4O4BB

Crystal structure of an inositol hexakisphosphate kinase ehip6ka as a fusion protein with maltose binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
EENLYFQGSFTDGQYLLKPCLSHRERDFYLHIKDDKEWTGTGIIPKFYGVELHEFGFGELEFIRMENLMYKYKRPFVLDLKIGTQTWDPETASSKMKKRLVVDSTSTTTSLGVRFSGMERNIGEEKPILYSRYLCTHEVNTRDSLKEYIKLFFNDGKKYRKELVPYFISQLDKMIEVMKKREYKMFSSSVLFVYDSTTTLEDKKYNCKMIDFAHNWILSEEECTVEDGFLFGLNNLKSILEDIENEFKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein family 1
publication title IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/transferase
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 2.7.4.21: Inositol-hexakisphosphate kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03770 IPK Inositol polyphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.50 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase); domain 1 4o4bB00
4FRFA 1W2DA 4O4DA 2A98A 2AQXA 4O4CA 4O4BB 2IF8A 1W2FA 1W2CA 1TZDA 2IEWA 4O4FA 4O4EA
chains in the Genus database with same CATH superfamily
1KOAA 3C51A 2UZNA 3BBTB 2R3KA 3IW8A 4Y46A 1F5QA 2ZM4A 1OL1A 5KE0A 4AGUA 5LVPA 2W1IA 3TV4A 4X2KA 5FP5A 4MAOA 4K77A 4AA4A 4NKAA 1W98A 4BHNA 3QFVA 2OIBA 4NW6A 2RG6A 3BELA 3VRZA 3QQFA 3UVRA 3KGAA 3HX4A 3QUPA 1U5QA 3MA3A 3LM5A 3DB6A 2H6DA 1W2DA 3FMLA 4RMZA 4EH3A 3R1NA 4WD5A 2WKMA 2WTVA 2OXDA 3MFTA 4N6YA 5AEPA 3TUDA 5CSHA 4F9YA 3VJOA 5IKWA 2BFYA 2P3GX 4FV2A 4RQKA 1Q8UA 4R8QA 4AU8A 3LM0A 4USEA 4W4XA 4RLLA 4CFXA 2CLQA 5I5ZA 2QKWB 1OB3A 3OC1A 1VR2A 3ZO4A 3BBWA 2UZUE 1S9JA 3E93A 4TL0A 1Q97A 5CVHA 5HIEA 2YM8A 3IDCA 3PE1A 2IVUA 4X6QC 4YGAA 5DGZA 2QU5A 4ZSEA 3WOWA 5KKRC 4EUTA 4EQCA 1PXNA 3F3ZA 3OBGA 4RJ6A 1ATPE 5HX8A 4IAYA 4USFA 1NXKA 1SZMA 3F9NA 3SXFA 4JVGA 5E8WA 5IH5A 3TUBA 5JRQA 1H1RA 4YJNA 4PNIA 4BTKA 4XV3A 2R2PA 3JVRA 3LFQA 1XH5A 2XCKA 3BEAA 4I0RA 1OIUA 4CNHA 1XH9A 4FTJA 1Q61A 2GTNA 2BROA 3WYXA 2WTKC 1YDSE 3AC4A 2YLEA 3HYHA 4X0MA 4LV5A 3ZS5A 3RM6A 1ZZ2A 3QKKA 5BVDA 1NVRA 1ZYJA 3KRLA 4QQTA 3ZXZA 2VTSA 3I0QA 4MQ2A 2GS2A 1WAKA 3R7GA 2PZPA 3IDBA 3O50A 4XV1A 3F61A 4IDVA 4IXPA 5EDRA 5EHYA 2O63A 3W8LA 3F7WA 4D1XA 5KZ0A 5CENA 5IA0A 4QT1A 1LR4A 2J5FA 2WQEA 5C03A 4BN1A 2RSVA 2VUWA 4Q9SA 4FSQA 4X2FA 3ZLXA 5HGIA 4H3QA 3R0TA 4L7FA 3QC9A 3IOPA 5EM8A 3UZPA 1Y6BA 4EOOA 4F7LA 2R3PA 2UZWE 4Y95A 3VHKA 5LVOA 2JLDA 5HCXA 4FKJA 4PL4A 4WO5A 3NYOA 2VGOA 3GVUA 4O27B 2X39A 4EK8A 2R3HA 4FVQA 3PRFA 5I9YA 1OITA 3R9OA 4FOCA 4EZ7A 4RVTA 2YM5A 4EOJA 4FBXA 2RL5A 3FL4A 5CAOA 5AMNA 2E2BA 4PL3A 4M15A 4YZDA 3PWDA 4BIEA 2J0KA 5HCZA 4HJOA 4XV9A 5HNIX 2FSOX 3PXQA 4YZBA 1H0VA 3VRYA 4O2ZA 4AT4A 1Q5KA 2XKDA 3V3VA 5H3QA 1O6LA 5H8GA 5B0XA 3KKVA 5TOZA 3LVPA 4BCNA 2Q0BA 4F1TA 1VEBA 4DFLA 5CF8A 3FJQE 2X6EA 3PP1A 3U6IA 1H08A 2ONLC 1B39A 4AWIA 3OTVA 4RT7A 5F4NA 2Y6MA 3R8UA 3ZEPA 3QZGA 3F3VA 4FKWA 3BE2A 4X6RA 4RX7A 5LCJA 4BCHA 3UIXA 4J98A 3P0MA 3RAKA 4NM5A 4AGDA 3A8XA 2PMIA 3EH9A 3KMMA 3UC4A 4K6ZA 4RJ7A 4QP3A 4IC7A 3BYSA 3OY3A 3SQQA 3VBTA 1URCA 4DGMA 4DFZE 5AUVA 4X2GA 3JY0A 1E1VA 4WG4A 4QQ5A 4E73A 3ORLA 2GNIA 2QOKA 3QLGA 3V5WA 4IADA 2W7XA 2P0CA 3NNXA 3E64A 3E8NA 1MRYA 2ACXA 3OP5A 4E4LA 2Z8CA 4I5PA 3WARA 2X4ZA 1RJBA 1JLUE 4XH6A 2XIRA 5I3OA 4DYMA 1JQHA 2B55A 3WZUA 5L2TA 3FUPA 4MK0A 3N9XA 4IVAA 4RIWA 4AS0A 3TJDA 2XMYA 1H25A 2J90A 1ZXEA 4AT5A 4B0GA 2WFYA 4BCGA 4EOLA 4Q5HA 1KSWA 3KXGA 3D5UA 3IK3A 4LMNA 1PXLA 3RPYA 2G2IA 4QQCA 3O96A 4ZEGA 5HIBA 1FVVA 2BHHA 5IEYA 5M53A 2C3LA 5AUUA 2JBOA 2X8EA 4ACCA 5KCVA 3R63A 2JIIA 4QPAA 5IDNA 2RFEA 1RW8A 4TTHB 3COHA 4KWPA 2F2UA 4E4NA 1U59A 2GS7A 2NRUA 3G2FA 5J1VA 3RM7A 3FPMA 1H0WA 4JBQA 5CNNA 5AUWA 1H01A 2A98A 3OWJA 4KIPA 3W18A 4BKZA 4FT5A 2OXXA 3HUBA 4IM0A 3G90X 4BZDA 3V5TA 4S32A 3R1YA 4G31A 4X2NA 2ERKA 3DZQA 3S4QA 3HRBA 4NH1A 2LGCA 5C8NA 4FZAB 4F1MA 2W05A 4FV0A 3ROCA 2VTHA 5FM2A 3D9VA 3RAIA 4FVPA 4W9WA 3UC3A 4V04A 3OFMA 2YCFA 3LFSA 4KINA 5ANKA 3GNIB 3LQ5A 4GMYA 1YI4A 4II5A 3QALE 2AC5A 2E9UA 2X4FA 3MPTA 5EW9A 3A99A 1WFCA 4R1YA 2WMWA 3CS9A 4ZSLA 5HLPA 4MBJA 4PDPA 2JDTA 4YSMA 3T3VA 3TCPA 1AQ1A 4MHAA 4ZY6A 4WIHA 2PMOX 4ASXA 2BKZA 2W99B 4FX3A 4ANMA 4O1PA 3R9HA 1BX6A 3KVWA 4FYOA 4IB0A 4S34A 2GFSA 3NNVA 4J71A 4FV5A 5ANJA 1OL7A 2WELA 3CR0A 4MXOA 2X0PA 3THBA 5AR5A 4R6VA 4U3ZA 2GNJA 2R0IA 3CEKA 4OBOA 3V6RA 4BGHA 4DN5A 2UW5A 4ZZOA 4M0ZA 2ZYBA 2VNYA 4FSNA 4HGSA 4KIKB 4YC3A 4NIFB 3VVHA 3IG7A 4I21A 4O91A 1QMZA 4EC8A 2R64A 2X0QA 3GC9A 2QONA 4LRKA 2Z7SA 5CSPA 4HGTA 1H00A 3FY2A 3D7ZA 1W7HA 3QCSA 3HP2A 3DU8A 3RVGA 4C02A 3ANRA 4IM2A 2ZV8A 3UOHA 3DJ6A 5BYYA 4FV4A 4AA0A 3HRCA 3F3UA 4FNYA 4KIOA 4MNEA 3BWFA 2WTJA 2BZKB 5CEKA 3NZ0A 4XYFA 3RBWA 4JDIA 5A54A 4F1OA 3ZLSA 4KSQA 4LL0A 2OXYA 2CMWA 3VW8A 2HW7A 4YJQA 1H1WA 3MH3A 5L6WL 3DBCA 4FKRA 3FZSA 4EK6A 2VRXA 2VWYA 3C0HA 4AA5A 3C13A 2V55A 3CCNA 4I20A 4K2RA 4OBPA 4BI1A 3GOPA 4KS8A 5KBRA 5HLNA 3TG1A 1ZYCA 4BBEA 3DKFA 4W4VA 3R7OA 1OIRA 3V01A 1FMKA 3PXYA 3BYVA 2ETMA 4I41A 5A4QA 4M8TA 4FTMA 1KWPA 1R78A 3AC3A 4YJUA 4E26A 2C3JA 3QKLA 2AUHA 3BU5A 3M11A 4EOPA 4FTKA 2VWUA 5EYMA 5FQDC 4LV8A 3DBQA 2UW6A 3CGFA 3CXWA 5L3AA 3FHRA 5EHLA 4C2WA 4CFMA 4LYNA 3HMNA 3QQUA 4CYJA 5EM6A 4F0FA 1PMUA 2W1EA 4FKPA 3FZ1A 3RHKA 5JH6A 2GNLA 4G1WA 2OGVA 5HEZA 4U7ZA 4U40A 4L7SA 2OZAB 5JZJA 4USDA 4DFNA 4G6LA 1UVRA 3TKUA 4PL5A 4GVJA 2VN9A 3R7UA 4RRVA 4BHZA 3BGQA 3TIZA 4XG3A 3ROYA 2QCSA 5ANIA 4QO9A 4U42A 4EZ5A 4UYAA 3MJ1A 4FIGA 2YDIA 4DEAA 4ANBA 2PZIA 2R5TA 2F7ZE 4O0UA 3ZZEA 3S0OA 4I0SA 5ITAA 3SRVA 3LW0A 3R83A 2PZYA 4GS6A 3ZO3A 3HUCA 2J0MB 4D28A 4BC6A 2IZSA 4DEIA 2IZUA 4RX8A 4V0GB 5AR4A 2A0CX 4P2KA 3P7AA 4BBFA 2PVNA 3NIZA 2VWBA 5L8JA 4CXAA 4GL9A 5D9HA 3O8TA 4XRLA 3NX8A 5ETIA 2C6LA 4ZTQA 1V1KA 3D0EA 3V8TA 4Y5QA 2WHBA 1TVOA 3QXPA 5GJDA 5I9VA 2W4JA 2X2MA 4QMXA 5CWZA 1OL6A 5I0BA 4PPCA 2ZMDA 3NUXA 3KFAA 4QRCA 4YTFA 5DMZA 5HD4A 4MWIA 5J9YA 4RIXA 2CHLA 2HY0A 4F9BA 2HENA 2X9EA 4QMSA 2VTNA 3OW4A 2JIUA 4HVDA 3D4QA 2PZRA 4W9XA 4CT2A 3BV2A 4F7JA 2PMLX 1U54A 4TYGA 1R39A 3OHTA 4RWKA 4FSWA 2ZVAA 3ETAA 4RX9A 4EHGA 5IUGA 3P7BA 4C38A 4QMPA 5J9LA 2VWWA 2YJSA 3KF7A 3FXZA 4H39A 1SVHA 5LWNA 4M7IA 4BIBA 5EK7A 3ODYX 3H10A 4XOYA 3Q5IA 4DHFA 3O23A 2CKEA 2GHLA 3AC2A 4L6QA 3SDJA 1DM2A 2CDZA 3MGYA 2XIXA 3OS3A 4KABA 2PE1A 4KIQA 1UU3A 2YM4A 4BZOA 4EWHA 3PVWA 4J8NA 4EYMA 4OTFA 5DI1A 5A4EA 3FI3A 1P14A 3H4JA 3SHEA 5KMIA 4J8MA 3E8EA 2A19B 4TPTA 3IS5A 3WILA 3GFEA 4YC6A 2YDJA 3GBZA 4L43A 4MH7A 5T3QA 3EN9A 4U8ZA 4UMPA 3OF0A 3BGZA 3QD0A 4LOPA 4NKSA 1Q99A 4R5SA 3NNWA 3EKNA 4YJTA 2WD1A 2X1NA 2UZLA 4D4RA 5HVYA 4FV7A 5HG9A 3PP0A 4HOKA 3MVLA 2FUMA 2CGWA 3KRXA 4IC8A 2YLFA 3LPBA 3KULA 3Q3BA 5HTCA 3FMDA 4X2JA 5ETCA 1XR1A 2OKRA 3DCVA 2YN8A 3QHRA 1M7NA 4P90A 4QMQA 2JKMA 2C0OA 3O8UA 4IWOA 2HZ4A 3LCDA 3TZ8A 2EB2A 3UODA 4E6AA 5TE0A 3I5ZA 4OTIA 4IJ9A 4QYFA 3RZFA 3UP2A 4C36A 4Z16A 5GZAA 5KMLA 2GDOA 4D1SA 4LFIA 3QX4A 5DPVA 3ORZA 4DG3E 4QQJA 5H2UA 1JOWB 2B54A 2IVTA 3RZBA 4NCTA 4A07A 3NW7A 3QTRA 4O22A 5KMOA 3RMFA 5HOAA 4C4JA 3VS5A 5KX8A 3VAPA 5JRSA 4L53A 2QOIA 2W5BA 3AMBA 3LQ8A 3QZHA 2QO7A 2BVAA 2VTIA 3ORPA 2QU6A 4IB5A 5AP3A 3P79A 4BZNA 4F7SA 2X2KA 3HDNA 3KCKA 4IWDA 1MQ4A 4EQMA 3HMOA 5ANEA 2A1AB 4O2PA 3UPZA 2F7EE 4NM3A 4B99A 4IMYA 4FKLA 5CAQA 3K5UA 3GC8A 3EJ1A 5I3RA 4F9WA 2WMTA 3QZFA 5D7VA 4JQEA 4BTMA 4JR3A 2SRCA 4UB7A 4ONAA 4BCPA 2BZIB 2C6KA 2C69A 4OT6A 3BIZA 2ZDTA 4FK6A 1OUYA 4ZTSA 3R8LA 3UJGA 1OM1A 2BDFA 4GEOA 1BYGA 1JSTA 5DIAA 3DNEA 2OI4X 5AR7A 5DBXA 2NO3A 1NVSA 2YEXA 3LCSA 3ERKA 3A60A 4I93A 3L9LA 2G9XA 4HPUE 2FH9A 5J8IA 1DAWA 4MXAA 4F6UA 3ZDUA 4B6LA 3ACJA 3D5XA 3PJ8A 2C5VA 2Z2WA 3OBJA 4FG7A 5IA4A 5AP5A 5I9WA 4PMMA 1V0OA 2R9SA 4Z7GA 3SV0A 3JYAA 2QOQA 5CSVA 3F3WA 4TYIA 5CYIA 3L8SA 4FTUA 3U6JA 1I44A 4XG9A 3QC4A 5J95A 3VS4A 