE1A 2YM4A 3QFVA 2YDKA 1PJKA 4PP9A 4WNMA 4L3JA 4FTUA 1ATPE 2QR7A 3Q9WA 5LQFA 3OXTA 4YHJA 3JS2A 3PRFA 2OG8A 2UZWE 3ET7A 2HELA 5KHWA 5CTPA 2DUVA 3IOKA 3GU8A 3MFRA 1WBVA 3PVWA 5CNNA 3CJFA 5EI6A 1PXLA
chains in the Genus database with same CATH topology
2A98A 1W2CA 1W2FA 1W2DA 2IF8A 4O4BB 2X0OA 2X0PA 4FRFA 2IEWA 1TZDA 4O4FA 4O4CA 2X0QA 4O4DA 4O4EA 2AQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A98 A;  1W2C A;  1W2F A;  1W2D A;  2IF8 A;  4O4B B;  4FRF A;  2IEW A;  1TZD A;  4O4F A;  4O4C A;  4O4D A;  4O4E A;  2AQX A; 
#chains in the Genus database with same CATH topology
 2A98 A;  2WQE A;  5C8N A;  1U5R A;  3ZFM A;  5CNO A;  3IGG A;  1E9H A;  4L53 A;  2PMI A;  3O8U A;  3Q3B A;  4CRS A;  5BX0 A;  2X2K A;  4GCJ A;  2J50 A;  4O1O A;  2PWL A;  4DLJ A;  3IGO A;  3R8V A;  4F4P A;  4YLJ A;  4FKL A;  4EKL A;  2WEL A;  1ZYJ A;  4A9Y A;  3E7V A;  1J1B A;  3OCG A;  2W05 A;  2YJR A;  3T3V A;  1WAK A;  3SVV A;  1BLX A;  4BI0 A;  3QU0 A;  4U40 A;  1OKW A;  3VJN A;  2VWZ A;  5H8G A;  4BDG A;  1H25 A;  3EYG A;  4NM3 A;  2GNG A;  1JNK A;  2FYS A;  1R1W A;  4FSM A;  4IAD A;  2YAC A;  1FMO E;  5B2M A;  5LVP A;  2R3O A;  3LLT A;  3CP9 A;  1KV1 A;  4FTR A;  2XNM A;  2ITT A;  4DBN A;  4JG6 A;  3FZT A;  2ZJW A;  4RIY B;  5AAF A;  4PX6 A;  3OFM A;  2GS2 A;  3GI3 A;  2C6M A;  1SMH A;  4KSP A;  4AGW A;  4BCJ A;  1I09 A;  5I5Z A;  3S1H A;  4DGL C;  1PXI A;  4FMQ A;  4RJ3 A;  3WIG A;  4L44 A;  3CPB A;  4HGL A;  4QP2 A;  3TI1 A;  4YJP A;  2QO7 A;  4L7S A;  5CI6 A;  2A1A B;  4YZC A;  3VRZ A;  4IAK A;  3F7W A;  2JBP A;  3PZE A;  2X7O A;  5E8U A;  3FHI A;  3R8M A;  4UWC A;  4YC6 A;  3EKN A;  2DS1 A;  3CQU A;  3ZM4 A;  2UZD A;  3G33 A;  2HY8 1;  4APC A;  4C36 A;  3LE6 A;  1MRY A;  5BVK A;  1PYX A;  5DEY A;  4F9W A;  5FQD C;  3DK7 A;  5E92 A;  3ZLW A;  3IDB A;  3KN6 A;  3TZ8 A;  4WG5 A;  1KE8 A;  1E1V A;  3HV7 A;  4ZZO A;  4YPS A;  4TYH A;  2IVS A;  4ZTM A;  3PYY A;  4EH2 A;  2JIU A;  2XIY A;  3A4P A;  4F1M A;  4FNY A;  2PZ5 A;  5AUW A;  4O4E A;  3A7F A;  4AZT A;  5HU3 A;  3LFA A;  3CXW A;  2Y4I B;  5CWZ A;  3FL4 A;  3SQQ A;  3Q4Z A;  5JGD A;  2XYN A;  4HVS A;  2RGP A;  3DU8 A;  4OTP A;  1OIY A;  2VAG A;  1XH6 A;  1AGW A;  3QUE A;  4RFY A;  4W8E A;  2PL0 A;  1YOJ A;  2IF8 A;  2AC3 A;  4O6L A;  4GT4 A;  2X8I A;  2WTC A;  3P78 A;  4CTC A;  3C4E A;  2C3I B;  3IW5 A;  3JXW A;  2QOO A;  1M2P A;  1O6L A;  3UE4 A;  2IO6 A;  3ZBF A;  4D58 A;  3ZC5 A;  5CF6 A;  2OW3 A;  1WBT A;  3KXH A;  2QO9 A;  4II5 A;  4C8B A;  5DVR A;  3U6J A;  3OCB A;  3MVL A;  1KE7 A;  4TPT A;  3LJ0 A;  4J1R A;  5ANI A;  2PZR A;  2PVJ A;  4MNE B;  5C27 A;  5JN2 A;  5EM8 A;  5L2T A;  4KS7 A;  4V0G A;  4X7Q A;  3QLG A;  3C1X A;  4FT0 A;  4U6R A;  4X6Q C;  4FA2 A;  1YHV A;  3QQH A;  5FEQ A;  3QTZ A;  2C6E A;  4PMT A;  2UZT A;  3UBD A;  3VO3 A;  3D0E A;  5JT2 A;  3DT1 A;  2XIK A;  4RT7 A;  3FZ1 A;  4C3F A;  2XKF A;  3OY1 A;  3OT3 A;  4HNI A;  5KKR B;  3PXY A;  5AR2 A;  3QD3 A;  2UZE A;  4BYJ A;  3BBT B;  4E73 A;  3ZXT A;  3NNV A;  3AD5 A;  3E63 A;  3TN8 A;  3CLY A;  4UBA A;  4AE9 A;  3IG7 A;  3KUL A;  4LUE A;  3RTP A;  4LGH A;  3EQD A;  4DFL A;  2VWB A;  5I9Y A;  4FK3 A;  4TW9 A;  3W10 A;  2QU5 A;  4IX6 A;  1H01 A;  5BUJ A;  2XJ2 A;  4O0T A;  5IPJ A;  4NKS A;  2FST X;  3HV3 A;  5J9Z A;  4JAJ A;  1KE6 A;  4IWD A;  4G31 A;  3V8S A;  3DB6 A;  4BRX A;  5IMX A;  4FV9 A;  3KFA A;  4MXZ A;  3KN5 A;  3PY0 A;  4D4Y A;  3FLW A;  1H1W A;  2F4J A;  5HIE A;  2ZMD A;  4GV1 A;  2QOD A;  4BWP A;  4JS8 A;  1CM8 A;  5DT3 A;  1O6K A;  1YHS A;  1W82 A;  2CGU A;  2GTN A;  4NTS A;  4TYJ A;  3SW4 A;  2WKM A;  3HEG A;  3AOX A;  5FP6 A;  1O6Y A;  3NNX A;  3B2W A;  3OHT A;  4U44 A;  4N70 A;  3C4F A;  3WZU A;  5EG3 A;  3RZB A;  4E3C A;  4HCU A;  2X2L A;  4LYN A;  1A9U A;  3G9L X;  3IOP A;  3U4W A;  3VW6 A;  5J5S A;  3OT8 A;  1QPE A;  4TYH B;  4PL5 A;  3QTU A;  1DAY A;  3KGA A;  4R5Y A;  3RPR A;  1P5E A;  3PWD A;  1OL7 A;  3LQ5 A;  4RRV A;  3RK9 A;  1NA7 A;  2WIP A;  1OKV A;  4EOL A;  4B6L A;  4EON A;  2C47 A;  3ORM A;  4QNY A;  5G6V A;  5AA8 A;  2P3G X;  5K0K A;  2W17 A;  3BWJ A;  2JFM A;  3QHW A;  2BR1 A;  5F4N A;  2YZA A;  3O2M A;  4QMM A;  2V7O A;  3MY0 A;  3Q04 A;  4RFM A;  5EM5 A;  4FKR A;  3TUC A;  1M2R A;  4J52 A;  5FED A;  2BDJ A;  3F9N A;  1H00 A;  1URW A;  3PPK A;  5J87 A;  3RM7 A;  3EL7 A;  4GFO A;  3M2W A;  5F9E A;  2PML X;  4AGC A;  4OTH A;  4RJ5 A;  3GB2 A;  4ERW A;  5AP1 A;  4ID7 A;  1W0X C;  2VN9 A;  4GG5 A;  4M7I A;  3IQ7 A;  4EOQ A;  5BVO A;  3JY9 A;  2Y6O A;  2GMX A;  3S95 A;  2XK6 A;  3WF5 A;  1BKX A;  1BL6 A;  3RCD A;  4I5C A;  3ZRM A;  2YIR A;  3LCK A;  3VUM A;  3DKC A;  3N9X A;  4F7N A;  4V0G B;  4TL0 A;  4RGJ A;  4CZU A;  3BGQ A;  2PZY A;  4QQC A;  4D9U A;  1PXP A;  3WE8 A;  4QYG A;  4AA4 A;  2X8D A;  4IX5 