5EW3A 3SW7A 4B9DA 4FIHA 4UEUA 4BCJA 4JBOA 4L3LA 3VW6A 2WEIA 5BX0A 4TWCA 4XS2A 4FV8A 2X9FA 1ZY5A 2B4SB 3N51A 4O0SA 2OJIA 2OF4A 3ZOSA 5ICPA 4TNBA 3MVHA 4U97A 3MY5A 1V0BA 3SVVA 4DEHA 5AP7A 4S31A 4IDTA 1GIHA 3HV7A 4FKTA 3EFLA 4I1ZA 4ZSGA 2VTJA 2BTRA 3TIYA 3VQHA 3WF5A 4IX3A 4G5JA 3MSSA 3FWQA 3KF4A 4FV3A 2VD5A 5CT7A 5AIRA 4AOJA 4AW2A 5BPYA 3EZRA 1Z9XA 2JAVA 4QMOA 1UKIA 3DA6A 4J99A 3FZOA 4K11A 4LL5A 4ZSJA 3P5KA 4M3QA 5HZNA 4G34A 2WMSA 1PKDA 3MV5A 5DRDA 4A9SA 3RP9A 2UZDA 1WZYA 4WKQA 5DEWA 5FXRA 4ENXA 3DB8A 3K5VA 2IF8A 1VZOA 2BAQA 4JLCA 5CLPA 1YOJA 1PXIA 4F9AA 2CGXA 3NW5A 1AGWA 4X3FA 3E8DA 4FTNA 3UVPA 4CFWA 2X7OA 4I92A 4MCVA 3ZYAA 4OTWA 4YTHA 4BDHA 4AE9A 2X2LA 3GQLA 3BU6A 3OXZA 3UIBA 3ZCLA 4G3CA 3K3JA 3M2WA 3KN5A 5JGBA 2W4KA 4IAIA 3CGOA 4IW0A 3T8OA 4EEVA 4E4XA 2PTKA 2WB8A 3C4XA 3CKXA 4WRGA 2ITXA 4EONA 3QBNA 4DFXE 4LG4A 2W1FA 5HD7A 2FGIA 2UW8A 3ITZA 3PTGA 4FIJA 2YFXA 3PRIA 2PE0A 4I6FA 2ZB0A 3PJCA 4MXZA 4ZJJA 5CTPA 3HZTA 3NUNA 5C9CA 4BVUA 3OXTA 5KKRB 1YVJA 2C47A 4G2FA 3HMMA 3TNPC 3MWUA 3WIGA 3FKLA 1OIYA 3AGLA 4NW5A 1K2PA 4A9UA 3AQVA 5KMNA 4FT0A 4KAOA 4MX9A 4O0TA 1YHVA 5EFQA 3TZMA 4QMZA 4AZVA 5CEOA 5C1QB 3NNUA 3UQFA 5DR6A 3NUUA 4ITJA 1RE8A 4MXYA 2RF9A 5L2QA 3SKCA 5TO8A 2W5AA 4DGLC 4EH8A 5KHWA 4UX9A 4PMTA 2J4ZA 2HZNA 3NYXA 4UZDA 5IMXA 5EKOA 2VWVA 4QNAA 2WTKB 3MTFA 5LARA 2PVFA 3T9TA 3CIKA 1OKVA 2V0DA 3E8CA 1LPUA 2W96B 3DGKA 3QQGA 1SNXA 4TYHB 3S95A 4QMNA 5IA1A 3K3IA 4BYIA 1PF8A 3PXKA 4Y72A 4DH5A 2E9OA 2QQ7A 2WQBA 2CPKE 3P4KA 5F1ZA 3CJGA 3TACA 4HVHA 4CTCA 3PYYA 3Q53A 3FKOA 3MFUA 4TZRA 3FMEA 1M14A 4C7TA 4GRBA 2GS6A 5JFVA 1PXPA 4JT3A 3KRRA 4C4HA 3WE4A 3DFCB 2C1AA 2Z7RA 2QD9A 4KSPA 3UOLA 4PTGA 4YNEA 3R01A 1TZDA 2J50A 4JR7A 4MWHA 2X7FA 5ACKA 3VUMA 4YTIA 2XIKA 1G5SA 2WOUA 4FK3A 4GFOA 3RWPA 4JRVA 1QPEA 3C7QA 4IZ5A 4FTOA 1BI7A 2QNJA 3TWJA 1W8CA 4M69B 3W2OA 4IWPA 4FVRA 3GFWA 1OKWA 2VTAA 4YLJA 2PWLA 5HTBA 2WIPA 3HP5A 5K0XA 2PE2A 3ZZWA 2B9FA 4QP7A 5E8SA 4ASDA 2R3OA 2WTIA 2YM3A 1DI9A 2XBJA 3I1AA 3L9PA 4IVBA 4GT5A 4EH2A 4BDAA 5G6VA 2UZTA 5LXMA 2Z7LA 3DPKA 4C33A 5D41A 2UVXA 3ZFXA 4BDIA 3QRKA 2ETKA 4PY1A 5HE2A 1MP8A 3MS9A 2HAKA 3COKA 3FLZA 5EI2A 1XBBA 3LZBA 4ACDA 3CPBA 2UZBA 5CX9A 3BQRA 3QU0A 3RPRA 3QF9A 4APCA 3BLHA 5KMMA 4UWYA 3R00A 5HHWA 3PJ1A 3ZLWA 3MDYA 2UZEA 3KRJA 3ZUVA 1TQMA 2EWAA 2OBJA 4LGGA 1NVQA 4DFYA 4QP1A 3DBEA 4UV0A 2VX0A 3LJ2A 1BKXA 3E3BX 5K3YA 5DT4A 4UMRA 5HNGA 3W2QA 5BUIA 2ZV9A 3QUEA 4KBCA 4QMYA 2UW3A 4EH9A 4XLIA 3BHTA 3SOAA 5B7VA 4ZOGA 2XJ0A 3P23A 4PDOA 1OI9A 4C3RA 3PPKA 3FDNA 3OT8A 1JPAA 5AA9A 4OUCA 3UYTA 3W2RA 2C6IA 4DGNA 2ITOA 4YNOA 2P55A 3DJ7A 5IDPA 2I40A 4K0YA 4H3PA 3OCBA 4EK3A 3SD0A 4PNKA 1PKGA 4O0WA 2OJGA 5AP4A 1P4OA 5JFWA 4FNZA 4KA3A 2H34A 1ZMVA 2IW8A 3R04A 3ZRMA 4EJNA 1MQBA 5AX9A 2C5YA 4RZVA 4EOQA 5IA2A 3W8QA 3MTLA 4YLLA 1ZWSA 4WSQA 2I1MA 2P2HA 4P5QA 5HORA 2OJFE 2VO0A 3FXWA 3OOMA 3PY3A 4FSTA 3FQHA 5C01A 4MD7E 3GCVA 5BVFA 4NZWB 4AXAA 5L8LA 3CKWA 3EQGA 2BDJA 5CSXA 5JN2A 1U4DA 2UV2A 3HA8A 4FTRA 4IZYA 4H36A 4I3ZA 4GVAA 2XBAA 5E90A 2BALA 3PUPA 2YAAA 3F5UA 5FBOA 4ZTRA 1MRUA 3WF7A 3WYYA 4EHZA 3VS1A 4IACA 3FY0A 4D5KA 1Y8GA 4AZEA 4RIOA 4H58A 3EHAA 1EH4A 2YHVA 4Z55A 3MPMA 2R3GA 3FZRA 3IW6A 3OCGA 2XYNA 3KU2A 2XKFA 3HNGA 3TV7A 2EVAA 1XH4A 4C3PA 3V5LA 4BKJA 3R7VA 3CD8A 3QRUA 4L68A 4EORA 2DYLA 3FYKX 4ALVA 3EFWA 5I4NA 4EH6A 2Y9QA 1OIQA 2HWPA 3A2CA 4OLIA 5EM7A 4AE6A 4QMWA 5L2WA 5DEYA 4I6HA 1MRVA 4NCTC 4F9CA 3GGFA 5AP6A 3LAUA 5E8ZA 3I60A 3QA8A 4UMUA 4FNXA 2WMUA 3BV3A 3UG1A 5HESA 4ZY5A 2C1BA 4XNEA 3TZ9A 2QKRA 5FD2A 2VTPA 4JIAA 3LE6A 4O4BB 3ZC5A 4RWLA 3DK3A 2PVRA 4E3CA 3KA0A 2DWBA 4WOVA 4E93A 4D1ZA 5HBJA 3A61A 3POOA 4IX4A 1IEPA 1OMWA 3F3TA 1OPKA 1M2PA 3M1SA 1OL2A 3NDMA 1BMKA 4AAAA 3OROA 3O0GA 1Y8YA 1XKKA 2FB8A 4HGLA 3RGFA 3PXZA 3Q2MA 4EH4A 3BZ3A 5L2SA 1P2AA 2AYPA 4AOIA 4RC2A 5EHOA 3E7VA 5F20A 1YXXA 3PXFA 3VN9A 2YJRA 2Z60A 2YA9A 5CAPA 4YO4A 4I94A 5FXSA 3DBFA 3TJCA 4CKRA 4FTIA 4IB3A 4N70A 3V51A 2Y8OA 5K9IA 4ITHA 4FZ6A 3KMWA 3RCDA 3ZLYA 4UMQA 1YHWA 1U46A 3ACKA 2A27A 2GHMA 4IX6A 3VNTA 5E8XA 1H27A 3HEGA 2R3NA 4QMVA 4FL1A 4IH8A 4IAAA 2O2UA 3GC7A 4M97A 2GNFA 2RGPA 4RJ5A 4NM7A 5IISA 1H07A 2FYSA 3MI9A 3QTSA 2X6DA 4D4SA 3FC1X 3NYVA 3OEFX 4XV2A 3MN3A 5A6OA 2J0LA 3A4OX 4CMUA 3I6UA 1YI6A 3A7FA 1WBSA 4C61A 4FG9A 3RWQA 3IDPA 4GJ3A 3PA4A 2YIWA 5C8KA 4CRLA 3ORXA 4NT4A 2JITA 4J1RA 3GU8A 4GSBA 5AWMA 4MD8E 4BB4A 1CMKE 3QRTA 3MW1A 3R7YA 3WE8A 4JOAA 5E8VA 5HBEA 5L6OA 3QWKA 2QOCA 3F88A 3UNJA 2YIRA 4HVGA 3SXRA 4NM0A 3W33A 3FLYA 4TXCA 4ALWA 4UWBA 4G3GA 3QRJA 1GAGA 5AP0A 4EOSA 4JBVA 4WNMA 2FSMX 4W4YA 3P7CA 5DVRA 3R71A 1J91A 5AV2A 2Y4PA 5AP1A 3H9FA 1XWSA 2IEWA 4TW9A 3NGAA 3DLSA 2JBPA 4AUAA 4FZ7A 2GQGA 2EXEA 2NRYA 5CVFA 3RKBA 3HGKA 4XX9A 2PHKA 5K4IA 3QTUA 4CFUA 4AZSA 4FC0A 4JRNA 4ACHA 3NPCA 3FHIA 1E9HA 4E6CA 3CTJA 1WVXA 1JKTA 4ANQA 3SXSA 1ZOEA 2C0IA 4JI9A 4A9TA 4FTLA 1J1BA 2XEYA 3ZC6A 2CN5A 2B9IA 4J96A 2CN8A 4U0IA 3BLRA 4X3FC 5IUHA 3AD5A 3A7GA 2XVDA 1UV5A 3EFKA 4BGGA 5IPJA 1HCKA 2YIQA 1UWJA 3G0EA 3IKAA 4C4GA 1W82A 3T9IA 4QYHA 3D7TA 4N6ZA 3LXLA 2EXCX 2DUVA 4DG0E 4AP7A 4FL3A 2JFMA 2XNEA 1LP4A 3C4EA 3ELJA 4J52A 3Q52A 4PRJA 5G1XA 5T68A 4AZTA 5JZNA 2UW7A 3QA0A 4YPDA 4AN2A 4DEBA 4ZAUA 2C68A 4BI0A 4D4VA 5AIKA 4CV9A 2F57A 2I0YA 4HZRA 4MD9E 3IW4A 4F6SA 4YLKA 3VS0A 2W1DA 2C5XA 4L42A 4YHTA 2H8HA 3D14A 4HYUA 4IQ6A 3GEQA 3BYUA 5GHVA 5EM5A 3Q32A 4CD0A 4FGBA 2X8DA 5HO8A 2ITQA 3KXXA 1DAYA 4KKGA 3RK9A 3P86A 5EYDA 4E7WA 4XG7A 4U44A 1VYWA 3TNWA 4RVLA 4FMQA 4IAFA 2PSQA 4GK2A 4O4CA 5EYCA 4EZ3A 4JG6A 3FI4A 4FZFB 1PMNA 2BRMA 3CP9A 4TWNA 2VTQA 4RFYA 3W16A 4ALUA 4ARKA 3OCTA 1SNUA 1YWRA 5J79A 2AC3A 1GZOA 1UNLA 3SAYA 4RIYB 3QTIA 3ZO1A 4BL1A 3TNIA 2BIKB 2QHMA 2XJ2A 1ZYDA 3IGGA 4NJDA 2C3KA 1M2RA 5T6KA 3HV5A 3GENA 4G3FA 1Q41A 2UW9A 2PVJA 2R3QA 3GCUA 2R3JA 3DKCA 4R3CA 3O17A 4IJPA 5CXHA 3QCXA 4GW8A 1IRKA 3UGCA 1ZAOA 4K9YA 4PWNA 4TRLA 4BDBA 4C0TA 2QOBA 1I09A 3AC1A 3PY0A 4UBAA 2VNWA 4HNIA 4YJSA 5H8BA 2C6MA 5AV4A 4KKHA 5CF6A 1QCFA 4AX8A 1XBCA 5A4TA 3ENMA 2CGUA 3F5PA 3QZIA 4O0VA 1URWA 4FTTA 4BYJA 4S33A 3LXKA 2JAMA 4PMPA 3E3PA 1YWNA 1YDTE 4MKCA 4ZTMA 2BZHB 4CT1A 4OR5A 2VZ6A 3BYMA 5CEIA 3TL8A 4L46A 3FMKA 3AMYA 5GNKA 1WBNA 3KXMA 4RFMA 4TYEA 4BCMA 5JSMA 4GCJA 3NWWA 1YXSA 1FOTA 2BRGA 1Q8YA 3JXWA 2XJ1A 5F95A 2ITVA 4FIEA 5CSWA 4C34A 2XK8A 3MBLA 1BUHA 5L4QA 5M4FA 4QTEA 5ANDA 3FZPA 2ERZE 3W1FA 3IOKA 3T3UA 4F08A 3CD3A 2X8IA 4YHJA 3PZHA 3FXXA 1VJYA 3UOKA 1UNHA 3JY9A 4AT3A 1CTPE 1GZKA 1GOLA 3MJ2A 3DAJA 1WVYA 3POZA 2VTMA 4M14A 4MQ1A 4OT5A 2WZJA 3RCJA 3WIKA 1JSUA 2O5KA 1M52A 2Q0NA 4CV8A 1S9IA 2YM7A 2BRNA 2EXMA 2YITA 5HBHA 4ZJIA 2C0TA 4MEDA 2VTRA 5FEEA 4AG8A 4NWMA 5EOBA 5IEVA 3EOCA 5LVLA 3R8MA 1CKIA 1W84A 5E8UA 2H96A 3ZRKA 2XM9A 4G3DA 4L01A 3PG3A 3Q4CA 3CQEA 4K18A 4EQUA 5AUTA 2PVMA 4OTQA 3WZDA 5CXZA 4Y5HA 4FI1A 4H1JA 1BI8A 3QCYA 4HYIA 3FE3A 4Q2AA 5TT7A 2YACA 2ZM1A 1HCLA 3LCOA 3TKIA 2UZVA 2XA4A 1FPUA 3JVSA 3K54A 4XOZA 4RIWB 3A7JA 2WIHA 1YI3A 5EI6A 3TN8A 3UQCA 3PJ2A 3Q4TA 3ZHPC 4FSUA 1H1QA 4FTQA 4I24A 4U9AA 2W1CA 5HNBA 2IZRA 4AGWA 5JEBA 2QR8A 4XG6A 5LMAA 3S2PA 3U4UA 1UA2A 2OICA 3PJ3A 2EUFB 3CE3A 5HE3A 3EZVA 1Z57A 4M68A 3LFDA 2IWIA 3B8RA 3LXPA 4CFVA 5L8KA 1FGKA 2XNOA 1R1WA 2QG5A 2YCQA 2O0UA 3PA3A 3DAEA 3RALA 4F65A 2H9VA 4O0RA 4EYJA 3DDQA 4C58A 4CQEA 3MB6A 3DLZA 2ZV2A 4DCEA 4FR4A 4I5CA 4XG8A 1GJOA 5DLSA 4CVAA 2BILB 3F66A 4FL2A 5FEDA 4IB1A 3D2KA 3AC8A 5B2LA 2B53A 5HE0A 1XHAA 4E6QA 5M4UA 2BPMA 2RFNA 4EC9A 5J1WA 4U6RA 5IH4A 5BVKA 1IASA 3EYGA 3FMHA 3W2PA 2PVYA 2WMRA 1TQIA 1JAMA 3L9MA 2HOGA 5LCKA 3A7IA 3KK9A 5JGDA 1STCE 5E92A 4MXCA 3EQDA 5JFSA 3KL8A 5AR3A 4OGRA 2Y0AA 5AM6A 4YZNA 3TTJA 2ITUA 3FL5A 4I6QA 2CCIA 4Y83A 4O96A 2YCRA 4M66A 3VO3A 2PVKA 2VTOA 3AC5A 2PY3A 3FBVA 4P5ZA 4YTCA 2XIZA 3S1HA 1CSNA 4EH5A 3ZH8A 5M56A 3KMUA 3BEGA 3V6SA 2G2FA 1XBAA 3UDBA 3TV6A 4B7TA 3BLQA 2W0JA 3EB0A 4N4SA 2OO8X 3Q04A 4CZUA 3R28A 4UALA 4DLJA 1KE8A 2I0EA 3NLBA 4RJ4A 4CMOA 1OKYA 4BWXA 4IVDA 3PE2A 4QNYA 3EYHA 2GPHA 3DFAA 4M69A 4DLIA 3O2MA 5H9BA 2ZJWA 3CLYA 5BUJA 4Z7HA 3AD4A 2XB7A 3BQCA 3CTHA 3WF9A 3HLLA 3LFEA 3WI6A 3PG1A 4O6LA 5HICA 2WTCA 3QD3A 2QO2A 5CZIA 3HV3A 3ZU7A 5FTOA 3U9NA 3D83A 5HO6A 4F6WA 3WBLA 1U5RA 5K5XA 4CKIA 3R7IA 4EHEA 4K1BA 3MVMA 5HTIA 4AQCA 2CGVA 3NAYA 5K5NA 2ZMCA 1JKKA 4XP3A 4MNEB 4QPSA 4M0YA 3FLSA 3Q9YA 1K9AA 4ZIMA 5FTQA 3UG2A 2IVSA 2YABA 3EL7A 2UVYA 3REPA 3IW5A 2QURA 4RG0A 2LAVA 4H3BA 4OTDA 1A9UA 3G51A 2I0HA 1REJA 3FLWA 3IONA 1KV2A 3LXNA 5DNRA 3AD6A 4UXLA 4GYGA 3HKOA 1BL6A 1OZ1A 2XKEA 4FT9A 3UQGA 4L00A 3COMA 4I0TA 3P08A 3UO6A 4OTRA 3W55A 3PVGA 4ASZA 3C4WA 4KRCA 5LMBA 3BKBA 3I79A 3IO7A 2R3LA 3LOKA 2XCHA 4IZ7A 2YAKA 4WBBB 2QO9A 3C4ZA 4FRFA 2HWOA 4QTDA 4U3YA 3KC3A 5FGKA 4F0GA 4QYEA 3DAKA 3DT1A 4FTAA 4O6EA 2XK3A 5HLWA 5FLFA 3C50A 4R5YA 3R8VA 3ORMA 5DWRA 5J9ZA 1TKIA 3KB7A 3R2BA 1XO2B 2XK4A 2YIXA 3RNYA 4DINA 5BMMA 2PVLA 2BCJA 5CEMA 4U5JA 3Q5ZA 3GU4A 5E1EA 2OH4A 2X7GA 4BWKA 4B4LA 3E87A 5HCYA 3U8WA 4HVIA 3SA0A 1X8BA 2BAJA 3R73A 3ZEWA 3EQPA 4FG8A 1FINA 4MVFA 2QOOA 4DH3A 2WU7A 4L44A 5M55A 4FKOA 4V05A 5JK3A 2HZ0A 3ORTA 4Y85A 4C59A 1GZNA 5GJFA 3QQHA 3FSFA 3VS6A 2XNNA 4CFNA 5A4CA 2BFXA 4D2WA 3C5UA 3EMGA 3BHYA 4RWIA 4RZWA 3QGWA 4QMLA 1GIJA 3KK8A 4G16A 3SRVB 1IG1A 1XQZA 3ZUUA 3MY1A 4JAJA 4XP2A 3BCEA 4NFMA 1H28A 2WU6A 4EH7A 4ZSAA 5IEXA 3QHWA 3PPZA 4D9TA 1YXTA 3RPSA 2P2IA 1Q8ZA 4XG2A 4YZCA 2WMQA 2OZOA 3ZO2A 1Y6AA 4F7NA 1E1XA 4DH1A 5CEPA 3UO5A 1MUOA 3A7HA 2C4GA 3Q96A 4J53A 4N0SA 3V8SA 4AW0A 3V04A 3G6HA 4GH2A 3R8PA 3ZFYA 4HW7A 5HI2A 4RGJA 4IVCA 5K4JA 4QP6A 1UU9A 1WVWA 4RBLA 4RIXB 3QD2B 4DH7A 3DOGA 5CZHA 3A8WA 3VQUA 2ITWA 4NU1A 4AW1A 3IECA 3R6XA 3VULA 2B52A 5BVNA 4BF2A 2XZSA 1WBWA 4KKEA 3QAME 3O7LB 5DA3A 1U54B 3G9LX 2XK9A 1KE6A 2B7AA 4S2ZA 3MB7A 4U80A 3VUTA 3DQXA 4O1OA 4I22A 4JBPA 4CMTA 4YP8A 1H8FA 1O9UA 1YKRA 2GNGA 4AZWA 4ANLA 4FA2A 5KNJA 5FP6A 5IA5A 5E1SA 1RQQA 4LUDA 4PPBA 1ZOHA 4L67A 1PJKA 1K3AA 1L3RE 2WNTA 4HCVA 2B9HA 2VWXA 1J3HA 5D12A 5EYKA 4RC4A 3FAAA 2FSLX 4CRSA 1NA7A 5CS6A 3ZMMA 3ZSHA 1HOWA 1OGUA 1CKPA 4GU9A 3QLFA 2ZM3A 3JS2A 1UU7A 4BDDA 4D2SA 3LLTA 4EK5A 5DR2A 3FI2A 3QQKA 4CEGA 5AAGA 5B2MA 4I4FA 1UU8A 3AG9A 4L9IA 2ESMA 2F49A 3DS6A 3G33A 4E5BA 4QYYA 2C6DA 3ORIA 4UY9A 4DGGA 4MYGA 5E8TA 3L8PA 4PPAA 5DHJA 5JGAA 4C37A 1O6KA 2BTSA 1PMEA 3HMPA 2RG5A 4FV6A 4O38A 5AADA 5EOLA 4C35A 4GV1A 2KTYA 4GK3A 3KULB 4C4FA 1Q24A 3PZEA 3EWHA 4QP8A 3OUKA 3KEXA 2VO3A 4U81A 5GZ8A 4YPSA 3UVQA 3KCFA 5CF5A 3F69A 1R0PA 4U41A 4YUQA 5GZ9A 2Z7QA 4WRSA 2O64A 4UYNA 4UZHA 2VO7A 4ERKA 2R4BA 3QCQA 2VGPA 4QP4A 5EDQA 3ULZA 5I9UA 2JDOA 3LJ0A 2OF2A 4DEDA 3JPVA 3OVVA 4FZDB 4TY1A 5ANGA 4DC2A 2WTWA 5I9XA 1W0XC 2JD5A 3BU3A 3O8PA 3UBDA 1ZARA 3FZTA 3DY7A 4JIKA 2PMNX 4BBMA 4EOIA 1M7QA 4NUSA 4FSMA 3QTXA 5LMKA 3D5WA 4CCUA 4QP2A 4GT3A 1LEWA 1ZY4A 5FDPA 2YIYA 3FPQA 2QOLA 1QPJA 3GXLA 3I0OA 4KBKA 2FA2A 4PP7A 4A4OA 3TZ7A 1Q3WA 3FYJX 1A06A 1Z5MA 4L3PA 1H1PA 5IU2A 4FOBA 2XK7A 4BDCA 3NUSA 3TT0A 4BWPA 3BI6A 1QL6A 5AX3A 2GU8A 1GNGA 3P1AA 4A9RA 3QTQA 2W5HA 5J7HA 5HE1A 4DEGA 1XH7A 3DV3A 4RJ8A 3VWAA 5CAVA 3L9NA 4ENYA 5FEQA 3TNQB 4GUBA 1JBPE 4JQ8A 5B2KA 2BUJA 3E5AA 3W32A 2W06A 5ETFA 1SVGA 2WQOA 1NY3A 1ZLTA 2X0OA 3G6GA 1ZOGA 3TEIA 5CEQA 4FKIA 3GP0A 3KXHA 4IWQA 2QOHA 2AQXA 3R2YA 4WUNA 2XF0A 4BRXA 4UN0C 2XK6A 3TKHA 4BCOA 5CU0A 2YCSA 1UNGA 5EG3A 2XM8A 4DTKA 5IH6A 5FWKK 1DS5A 3QGYA 3AMAA 2W1GA 1OUKA 4JDHA 3Q4ZA 4FNWA 4KIKA 1REKA 4OAUC 4GU6A 3PPJA 4NIFA 4YBKA 3EKKA 3E92A 2Y4IC 4HYSA 4HPTE 1PYXA 3E63A 3CBLA 3DJ5A 2ITYA 3NYNA 5CAUA 1ZYSA 2XH5A 2VTTA 2XNPA 4PTEA 3MA6A 2VTLA 4FUXA 3M42A 3MH1A 5CU6A 2RKUA 3ANQA 3EQRA 3UE4A 5KMJA 3MH0A 4ZTNA 4RIYA 3UMWA 1TQPA 3IW7A 3Q6WA 5FBNC 3VHEA 4BTFA 4D9UA 3DXNA 1CDKA 1CM8A 1W2FA 3AT2A 3O7LD 3OG7A 3B8QA 3LFBA 1M2QA 4OTHA 3ZSIA 3EQFA 2JC6A 5EH0A 3MVJA 4BDGA 5DRBA 1KE9A 4NTTA 3MFSA 4RSSA 3C9WA 3G0FA 3NCZA 1UKHA 3E88A 3PFQA 4JAIA 4E6DA 5CASA 1Q3DA 2V62A 4PX6A 4FSRA 4F70A 2OIDA 4JNWA 3ZSGA 2XRUA 1T46A 4KNBA 4R1VA 3MH2A 2JKQA 2X0GA 3EN5A 3G5DA 3Q60A 2HELA 4X3FB 5F9EA 2ITTA 4GIIA 4YJPA 3DTCA 3BHVA 3UNKA 3VUKA 4UMTA 5IG1A 3U87A 2WO6A 2V7OA 4BFMA 2IZTA 2VO6A 3ZFMA 5ANOA 4BIDA 4ZLYA 4G3EA 4G5PA 3UYSA 1W83A 3NR9A 3FC2A 4HZSA 4YURA 2WMVA 3ZUTA 3TTIA 1PXKA 3DNDA 4F64A 4S30A 3Q9XA 2PK9A 3H0ZA 4XHKB 3SX9A 4PP9A 1PYEA 1UWHA 3OOGA 4DITA 1AD5A 5KO1A 2JDVA 2W17A 4FIIA 3QUDA 4O4DA 5AUYA 3RK5A 2OK1A 4DBNA 4R7IA 5DT0A 5C26A 3CJFA 5D10A 4FIFA 4AGCA 3V5QA 4G17A 3HECA 2OZAA 4FKGA 2R7BA 3VBWA 1T45A 2P33A 4LUEA 3PWYA 4QTBA 4A7CA 4BCFA 5IF1A 3GCPA 4BICA 3GCQA 3UOJA 4Q9ZA 2YERA 5LWMA 1SM2A 4ZLZA 4WNPA 3EIDA 4C4EA 4R7HA 5LOHA 3IQ7A 4FYNA 2VWIA 5AAFA 4ZY4A 2OU7A 3LMGA 1F0QA 4X7QA 1R0EA 2C5NA 3U4WA 4LOOA 3ZONA 5E7RA 1ZRZA 4IBMA 4L52A 4MF0A 4K8AA 4WHZA 4V0GA 4L3JA 4FSYA 4EBWA 3EN6A 3TXOA 5LJJA 4PQNA 5DFPA 2ITNA 3BWJA 4M12A 4WG3A 3V5PA 4QMTA 4E5WA 5LVMA 4AF3A 4IZAA 3OW3A 4I4EA 4E4MA 1OL5A 2JIVA 3QKMA 4HCUA 2QHNA 1CKJA 3E62A 1J1CA 1YOMA 3ALOA 3D2IA 1ZYLA 1OPJA 4PTCA 4XCUA 4CLJA 2BDWA 4TWPA 1YXUA 2R3FA 3QRIA 3NS9A 3NAXA 3ZDIA 4DG2E 2F2CB 5AA8A 4WA9A 4YBJA 2XS0A 4JG8A 3MPAA 3CPCA 4ZZMA 4LI5A 4QD6A 3MFRA 4G6NA 1FVRA 1QPDA 4TYJA 3FQEA 4F0IA 3A62A 4BCKA 2HXQA 2RIOA 4ZTLA 3KXZA 4E5AX 4ID7A 4JX3A 5AR2A 4EOMA 2YM6A 2JDSA 4D0WA 1W2CA 4JDJA 4JG7A 2WAJA 4OTPA 4XJ0A 3AT4A 3Q9WA 2W1ZA 5JMSA 4PF4A 3F7ZA 3P9JA 5HU9A 3LJ1A 1B6CB 4XUFA 4I5MA 2YDKA 4CZTA 4H1MA 3OWLA 4FV9A 1IA8A 3VJNA 3I6WA 5EW8A 3F6XA 3Q9ZA 4PUZA 5D7AA 4D5HA 3UNZA 3EQCA 5A3XA 4LQMA 1OPLA 5D1JA 4IFCA 5FRIA 4GYIA 3VS2A 5HX6A 3LFFA 4C3FA 4XRJA 1BLXA 4WNKA 4OW8A 2A4LA 4V01A 3PY1A 3COIA 4O0YA 5HIDA 4D2RA 2C3IB 3GU7A 3MY0A 4KD1A 1H24A 3MYGA 3P78A 2HIWA 4JQ7A 1JVPP 3CQWA 3WF8A 1V0PA 4YHFA 5C8MA 4CYIA 1PXOA 3QWJA 4YJRA 3I4BA 3S00A 2R7IA 4GFGA 4ZZNA 3VIDA 2XRWA 4APPA 1WBVA 2QODA 4BGQA 5J7BA 2BHEA 4YC8A 3GCSA 2ZV7A 4LRMA 4K33A 3DKGA 3BPRA 4MF1A 4GIHA 2FVDA 1YQJA 3I81A 4GUEA 2W1HA 3QTZA 3I5NA 5DE2A 4FF8A 3PSBA 3Q6UA 4RWJA 4BDJA 2GSFA 4GJ2A 4IANA 5KZIA 1M17A 3LCTA 3OUNB 4FT7A 4QMUA 5AR8A 2W9FB 3HDMA 3ENHA 1O6YA 4O4FA 3QQLA 4E20A 4D2TA 3W10A 1VYZA 3TUCA 2YZAA 1ZMWA 2E9PA 2NPQA 3PIYA 3FKNA 5L2IA 3H3CA 3AGMA 2JKKA 3FMNA 3Q4UA 2DQ7X 4U79A 3HVCA 5DT3A 1PW2A 3IGOA 1FQ1B 1KOBA 3C4FA 2ITZA 4FKUA 5KMKA 2E9NA 2XUUA 1YW2A 3B2WA 3NEWA 4ANOA 5AAEA 3QTWA 4D0XA 2OFVA 2J9MA 2GMXA 1YDRE 4RLKA 3TI1A 4RA5A 5M51A 5ACBC 4WBOA 2Y7JA 2JKOA 4RQVA 4FTCA 3WF6A 2XIYA 3QXOA 4I6BA 5J87A 4ACGA 4ANNA 3F2AA 4KRDA 4Y73A 3F5XA 3L1SA 5HG8A 4ANSA 4GG7A 4DH8A 2HXLA 3FLQA 4ZP5A 2CLXA 2WMBA 1LEZA 3UO4A 4X21A 5HVKA 4IHPA 3F2NA 3GT8A 4YMJA 3EQIA 2RFSA 3FV8A 4O21A 5JT2A 3NSZA 2WGJA 4ASEA 3PLSA 4DAWA 2G2HA 2HYYA 3AT3A 2JFLA 4AW5A 4EK4A 5KHXA 5LQFA 1WCCA 3UTOA 2QLQA 5HU3A 2IW6A 5BVOA 1KV1A 4YJOA 5FDXA 4XBRA 1PXJA 5DN3A 3EFJA 3H9OA 1Q8WA 4A9YA 2XNGA 4Z3VA 2XNBA 4HVSA 3VBYA 5LMKC 2QR7A 3OY1A 5JKGA 1WMKA 2BIYA 3DK6A 4CSVA 1BL7A 4QOXA 2I0VA 5CQWA 4FT3A 5CY3A 4XMOA 5DH3A 5IUIA 2UZOA 3ZRLA 2GFCA 5A14A 4M67A 3EN7A 1Y57A 4J97A 5DOSA 2W9ZB 4O0XA 3VF9A 4F09A 2CCHA 2V22A 5BUEA 5FM3A 1JSVA 2F7XE 4GG5A 4F99A 2JGZA 4UWCA 1RDQE 2UUEA 4BDEA 3G9NA 1XH8A 3KN6A 5FXQA 1G3NA 1IR3A 2REIA 5D11A 4ERWA 3NUPA 4EUUA 3PA5A 3WZKA 2CJMA 3LCKA 3WZJA 2OJ9A 4TKSA 3U9CA 5AP2A 4LMUA 5DR9A 4BCIA 3CY3A 4R3PA 2BAKA 5K0KA 3V5JA 2RFDA 4IAZA 4FODA 3EN4A 4TN6A 3DK7A 3OZ6A 2HK5A 5TKDA 2V7AA 4U45A 5H8EA 1OKZA 3V8WA 4AACA 4FKQA 4WT6A 3OMVA 3PIXA 4EBVA 5EDPA 2IO6A 2HW6A 