A;  3AXW A;  2XRU A;  2Q0N A;  4TXC A;  3D5V A;  2J6M A;  4GII A;  4IC8 A;  3R7U A;  4D2T A;  4RIW B;  4KD1 A;  4F0F A;  3ZFX A;  5HX8 A;  3C0H A;  5CYI A;  2P2I A;  5LAR A;  4N4S A;  2X0P A;  1F5Q A;  5D1J A;  4E6Q A;  3FBV A;  1TZD A;  3CJG A;  4BBE A;  4P2K A;  4AXA A;  2HIW A;  5E8W A;  1JAM A;  3KUL B;  4NK9 A;  4D1S A;  3K2L A;  5EYM A;  3ROY A;  4M66 A;  5FLF A;  3HGK A;  4CFN A;  2C30 A;  4U42 A;  4D4S A;  4G9R A;  4M67 A;  5AM6 A;  5JZJ A;  3EFJ A;  5ETF A;  3I60 A;  2PZI A;  1UKI A;  3F2A A;  4AN2 A;  4EHE A;  1WVY A;  2WU6 A;  4FNX A;  4N6Z A;  5AX3 A;  4ANL A;  3T8O A;  3VBX A;  3MW1 A;  3U6I A;  2AC5 A;  2J9M A;  2JIT A;  4F0G A;  4S31 A;  3KRW A;  4M84 A;  4YUQ A;  2NPQ A;  1ZMU A;  1ZYS A;  3V5W A;  4EHG A;  3R7G A;  3Q52 A;  5KMN A;  2C6O A;  4D2S A;  3VID A;  2Z2W A;  4E1Z A;  2QOH A;  4C4I A;  3PG3 A;  3NUN A;  3SXS A;  3R9N A;  1V0O A;  3FMM A;  5IH6 A;  3SOC A;  1KE5 A;  2R3L A;  2QOQ A;  2GCD A;  3I81 A;  1YDT E;  5GJD A;  4EC9 A;  1U46 A;  2JDO A;  2W5H A;  3QKK A;  4Y46 A;  4GL9 A;  4I4E A;  3II5 A;  2UVX A;  3HMI A;  2XB7 A;  4K0Y A;  4V04 A;  3E8E A;  2XIZ A;  4RFZ A;  1UU8 A;  3TNH A;  1PMU A;  4L67 A;  3ZO2 A;  2VO7 A;  3BZ3 A;  5HNG A;  3VHK A;  4BI1 A;  3SAY A;  4E93 A;  3P4K A;  3G6G A;  4AE6 A;  2CSN A;  3PLS A;  2ZYB A;  4IMY A;  5IEX A;  4JVG A;  2Y6M A;  4O0R A;  1URC A;  5KHX A;  1K9A A;  2X0O A;  1ZAR A;  2RFN A;  2UZO A;  5B2L A;  3N51 A;  4FNZ A;  4LOQ A;  3W32 A;  4O0S A;  3HRC A;  4BHN A;  2OFU A;  1CKP A;  1QPD A;  3FMK A;  4DG2 E;  1Q4L A;  3EQF A;  2IW8 A;  3WI6 A;  1LP4 A;  2BRB A;  5LVN A;  4QYF A;  5EOB A;  3PVU A;  3TKH A;  2QKW B;  4I6H A;  3V5Q A;  5HZN A;  4F63 A;  4CFF A;  3ANR A;  4KKE A;  3FLN C;  1ZMW A;  2Y4P A;  4JAI A;  5JH6 A;  4LRM A;  1XH8 A;  3TTI A;  4GVA A;  1JQH A;  2IW9 A;  4ANQ A;  4DH1 A;  2LGC A;  3PY3 A;  3UYS A;  3GCS A;  2GNF A;  2PMO X;  4CKI A;  1Y8Y A;  3OBG A;  1BMK A;  1UA2 A;  4XG4 A;  3GNI B;  2C6L A;  3LHJ A;  4G9C A;  4M3Q A;  4BDE A;  4FL1 A;  2VTR A;  4IW0 A;  1ZY5 A;  2J4Z A;  4LL5 A;  4XV9 A;  1SYK A;  2IZS A;  2X6E A;  1YXT A;  3Q5Z A;  3ZXZ A;  2VO0 A;  4L01 A;  2X4Z A;  2R7I A;  4HYU A;  4FZF B;  3MBL A;  4AZV A;  2WO6 A;  2EXM A;  3MSS A;  4C33 A;  4RX5 A;  4J98 A;  3MVM A;  3PIY A;  4ANB A;  2WMT A;  4U81 A;  2BRM A;  4FTI A;  4ZSG A;  3PJ8 A;  4C3P A;  5JGA A;  4CLJ A;  4P4C A;  3HL7 A;  4QRC A;  3LJ2 A;  2W1E A;  3AC8 A;  3NR9 A;  4HYH A;  2BKZ A;  4NEU A;  4IDT A;  4AW2 A;  4L9I A;  1J3H A;  1BI8 A;  4MD7 E;  3PJC A;  5HCY A;  2EWA A;  4N0S A;  4RX7 A;  5B2K A;  4FVP A;  4YJU A;  4EUU A;  3S3I A;  4Q9S A;  1SNX A;  2OXY A;  3PG1 A;  5J95 A;  3BPR A;  3R9D A;  3HP5 A;  2QO2 A;  4ASE A;  4JX3 A;  4AU8 A;  4BI2 A;  4UWB A;  3V5P A;  2BAJ A;  3FME A;  4FGB A;  4G3E A;  5EDP A;  3QTS A;  3CS9 A;  1B38 A;  4GK4 A;  5T68 A;  4PQN A;  3M1S A;  4X2K A;  1FVV A;  3KQ7 A;  3DKF A;  1YI3 A;  5L6P A;  2XK9 A;  3OWK A;  1REK A;  3F5X A;  2HOG A;  3QTI A;  2X7G A;  5CXZ A;  3AT2 A;  4C58 A;  5ITA A;  4A9S A;  3AG9 A;  1WBW A;  4MXC A;  4JQE A;  2AUH A;  4JR7 A;  2OH0 E;  5D41 A;  4GYG A;  3S2P A;  4ANO A;  5K4I A;  4JLC A;  3P86 A;  5FTQ A;  5TR6 A;  4ZTS A;  1M7Q A;  2YIY A;  2RFS A;  3COM A;  3NUY A;  4QD6 A;  3H3C A;  3VF9 A;  4EK4 A;  3R73 A;  4EOJ A;  3H0Z A;  3OXI A;  4HW7 A;  3R1Y A;  2W4J A;  5CAU A;  3R71 A;  4J71 A;  2WIH A;  5DG5 A;  5JEB A;  2CGV A;  4UYA A;  4D4R A;  3VUH A;  4BCI A;  4U8Z A;  4TWO A;  1R3C A;  3QTX A;  2JKK A;  3WE4 A;  1RW8 A;  3AC1 A;  3D14 A;  3DNE A;  4U7Z A;  4ZJJ A;  3PIX A;  2R3J A;  3TL8 A;  2WQB A;  3LIJ A;  4L68 A;  5CSH A;  3LFN A;  5AV1 A;  5GZ9 A;  4CQG A;  4AP7 A;  4FKP A;  5M4I A;  5JFX A;  3G51 A;  4EQC A;  5AUV A;  5AIR A;  4JDK A;  1G5S A;  3A8W A;  2WMA A;  2WMS A;  5M4C A;  4NM0 A;  4KKH A;  3NW6 A;  4YNO A;  4I94 A;  3QZF A;  2UW5 A;  4FL3 A;  2B52 A;  1HOW A;  5AMN A;  2G1T A;  4FX3 A;  2YM6 A;  1UVR A;  4ZLY A;  2V7A A;  2UUE A;  5GZA A;  2R0I A;  4W4X A;  3QLF A;  4GT3 A;  3R22 A;  3OBJ A;  1H28 A;  4CFU A;  1PMN A;  4PDO A;  4P7E A;  4PL4 A;  3LFE A;  2JAM A;  3FXW A;  4PL3 A;  4PMM A;  2HW6 A;  2R9S A;  5KE0 A;  3A7H A;  1ERK A;  4FT3 A;  1Q5K A;  1V1K A;  1WCC A;  4AT3 A;  3GEN A;  1Q8Z A;  3V6R A;  1BL7 A;  2V0D A;  2WEV A;  3Q5I A;  3WOW A;  1UWJ A;  3RWP A;  5H3Q A;  4G16 A;  2YWP A;  4ALW A;  5HEZ A;  4CT2 A;  2OK1 A;  2I40 A;  4XP2 A;  4WIH A;  2QUR A;  4FTQ A;  4EOS A;  1ZXE A;  3PWY A;  4PY1 A;  4A7C A;  3ZSH A;  5IEV A;  5JFW A;  2I0V A;  3FI4 A;  5AUX A;  5AV2 A;  4RBL A;  5CU0 A;  3R63 A;  4IQ6 A;  5EM6 A;  4MKC A;  2CHL A;  3QCY A;  4PTE A;  5HU9 A;  5HLW A;  2J0M B;  3CBL A;  2WMV A;  3NZ0 A;  4X3J A;  4MYG A;  3R02 A;  4IM3 A;  2VO3 A;  2WMR A;  5EYC A;  5BVE A;  3UO5 A;  3EFW A;  5JFS A;  3DLS A;  2BUJ A;  1S9J A;  3TZ7 A;  3MY1 A;  5HX6 A;  3G2F A;  3UVP A;  5L3A A;  5A9U A;  5HOR A;  3V5T A;  4DCE A;  5AM7 A;  1PXO A;  2HYY A;  2ITX A;  5E8V A;  5J9L A;  3FLQ A;  3NDM A;  3BE9 A;  5TOZ A;  1XJD A;  1DM2 A;  4AGU A;  4YZB A;  3W2Q A;  5B0X A;  4G6O A;  3L8V A;  3C4C A;  4JOA A;  3NUX A;  4FKJ A;  3W2C A;  2FH9 A;  4M14 A;  2OF2 A;  4FTL A;  4B8M A;  4D0W A;  2YCS A;  5I4N A;  4UB7 A;  1MRU A;  2HZ4 A;  3KVX A;  4OTF A;  4Q2A A;  4EOO A;  2VNW A;  5IUI A;  3ORI A;  1WZY A;  1UNL A;  3PA5 A;  2YCR A;  5BMM A;  5JQ8 A;  3BKB A;  1FVT A;  4PV0 A;  4JDI A;  4O4D A;  3GOK A;  4M97 A;  3MS9 A;  5HQ0 A;  4FSZ A;  3TV4 A;  3JPV A;  3CTQ A;  3UNJ A;  4BHZ A;  4ZSA A;  5LCJ A;  2RG5 A;  4ZZN A;  3Q32 A;  2O2U A;  2QKR A;  1IR3 A;  4RZV A;  4AOT A;  4E4M A;  4EQM A;  1JVP P;  4DH3 A;  3BYO A;  2VTT A;  5E7R A;  4EK8 A;  2C5X A;  2NRU A;  2B7A A;  2W4K A;  3LCS A;  3MB6 A;  4FTC A;  3BU6 A;  2C68 A;  3R9O A;  4GIH A;  1NXK A;  4AZF A;  1P2A A;  3PP1 A;  4QTA A;  4UXQ A;  2R64 A;  3VS0 A;  1J91 A;  4CKJ A;  2B54 A;  4FIE A;  4O2Z A;  3VNT A;  4OAU C;  2XNE A;  3ORP A;  2RL5 A;  1YXU A;  1XH7 A;  3ZS5 A;  1MQB A;  3SW7 A;  3PTG A;  4IAI A;  4FT5 A;  2EB3 A;  2BCJ A;  2BZH B;  4NFM A;  3ITZ A;  3KXX A;  4IWO A;  5D9H A;  3RHK A;  5G1X A;  2QLU A;  3TUB A;  3CQE A;  5BYZ A;  1ZOG A;  1Q3W A;  4BDK A;  3CTH A;  4YJQ A;  3A2C A;  4QMP A;  2WEI A;  3R28 A;  5CEN A;  2WTD A;  4EZ5 A;  3ZUV A;  5FM2 A;  5IEY A;  3ZHP C;  4Z55 A;  2WTK C;  2ONL A;  1KE9 A;  4ACD A;  2WMB A;  2YM3 A;  5DNR A;  5GJF A;  4ASD A;  5GHV A;  2XNG A;  1W2F A;  4BCH A;  4YTI A;  4BF2 A;  3G90 X;  4DGM A;  1BI7 A;  4XRJ A;  2XS0 A;  4RIO A;  3SXF A;  2PK9 A;  2BIK B;  4ZJV A;  3VF8 A;  4S30 A;  4JBV A;  4NJ3 A;  2HWP A;  3GFE A;  4FK6 A;  4I0T A;  4BTK A;  1P4F A;  2QD9 A;  2PVY A;  3VS4 A;  5L8L A;  3E64 A;  4IB0 A;  4U41 A;  5AAD A;  4HVI A;  2QG5 A;  3UYT A;  5BVD A;  1OB3 A;  5BYY A;  4NT4 A;  1KV2 A;  4CFV A;  2Z7Q A;  5FRI A;  4A9R A;  2R3R A;  3FAA A;  1XQZ A;  3F2N A;  4M15 A;  4QTC A;  1OUK A;  3AQV A;  3QX2 A;  1FGK A;  4J97 A;  4V01 A;  3LCT A;  4M13 A;  3TWJ A;  4I20 A;  2OH4 A;  4XP3 A;  4NCT A;  3A61 A;  4NW5 A;  3GCP A;  4FG7 A;  5IA3 A;  1A06 A;  2Z60 A;  3DCV A;  3EQR A;  4FV6 A;  5CAQ A;  5HE3 A;  4J7B A;  1GZN A;  2PE0 A;  3IK3 A;  2G01 A;  3Q9Y A;  3TAC A;  3NUU A;  4TYI A;  1VEB A;  2XEZ A;  3WZJ A;  4UX9 A;  3OF0 A;  1U54 B;  3HV4 A;  2BAK A;  3HUB A;  4L52 A;  3QGY A;  4XUF A;  3RAH A;  2CLQ A;  5ANK A;  1ZOH A;  2YM7 A;  3GOP A;  3MWU A;  3D15 A;  4J53 A;  3ZO4 A;  4UMU A;  4CMU A;  4G17 A;  3E8N A;  4CYJ A;  4ASZ A;  3VS7 A;  5E8S A;  1Q62 A;  5C01 A;  1RQQ A;  2OID A;  5D7V A;  2ZAZ A;  1XBB A;  4ZTN A;  2PVN A;  3D2K A;  5HE0 A;  3BHU A;  4OTQ A;  4X2F A;  3D4Q A;  3EQG A;  5BVW A;  2IZT A;  4F7J A;  1H1P A;  4OT6 A;  4ZS0 A;  4NIF B;  3K5U A;  4JBQ A;  1FMK A;  3ZEP A;  2RKU A;  1H1S A;  2VWX A;  2C6T A;  4BBF A;  4LL0 A;  4QQ5 A;  4NWM A;  2WMQ A;  2A4L A;  3K5V A;  3D83 A;  4DLI A;  1UU9 A;  4QP7 A;  2JAV A;  3DAK A;  2JGZ A;  4JT3 A;  4L45 A;  5EKN A;  4YR8 A;  3I5N A;  4USF A;  4IJ9 A;  5C03 A;  4C62 A;  1REJ A;  3HNG A;  4C3R A;  4O0V A;  3DGK A;  3KRL A;  2V22 A;  2VGP A;  3HUC A;  4FOC A;  2P55 A;  4GEO A;  3W2R A;  4IWP A;  4D5K A;  4C7T A;  3RPY A;  3C7Q A;  4GSB A;  2WQM A;  4WKQ A;  4K6Z A;  4BDD A;  1S9I A;  3ULI A;  5L2S A;  5HTI A;  2O8Y A;  3QWK A;  5E8X A;  2P4I A;  2OZO A;  3BU5 A;  3MVH A;  2F49 A;  4TWC A;  4YJS A;  4E6D A;  3AC2 A;  3B2T A;  3EFL A;  3LFS A;  3Q60 A;  4IZY A;  4ZTR A;  2C0T A;  3TV7 A;  2ITP A;  4EH4 A;  4X3F A;  2GNH A;  2UVY A;  4LV5 A;  3Q6U A;  2O0U A;  4I21 A;  3ELJ A;  2EXE A;  5DFP A;  5FBN C;  2PVK A;  4O0Y A;  4QP3 A;  1O9U A;  1DI9 A;  2VWU A;  2PMN X;  5FEE A;  5LWM A;  5M4U A;  1ZZ2 A;  4DED A;  4IB3 A;  3FQH A;  4BB4 A;  2XK8 A;  1ZYL A;  3H9R A;  4PDP A;  2I0Y A;  3ZZW A;  3AC3 A;  4MK0 A;  3CGF A;  3FKN A;  4RJ7 A;  5AUY A;  2C4G A;  4KIK A;  4HPU E;  5CU3 A;  1JST A;  4ENX A;  3R7I A;  1QPJ A;  1VZO A;  4Y83 A;  3VUI A;  3BQR A;  1OL5 A;  3L8S A;  2XKD A;  2R7B A;  3NAX A;  4PMP A;  3SKC A;  2IVU A;  2JD5 A;  2YJS A;  2Y4I C;  3MGY A;  5BVN A;  2A27 A;  1NY3 A;  3IEC A;  3O0G A;  4MWH A;  3QTW A;  2F7Z E;  2J0I A;  4E5A X;  5AV0 A;  2QON A;  3BX5 A;  3QKM A;  4CNH A;  2W1I A;  3G0E A;  4BGQ A;  2YHV A;  2E9O A;  1UKH A;  1HCK A;  4EH7 A;  2X4F A;  3PXK A;  4MED A;  4NTT A;  3TXO A;  4RZW A;  3GC8 A;  2J0J A;  2Z7L A;  4DG0 E;  4QTD A;  1XWS A;  2FGI A;  4WRG A;  1PXM A;  1H08 A;  3QQL A;  4E6C A;  4O2P A;  3VAP A;  4ITJ A;  4KSQ A;  2F2U A;  3KRR A;  4WNP A;  2G9X A;  2VWY A;  3GC9 A;  3RJC A;  4BDI A;  5IA2 A;  5A54 A;  3R1Q A;  4Q5E A;  4GJ2 A;  3L9N A;  3VUG A;  1OVE A;  4C0T