1JKSA 3EQBA 4FKVA 4AN3A 2VV9A 4ZJVA 4DGOA 3MIAA 2QC6A 3GU5A 5AJQA 3VUHA 4F63A 1APME 4IFGA 4BDFA 4I5HA 4A4XA 1GIIA 3R9DA 4ZLOA 3BRBA 3W2SA 4I23A 2OJJA 3ET7A 2NP8A 1KE7A 2GTMA 4RFZA 4NJ3A 1F3MC 4QP9A 4TWOA 5KBQA 1SVEA 3LFNA 4WNOA 2ETRA 3OWPA 1B38A 1XJDA 4FICA 3RINA 2J0JA 5IA3A 1PY5A 5AV0A 3R22A 4ITIA 5CF4A 2GCDA 4PMSA 4LM5A 4C4IA 4IAKA 5A6NA 1YOLA 1P5EA 2B1PA 4J7BA 4QPMA 4RC3A 5J5SA 5BVWA 1ERKA 3EL8A 3ORKA 4IX5A 2BMCA 3FLNC 4G6OA 4YU2A 4TYHA 3HMIA 3UP7A 4YO6A 2R3IA 4WSYA 5JQ5A 3UZTA 3DTWA 3DZOA 3BHHA 2VWZA 4L8MA 5M57A 3GI3A 2F9GA 4W8EA 1XH6A 3DQWA 3NCGA 4JDKA 4ZTHA 3D7TB 3D94A 3U6HA 2OFUA 4IE9A 3BGPA 3H0YA 1ZMUA 2R3RA 3I7CA 3C1XA 3RAWA 3L8VA 3ORNA 1JWHA 4X3JA 4W4WA 3ODZX 3OTUA 5CI6A 3S3IA 4CCBA 5HQ0A 3FSKA 2WMXA 3VBXA 3D15A 5CNOA 4M13A 3U51A 4AFEA 4IEBA 3HL7A 5EI8A 5F94A 2PVHA 3HV6A 3R1SA 4B8LA 2WQNA 3RK7A 3F82A 1Q4LA 2O65A 2FO0A 1OVEA 3F5GA 4M84A 3H30A 4ACMA 4EKKA 2BZJA 5A46A 2O3PA 2R3MA 2WXVA 4XP0A 5CANA 2ITPA 2WQMA 2PZ5A 4NK9A 5CVGA 3I7BA 3VS7A 1JNKA 1YHSA 2VX3A 3QQJA 4MTAA 4QYGA 2V5QA 4RVKA 2ZAZA 2ZDUA 3VUGA 4EI4A 2C6OA 4U43A 3AXWA 1Y91A 4WG5A 1H26A 3RPVA 2BR1A 2XP2A 5M4CA 2C6TA 3CTQA 4OTGA 4MBIA 5FG8A 4HCTA 4Q5EA 4CZYB 4YZ9A 5TF9A 2A2AA 4GK4A 1YXVA 3C4CA 4EHVA 2ZOQA 5AV3A 2VU3A 4DEEA 3FQSA 3VF8A 5CQUA 3CQUA 3CY2A 3OT3A 3II5A 3R21A 2ONLA 5HVJA 4EL9A 2G1TA 3R1QA 4IM3A 4GT4A 2W4OA 4O4EA 5HG5A 2EU9A 5EKNA 3PSCA 1GY3A 4JJRA 4HYHA 4WUAA 4F4PA 2QVSE 1P4FA 1SMHA 3TNHA 2IVVA 4J95A 4G9RA 5DG5A 4MNFA 2YISA 2XEZA 3CC6A 3NW6A 3K2LA 1LUFA 5CI7A 3SC1A 3SOCA 3KXNA 3SW4A 3OD6X 3HRFA 3OXIA 5BNJA 2J7TA 2WPAA 2IJMA 1ZZLA 2J0IA 4ZXTA 4Z9LA 4G9CA 3QYZA 3R7EA 2PUUA 3RPOA 3WZEA 5J5TA 3L8XA 3GOKA 4RPVA 3HA6A 4RJ3A 4LOQA 5KUPA 2J5EA 3SLSA 1GZ8A 3EQHA 3R8ZA 3ZBXA 4LGDA 3GUBA 5ETAA 3VUIA 4EWQA 2J2IB 3DDPA 4PV0A 1YWVA 3GC0A 5HO7A 5JFXA 5AM7A 2WEVA 2G01A 3B2TA 3O51A 4KBAA 3PXRA 4RVMA 2XNMA 2PL0A 5BYZA 4W8DA 2UW0A 1PXMA 2B9JA 3BX5A 2J51A 3KQ7A 4OBQA 5AV1A 3W2CA 4NTSA 3GB2A 3LHJA 5CALA 1Q62A 4BDKA 5E91A 4C2VA 4AN9A 2UW4A 4BTJA 3D5VA 3FMMA 3ZM4A 5I9ZA 3NIEA 5L6PA 3RTPA 2GNHA 4XEYA 2HZIA 2JDRA 3NRMA 3QD4A 2O8YA 3GU6A 4C57A 4JS8A 3BHUA 2XKCA 5TR6A 3RJCA 4NEUA 3KVXA 3QYWA 3JUHA 3ZXTA 1FVTA 5JQ8A 3BE9A 2OSCA 3O71A 4C8BA 2I6LA 4EKLA 2QLUA 3C0GA 3PSDA 3OCSA 2OH0E 4HNFA 5A4LA 4D4YA 2OWBA 2X81A 3RNIA 3GQIA 2HY81 5GJGA 3RAHA 3AOXA 4YSJA 3IPHA 4CTBA 4IIRA 3PVUA 1H4LA 2KULA 3VUDA 2QOFA 3A4PA 3UMXA 4BI2A 5BMSA 5C27A 3OWKA 4CFFA 5LVNA 4BCQA 2OW3A 4JL9A 2OIQA 3UIMA 1WBPA 2OG8A 1WBOA 4GFMA 4MBLA 3R02A 4E1ZA 4E8AA 3HV4A 4QTCA 2BRHA 5BVEA 2WTDA 4UXQA 1PMVA 5AUXA 4ZS0A 4FEQA 4AFJA 2VAGA 3BYOA 3H9RA 4CQGA 3FMJA 4YZMA 4D2VA 2BRBA 4P4CA 2ZB1A 4LGHA 3R9NA 3UPXA 4KB8A 4CLIA 2IN6A 4YR8A 1DI8A 4FKSA 1JKLA 3ALNA 2DS1A 4LRJA 5AUZA 4A4LA 4XG4A 2P4IA 1KE5A 4C62A 1FGIA 2UVZA 3VC4A 4AZFA 3NUYA 4XLVA 2Y4IB 2G15A 5HG7A 2YWPA 5CU3A 1WBTA 2WOTA 4FSZA 4JXFA 2E9VA 1PHKA 4FUYA 4P7EA 3DKOA 4KS7A 2R0UA 5A9UA 3QX2A 4ZK5A 2XYUA 2F4JA 3VBVA 4JX7A 1Q8TA 3KY2A 5BQ0A 3PVBA 2GHGA 2J6MA 3LFCA 4MXXA 4XBUA 4D2PA 3UIUA 5M4IA 1H1SA 3C0IA 2QI8A 4EOKA 4BKYA 4YJVA 3KRWA 2HCKA 2WMAA 4L45A 5CU4A 5CT0A 3MIYA 3RI1A 2IW9A 3ULIA 3VBQA 5E8YA 1OECA 2CSNA 3LFAA 4PDSA 4QMMA 5CU2A 4AOTA 4OAVB 4R3RA 3ZTXA 5M44A 4TT7A 2Y6OA 3DBDA 4FV1A 2FSTX 4TNDA 4RX5A 1R3CA 2C5OA 3QL8A 5HKMA 2VX1A 4D58A 3PIZA 4D55A 1YRPA 5IZFA 4CKJA 3RHXA 3E7OA 5IMEA 1SYKA 4NSTA 2C30A 3OEZA 4Y8DA 4QTAA 4RA4A 2JEDA 4A06A 2C6EA 2EB3A 1FMOE 3R30A 4B8MA 3VS3A 3LIJA 4NFNA 1QPCA 3ZBFA 4HGEA
chains in the Genus database with same CATH topology
2X0OA 4FRFA 1W2DA 2X0PA 4O4DA 2A98A 2AQXA 4O4CA 4O4BB 2IF8A 1W2FA 1W2CA 1TZDA 2IEWA 4O4FA 2X0QA 4O4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRF A;  1W2D A;  4O4D A;  2A98 A;  2AQX A;  4O4C A;  4O4B B;  2IF8 A;  1W2F A;  1W2C A;  1TZD A;  2IEW A;  4O4F A;  4O4E A; 
#chains in the Genus database with same CATH topology
 1KOA A;  3C51 A;  2UZN A;  3BBT B;  2R3K A;  3IW8 A;  4Y46 A;  1F5Q A;  2ZM4 A;  1OL1 A;  5KE0 A;  4AGU A;  5LVP A;  2W1I A;  3TV4 A;  4X2K A;  5FP5 A;  4MAO A;  4K77 A;  4AA4 A;  4NKA A;  1W98 A;  4BHN A;  3QFV A;  2OIB A;  4NW6 A;  2RG6 A;  3BEL A;  3VRZ A;  3QQF A;  3UVR A;  3KGA A;  3HX4 A;  3QUP A;  1U5Q A;  3MA3 A;  3LM5 A;  3DB6 A;  2H6D A;  1W2D A;  3FML A;  4RMZ A;  4EH3 A;  3R1N A;  4WD5 A;  2WKM A;  2WTV A;  2OXD A;  3MFT A;  4N6Y A;  5AEP A;  3TUD A;  5CSH A;  4F9Y A;  3VJO A;  5IKW A;  2BFY A;  2P3G X;  4FV2 A;  4RQK A;  1Q8U A;  4R8Q A;  4AU8 A;  3LM0 A;  4USE A;  4W4X A;  4RLL A;  4CFX A;  2CLQ A;  5I5Z A;  2QKW B;  1OB3 A;  3OC1 A;  1VR2 A;  3ZO4 A;  3BBW A;  2UZU E;  1S9J A;  3E93 A;  4TL0 A;  1Q97 A;  5CVH A;  5HIE A;  2YM8 A;  3IDC A;  3PE1 A;  2IVU A;  4X6Q C;  4YGA A;  5DGZ A;  2QU5 A;  4ZSE A;  3WOW A;  5KKR C;  4EUT A;  4EQC A;  1PXN A;  3F3Z A;  3OBG A;  4RJ6 A;  1ATP E;  5HX8 A;  4IAY A;  4USF A;  1NXK A;  1SZM A;  3F9N A;  3SXF A;  4JVG A;  5E8W A;  5IH5 A;  3TUB A;  5JRQ A;  1H1R A;  4YJN A;  4PNI A;  4BTK A;  4XV3 A;  2R2P A;  3JVR A;  3LFQ A;  1XH5 A;  2XCK A;  3BEA A;  4I0R A;  1OIU A;  4CNH A;  1XH9 A;  4FTJ A;  1Q61 A;  2GTN A;  2BRO A;  3WYX A;  2WTK C;  1YDS E;  3AC4 A;  2YLE A;  3HYH A;  4X0M A;  4LV5 A;  3ZS5 A;  3RM6 A;  1ZZ2 A;  3QKK A;  5BVD A;  1NVR A;  1ZYJ A;  3KRL A;  4QQT A;  3ZXZ A;  2VTS A;  3I0Q A;  4MQ2 A;  2GS2 A;  1WAK A;  3R7G A;  2PZP A;  3IDB A;  3O50 A;  4XV1 A;  3F61 A;  4IDV A;  4IXP A;  5EDR A;  5EHY A;  2O63 A;  3W8L A;  3F7W A;  4D1X A;  5KZ0 A;  5CEN A;  5IA0 A;  4QT1 A;  1LR4 A;  2J5F A;  2WQE A;  5C03 A;  4BN1 A;  2RSV A;  2VUW A;  4Q9S A;  4FSQ A;  4X2F A;  3ZLX A;  5HGI A;  4H3Q A;  3R0T A;  4L7F A;  3QC9 A;  3IOP A;  5EM8 A;  3UZP A;  1Y6B A;  4EOO A;  4F7L A;  2R3P A;  2UZW E;  4Y95 A;  3VHK A;  5LVO A;  2JLD A;  5HCX A;  4FKJ A;  4PL4 A;  4WO5 A;  3NYO A;  2VGO A;  3GVU A;  4O27 B;  2X39 A;  4EK8 A;  2R3H A;  4FVQ A;  3PRF A;  5I9Y A;  1OIT A;  3R9O A;  4FOC A;  4EZ7 A;  4RVT A;  2YM5 A;  4EOJ A;  4FBX A;  2RL5 A;  3FL4 A;  5CAO A;  5AMN A;  2E2B A;  4PL3 A;  4M15 A;  4YZD A;  3PWD A;  4BIE A;  2J0K A;  5HCZ A;  4HJO A;  4XV9 A;  5HNI X;  2FSO X;  3PXQ A;  4YZB A;  1H0V A;  3VRY A;  4O2Z A;  4AT4 A;  1Q5K A;  2XKD A;  3V3V A;  5H3Q A;  1O6L A;  5H8G A;  5B0X A;  3KKV A;  5TOZ A;  3LVP A;  4BCN A;  2Q0B A;  4F1T A;  1VEB A;  4DFL A;  5CF8 A;  3FJQ E;  2X6E A;  3PP1 A;  3U6I A;  1H08 A;  2ONL C;  1B39 A;  4AWI A;  3OTV A;  4RT7 A;  5F4N A;  2Y6M A;  3R8U A;  3ZEP A;  3QZG A;  3F3V A;  4FKW A;  3BE2 A;  4X6R A;  4RX7 A;  5LCJ A;  4BCH A;  3UIX A;  4J98 A;  3P0M A;  3RAK A;  4NM5 A;  4AGD A;  3A8X A;  2PMI A;  3EH9 A;  3KMM A;  3UC4 A;  4K6Z A;  4RJ7 A;  4QP3 A;  4IC7 A;  3BYS A;  3OY3 A;  3SQQ A;  3VBT A;  1URC A;  4DGM A;  4DFZ E;  5AUV A;  4X2G A;  3JY0 A;  1E1V A;  4WG4 A;  4QQ5 A;  4E73 A;  3ORL A;  2GNI A;  2QOK A;  3QLG A;  3V5W A;  4IAD A;  2W7X A;  2P0C A;  3NNX A;  3E64 A;  3E8N A;  1MRY A;  2ACX A;  3OP5 A;  4E4L A;  2Z8C A;  4I5P A;  3WAR A;  2X4Z A;  1RJB A;  1JLU E;  4XH6 A;  2XIR A;  5I3O A;  4DYM A;  1JQH A;  2B55 A;  3WZU A;  5L2T A;  3FUP A;  4MK0 A;  3N9X A;  4IVA A;  4RIW A;  4AS0 A;  3TJD A;  2XMY A;  1H25 A;  2J90 A;  1ZXE A;  4AT5 A;  4B0G A;  2WFY A;  4BCG A;  4EOL A;  4Q5H A;  1KSW A;  3KXG A;  3D5U A;  3IK3 A;  4LMN A;  1PXL A;  3RPY A;  2G2I A;  4QQC A;  3O96 A;  4ZEG A;  5HIB A;  1FVV A;  2BHH A;  5IEY A;  5M53 A;  2C3L A;  5AUU A;  2JBO A;  2X8E A;  4ACC A;  5KCV A;  3R63 A;  2JII A;  4QPA A;  5IDN A;  2RFE A;  1RW8 A;  4TTH B;  3COH A;  4KWP A;  2F2U A;  4E4N A;  1U59 A;  2GS7 A;  2NRU A;  3G2F