A;  2R3N A;  4DGN A;  3BRB A;  1JLU E;  5ANO A;  1DS5 A;  5ANE A;  5HBE A;  4XS2 A;  4NFN A;  3TNW A;  5LVM A;  1GZK A;  5KKR C;  3H0Y A;  3R0T A;  2B4S B;  4QYY A;  4TYG A;  4WD5 A;  3RPV A;  1ZYC A;  2ACX A;  4ZZM A;  4DH8 A;  2PE1 A;  4TN6 A;  4XH6 A;  4YNE A;  3E3B X;  2VTO A;  1H4L A;  2J0L A;  3RMF A;  3HX4 A;  5CI7 A;  2OZA A;  3E3P A;  3GT8 A;  3MFT A;  3ANQ A;  3BHV A;  1CTP E;  4OBP A;  4CEG A;  5L8J A;  1W7H A;  4AF3 A;  2BFX A;  2YIQ A;  4I0R A;  3ZLS A;  3FYJ X;  4FKV A;  2FSM X;  4KIP A;  5HG8 A;  4FKQ A;  2XYU A;  5FXR A;  2X6D A;  1ZYD A;  4DEE A;  4MAO A;  3ODY X;  4KS8 A;  4EZ7 A;  5D12 A;  3GC7 A;  3RHX A;  4K8A A;  4X3F B;  4YSJ A;  4JRV A;  5A4T A;  5AV4 A;  3OWL A;  5CEI A;  4XEY A;  4QQJ A;  3WIL A;  2R3G A;  1W84 A;  3Q6W A;  3IS5 A;  3QF9 A;  5EDQ A;  2QI8 A;  4ZSL A;  1YWN A;  5ETI A;  3TZ9 A;  2JLD A;  1XR1 A;  4PPC A;  4MNF A;  4XG2 A;  3FMN A;  4ZXT A;  4NM7 A;  4U0I A;  4LRK A;  3C50 A;  3OUN B;  3LQ8 A;  3RBW A;  4KIK B;  5AP0 A;  4QMZ A;  2JC6 A;  3QQJ A;  4FG9 A;  3UQF A;  4R3P A;  3DZQ A;  3EZV A;  2RFD A;  3FPM A;  2B9J A;  3TZM A;  3VRY A;  5C26 A;  3AMB A;  4I22 A;  5F95 A;  4EYJ A;  4EHZ A;  5H2U A;  3AD6 A;  3QC4 A;  4IAF A;  3E92 A;  3E87 A;  4I5H A;  3W8Q A;  1OUY A;  5ETC A;  3UJG A;  4IDV A;  5IME A;  2FSL X;  3R04 A;  5CSX A;  5L2I A;  2ITV A;  1YVJ A;  2XNB A;  3F61 A;  3PE1 A;  3M11 A;  2WMU A;  3QCX A;  2B9F A;  4FSY A;  5JZN A;  2V55 A;  3H9O A;  3D7Z A;  4KIO A;  4I41 A;  4LV8 A;  3WYX A;  4MHA A;  3SLS A;  4H36 A;  5CS6 A;  3R1S A;  2UW3 A;  2WD1 A;  3RPS A;  4CZY B;  4IZA A;  1OKZ A;  2H96 A;  2EB2 A;  2R3M A;  5J7H A;  4XBR A;  3OVV A;  1CDK A;  2ETM A;  4GK3 A;  3A8X A;  5J1W A;  1IEP A;  3UQC A;  4R5S A;  3OW3 A;  1GAG A;  3OS3 A;  5A4C A;  2OSC A;  1F0Q A;  2OKR A;  5CT0 A;  3GBZ A;  3V5L A;  2P0C A;  4W4Y A;  4TTH B;  5KMM A;  2VU3 A;  2IWI A;  5JFV A;  3GUB A;  2RG6 A;  4U45 A;  4ZY4 A;  4FF8 A;  2X0G A;  4E26 A;  4DEI A;  3FJQ E;  5KZI A;  1OPJ A;  3E88 A;  5A6N A;  4YJT A;  2P2H A;  3MH3 A;  4YJO A;  4OBO A;  3DQW A;  2OZA B;  3HKO A;  3EYH A;  5IF1 A;  3C9W A;  3NYV A;  3CD3 A;  5DT4 A;  5EFQ A;  3W33 A;  4BCO A;  4WG3 A;  3KK8 A;  5HID A;  3PIZ A;  3SDJ A;  1M14 A;  3U87 A;  1BYG A;  4RVM A;  2A2A A;  4L7F A;  5DH3 A;  3NGA A;  4BFM A;  2BFY A;  2IJM A;  1JKS A;  3ODZ X;  5TT7 A;  4XG3 A;  4KRC A;  3ZYA A;  4C61 A;  2R3I A;  4YGA A;  3DV3 A;  3OOG A;  4RJ4 A;  5FD2 A;  3QA0 A;  2JDS A;  1JBP E;  4DAW A;  1WBO A;  2WQO A;  4EWH A;  2WMW A;  4ZEG A;  2XNN A;  3FXZ A;  1Q97 A;  2W1D A;  4XP0 A;  3BYV A;  5E91 A;  3MB7 A;  3LOK A;  4AW5 A;  5AR3 A;  4P5Q A;  4DEH A;  4MWI A;  2F57 A;  3I6U A;  4UMQ A;  5FXS A;  3S00 A;  5I9W A;  2G2H A;  3PUP A;  2BAQ A;  2Y9Q A;  2VTA A;  3D5X A;  3ERK A;  4WNO A;  3EWH A;  4KIQ A;  3MPA A;  3CEK A;  4I92 A;  2G2F A;  3NUP A;  4LUD A;  4YBJ A;  3COK A;  4G5J A;  4AT4 A;  3FSK A;  3BEL A;  2B9H A;  3KMU A;  3VUT A;  2A19 B;  2CGW A;  2R5T A;  4BCP A;  5AUT A;  1Q99 A;  4E4L A;  2SRC A;  4WUN A;  2ZV9 A;  4UZH A;  4G3C A;  5E8Z A;  1I44 A;  1ZOE A;  4PTC A;  3GXL A;  4KBC A;  2QVS E;  4CD0 A;  3PY1 A;  1YDS E;  4C34 A;  1W2D A;  3I7B A;  1LUF A;  5C8K A;  4LOO A;  4X0M A;  3ZUU A;  4FII A;  1FIN A;  4QPM A;  5EM7 A;  4AAC A;  2C3L A;  3IKA A;  5IDP A;  4WUA A;  5DRB A;  4AUA A;  2YFX A;  4IM2 A;  3W2S A;  4USD A;  1JOW B;  3ENH A;  3A7G A;  1QPC A;  1OPK A;  4XV1 A;  3FY0 A;  1V0B A;  2UV2 A;  3GQL A;  5LXM A;  3VHE A;  3LCD A;  3U9C A;  2P33 A;  1RE8 A;  5IA5 A;  2F7E E;  4HZS A;  4AA5 A;  3RPO A;  2H8H A;  1OGU A;  2QR8 A;  1Z5M A;  2XJ1 A;  3CQW A;  3OWP A;  1WBS A;  4ZK5 A;  4ANN A;  1OIQ A;  1MQ4 A;  4EEV A;  3P08 A;  5KUP A;  4F08 A;  2CGX A;  1UU3 A;  2C6K A;  3E5A A;  3HVC A;  2YIX A;  3B8Q A;  4H3B A;  5HCX A;  3DBE A;  5AP7 A;  4D0X A;  2QOI A;  3TKI A;  3Q2M A;  3HRF A;  3FSF A;  4V05 A;  2JKO A;  5ACK A;  4BTF A;  2J7T A;  2X39 A;  4JDH A;  1YI4 A;  2W1G A;  4DGG A;  3LFD A;  5HNB A;  5BUI A;  3P7C A;  3C0I A;  5JRS A;  4XCU A;  4ACC A;  3RAK A;  4C4E A;  3UPZ A;  2R3F A;  3GC0 A;  4RX9 A;  4RVK A;  3HMN A;  3HDN A;  2YCF A;  4MXO A;  4FV5 A;  1STC E;  4ENY A;  3PP0 A;  3CD8 A;  3DXN A;  5HVJ A;  3UGC A;  3DA6 A;  4FTK A;  3R7E A;  3KXG A;  4FT7 A;  3DBF A;  2PTK A;  3QD4 A;  2DQ7 X;  4NH1 A;  3ULZ A;  4L8M A;  3ZRK A;  1YXS A;  4IZ7 A;  2VUW A;  4A9U A;  2YDJ A;  4IVD A;  4IHP A;  4X6R A;  2J0K A;  3RGF A;  4MQ2 A;  4TND A;  5JMS A;  5HNI X;  4FL2 A;  3P0M A;  4H1J A;  3MJ2 A;  2J5E A;  5F20 A;  5DT0 A;  5CT7 A;  4MXY A;  4YLK A;  4O91 A;  3UNK A;  3QAL E;  4BGG A;  3CTJ A;  1VYZ A;  4YPD A;  4G3F A;  2Y0A A;  2HCK A;  1XH9 A;  2QNJ A;  5A6O A;  3FI2 A;  2OIQ A;  3U6H A;  1DI8 A;  2X2M A;  5HG5 A;  4XG8 A;  2WTJ A;  2UW4 A;  4M68 A;  4AN3 A;  3EMG A;  4K1B A;  1K3A A;  3R21 A;  2VTS A;  3F3U A;  4IC7 A;  3DQX A;  3U4U A;  4ERK A;  3IO7 A;  3CIK A;  2PVL A;  3PRI A;  5DR9 A;  4Y5Q A;  2R0U A;  3TJC A;  3RAW A;  4LMU A;  3ORX A;  2R3P A;  3A99 A;  4I3Z A;  5CQW A;  4J8N A;  5CQU A;  2HXQ A;  4DEB A;  3CC6 A;  1YDR E;  3RP9 A;  4B4L A;  3LXL A;  3ACJ A;  4FKS A;  5DWR A;  5ETA A;  4EOK A;  3QZG A;  3TTJ A;  4F65 A;  1UU7 A;  1TQP A;  4JI9 A;  4CFW A;  5LMK C;  5BMS A;  3QQF A;  3AT4 A;  3POZ A;  5FP5 A;  4TY1 A;  2UZV A;  3NCZ A;  2WTW A;  3M42 A;  1ZWS A;  4FIG A;  3DY7 A;  4YZN A;  4EC8 A;  4Z16 A;  4IAY A;  3GVU A;  4PF4 A;  4B8L A;  4F0I A;  1YQJ A;  2VV9 A;  2WFY A;  4K9Y A;  2NO3 A;  1BUH A;  2UZN A;  4C2W A;  1M2Q A;  2VTM A;  2XEY A;  5AAE A;  3OUK A;  1Q3D A;  5CSW A;  2YAB A;  2G2I A;  3PVG A;  3PJ1 A;  4FZA B;  4UN0 C;  1H1R A;  3NAY A;  4LG4 A;  3ZCL A;  5BPY A;  2W7X A;  5JSM A;  4XMO A;  4O38 A;  4CSV A;  3ALN A;  4BZD A;  1FOT A;  2IVV A;  4BIB A;  5CU6 A;  3BYS A;  4YUR A;  4ACH A;  2GS7 A;  2KUL A;  2QLQ A;  4EBV A;  1OKY A;  3QQU A;  4UZD A;  2O5K A;  5JKG A;  4S32 A;  2ITY A;  3QD0 A;  3Q4C A;  2B9I A;  3V51 A;  1TQI A;  5M51 A;  3ZMM A;  4D2V A;  4LRJ A;  2JDR A;  4LI5 A;  4F6U A;  1Q8U A;  4I5P A;  3R30 A;  3QRI A;  2PHK A;  1PW2 A;  3FC1 X;  3RNI A;  4RVL A;  4JDJ A;  5DPV A;  1NVR A;  2ITN A;  4FEQ A;  1CMK E;  1OIU A;  4I4F A;  5KZ0 A;  3I7C A;  4F7L A;  4X2J A;  4EK3 A;  3OMV A;  3WZD A;  5C8M A;  1TQM A;  3EN9 A;  3NNU A;  3ORL A;  3QRU A;  4U9A A;  2GU8 A;  1ZLT A;  1WVX A;  1JKL A;  1XH4 A;  2W9Z B;  4BN1 A;  1Z9X A;  3DJ7 A;  3FKL A;  2ZM3 A;  3OC1 A;  4IAN A;  3KXZ A;  3O23 A;  1H24 A;  3HRB A;  3H4J A;  4BVU A;  2GFS A;  2UZL A;  3DK3 A;  3HMP A;  4U3Z A;  4UYN A;  4CKR A;  2W96 B;  4IX3 A;  3NRM A;  5AP6 A;  3BGZ A;  5FTO A;  4GRB A;  3FY2 A;  2ZVA A;  3BEA A;  4U43 A;  3MPM A;  1KSW A;  3I0Q A;  5AND A;  3LMG A;  4CRL A;  3BI6 A;  4G2F A;  4R1Y A;  1PKG A;  2C1A A;  2Z7R A;  4A9T A;  2XCH A;  3EB0 A;  3DB8 A;  4HOK A;  4D9T A;  2XM8 A;  4G5P A;  5HVY A;  1PY5 A;  4FSR A;  3UOK A;  1JSV A;  2QOK A;  1WFC A;  5HLP A;  4BWX A;  4EI4 A;  2WOU A;  1APM E;  3NIE A;  4BZN A;  2OJ9 A;  4QML A;  3TV6 A;  4EOI A;  3EFK A;  3LXP A;  3F3W A;  1UNG A;  4YC3 A;  3UVR A;  4FSW A;  4JBO A;  1Q61 A;  2HK5 A;  5TF9 A;  3EQC A;  4OBQ A;  4DC2 A;  3MTL A;  2OFV A;  4PRJ A;  4Q5H A;  3ZSG A;  5K9I A;  3ALO A;  4FOB A;  5GJG A;  4JQ7 A;  4YMJ A;  1YRP A;  1QMZ A;  3RVG A;  4W4W A;  2O63 A;  2YIW A;  5TO8 A;  4IXP A;  2ITO A;  1FGI A;  4OUC A;  3VS2 A;  3NW5 A;  3PJ3 A;  3PE2 A;  3UG1 A;  4ZLO A;  3DAJ A;  4Z3V A;  2VO6 A;  1JKK A;  3R2B A;  4R6V A;  4BBM A;  3LFF A;  2UW7 A;  3ZFY A;  5I0B A;  3EID A;  2O3P A;  4D2P A;  4MTA A;  3NPC A;  2IZR A;  2J2I B;  2OBJ A;  3MH2 A;  1P4O A;  4QNA A;  4ALU A;  1U4D A;  3O7L B;  4EH5 A;  2AYP A;  4FKW A;  3BQC A;  4MF1 A;  4KBK A;  3PPJ A;  3NYN A;  1PYE A;  2W1C A;  3ACK A;  4GU6 A;  2X7F A;  4B0G A;  5I9X A;  3QUD A;  3WF7 A;  1V0P A;  2XJ0 A;  2ZV2 A;  4XG6 A;  4DH7 A;  4M0Z A;  2ZM1 A;  3UIU A;  5AA9 A;  2JIV A;  4NJD A;  4O21 A;  5DRD A;  2GQG A;  4KIN A;  3FPQ A;  1GY3 A;  3O8T A;  4RG0 A;  4MCV A;  5AAG A;  2ERK A;  2JDT A;  4RJ6 A;  2QHN A;  3BYM A;  5AV3 A;  2W5B A;  4ALV A;  5EK7 A;  2ITW A;  2XIX A;  3O71 A;  3QRT A;  4E7W A;  5HBH A;  3GP0 A;  4C4G A;  2ZV8 A;  5DBX A;  3S0O A;  2VX1 A;  4JX7 A;  2OJI A;  2B53 A;  2ZB1 A;  3FZS A;  2C69 A;  1Q8T A;  4LGG A;  2UW8 A;  2HZI A;  3P5K A;  3TIY A;  3VBV A;  4BTM A;  4Y8D A;  4F9Y A;  3W8L A;  2VRX A;  3D9V A;  3QX4 A;  3V01 A;  2BZJ A;  4QP1 A;  4R3C A;  2R4B A;  4WHZ A;  2OIB A;  5CU2 A;  3O51 A;  4IZ5 A;  4C2V A;  2C3K A;  4FKI A;  3BHH A;  1AQ1 A;  1VYW A;  1Y57 A;  4I6F A;  4RA5 A;  5M56 A;  4EH8 A;  2RF9 A;  3R01 A;  5K5N A;  3RI1 A;  5E1S A;  5E8Y A;  4L3L A;  3VS6 A;  2QOC A;  2YDI A;  3VVH A;  4BDJ A;  3BCE A;  3VBT A;  4QQT A;  3W2O A;  2HZ0 A;  3WAR A;  5FG8 A;  3QZH A;  4XG7 A;  5HCZ A;  4QMU A;  3ZH8 A;  3RK7 A;  5J79 A;  4KAB A;  3UG2 A;  4HCT A;  4E20 A;  3HV6 A;  5ACB C;  3LFB A;  1ZAO A;  1OEC A;  1JPA A;  1SM2 A;  3IW7 A;  4K33 A;  3SX9 A;  4B7T A;  3ZTX A;  3EN5 A;  4YZM A;  2WTI A;  3PA3 A;  3RCJ A;  3TNQ B;  3UZP A;  4BID A;  4L42 A;  2XNP A;  3FE3 A;  4U97 A;  2CKE A;  5IH4 A;  4DYM A;  5AUU A;  4JIA A;  1CKJ A;  3C51 A;  3F5P A;  4GUB A;  3R83 A;  3CKW A;  3MTF A;  4F09 A;  3OEF X;  4AG8 A;  3EQH A;  2ETR A;  4IVA A;  5J5T A;  4C4H A;  3TNI A;  4O4C A;  5F94 A;  3U9N A;  3KB7 A;  4EK5 A;  5C9C A;  4XLV A;  4FTN A;  2BIY A;  4QMY A;  1OIT A;  2OGV A;  3ROC A;  3EOC A;  4Y73 A;  3R7O A;  4AT5 A;  4A07 A;  5KML A;  2XK7 A;  2ONL C;  3MV5 A;  4J95 A;  3HMM A;  4X2G A;  3WF8 A;  4PP7 A;  4QP8 A;  1GZO A;  4GFM A;  4I93 A;  5HO7 A;  5LWN