A;  5J1V A;  3RM7 A;  3FPM A;  1H0W A;  4JBQ A;  5CNN A;  5AUW A;  1H01 A;  2A98 A;  3OWJ A;  4KIP A;  3W18 A;  4BKZ A;  4FT5 A;  2OXX A;  3HUB A;  4IM0 A;  3G90 X;  4BZD A;  3V5T A;  4S32 A;  3R1Y A;  4G31 A;  4X2N A;  2ERK A;  3DZQ A;  3S4Q A;  3HRB A;  4NH1 A;  2LGC A;  5C8N A;  4FZA B;  4F1M A;  2W05 A;  4FV0 A;  3ROC A;  2VTH A;  5FM2 A;  3D9V A;  3RAI A;  4FVP A;  4W9W A;  3UC3 A;  4V04 A;  3OFM A;  2YCF A;  3LFS A;  4KIN A;  5ANK A;  3GNI B;  3LQ5 A;  4GMY A;  1YI4 A;  4II5 A;  3QAL E;  2AC5 A;  2E9U A;  2X4F A;  3MPT A;  5EW9 A;  3A99 A;  1WFC A;  4R1Y A;  2WMW A;  3CS9 A;  4ZSL A;  5HLP A;  4MBJ A;  4PDP A;  2JDT A;  4YSM A;  3T3V A;  3TCP A;  1AQ1 A;  4MHA A;  4ZY6 A;  4WIH A;  2PMO X;  4ASX A;  2BKZ A;  2W99 B;  4FX3 A;  4ANM A;  4O1P A;  3R9H A;  1BX6 A;  3KVW A;  4FYO A;  4IB0 A;  4S34 A;  2GFS A;  3NNV A;  4J71 A;  4FV5 A;  5ANJ A;  1OL7 A;  2WEL A;  3CR0 A;  4MXO A;  2X0P A;  3THB A;  5AR5 A;  4R6V A;  4U3Z A;  2GNJ A;  2R0I A;  3CEK A;  4OBO A;  3V6R A;  4BGH A;  4DN5 A;  2UW5 A;  4ZZO A;  4M0Z A;  2ZYB A;  2VNY A;  4FSN A;  4HGS A;  4KIK B;  4YC3 A;  4NIF B;  3VVH A;  3IG7 A;  4I21 A;  4O91 A;  1QMZ A;  4EC8 A;  2R64 A;  2X0Q A;  3GC9 A;  2QON A;  4LRK A;  2Z7S A;  5CSP A;  4HGT A;  1H00 A;  3FY2 A;  3D7Z A;  1W7H A;  3QCS A;  3HP2 A;  3DU8 A;  3RVG A;  4C02 A;  3ANR A;  4IM2 A;  2ZV8 A;  3UOH A;  3DJ6 A;  5BYY A;  4FV4 A;  4AA0 A;  3HRC A;  3F3U A;  4FNY A;  4KIO A;  4MNE A;  3BWF A;  2WTJ A;  2BZK B;  5CEK A;  3NZ0 A;  4XYF A;  3RBW A;  4JDI A;  5A54 A;  4F1O A;  3ZLS A;  4KSQ A;  4LL0 A;  2OXY A;  2CMW A;  3VW8 A;  2HW7 A;  4YJQ A;  1H1W A;  3MH3 A;  5L6W L;  3DBC A;  4FKR A;  3FZS A;  4EK6 A;  2VRX A;  2VWY A;  3C0H A;  4AA5 A;  3C13 A;  2V55 A;  3CCN A;  4I20 A;  4K2R A;  4OBP A;  4BI1 A;  3GOP A;  4KS8 A;  5KBR A;  5HLN A;  3TG1 A;  1ZYC A;  4BBE A;  3DKF A;  4W4V A;  3R7O A;  1OIR A;  3V01 A;  1FMK A;  3PXY A;  3BYV A;  2ETM A;  4I41 A;  5A4Q A;  4M8T A;  4FTM A;  1KWP A;  1R78 A;  3AC3 A;  4YJU A;  4E26 A;  2C3J A;  3QKL A;  2AUH A;  3BU5 A;  3M11 A;  4EOP A;  4FTK A;  2VWU A;  5EYM A;  5FQD C;  4LV8 A;  3DBQ A;  2UW6 A;  3CGF A;  3CXW A;  5L3A A;  3FHR A;  5EHL A;  4C2W A;  4CFM A;  4LYN A;  3HMN A;  3QQU A;  4CYJ A;  5EM6 A;  4F0F A;  1PMU A;  2W1E A;  4FKP A;  3FZ1 A;  3RHK A;  5JH6 A;  2GNL A;  4G1W A;  2OGV A;  5HEZ A;  4U7Z A;  4U40 A;  4L7S A;  2OZA B;  5JZJ A;  4USD A;  4DFN A;  4G6L A;  1UVR A;  3TKU A;  4PL5 A;  4GVJ A;  2VN9 A;  3R7U A;  4RRV A;  4BHZ A;  3BGQ A;  3TIZ A;  4XG3 A;  3ROY A;  2QCS A;  5ANI A;  4QO9 A;  4U42 A;  4EZ5 A;  4UYA A;  3MJ1 A;  4FIG A;  2YDI A;  4DEA A;  4ANB A;  2PZI A;  2R5T A;  2F7Z E;  4O0U A;  3ZZE A;  3S0O A;  4I0S A;  5ITA A;  3SRV A;  3LW0 A;  3R83 A;  2PZY A;  4GS6 A;  3ZO3 A;  3HUC A;  2J0M B;  4D28 A;  4BC6 A;  2IZS A;  4DEI A;  2IZU A;  4RX8 A;  4V0G B;  5AR4 A;  2A0C X;  4P2K A;  3P7A A;  4BBF A;  2PVN A;  3NIZ A;  2VWB A;  5L8J A;  4CXA A;  4GL9 A;  5D9H A;  3O8T A;  4XRL A;  3NX8 A;  5ETI A;  2C6L A;  4ZTQ A;  1V1K A;  3D0E A;  3V8T A;  4Y5Q A;  2WHB A;  1TVO A;  3QXP A;  5GJD A;  5I9V A;  2W4J A;  2X2M A;  4QMX A;  5CWZ A;  1OL6 A;  5I0B A;  4PPC A;  2ZMD A;  3NUX A;  3KFA A;  4QRC A;  4YTF A;  5DMZ A;  5HD4 A;  4MWI A;  5J9Y A;  4RIX A;  2CHL A;  2HY0 A;  4F9B A;  2HEN A;  2X9E A;  4QMS A;  2VTN A;  3OW4 A;  2JIU A;  4HVD A;  3D4Q A;  2PZR A;  4W9X A;  4CT2 A;  3BV2 A;  4F7J A;  2PML X;  1U54 A;  4TYG A;  1R39 A;  3OHT A;  4RWK A;  4FSW A;  2ZVA A;  3ETA A;  4RX9 A;  4EHG A;  5IUG A;  3P7B A;  4C38 A;  4QMP A;  5J9L A;  2VWW A;  2YJS A;  3KF7 A;  3FXZ A;  4H39 A;  1SVH A;  5LWN A;  4M7I A;  4BIB A;  5EK7 A;  3ODY X;  3H10 A;  4XOY A;  3Q5I A;  4DHF A;  3O23 A;  2CKE A;  2GHL A;  3AC2 A;  4L6Q A;  3SDJ A;  1DM2 A;  2CDZ A;  3MGY A;  2XIX A;  3OS3 A;  4KAB A;  2PE1 A;  4KIQ A;  1UU3 A;  2YM4 A;  4BZO A;  4EWH A;  3PVW A;  4J8N A;  4EYM A;  4OTF A;  5DI1 A;  5A4E A;  3FI3 A;  1P14 A;  3H4J A;  3SHE A;  5KMI A;  4J8M A;  3E8E A;  2A19 B;  4TPT A;  3IS5 A;  3WIL A;  3GFE A;  4YC6 A;  2YDJ A;  3GBZ A;  4L43 A;  4MH7 A;  5T3Q A;  3EN9 A;  4U8Z A;  4UMP A;  3OF0 A;  3BGZ A;  3QD0 A;  4LOP A;  4NKS A;  1Q99 A;  4R5S A;  3NNW A;  3EKN A;  4YJT A;  2WD1 A;  2X1N A;  2UZL A;  4D4R A;  5HVY A;  4FV7 A;  5HG9 A;  3PP0 A;  4HOK A;  3MVL A;  2FUM A;  2CGW A;  3KRX A;  4IC8 A;  2YLF A;  3LPB A;  3KUL A;  3Q3B A;  5HTC A;  3FMD A;  4X2J A;  5ETC A;  1XR1 A;  2OKR A;  3DCV A;  2YN8 A;  3QHR A;  1M7N A;  4P90 A;  4QMQ A;  2JKM A;  2C0O A;  3O8U A;  4IWO A;  2HZ4 A;  3LCD A;  3TZ8 A;  2EB2 A;  3UOD A;  4E6A A;  5TE0 A;  3I5Z A;  4OTI A;  4IJ9 A;  4QYF A;  3RZF A;  3UP2 A;  4C36 A;  4Z16 A;  5GZA A;  5KML A;  2GDO A;  4D1S A;  4LFI A;  3QX4 A;  5DPV A;  3ORZ A;  4DG3 E;  4QQJ A;  5H2U A;  1JOW B;  2B54 A;  2IVT A;  3RZB A;  4NCT A;  4A07 A;  3NW7 A;  3QTR A;  4O22 A;  5KMO A;  3RMF A;  5HOA A;  4C4J A;  3VS5 A;  5KX8 A;  3VAP A;  5JRS A;  4L53 A;  2QOI A;  2W5B A;  3AMB A;  3LQ8 A;  3QZH A;  2QO7 A;  2BVA A;  2VTI A;  3ORP A;  2QU6 A;  4IB5 A;  5AP3 A;  3P79 A;  4BZN A;  4F7S A;  2X2K A;  3HDN A;  3KCK A;  4IWD A;  1MQ4 A;  4EQM A;  3HMO A;  5ANE A;  2A1A B;  4O2P A;  3UPZ A;  2F7E E;  4NM3 A;  4B99 A;  4IMY A;  4FKL A;  5CAQ A;  3K5U A;  3GC8 A;  3EJ1 A;  5I3R A;  4F9W A;  2WMT A;  3QZF A;  5D7V A;  4JQE A;  4BTM A;  4JR3 A;  2SRC A;  4UB7 A;  4ONA A;  4BCP A;  2BZI B;  2C6K A;  2C69 A;  4OT6 A;  3BIZ A;  2ZDT A;  4FK6 A;  1OUY A;  4ZTS A;  3R8L A;  3UJG A;  1OM1 A;  2BDF A;  4GEO A;  1BYG A;  1JST A;  5DIA A;  3DNE A;  2OI4 X;  5AR7 A;  5DBX A;  2NO3 A;  1NVS A;  2YEX A;  3LCS A;  3ERK A;  3A60 A;  4I93 A;  3L9L A;  2G9X A;  4HPU E;  2FH9 A;  5J8I A;  1DAW A;  4MXA A;  4F6U A;  3ZDU A;  4B6L A;  3ACJ A;  3D5X A;  3PJ8 A;  2C5V A;  2Z2W A;  3OBJ A;  4FG7 A;  5IA4 A;  5AP5 A;  5I9W A;  4PMM A;  1V0O A;  2R9S A;  4Z7G A;  3SV0 A;  3JYA A;  2QOQ A;  5CSV A;  3F3W A;  4TYI A;  5CYI A;  3L8S A;  4FTU A;  3U6J A;  1I44 A;  4XG9 A;  3QC4 A;  5J95 A;  3VS4 A;  5EW3 A;  3SW7 A;  4B9D A;  4FIH A;  4UEU A;  4BCJ A;  4JBO A;  4L3L A;  3VW6 A;  2WEI A;  5BX0 A;  4TWC A;  4XS2 A;  4FV8 A;  2X9F A;  1ZY5 A;  2B4S B;  3N51 A;  4O0S A;  2OJI A;  2OF4 A;  3ZOS A;  5ICP A;  4TNB A;  3MVH A;  4U97 A;  3MY5 A;  1V0B A;  3SVV A;  4DEH A;  5AP7 A;  4S31 A;  4IDT A;  1GIH A;  3HV7 A;  4FKT A;  3EFL A;  4I1Z A;  4ZSG A;  2VTJ A;  2BTR A;  3TIY A;  3VQH A;  3WF5 A;  4IX3 A;  4G5J A;  3MSS A;  3FWQ A;  3KF4 A;  4FV3 A;  2VD5 A;  5CT7 A;  5AIR A;  4AOJ A;  4AW2 A;  5BPY A;  3EZR A;  1Z9X A;  2JAV A;  4QMO A;  1UKI A;  3DA6 A;  4J99 A;  3FZO A;  4K11 A;  4LL5 A;  4ZSJ A;  3P5K A;  4M3Q A;  5HZN A;  4G34 A;  2WMS A;  1PKD A;  3MV5 A;  5DRD A;  4A9S A;  3RP9 A;  2UZD A;  1WZY A;  4WKQ A;  5DEW A;  5FXR A;  4ENX A;  3DB8 A;  3K5V A;  2IF8 A;  1VZO A;  2BAQ A;  4JLC A;  5CLP A;  1YOJ A;  1PXI A;  4F9A A;  2CGX A;  3NW5 A;  1AGW A;  4X3F A;  3E8D A;  4FTN A;  3UVP A;  4CFW A;  2X7O A;  4I92 A;  4MCV A;  3ZYA A;  4OTW A;  4YTH A;  4BDH A;  4AE9 A;  2X2L A;  3GQL A;  3BU6 A;  3OXZ A;  3UIB A;  3ZCL A;  4G3C A;  3K3J A;  3M2W A;  3KN5 A;  5JGB A;  2W4K A;  4IAI A;  3CGO A;  4IW0 A;  3T8O A;  4EEV A;  4E4X A;  2PTK A;  2WB8 A;  3C4X A;  3CKX A;  4WRG A;  2ITX A;  4EON A;  3QBN A;  4DFX E;  4LG4 A;  2W1F A;  5HD7 A;  2FGI A;  2UW8 A;  3ITZ A;  3PTG A;  4FIJ A;  2YFX A;  3PRI A;  2PE0 A;  4I6F A;  2ZB0 A;  3PJC A;  4MXZ A;  4ZJJ A;  5CTP A;  3HZT A;  3NUN A;  5C9C A;  4BVU A;  3OXT A;  5KKR B;  1YVJ A;  2C47 A;  4G2F A;  3HMM A;  3TNP C;  3MWU A;  3WIG A;  3FKL A;  1OIY A;  3AGL A;  4NW5 A;  1K2P A;  4A9U A;  3AQV A;  5KMN A;  4FT0 A;  4KAO A;  4MX9 A;  4O0T A;  1YHV A;  5EFQ A;  3TZM A;  4QMZ A;  4AZV A;  5CEO A;  5C1Q B;  3NNU A;  3UQF A;  5DR6 A;  3NUU A;  4ITJ A;  1RE8 A;  4MXY A;  2RF9 A;  5L2Q A;  3SKC A;  5TO8 A;  2W5A A;  4DGL C;  4EH8 A;  5KHW A;  4UX9 A;  4PMT A;  2J4Z A;  2HZN A;  3NYX A;  4UZD A;  5IMX A;  5EKO A;  2VWV A;  4QNA A;  2WTK B;  3MTF A;  5LAR A;  2PVF A;  3T9T A;  3CIK A;  1OKV A;  2V0D A;  3E8C A;  1LPU A;  2W96 B;  3DGK A;  3QQG A;  1SNX A;  4TYH B;  3S95 A;  4QMN A;  5IA1 A;  3K3I A;  4BYI A;  1PF8 A;  3PXK A;  4Y72 A;  4DH5 A;  2E9O A;  2QQ7 A;  2WQB A;  2CPK E;  3P4K A;  5F1Z A;  3CJG A;  3TAC A;  4HVH A;  4CTC A;  3PYY A;  3Q53 A;  3FKO A;  3MFU A;  4TZR A;  3FME A;  1M14 A;  4C7T A;  4GRB A;  2GS6 A;  5JFV A;  1PXP A;  4JT3 A;  3KRR A;  4C4H A;  3WE4 A;  3DFC B;  2C1A A;  2Z7R A;  2QD9 A;  4KSP A;  3UOL A;  4PTG A;  4YNE A;  3R01 A;  1TZD A;  2J50 A;  4JR7 A;  4MWH A;  2X7F A;  5ACK A;  3VUM A;  4YTI A;  2XIK A;  1G5S A;  2WOU A;  4FK3 A;  4GFO A;  3RWP A;  4JRV A;  1QPE A;  3C7Q A;  4IZ5 A;  4FTO A;  1BI7 A;  2QNJ A;  3TWJ A;  1W8C A;  4M69 B;  3W2O A;  4IWP A;  4FVR A;  3GFW A;  1OKW A;  2VTA A;  4YLJ A;  2PWL A;  5HTB A;  2WIP A;  3HP5 A;  5K0X A;  2PE2 A;  3ZZW A;  2B9F A;  4QP7 A;  5E8S A;  4ASD A;  2R3O A;  2WTI A;  2YM3 A;  1DI9 A;  2XBJ A;  3I1A A;  3L9P A;  4IVB A;  4GT5 A;  4EH2 A;  4BDA A;  5G6V A;  2UZT A;  5LXM A;  2Z7L A;  3DPK A;  4C33 A;  5D41 A;  2UVX A;  3ZFX A;  4BDI A;  3QRK A;  2ETK A;  4PY1 A;  5HE2 A;  1MP8 A;  3MS9 A;  2HAK A;  3COK A;  3FLZ A;  5EI2 A;  1XBB A;  3LZB A;  4ACD A;  3CPB A;  2UZB A;  5CX9 A;  3BQR A;  3QU0 A;  3RPR A;  3QF9 A;  4APC A;  3BLH A;  5KMM A;  4UWY A;  3R00 A;  5HHW A;  3PJ1 A;  3ZLW A;  3MDY A;  2UZE A;  3KRJ A;  3ZUV A;  1TQM A;  2EWA A;  2OBJ A;  4LGG A;  1NVQ A;  4DFY A;  4QP1 A;  3DBE A;  4UV0 A;  2VX0 A;  3LJ2 A;  1BKX A;  3E3B X;  5K3Y A;  5DT4 A;  4UMR A;  5HNG A;  3W2Q A;  5BUI A;  2ZV9 A;  3QUE A;  4KBC A;  4QMY A;  2UW3 A;  4EH9 A;  4XLI A;  3BHT A;  3SOA A;  5B7V A;  4ZOG A;  2XJ0 A;  3P23 A;  4PDO A;  1OI9 A;  4C3R A;  3PPK A;  3FDN A;  3OT8 A;  1JPA A;  5AA9 A;  4OUC A;  3UYT A;  3W2R A;  2C6I A;  4DGN A;  2ITO A;  4YNO A;  2P55 A;  3DJ7 A;  5IDP A;  2I40 A;  4K0Y A;  4H3P A;  3OCB A;  4EK3 A;  3SD0 A;  4PNK A;  1PKG A;  4O0W A;  2OJG A;  5AP4 A;  1P4O A;  5JFW A;  4FNZ A;  4KA3 A;  2H34 A;  1ZMV A;  2IW8 A;  3R04 A;  3ZRM A;  4EJN A;  1MQB A;  5AX9 A;  2C5Y A;  4RZV A;  4EOQ A;  5IA2 A;  3W8Q A;  3MTL A;  4YLL A;  1ZWS A;  4WSQ A;  2I1M A;  2P2H A;  4P5Q A;  5HOR A;  2OJF E;  2VO0 A;  3FXW A;  3OOM A;  3PY3 A;  4FST A;  3FQH A;  5C01 A;  4MD7 E;  3GCV A;  5BVF A;  4NZW B;  4AXA A;  5L8L A;  3CKW A;  3EQG A;  2BDJ A;  5CSX A;  5JN2 A;  1U4D A;  2UV2 A;  3HA8 A;  4FTR A;  4IZY A;  4H36 A;  4I3Z A;  4GVA A;  2XBA A;  5E90 A;  2BAL A;  3PUP A;  2YAA A;  3F5U A;  5FBO A;  4ZTR A;  1MRU A;  3WF7 A;  3WYY A;  4EHZ A;  3VS1 A;  4IAC A;  3FY0 A;  4D5K A;  1Y8G A;  4AZE A;  4RIO A;  4H58 A;  3EHA A;  1EH4 A;  2YHV A;  4Z55 A;  3MPM A;  2R3G A;  3FZR A;  3IW6 A;  3OCG A;  2XYN A;  3KU2 A;  2XKF A;  3HNG A;  3TV7 A;  2EVA A;  1XH4 A;  4C3P A;  3V5L A;  4BKJ A;  3R7V A;  3CD8 A;  3QRU A;  4L68 A;  4EOR A;  2DYL A;  3FYK X;  4ALV A;  3EFW A;  5I4N A;  4EH6 A;  2Y9Q A;  1OIQ A;  2HWP A;  3A2C A;  4OLI A;  5EM7 A;  4AE6 A;  4QMW A;  5L2W A;  5DEY A;  4I6H A;  1MRV A;  4NCT C;  4F9C A;  3GGF A;  5AP6 A;  3LAU A;  5E8Z A;  3I60 A;  3QA8 A;  4UMU A;  4FNX A;  2WMU A;  3BV3 A;  3UG1 A;  5HES A;  4ZY5 A;  2C1B A;  4XNE A;  3TZ9 A;  2QKR A;  5FD2 A;  2VTP A;  4JIA A;  3LE6 A;  4O4B B;  3ZC5 A;  4RWL A;  3DK3 A;  2PVR A;  4E3C A;  3KA0 A;  2DWB A;  4WOV A;  4E93 A;  4D1Z A;  5HBJ A;  3A61 A;  3POO A;  4IX4 A;  1IEP A;  1OMW A;  3F3T A;  1OPK A;  1M2P A;  3M1S A;  1OL2 A;  3NDM A;  1BMK A;  4AAA A;  3ORO A;  3O0G A;  1Y8Y A;  1XKK A;  2FB8 A;  4HGL A;  3RGF A;  3PXZ A;  3Q2M A;  4EH4 A;  3BZ3 A;  5L2S A;  1P2A A;  2AYP A;  4AOI A;  4RC2 A;  5EHO A;  3E7V A;  5F20 A;  1YXX A;  3PXF A;  3VN9 A;  2YJR A;  2Z60 A;  2YA9 A;  5CAP A;  4YO4 A;  4I94 A;  5FXS A;  3DBF A;  3TJC A;  4CKR A;  4FTI A;  4IB3 A;  4N70 A;  3V51 A;  2Y8O A;  5K9I A;  4ITH A;  4FZ6 A;  3KMW A;  3RCD A;  3ZLY A;  4UMQ A;  1YHW A;  1U46 A;  3ACK A;  2A27 A;  2GHM A;  4IX6 A;  3VNT A;  5E8X A;  1H27 A;  3HEG A;  2R3N A;  4QMV A;  4FL1 A;  4IH8 A;  4IAA A;  2O2U A;  3GC7 A;  4M97 A;  2GNF A;  2RGP A;  4RJ5 A;  4NM7 A;  5IIS A;  1H07 A;  2FYS A;  3MI9 A;  3QTS A;  2X6D A;  4D4S A;  3FC1 X;  3NYV A;  3OEF X;  4XV2 A;  3MN3 A;  5A6O A;  2J0L A;  3A4O X;  4CMU A;  3I6U A;  1YI6 A;  3A7F A;  1WBS A;  4C61 A;  4FG9 A;  3RWQ A;  3IDP A;  4GJ3 A;  3PA4 A;  2YIW A;  5C8K A;  4CRL A;  3ORX A;  4NT4 A;  2JIT A;  4J1R A;  3GU8 A;  4GSB A;  5AWM A;  4MD8 E;  4BB4 A;  1CMK E;  3QRT A;  3MW1 A;  3R7Y A;  3WE8 A;  4JOA A;  5E8V A;  5HBE A;  5L6O A;  3QWK A;  2QOC A;  3F88 A;  3UNJ A;  2YIR A;  4HVG A;  3SXR A;  4NM0 A;  3W33 A;  3FLY A;  4TXC A;  4ALW A;  4UWB A;  4G3G A;  3QRJ A;  1GAG A;  5AP0 A;  4EOS A;  4JBV A;  4WNM A;  2FSM X;  4W4Y A;  3P7C A;  5DVR A;  3R71 A;  1J91 A;  5AV2 A;  2Y4P A;  5AP1 A;  3H9F A;  1XWS A;  2IEW A;  4TW9 A;  3NGA A;  3DLS A;  2JBP A;  4AUA A;  4FZ7 A;  2GQG A;  2EXE A;  2NRY A;  5CVF A;  3RKB A;  3HGK A;  4XX9 A;  2PHK A;  5K4I A;  3QTU A;  4CFU A;  4AZS A;  4FC0 A;  4JRN A;  4ACH A;  3NPC A;  3FHI A;  1E9H A;  4E6C A;  3CTJ A;  1WVX A;  1JKT A;  4ANQ A;  3SXS A;  1ZOE A;  2C0I A;  4JI9 A;  4A9T A;  4FTL A;  1J1B A;  2XEY A;  3ZC6 A;  2CN5 A;  2B9I A;  4J96 A;  2CN8 A;  4U0I A;  3BLR A;  4X3F C;  5IUH A;  3AD5 A;  3A7G A;  2XVD A;  1UV5 A;  3EFK A;  4BGG A;  5IPJ A;  1HCK A;  2YIQ A;  1UWJ A;  3G0E A;  3IKA A;  4C4G A;  1W82 A;  3T9I A;  4QYH A;  3D7T A;  4N6Z A;  3LXL A;  2EXC X;  2DUV A;  4DG0 E;  4AP7 A;  4FL3 A;  2JFM A;  2XNE A;  1LP4 A;  3C4E A;  3ELJ A;  4J52 A;  3Q52 A;  4PRJ A;  5G1X A;  5T68 A;  4AZT A;  5JZN A;  2UW7 A;  3QA0 A;  4YPD A;  4AN2 A;  4DEB A;  4ZAU A;  2C68 A;  4BI0 A;  4D4V A;  5AIK A;  4CV9 A;  2F57 A;  2I0Y A;  4HZR A;  4MD9 E;  3IW4 A;  4F6S A;  4YLK A;  3VS0 A;  2W1D A;  2C5X A;  4L42 A;  4YHT A;  2H8H A;  3D14 A;  4HYU A;  4IQ6 A;  3GEQ A;  3BYU A;  5GHV A;  5EM5 A;  3Q32 A;  4CD0 A;  4FGB A;  2X8D A;  5HO8 A;  2ITQ A;  3KXX A;  1DAY A;  4KKG A;  3RK9 A;  3P86 A;  5EYD A;  4E7W A;  4XG7 A;  4U44 A;  1VYW A;  3TNW A;  4RVL A;  4FMQ A;  4IAF A;  2PSQ A;  4GK2 A;  4O4C A;  5EYC A;  4EZ3 A;  4JG6 A;  3FI4 A;  4FZF B;  1PMN A;  2BRM A;  3CP9 A;  4TWN A;  2VTQ A;  4RFY A;  3W16 A;  4ALU A;  4ARK A;  3OCT A;  1SNU A;  1YWR A;  5J79 A;  2AC3 A;  1GZO A;  1UNL A;  3SAY A;  4RIY B;  3QTI A;  3ZO1 A;  4BL1 A;  3TNI A;  2BIK B;  2QHM A;  2XJ2 A;  1ZYD A;  3IGG A;  4NJD A;  2C3K A;  1M2R A;  5T6K A;  3HV5 A;  3GEN A;  4G3F A;  1Q41 A;  2UW9 A;  2PVJ A;  2R3Q A;  3GCU A;  2R3J A;  3DKC A;  4R3C A;  3O17 A;  4IJP A;  5CXH A;  3QCX A;  4GW8 A;  1IRK A;  3UGC A;  1ZAO A;  4K9Y A;  4PWN A;  4TRL A;  4BDB A;  4C0T A;  2QOB A;  1I09 A;  3AC1 A;  3PY0 A;  4UBA A;  2VNW A;  4HNI A;  4YJS A;  5H8B A;  2C6M A;  5AV4 A;  4KKH A;  5CF6 A;  1QCF A;  4AX8 A;  1XBC A;  5A4T A;  3ENM A;  2CGU A;  3F5P A;  3QZI A;  4O0V A;  1URW A;  4FTT A;  4BYJ A;  4S33 A;  3LXK A;  2JAM A;  4PMP A;  3E3P A;  1YWN A;  1YDT E;  4MKC A;  4ZTM A;  2BZH B;  4CT1 A;  4OR5 A;  