A;  3FZP A;  3QRJ A;  4YHF A;  2HAK A;  3D5W A;  3WIK A;  2OWB A;  4CCU A;  3FMJ A;  4O0W A;  5A4E A;  3EN7 A;  5HE2 A;  4AGD A;  3E8C A;  4IFG A;  3WF9 A;  1YWV A;  4EK6 A;  3D5U A;  3FUP A;  4XJ0 A;  5CX9 A;  1MRV A;  4MD9 E;  2X1N A;  1YKR A;  2W5A A;  4JRN A;  3FMH A;  4PTG A;  4BKY A;  4DEA A;  1T45 A;  1H0V A;  4BC6 A;  4Z7G A;  4GJ3 A;  4ZAU A;  2CMW A;  2ITZ A;  4I1Z A;  3FV8 A;  1Q8W A;  5M57 A;  5GZ8 A;  4S2Z A;  3KF4 A;  3QZI A;  4BKJ A;  2PZP A;  4NCT C;  2ESM A;  2JDV A;  1IRK A;  4G6N A;  5H8E A;  3V8W A;  2YLF A;  5AR5 A;  3GCQ A;  4G3D A;  3D94 A;  5AR4 A;  4HVG A;  4RQV A;  5KMK A;  1OZ1 A;  3K3I A;  4G34 A;  4IWQ A;  3DK6 A;  4R1V A;  2WQN A;  3I6W A;  4R3R A;  2VD5 A;  4X21 A;  1E1X A;  2W99 B;  2VGO A;  4QMQ A;  2YIT A;  3WZE A;  2BDW A;  2W1Z A;  4FSN A;  4ONA A;  4F1O A;  4YTF A;  5FDP A;  3LVP A;  2B55 A;  5FDX A;  3CCN A;  4Z7H A;  1GOL A;  3RIN A;  5IU2 A;  4FKU A;  4QYE A;  4BCM A;  1K2P A;  2CN8 A;  5AP5 A;  1YOM A;  2R3Q A;  3FDN A;  4AZW A;  4GT5 A;  3FLZ A;  3HMO A;  3TIZ A;  3MFU A;  4EHV A;  3U51 A;  4IE9 A;  4FC0 A;  5L8K A;  4XOY A;  1SVE A;  4XNE A;  3VWA A;  3OP5 A;  5AP3 A;  4YU2 A;  2OIC A;  3FQS A;  5D10 A;  2X81 A;  3O96 A;  1M7N A;  2VNY A;  2J5F A;  3WZK A;  5HD4 A;  3F82 A;  3MFS A;  4O0X A;  4C38 A;  4AQC A;  4ITH A;  4EKK A;  2ZDT A;  3HA8 A;  4FVR A;  3L9M A;  4YSM A;  4WBB B;  4D55 A;  2E9V A;  1G3N A;  4FUY A;  4YTH A;  2GNI A;  2UVZ A;  3VUK A;  4CQE A;  4D5H A;  3R2Y A;  1EH4 A;  3PXF A;  4ACM A;  4EQU A;  3FQE A;  2VTI A;  3OY3 A;  1GIH A;  1PKD A;  3Q4T A;  4CTB A;  3A7I A;  5IZF A;  3CY3 A;  4O4B B;  1LEZ A;  2A0C X;  2VTQ A;  1UNH A;  3EQP A;  3FLS A;  3MH0 A;  4FYO A;  4MNE A;  4EOR A;  4FT9 A;  5LJJ A;  4CLI A;  2R2P A;  5JGB A;  5IH5 A;  3FMD A;  5AWM A;  1WVW A;  2ZOQ A;  1OIR A;  2XKC A;  2WPA A;  2CPK E;  2OU7 A;  3DND A;  3I0O A;  3EH9 A;  2EU9 A;  3OG7 A;  3QRK A;  2UZB A;  4IVC A;  4X3F C;  5FM3 A;  3UC3 A;  5H9B A;  4YTC A;  4AW0 A;  5CAN A;  3DKO A;  4FST A;  2GHG A;  4HJO A;  4AW1 A;  4FYN A;  3HV5 A;  4CV9 A;  5J9Y A;  5AEP A;  4QMT A;  3R8L A;  5EHY A;  4IM0 A;  4R8Q A;  3UOD A;  1LEW A;  4E8A A;  5IA1 A;  4OTI A;  4BCK A;  3E8D A;  4S33 A;  5HG7 A;  3QAM E;  3I1A A;  3G0F A;  3NLB A;  2CCI A;  4ZTQ A;  3P7B A;  1M17 A;  1R78 A;  4I5M A;  2WB8 A;  4RPV A;  3SV0 A;  1YI6 A;  1W98 A;  1KWP A;  4I0S A;  3COI A;  4BYI A;  3O50 A;  5AUZ A;  2JFL A;  4FKG A;  2FA2 A;  5KMO A;  4HNF A;  3CGO A;  3DLZ A;  3KVW A;  4HGE A;  3BWF A;  2CN5 A;  5LVL A;  4CVA A;  3BBW A;  3LCO A;  5K4J A;  5J1V A;  4OTG A;  4BDB A;  4F6W A;  3UZT A;  3VQU A;  3BLH A;  3KK9 A;  1TKI A;  2XK4 A;  1XBA A;  4RC4 A;  5CLP A;  4LMN A;  4BTJ A;  3COH A;  2E9U A;  3QQK A;  1PXJ A;  4KWP A;  4K11 A;  5EI8 A;  2GFC A;  5CSV A;  5DOS A;  4TWN A;  5CZI A;  3P79 A;  4RQK A;  2W4O A;  4CYI A;  2PVF A;  3F5G A;  4F70 A;  4RC2 A;  3HP2 A;  4AZE A;  1T46 A;  4QP4 A;  5BVF A;  3C0G A;  3NX8 A;  5IKW A;  2BDF A;  2VWW A;  4FKO A;  4L46 A;  1H07 A;  3H9F A;  4CMO A;  3O7L D;  4UMP A;  3F3Z A;  2O65 A;  2VX3 A;  4NW6 A;  3T9T A;  2Y8O A;  3Q9X A;  2RIO A;  2UW0 A;  2QOB A;  2IZU A;  3OW4 A;  4J8M A;  3R1N A;  4DFN A;  4A4X A;  4FV3 A;  5CAV A;  2HWO A;  5LVO A;  5FWK K;  4PMS A;  2NP8 A;  5A4Q A;  3L1S A;  2XF0 A;  3F3V A;  2VZ6 A;  3EJ1 A;  3OEZ A;  4KA3 A;  4EZ3 A;  3DFA A;  3GU6 A;  4FV0 A;  5JQ5 A;  4QTB A;  3MI9 A;  2YIS A;  3SRV A;  4DIT A;  4NKA A;  3L8X A;  2V62 A;  2OJG A;  3AC4 A;  3VC4 A;  3A4O X;  3KL8 A;  3QC9 A;  3KCK A;  4JIK A;  4AX8 A;  1FPU A;  1JWH A;  2C5Y A;  4H58 A;  2BAL A;  3BHT A;  3UIM A;  2BRN A;  4HGT A;  5HKM A;  3ORN A;  4HYI A;  3WBL A;  2BTS A;  3UO6 A;  2IVT A;  3DDP A;  4FV1 A;  4RWJ A;  3QCS A;  3V04 A;  2XM9 A;  2EVA A;  4RIW A;  3R7V A;  3VS1 A;  4F9A A;  4TYE A;  3OTU A;  5AP4 A;  5CAL A;  4OT5 A;  3DBC A;  4CCB A;  4AFJ A;  4C37 A;  2VWI A;  4Q9Z A;  3DTC A;  3QYZ A;  3QA8 A;  4OTR A;  3O17 A;  3MIA A;  3PSD A;  2GS6 A;  2ITQ A;  3LXK A;  2XH5 A;  4CFM A;  4E5B A;  4UMR A;  1H27 A;  4F99 A;  3BGP A;  3KC3 A;  3FML A;  4XV2 A;  4EH3 A;  3EKK A;  3CE3 A;  3NYO A;  4FV2 A;  3L8P A;  3TUD A;  1IG1 A;  2OXD A;  3C4X A;  3LXN A;  3V3V A;  3DS6 A;  5CU4 A;  4GH2 A;  4ZY6 A;  5HO8 A;  3UP2 A;  4O4F A;  5I9V A;  3RKB A;  1IA8 A;  5L6O A;  4FKT A;  1CKI A;  4H1M A;  4OGR A;  3RZF A;  3THB A;  3Q96 A;  5HD7 A;  4H3Q A;  2XMY A;  3P7A A;  3GCU A;  5M55 A;  4LOP A;  3RM6 A;  4O22 A;  4YO4 A;  3JYA A;  4AOI A;  3FYK X;  3LPB A;  2F2C B;  1JSU A;  2IEW A;  3G5D A;  5DA3 A;  3KCF A;  3KY2 A;  2E2B A;  2OI4 X;  4ZJI A;  2H6D A;  4EOM A;  4JL9 A;  3I5Z A;  2I0E A;  5CEP A;  3CPC A;  4DH5 A;  4XBU A;  4XG9 A;  3R8Z A;  4ASX A;  1SNU A;  4FBX A;  5HGI A;  3MN3 A;  4KB8 A;  4YZ9 A;  3BEG A;  4FIH