2VZ6 A;  3BYM A;  5CEI A;  3TL8 A;  4L46 A;  3FMK A;  3AMY A;  5GNK A;  1WBN A;  3KXM A;  4RFM A;  4TYE A;  4BCM A;  5JSM A;  4GCJ A;  3NWW A;  1YXS A;  1FOT A;  2BRG A;  1Q8Y A;  3JXW A;  2XJ1 A;  5F95 A;  2ITV A;  4FIE A;  5CSW A;  4C34 A;  2XK8 A;  3MBL A;  1BUH A;  5L4Q A;  5M4F A;  4QTE A;  5AND A;  3FZP A;  2ERZ E;  3W1F A;  3IOK A;  3T3U A;  4F08 A;  3CD3 A;  2X8I A;  4YHJ A;  3PZH A;  3FXX A;  1VJY A;  3UOK A;  1UNH A;  3JY9 A;  4AT3 A;  1CTP E;  1GZK A;  1GOL A;  3MJ2 A;  3DAJ A;  1WVY A;  3POZ A;  2VTM A;  4M14 A;  4MQ1 A;  4OT5 A;  2WZJ A;  3RCJ A;  3WIK A;  1JSU A;  2O5K A;  1M52 A;  2Q0N A;  4CV8 A;  1S9I A;  2YM7 A;  2BRN A;  2EXM A;  2YIT A;  5HBH A;  4ZJI A;  2C0T A;  4MED A;  2VTR A;  5FEE A;  4AG8 A;  4NWM A;  5EOB A;  5IEV A;  3EOC A;  5LVL A;  3R8M A;  1CKI A;  1W84 A;  5E8U A;  2H96 A;  3ZRK A;  2XM9 A;  4G3D A;  4L01 A;  3PG3 A;  3Q4C A;  3CQE A;  4K18 A;  4EQU A;  5AUT A;  2PVM A;  4OTQ A;  3WZD A;  5CXZ A;  4Y5H A;  4FI1 A;  4H1J A;  1BI8 A;  3QCY A;  4HYI A;  3FE3 A;  4Q2A A;  5TT7 A;  2YAC A;  2ZM1 A;  1HCL A;  3LCO A;  3TKI A;  2UZV A;  2XA4 A;  1FPU A;  3JVS A;  3K54 A;  4XOZ A;  4RIW B;  3A7J A;  2WIH A;  1YI3 A;  5EI6 A;  3TN8 A;  3UQC A;  3PJ2 A;  3Q4T A;  3ZHP C;  4FSU A;  1H1Q A;  4FTQ A;  4I24 A;  4U9A A;  2W1C A;  5HNB A;  2IZR A;  4AGW A;  5JEB A;  2QR8 A;  4XG6 A;  5LMA A;  3S2P A;  3U4U A;  1UA2 A;  2OIC A;  3PJ3 A;  2EUF B;  3CE3 A;  5HE3 A;  3EZV A;  1Z57 A;  4M68 A;  3LFD A;  2IWI A;  3B8R A;  3LXP A;  4CFV A;  5L8K A;  1FGK A;  2XNO A;  1R1W A;  2QG5 A;  2YCQ A;  2O0U A;  3PA3 A;  3DAE A;  3RAL A;  4F65 A;  2H9V A;  4O0R A;  4EYJ A;  3DDQ A;  4C58 A;  4CQE A;  3MB6 A;  3DLZ A;  2ZV2 A;  4DCE A;  4FR4 A;  4I5C A;  4XG8 A;  1GJO A;  5DLS A;  4CVA A;  2BIL B;  3F66 A;  4FL2 A;  5FED A;  4IB1 A;  3D2K A;  3AC8 A;  5B2L A;  2B53 A;  5HE0 A;  1XHA A;  4E6Q A;  5M4U A;  2BPM A;  2RFN A;  4EC9 A;  5J1W A;  4U6R A;  5IH4 A;  5BVK A;  1IAS A;  3EYG A;  3FMH A;  3W2P A;  2PVY A;  2WMR A;  1TQI A;  1JAM A;  3L9M A;  2HOG A;  5LCK A;  3A7I A;  3KK9 A;  5JGD A;  1STC E;  5E92 A;  4MXC A;  3EQD A;  5JFS A;  3KL8 A;  5AR3 A;  4OGR A;  2Y0A A;  5AM6 A;  4YZN A;  3TTJ A;  2ITU A;  3FL5 A;  4I6Q A;  2CCI A;  4Y83 A;  4O96 A;  2YCR A;  4M66 A;  3VO3 A;  2PVK A;  2VTO A;  3AC5 A;  2PY3 A;  3FBV A;  4P5Z A;  4YTC A;  2XIZ A;  3S1H A;  1CSN A;  4EH5 A;  3ZH8 A;  5M56 A;  3KMU A;  3BEG A;  3V6S A;  2G2F A;  1XBA A;  3UDB A;  3TV6 A;  4B7T A;  3BLQ A;  2W0J A;  3EB0 A;  4N4S A;  2OO8 X;  3Q04 A;  4CZU A;  3R28 A;  4UAL A;  4DLJ A;  1KE8 A;  2I0E A;  3NLB A;  4RJ4 A;  4CMO A;  1OKY A;  4BWX A;  4IVD A;  3PE2 A;  4QNY A;  3EYH A;  2GPH A;  3DFA A;  4M69 A;  4DLI A;  3O2M A;  5H9B A;  2ZJW A;  3CLY A;  5BUJ A;  4Z7H A;  3AD4 A;  2XB7 A;  3BQC A;  3CTH A;  3WF9 A;  3HLL A;  3LFE A;  3WI6 A;  3PG1 A;  4O6L A;  5HIC A;  2WTC A;  3QD3 A;  2QO2 A;  5CZI A;  3HV3 A;  3ZU7 A;  5FTO A;  3U9N A;  3D83 A;  5HO6 A;  4F6W A;  3WBL A;  1U5R A;  5K5X A;  4CKI A;  3R7I A;  4EHE A;  4K1B A;  3MVM A;  5HTI A;  4AQC A;  2CGV A;  3NAY A;  5K5N A;  2ZMC A;  1JKK A;  4XP3 A;  4MNE B;  4QPS A;  4M0Y A;  3FLS A;  3Q9Y A;  1K9A A;  4ZIM A;  5FTQ A;  3UG2 A;  2IVS A;  2YAB A;  3EL7 A;  2UVY A;  3REP A;  3IW5 A;  2QUR A;  4RG0 A;  2LAV A;  4H3B A;  4OTD A;  1A9U A;  3G51 A;  2I0H A;  1REJ A;  3FLW A;  3ION A;  1KV2 A;  3LXN A;  5DNR A;  3AD6 A;  4UXL A;  4GYG A;  3HKO A;  1BL6 A;  1OZ1 A;  2XKE A;  4FT9 A;  3UQG A;  4L00 A;  3COM A;  4I0T A;  3P08 A;  3UO6 A;  4OTR A;  3W55 A;  3PVG A;  4ASZ A;  3C4W A;  4KRC A;  5LMB A;  3BKB A;  3I79 A;  3IO7 A;  2R3L A;  3LOK A;  2XCH A;  4IZ7 A;  2YAK A;  4WBB B;  2QO9 A;  3C4Z A;  4FRF A;  2HWO A;  4QTD A;  4U3Y A;  3KC3 A;  5FGK A;  4F0G A;  4QYE A;  3DAK A;  3DT1 A;  4FTA A;  4O6E A;  2XK3 A;  5HLW A;  5FLF A;  3C50 A;  4R5Y A;  3R8V A;  3ORM A;  5DWR A;  5J9Z A;  1TKI A;  3KB7 A;  3R2B A;  1XO2 B;  2XK4 A;  2YIX A;  3RNY A;  4DIN A;  5BMM A;  2PVL A;  2BCJ A;  5CEM A;  4U5J A;  3Q5Z A;  3GU4 A;  5E1E A;  2OH4 A;  2X7G A;  4BWK A;  4B4L A;  3E87 A;  5HCY A;  3U8W A;  4HVI A;  3SA0 A;  1X8B A;  2BAJ A;  3R73 A;  3ZEW A;  3EQP A;  4FG8 A;  1FIN A;  4MVF A;  2QOO A;  4DH3 A;  2WU7 A;  4L44 A;  5M55 A;  4FKO A;  4V05 A;  5JK3 A;  2HZ0 A;  3ORT A;  4Y85 A;  4C59 A;  1GZN A;  5GJF A;  3QQH A;  3FSF A;  3VS6 A;  2XNN A;  4CFN A;  5A4C A;  2BFX A;  4D2W A;  3C5U A;  3EMG A;  3BHY A;  4RWI A;  4RZW A;  3QGW A;  4QML A;  1GIJ A;  3KK8 A;  4G16 A;  3SRV B;  1IG1 A;  1XQZ A;  3ZUU A;  3MY1 A;  4JAJ A;  4XP2 A;  3BCE A;  4NFM A;  1H28 A;  2WU6 A;  4EH7 A;  4ZSA A;  5IEX A;  3QHW A;  3PPZ A;  4D9T A;  1YXT A;  3RPS A;  2P2I A;  1Q8Z A;  4XG2 A;  4YZC A;  2WMQ A;  2OZO A;  3ZO2 A;  1Y6A A;  4F7N A;  1E1X A;  4DH1 A;  5CEP A;  3UO5 A;  1MUO A;  3A7H A;  2C4G A;  3Q96 A;  4J53 A;  4N0S A;  3V8S A;  4AW0 A;  3V04 A;  3G6H A;  4GH2 A;  3R8P A;  3ZFY A;  4HW7 A;  5HI2 A;  4RGJ A;  4IVC A;  5K4J A;  4QP6 A;  1UU9 A;  1WVW A;  4RBL A;  4RIX B;  3QD2 B;  4DH7 A;  3DOG A;  5CZH A;  3A8W A;  3VQU A;  2ITW A;  4NU1 A;  4AW1 A;  3IEC A;  3R6X A;  3VUL A;  2B52 A;  5BVN A;  4BF2 A;  2XZS A;  1WBW A;  4KKE A;  3QAM E;  3O7L B;  5DA3 A;  1U54 B;  3G9L X;  2XK9 A;  1KE6 A;  2B7A A;  4S2Z A;  3MB7 A;  4U80 A;  3VUT A;  3DQX A;  4O1O A;  4I22 A;  4JBP A;  4CMT A;  4YP8 A;  1H8F A;  1O9U A;  1YKR A;  2GNG A;  4AZW A;  4ANL A;  4FA2 A;  5KNJ A;  5FP6 A;  5IA5 A;  5E1S A;  1RQQ A;  4LUD A;  4PPB A;  1ZOH A;  4L67 A;  1PJK A;  1K3A A;  1L3R E;  2WNT A;  4HCV A;  2B9H A;  2VWX A;  1J3H A;  5D12 A;  5EYK A;  4RC4 A;  3FAA A;  2FSL X;  4CRS A;  1NA7 A;  5CS6 A;  3ZMM A;  3ZSH A;  1HOW A;  1OGU A;  1CKP A;  4GU9 A;  3QLF A;  2ZM3 A;  3JS2 A;  1UU7 A;  4BDD A;  4D2S A;  3LLT A;  4EK5 A;  5DR2 A;  3FI2 A;  3QQK A;  4CEG A;  5AAG A;  5B2M A;  4I4F A;  1UU8 A;  3AG9 A;  4L9I A;  2ESM A;  2F49 A;  3DS6 A;  3G33 A;  4E5B A;  4QYY A;  2C6D A;  3ORI A;  4UY9 A;  4DGG A;  4MYG A;  5E8T A;  3L8P A;  4PPA A;  5DHJ A;  5JGA A;  4C37 A;  1O6K A;  2BTS A;  1PME A;  3HMP A;  2RG5 A;  4FV6 A;  4O38 A;  5AAD A;  5EOL A;  4C35 A;  4GV1 A;  2KTY A;  4GK3 A;  3KUL B;  4C4F A;  1Q24 A;  3PZE A;  3EWH A;  4QP8 A;  3OUK A;  3KEX A;  2VO3 A;  4U81 A;  5GZ8 A;  4YPS A;  3UVQ A;  3KCF A;  5CF5 A;  3F69 A;  1R0P A;  4U41 A;  4YUQ A;  5GZ9 A;  2Z7Q A;  4WRS A;  2O64 A;  4UYN A;  4UZH A;  2VO7 A;  4ERK A;  2R4B A;  3QCQ A;  2VGP A;  4QP4 A;  5EDQ A;  3ULZ A;  5I9U A;  2JDO A;  3LJ0 A;  2OF2 A;  4DED A;  3JPV A;  3OVV A;  4FZD B;  4TY1 A;  5ANG A;  4DC2 A;  2WTW A;  5I9X A;  1W0X C;  2JD5 A;  3BU3 A;  3O8P A;  3UBD A;  1ZAR A;  3FZT A;  3DY7 A;  4JIK A;  2PMN X;  4BBM A;  4EOI A;  1M7Q A;  4NUS A;  4FSM A;  3QTX A;  5LMK A;  3D5W A;  4CCU A;  4QP2 A;  4GT3 A;  1LEW A;  1ZY4 A;  5FDP A;  2YIY A;  3FPQ A;  2QOL A;  1QPJ A;  3GXL A;  3I0O A;  4KBK A;  2FA2 A;  4PP7 A;  4A4O A;  3TZ7 A;  1Q3W A;  3FYJ X;  1A06 A;  1Z5M A;  4L3P A;  1H1P A;  5IU2 A;  4FOB A;  2XK7 A;  4BDC A;  3NUS A;  3TT0 A;  4BWP A;  3BI6 A;  1QL6 A;  5AX3 A;  2GU8 A;  1GNG A;  3P1A A;  4A9R A;  3QTQ A;  2W5H A;  5J7H A;  5HE1 A;  4DEG A;  1XH7 A;  3DV3 A;  4RJ8 A;  3VWA A;  5CAV A;  3L9N A;  4ENY A;  5FEQ A;  3TNQ B;  4GUB A;  1JBP E;  4JQ8 A;  5B2K A;  2BUJ A;  3E5A A;  3W32 A;  2W06 A;  5ETF A;  1SVG A;  2WQO A;  1NY3 A;  1ZLT A;  2X0O A;  3G6G A;  1ZOG A;  3TEI A;  5CEQ A;  4FKI A;  3GP0 A;  3KXH A;  4IWQ A;  2QOH A;  2AQX A;  3R2Y A;  4WUN A;  2XF0 A;  4BRX A;  4UN0 C;  2XK6 A;  3TKH