A;  2WMX A;  2Z8C A;  4MF0 A;  1H1Q A;  4AA0 A;  4AOJ A;  2PY3 A;  1HCL A;  3NW7 A;  4JG8 A;  3BHY A;  4OW8 A;  4UXL A;  5HBJ A;  5IG1 A;  3I4B A;  2Y7J A;  4MBJ A;  1Q24 A;  3NSZ A;  4FNW A;  3NS9 A;  3ZON A;  2DWB A;  4BKZ A;  1B6C B;  4JNW A;  4MBL A;  4FSQ A;  3AC5 A;  3QGW A;  4DFZ E;  5J7B A;  1QL6 A;  2JII A;  3W55 A;  3CY2 A;  2BTR A;  2GSF A;  3PSC A;  2XKE A;  3TEI A;  3UC4 A;  5TE0 A;  3ZOS A;  4EH9 A;  5KMJ A;  2PUU A;  3EL8 A;  3QUP A;  4IJP A;  5HVK A;  3IDP A;  3AT3 A;  4IBM A;  5HOA A;  3O8P A;  4NM5 A;  5CEQ A;  3UVQ A;  5AP2 A;  4U80 A;  2UW6 A;  3NCG A;  2YCQ A;  4HCV A;  4B99 A;  3Q53 A;  3SRV B;  2XZS A;  5M53 A;  5I3R A;  4USE A;  1OL6 A;  5HG9 A;  1JKT A;  4WSQ A;  5D7A A;  4I23 A;  4NUS A;  5EOL A;  4DGO A;  5DR6 A;  4FV4 A;  4GG7 A;  4JQ8 A;  2XBJ A;  2OXX A;  2UZU E;  2WAJ A;  2FO0 A;  5HLN A;  4WG4 A;  4F9B A;  4GYI A;  3LW0 A;  3ZSI A;  4FOD A;  3EN6 A;  2ZV7 A;  4W4V A;  1UV5 A;  4PNK A;  2H9V A;  1WBP A;  5ICP A;  4ZTL A;  3LM0 A;  5HTC A;  3MA3 A;  2GDO A;  3VUD A;  4KNB A;  4GFG A;  3UP7 A;  2H34 A;  2R3K A;  4EWQ A;  1XO2 B;  5DEW A;  4DTK A;  3R6X A;  1YW2 A;  2W0J A;  4FI1 A;  4FV7 A;  2JKM A;  4OTD A;  4XOZ A;  3OOM A;  3P1A A;  2W06 A;  5M44 A;  1W2C A;  2WGJ A;  4FTT A;  3FI3 A;  2F7X E;  3FZR A;  4KAO A;  5KO1 A;  3H10 A;  4YP8 A;  1H8F A;  1X8B A;  4W9X A;  3D2I A;  4TZR A;  2FUM A;  4D4V A;  1LR4 A;  3C13 A;  3V5J A;  3D7T A;  1OM1 A;  4FRF A;  4QMO A;  2WOT A;  4RVT A;  2VWV A;  2BHE A;  4BIE A;  4MD8 E;  5B7V A;  1R0E A;  2EXC X;  3QL8 A;  4ZY5 A;  3SA0 A;  1SVG A;  1Y91 A;  1WMK A;  2RSV A;  5AJQ A;  4AN9 A;  5KX8 A;  1OI9 A;  3DAE A;  5IA4 A;  4EBW A;  1PHK A;  4O0U A;  4FTJ A;  3DOG A;  3SXR A;  4M69 A;  4GW8 A;  4AAA A;  3KF7 A;  5BUE A;  4PNI A;  2REI A;  4GUE A;  4QPA A;  3RAI A;  2OJF E;  2FVD A;  3VN9 A;  3B8R A;  3A62 A;  3G6H A;  4O1P A;  1CSN A;  2XCK A;  5LCK A;  3V6S A;  4QP6 A;  4ZP5 A;  4BDH A;  2HW7 A;  2UW9 A;  4FZD B;  3OCS A;  3T3U A;  4IB5 A;  4MX9 A;  2PE2 A;  3BLQ A;  3QBN A;  4NU1 A;  4PPB A;  3K3J A;  4Y5H A;  5EYD A;  3SD0 A;  3W2P A;  3BYU A;  4FIC A;  3DFC B;  3HA6 A;  3ZO3 A;  4D1X A;  1PMV A;  4AWI A;  2X9E A;  3K54 A;  3MY5 A;  3WYY A;  4EL9 A;  2I0H A;  4CXA A;  3FL5 A;  3R9H A;  4P5Z A;  4ARK A;  3UIX A;  2XRW A;  1M52 A;  5FBO A;  3DJ5 A;  3EZR A;  5CEK A;  5CF8 A;  3JVR A;  4FUX A;  2X0Q A;  3TCP A;  3GU7 A;  4RJ8 A;  4C02 A;  2WU7 A;  3Q9Z A;  4HZR A;  2VTL A;  1MP8 A;  4PUZ A;  4YJN A;  5DI1 A;  5FGK A;  5M4F A;  5E1E A;  5H8B A;  4A4L A;  3F69 A;  3F5U A;  2WZJ A;  4L00 A;  4NST A;  4WBO A;  4Z9L A;  2FB8 A;  4IEB A;  5LOH A;  4XLI A;  4K18 A;  4O27 B;  4GMY A;  5CSP A;  3E7O A;  2GNL A;  4M0Y A;  4G1W A;  5EW8 A;  5CVF A;  5CAP A;  5LMK A;  1Q41 A;  3FZO A;  1GNG A;  1ZMV A;  4IVB A;  3ZDU A;  4ZTH A;  5L6W L;  4S34 A;  2ZB0 A;  3PJ2 A;  4K77 A;  2YN8 A;  4RIX A;  4IAZ A;  2YAK A;  1SZM A;  4F7S A;  4HVD A;  1Z57 A;  5IUG A;  5AR8 A;  4C59 A;  3DKG A;  1ZY4 A;  4QP9 A;  2WTV A;  5C1Q B;  4LFI A;  2XP2 A;  3P23 A;  3QKL A;  3ZUT A;  3H30 A;  4EOP A;  3C4Z A;  3UO4 A;  3ZU7 A;  4FZ7 A;  1OPL A;  2X9F A;  4FIF A;  4GS6 A;  4AS0 A;  5A4L A;  4OAV B;  4C57 A;  3REP A;  2XK3 A;  3T9I A;  2YEX A;  4TWP A;  2VTP A;  3IDC A;  1F3M C;  1RDQ E;  4H39 A;  1YWR A;  3R8P A;  4WNK A;  2ERZ E;  5DIA A;  3POO A;  5K3Y A;  2BRH A;  4XYF A;  2YA9 A;  1DAW A;  3KXM A;  3NUS A;  4QMS A;  3NIZ A;  3VBY A;  5IIS A;  5EDR A;  5EW9 A;  2CJM A;  2ETK A;  5IUH A;  3PZH A;  5D11 A;  5EHO A;  3BE2 A;  3UOH A;  4ZLZ A;  5ANJ A;  1W83 A;  4E4N A;  2HEN A;  4OTW A;  2HXL A;  3MVJ A;  3PA4 A;  3D7T B;  4ITI A;  4RLK A;  3U8W A;  5CEO A;  1PXN A;  2PVM A;  4DHF A;  3FWQ A;  4F64 A;  3QYW A;  4I24 A;  3FHR A;  2QCS A;  2YM8 A;  5DGZ A;  4MQ1 A;  4BIC A;  4IFC A;  4RLL A;  4YBK A;  1H0W A;  5EW3 A;  5A14 A;  2ZDU A;  2XA4 A;  3QWJ A;  4E6A A;  4M69 B;  5CF4 A;  2WNT A;  3OTV A;  5E90 A;  4WOV A;  4Y85 A;  3GEQ A;  4JBP A;  3EQB A;  3HLL A;  2XNO A;  4FV8 A;  4WSY A;  4CZT A;  4RWK A;  4HYS A;  2Q0B A;  2HY0 A;  3V8T A;  1ZZL A;  4FIJ A;  4FG8 A;  2YM5 A;  2C1B A;  3NWW A;  4EYM A;  3RK5 A;  4JJR A;  4D28 A;  3UQG A;  4J99 A;  3UDB A;  3TT0 A;  4UMT A;  3NEW A;  2IN6 A;  1OL1 A;  5DE2 A;  2GHM A;  3AD4 A;  1PF8 A;  2E9P A;  5I9Z A;  5AR7 A;  4OLI A;  3KA0 A;  1FQ1 B;  4L43 A;  4YLL A;  5F1Z A;  5EYK A;  3OCT A;  2BRG A;  1J1C A;  3KRJ A;  3ORO A;  4FSU A;  4MXX A;  5TKD A;  4BDA A;  4DN5 A;  3KRX A;  3VS3 A;  4DG3 E;  4W9W A;  5GNK A;  4RWL A;  1Q8Y A;  2J51 A;  2C0O A;  4UV0 A;  4EJN A;  5CXH A;  3VJO A;  1TVO A;  2BVA A;  4TKS A;  3UPX A;  5HIC A;  3VQH A;  4CFX A;  5K5X A;  4TNB A;  3F3T A;  4K2R A;  4BGH A;  3EQI A;  2XIR A;  2EUF B;  4I6B A;  4UEU A;  4QO9 A;  4BDF A;  3IW6 A;  5DHJ A;  2DYL A;  4FR4 A;  4XV3 A;  5HIB A;  3WF6 A;  4RIX B;  1OMW A;  2PVR A;  3IW8 A;  5CEM A;  3ORT A;  2GHL A;  5CY3 A;  1QCF A;  2OJJ A;  3FC2 A;  3NYX A;  4I6Q A;  1NVQ A;  3R8U A;  1U59 A;  4QPS A;  3VS5 A;  4RSS A;  2WHB A;  3VW8 A;  2G15 A;  5EH0 A;  3TG1 A;  3ZO1 A;  5I3O A;  3ZC6 A;  1Y6A A;  5HO6 A;  3FLY A;  3PSB A;  2C5V A;  5KCV A;  5JK3 A;  3BLR A;  2BRO A;  5L2Q A;  3IW4 A;  5EKO A;  2C5O A;  4B9D A;  1VR2 A;  3HYH A;  1GJO A;  3MIY A;  3OXZ A;  2W9F B;  4BCG A;  4QMV A;  4UY9 A;  4BCQ A;  4CT1 A;  5L2W A;  5J8I A;  2OF4 A;  5KNJ A;  3C5U A;  4KBA A;  4ZIM A;  3SC1 A;  5LMB A;  1YXV A;  3ZDI A;  3L9P A;  4MXA A;  3LAU A;  3DBQ A;  4GU9 A;  3KKV A;  3OD6 X;  4P90 A;  3R7Y A;  4CV8 A;  3C4W A;  1U5Q A;  4IX4 A;  3ORK A;  4Y72 A;  5CVH A;  5HES A;  1KOB A;  4KKG A;  4IAA A;  2C6D A;  3RNY A;  1MUO A;  3JUH A;  1IAS A;  4JR3 A;  3IPH A;  3RAL A;  1B39 A;  4YC8 A;  3TKU A;  4QYH A;  2QQ7 A;  4GK2 A;  3MA6 A;  5CF5 A;  3S4Q A;  4G6L A;  3TNP C;  5A3X A;  3W18 A;  3UMW A;  5BQ0 A;  1KOA A;  1VJY A;  2JED A;  2XBA A;  4IIR A;  4HVH A;  2OO8 X;  5CVG A;  3TJD A;  2XVD A;  2W1H A;  1NVS A;  1U54 A;  5I9U A;  5AIK A;  3MPT A;  2E9N A;  2KTY A;  2BZK B;  3A60 A;  3AMY A;  5CZH A;  2AQX A;  3F66 A;  4IAC A;  3DZO A;  3SHE A;  4KRD A;  2PVH A;  1YHW A;  4RA4 A;  3AGM A;  5HI2 A;  4E5W A;  3E93 A;  3QXO A;  1FVR A;  2C6I A;  3PXR A;  3DJ6 A;  3F6X A;  4J96 A;  5A46 A;  3GGF A;  3W1F A;  3OWJ A;  1P14 A;  3BV2 A;  2BMC A;  1UWH A;  3KMW A;  3NNW A;  4QMX A;  4DFY A;  5JRQ A;  4M12 A;  2VTJ A;  2YAA A;  2Z7S A;  3P9J A;  5DN3 A;  1BX6 A;  5ANG A;  1R39 A;  3ZBX A;  2BHH A;  4PDS A;  4FZ6 A;  4APP A;  1XHA A;  3G9N A;  1PXK A;  3HEC A;  4NIF A;  4X2N A;  4QOX A;  4QMW A;  2GTM A;  4MH7 A;  4UWY A;  3R00 A;  3PPZ A;  1H26 A;  2FSO X;  3FXX A;  4YZD A;  1SVH A;  4C4F A;  2X8E A;  5T6K A;  3CR0 A;  4XHK B;  4EUT A;  2BIL B;  4F6S A;  3DPK A;  5KBR A;  5HTB A;  1OL2 A;  4G3G A;  2BZI B;  5AX9 A;  4BL1 A;  4U5J A;  5BNJ A;  4PPA A;  4ZSJ A;  3JVS A;  4LM5 A;  3LFQ A;  3F7Z A;  4FTA A;  1PME A;  2QU6 A;  2C3J A;  2HZN A;  3SOA A;  4WRS A;  4D2R A;  4AFE A;  3ENM A;  4DFX E;  4FVQ A;  5KMI A;  2ZM4 A;  4HGS A;  5EI2 A;  3KU2 A;  5T3Q A;  3UIB A;  2VTH A;  3EHA A;  3LM5 A;  3BIZ A;  2LAV A;  4RC3 A;  4AZS A;  4L3P A;  3PXQ A;  4MVF A;  5DR2 A;  3PFQ A;  5KBQ A;  5HHW A;  4FTO A;  3ION A;  3VBQ A;  1L3R E;  3MDY A;  5IA0 A;  4OR5 A;  4YJV A;  4C4J A;  5EHL A;  4F9C A;  3HZT A;  5E8T A;  3KXN A;  4WT6 A;  1RJB A;  2CLX A;  3FKO A;  3CKX A;  3W16 A;  1R0P A;  2YLE A;  3QHR A;  4RWI A;  4O96 A;  3QXP A;  4A06 A;  2B1P A;  3GCV A;  4ANM A;  4W8D A;  3AMA A;  3LZB A;  4ACG A;  2JBO A;  4HPT E;  3Q4U A;  1YXX A;  3L9L A;  2R3H A;  3DDQ A;  4N6Y A;  4PWN A;  4BCN A;  4RX8 A;  2YER A;  3ETA A;  4GVJ A;  4U3Y A;  4YO6 A;  3QD2 B;  4JXF A;  4F1T A;  2ITU A;  3JY0 A;  4R7H A;  5IDN A;  3ZLY A;  4LQM A;  4JG7 A;  4XRL A;  2VX0 A;  3KEX A;  2J90 A;  4DIN A;  4E4X A;  1GII A;  2CCH A;  2GPH A;  3GU4 A;  2VTN A;  2QC6 A;  2PSQ A;  4TRL A;  2C0I A;  4LGD A;  2QHM A;  4QTE A;  3AGL A;  3UOL A;  2JKQ A;  4U79 A;  4Y95 A;  3MYG A;  5DMZ A;  4IH8 A;  4ZSE A;  3PXZ A;  5LMA A;  3UTO A;  3A7J A;  3I79 A;  3PVB A;  4R7I A;  3MJ1 A;  1XKK A;  4RIY A;  4BZO A;  3ZLX A;  4BDC A;  3UNZ A;  4FTM A;  3ORZ A;  2O64 A;  2QOF A;  2BPM A;  2RFE A;  3BV3 A;  3EN4 A;  3GU5 A;  4MBI A;  4IB1 A;  4NZW B;  3VUL A;  5K0X A;  2GNJ A;  4RMZ A;  4WA9 A;  2WTK B;  3DBD A;  3DTW A;  3KMM A;  2NRY A;  5DLS A;  4O6E A;  4BWK A;  4QT1 A;  2I1M A;  4M8T A;  4WO5 A;  5CAO A;  3UOJ A;  4YJR A;  2W1F A;  2I6L A;  3QTR A;  1Y6B A;  2WXV A;  3MH1 A;  3E62 A;  3OZ6 A;  3F88 A;  3LFC A;  2QOL A;  4L6Q A;  4UAL A;  3ZZE A;  2C5N A;  4ANS A;  3GFW A;  4D2W A;  2F9G A;  3RWQ A;  1ZRZ A;  4QMN A;  1GZ8 A;  4CMT A;  3QCQ A;  5FXQ A;  4A4O A;  2IW6 A;  4C35 A;  1Y8G A;  3ZRL A;  4EH6 A;  4DEG A;  4XX9 A;  4YHT A;  2CDZ A;  5CAS A;  5L4Q A;  1LPU A;  1WBN A;  1XBC A;  1XH5 A;  3BU3 A;  3HDM A;  3QTQ A;  4ZOG A;  1YOL A;  4H3P A;  4BCF A;  1GIJ A;  4TT7 A;  3GQI A;  3QQG A;  4D1Z A;  3VBW A;  1W8C A;  2V5Q A;  2XUU A;  2ZMC A;  3LJ1 A;  3UMX A;  3ZEW A;  1AD5 A;  5HE1 A;  2YM4 A;  3QFV A;  2YDK A;  1PJK A;  4PP9 A;  4WNM A;  4L3J A;  4FTU A;  1ATP E;  2QR7 A;  3Q9W A;  5LQF A;  3OXT A;  4YHJ A;  3JS2 A;  3PRF A;  2OG8 A;  2UZW E;  3ET7 A;  2HEL A;  5KHW A;  5CTP A;  2DUV A;  3IOK A;  3GU8 A;  3MFR A;  1WBV A;  3PVW A;  5CNN A;  3CJF A;  5EI6 A;  1PXL A; 
#chains in the Genus database with same CATH homology
 2A98 A;  1W2C A;  1W2F A;  1W2D A;  2IF8 A;  4O4B B;  2X0O A;  2X0P A;  4FRF A;  2IEW A;  1TZD A;  4O4F A;  4O4C A;  2X0Q A;  4O4D A;  4O4E A;  2AQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...