A;  4BCO A;  5CU0 A;  2YCS A;  1UNG A;  5EG3 A;  2XM8 A;  4DTK A;  5IH6 A;  5FWK K;  1DS5 A;  3QGY A;  3AMA A;  2W1G A;  1OUK A;  4JDH A;  3Q4Z A;  4FNW A;  4KIK A;  1REK A;  4OAU C;  4GU6 A;  3PPJ A;  4NIF A;  4YBK A;  3EKK A;  3E92 A;  2Y4I C;  4HYS A;  4HPT E;  1PYX A;  3E63 A;  3CBL A;  3DJ5 A;  2ITY A;  3NYN A;  5CAU A;  1ZYS A;  2XH5 A;  2VTT A;  2XNP A;  4PTE A;  3MA6 A;  2VTL A;  4FUX A;  3M42 A;  3MH1 A;  5CU6 A;  2RKU A;  3ANQ A;  3EQR A;  3UE4 A;  5KMJ A;  3MH0 A;  4ZTN A;  4RIY A;  3UMW A;  1TQP A;  3IW7 A;  3Q6W A;  5FBN C;  3VHE A;  4BTF A;  4D9U A;  3DXN A;  1CDK A;  1CM8 A;  1W2F A;  3AT2 A;  3O7L D;  3OG7 A;  3B8Q A;  3LFB A;  1M2Q A;  4OTH A;  3ZSI A;  3EQF A;  2JC6 A;  5EH0 A;  3MVJ A;  4BDG A;  5DRB A;  1KE9 A;  4NTT A;  3MFS A;  4RSS A;  3C9W A;  3G0F A;  3NCZ A;  1UKH A;  3E88 A;  3PFQ A;  4JAI A;  4E6D A;  5CAS A;  1Q3D A;  2V62 A;  4PX6 A;  4FSR A;  4F70 A;  2OID A;  4JNW A;  3ZSG A;  2XRU A;  1T46 A;  4KNB A;  4R1V A;  3MH2 A;  2JKQ A;  2X0G A;  3EN5 A;  3G5D A;  3Q60 A;  2HEL A;  4X3F B;  5F9E A;  2ITT A;  4GII A;  4YJP A;  3DTC A;  3BHV A;  3UNK A;  3VUK A;  4UMT A;  5IG1 A;  3U87 A;  2WO6 A;  2V7O A;  4BFM A;  2IZT A;  2VO6 A;  3ZFM A;  5ANO A;  4BID A;  4ZLY A;  4G3E A;  4G5P A;  3UYS A;  1W83 A;  3NR9 A;  3FC2 A;  4HZS A;  4YUR A;  2WMV A;  3ZUT A;  3TTI A;  1PXK A;  3DND A;  4F64 A;  4S30 A;  3Q9X A;  2PK9 A;  3H0Z A;  4XHK B;  3SX9 A;  4PP9 A;  1PYE A;  1UWH A;  3OOG A;  4DIT A;  1AD5 A;  5KO1 A;  2JDV A;  2W17 A;  4FII A;  3QUD A;  4O4D A;  5AUY A;  3RK5 A;  2OK1 A;  4DBN A;  4R7I A;  5DT0 A;  5C26 A;  3CJF A;  5D10 A;  4FIF A;  4AGC A;  3V5Q A;  4G17 A;  3HEC A;  2OZA A;  4FKG A;  2R7B A;  3VBW A;  1T45 A;  2P33 A;  4LUE A;  3PWY A;  4QTB A;  4A7C A;  4BCF A;  5IF1 A;  3GCP A;  4BIC A;  3GCQ A;  3UOJ A;  4Q9Z A;  2YER A;  5LWM A;  1SM2 A;  4ZLZ A;  4WNP A;  3EID A;  4C4E A;  4R7H A;  5LOH A;  3IQ7 A;  4FYN A;  2VWI A;  5AAF A;  4ZY4 A;  2OU7 A;  3LMG A;  1F0Q A;  4X7Q A;  1R0E A;  2C5N A;  3U4W A;  4LOO A;  3ZON A;  5E7R A;  1ZRZ A;  4IBM A;  4L52 A;  4MF0 A;  4K8A A;  4WHZ A;  4V0G A;  4L3J A;  4FSY A;  4EBW A;  3EN6 A;  3TXO A;  5LJJ A;  4PQN A;  5DFP A;  2ITN A;  3BWJ A;  4M12 A;  4WG3 A;  3V5P A;  4QMT A;  4E5W A;  5LVM A;  4AF3 A;  4IZA A;  3OW3 A;  4I4E A;  4E4M A;  1OL5 A;  2JIV A;  3QKM A;  4HCU A;  2QHN A;  1CKJ A;  3E62 A;  1J1C A;  1YOM A;  3ALO A;  3D2I A;  1ZYL A;  1OPJ A;  4PTC A;  4XCU A;  4CLJ A;  2BDW A;  4TWP A;  1YXU A;  2R3F A;  3QRI A;  3NS9 A;  3NAX A;  3ZDI A;  4DG2 E;  2F2C B;  5AA8 A;  4WA9 A;  4YBJ A;  2XS0 A;  4JG8 A;  3MPA A;  3CPC A;  4ZZM A;  4LI5 A;  4QD6 A;  3MFR A;  4G6N A;  1FVR A;  1QPD A;  4TYJ A;  3FQE A;  4F0I A;  3A62 A;  4BCK A;  2HXQ A;  2RIO A;  4ZTL A;  3KXZ A;  4E5A X;  4ID7 A;  4JX3 A;  5AR2 A;  4EOM A;  2YM6 A;  2JDS A;  4D0W A;  1W2C A;  4JDJ A;  4JG7 A;  2WAJ A;  4OTP A;  4XJ0 A;  3AT4 A;  3Q9W A;  2W1Z A;  5JMS A;  4PF4 A;  3F7Z A;  3P9J A;  5HU9 A;  3LJ1 A;  1B6C B;  4XUF A;  4I5M A;  2YDK A;  4CZT A;  4H1M A;  3OWL A;  4FV9 A;  1IA8 A;  3VJN A;  3I6W A;  5EW8 A;  3F6X A;  3Q9Z A;  4PUZ A;  5D7A A;  4D5H A;  3UNZ A;  3EQC A;  5A3X A;  4LQM A;  1OPL A;  5D1J A;  4IFC A;  5FRI A;  4GYI A;  3VS2 A;  5HX6 A;  3LFF A;  4C3F A;  4XRJ A;  1BLX A;  4WNK A;  4OW8 A;  2A4L A;  4V01 A;  3PY1 A;  3COI A;  4O0Y A;  5HID A;  4D2R A;  2C3I B;  3GU7 A;  3MY0 A;  4KD1 A;  1H24 A;  3MYG A;  3P78 A;  2HIW A;  4JQ7 A;  1JVP P;  3CQW A;  3WF8 A;  1V0P A;  4YHF A;  5C8M A;  4CYI A;  1PXO A;  3QWJ A;  4YJR A;  3I4B A;  3S00 A;  2R7I A;  4GFG A;  4ZZN A;  3VID A;  2XRW A;  4APP A;  1WBV A;  2QOD A;  4BGQ A;  5J7B A;  2BHE A;  4YC8 A;  3GCS A;  2ZV7 A;  4LRM A;  4K33 A;  3DKG A;  3BPR A;  4MF1 A;  4GIH A;  2FVD A;  1YQJ A;  3I81 A;  4GUE A;  2W1H A;  3QTZ A;  3I5N A;  5DE2 A;  4FF8 A;  3PSB A;  3Q6U A;  4RWJ A;  4BDJ A;  2GSF A;  4GJ2 A;  4IAN A;  5KZI A;  1M17 A;  3LCT A;  3OUN B;  4FT7 A;  4QMU A;  5AR8 A;  2W9F B;  3HDM A;  3ENH A;  1O6Y A;  4O4F A;  3QQL A;  4E20 A;  4D2T A;  3W10 A;  1VYZ A;  3TUC A;  2YZA A;  1ZMW A;  2E9P A;  2NPQ A;  3PIY A;  3FKN A;  5L2I A;  3H3C A;  3AGM A;  2JKK A;  3FMN A;  3Q4U A;  2DQ7 X;  4U79 A;  3HVC A;  5DT3 A;  1PW2 A;  3IGO A;  1FQ1 B;  1KOB A;  3C4F A;  2ITZ A;  4FKU A;  5KMK A;  2E9N A;  2XUU A;  1YW2 A;  3B2W A;  3NEW A;  4ANO A;  5AAE A;  3QTW A;  4D0X A;  2OFV A;  2J9M A;  2GMX A;  1YDR E;  4RLK A;  3TI1 A;  4RA5 A;  5M51 A;  5ACB C;  4WBO A;  2Y7J A;  2JKO A;  4RQV A;  4FTC A;  3WF6 A;  2XIY A;  3QXO A;  4I6B A;  5J87 A;  4ACG A;  4ANN A;  3F2A A;  4KRD A;  4Y73 A;  3F5X A;  3L1S A;  5HG8 A;  4ANS A;  4GG7 A;  4DH8 A;  2HXL A;  3FLQ A;  4ZP5 A;  2CLX A;  2WMB A;  1LEZ A;  3UO4 A;  4X21 A;  5HVK A;  4IHP A;  3F2N A;  3GT8 A;  4YMJ A;  3EQI A;  2RFS A;  3FV8 A;  4O21 A;  5JT2 A;  3NSZ A;  2WGJ A;  4ASE A;  3PLS A;  4DAW A;  2G2H A;  2HYY A;  3AT3 A;  2JFL A;  4AW5 A;  4EK4 A;  5KHX A;  5LQF A;  1WCC A;  3UTO A;  2QLQ A;  5HU3 A;  2IW6 A;  5BVO A;  1KV1 A;  4YJO A;  5FDX A;  4XBR A;  1PXJ A;  5DN3 A;  3EFJ A;  3H9O A;  1Q8W A;  4A9Y A;  2XNG A;  4Z3V A;  2XNB A;  4HVS A;  3VBY A;  5LMK C;  2QR7 A;  3OY1 A;  5JKG A;  1WMK A;  2BIY A;  3DK6 A;  4CSV A;  1BL7 A;  4QOX A;  2I0V A;  5CQW A;  4FT3 A;  5CY3 A;  4XMO A;  5DH3 A;  5IUI A;  2UZO A;  3ZRL A;  2GFC A;  5A14 A;  4M67 A;  3EN7 A;  1Y57 A;  4J97 A;  5DOS A;  2W9Z B;  4O0X A;  3VF9 A;  4F09 A;  2CCH A;  2V22 A;  5BUE A;  5FM3 A;  1JSV A;  2F7X E;  4GG5 A;  4F99 A;  2JGZ A;  4UWC A;  1RDQ E;  2UUE A;  4BDE A;  3G9N A;  1XH8 A;  3KN6 A;  5FXQ A;  1G3N A;  1IR3 A;  2REI A;  5D11 A;  4ERW A;  3NUP A;  4EUU A;  3PA5 A;  3WZK A;  2CJM A;  3LCK A;  3WZJ A;  2OJ9 A;  4TKS A;  3U9C A;  5AP2 A;  4LMU A;  5DR9 A;  4BCI A;  3CY3 A;  4R3P A;  2BAK A;  5K0K A;  3V5J A;  2RFD A;  4IAZ A;  4FOD A;  3EN4 A;  4TN6 A;  3DK7 A;  3OZ6 A;  2HK5 A;  5TKD A;  2V7A A;  4U45 A;  5H8E A;  1OKZ A;  3V8W A;  4AAC A;  4FKQ A;  4WT6 A;  3OMV A;  3PIX A;  4EBV A;  5EDP A;  2IO6 A;  2HW6 A;  1JKS A;  3EQB A;  4FKV A;  4AN3 A;  2VV9 A;  4ZJV A;  4DGO A;  3MIA A;  2QC6 A;  3GU5 A;  5AJQ A;  3VUH A;  4F63 A;  1APM E;  4IFG A;  4BDF A;  4I5H A;  4A4X A;  1GII A;  3R9D A;  4ZLO A;  3BRB A;  3W2S A;  4I23 A;  2OJJ A;  3ET7 A;  2NP8 A;  1KE7 A;  2GTM A;  4RFZ A;  4NJ3 A;  1F3M C;  4QP9 A;  4TWO A;  5KBQ A;  1SVE A;  3LFN A;  4WNO A;  2ETR A;  3OWP A;  1B38 A;  1XJD A;  4FIC A;  3RIN A;  2J0J A;  5IA3 A;  1PY5 A;  5AV0 A;  3R22 A;  4ITI A;  5CF4 A;  2GCD A;  4PMS A;  4LM5 A;  4C4I A;  4IAK A;  5A6N A;  1YOL A;  1P5E A;  2B1P A;  4J7B A;  4QPM A;  4RC3 A;  5J5S A;  5BVW A;  1ERK A;  3EL8 A;  3ORK A;  4IX5 A;  2BMC A;  3FLN C;  4G6O A;  4YU2 A;  4TYH A;  3HMI A;  3UP7 A;  4YO6 A;  2R3I A;  4WSY A;  5JQ5 A;  3UZT A;  3DTW A;  3DZO A;  3BHH A;  2VWZ A;  4L8M A;  5M57 A;  3GI3 A;  2F9G A;  4W8E A;  1XH6 A;  3DQW A;  3NCG A;  4JDK A;  4ZTH A;  3D7T B;  3D94 A;  3U6H A;  2OFU A;  4IE9 A;  3BGP A;  3H0Y A;  1ZMU A;  2R3R A;  3I7C A;  3C1X A;  3RAW A;  3L8V A;  3ORN A;  1JWH A;  4X3J A;  4W4W A;  3ODZ X;  3OTU A;  5CI6 A;  3S3I A;  4CCB A;  5HQ0 A;  3FSK A;  2WMX A;  3VBX A;  3D15 A;  5CNO A;  4M13 A;  3U51 A;  4AFE A;  4IEB A;  3HL7 A;  5EI8 A;  5F94 A;  2PVH A;  3HV6 A;  3R1S A;  4B8L A;  2WQN A;  3RK7 A;  3F82 A;  1Q4L A;  2O65 A;  2FO0 A;  1OVE A;  3F5G A;  4M84 A;  3H30 A;  4ACM A;  4EKK A;  2BZJ A;  5A46 A;  2O3P A;  2R3M A;  2WXV A;  4XP0 A;  5CAN A;  2ITP A;  2WQM A;  2PZ5 A;  4NK9 A;  5CVG A;  3I7B A;  3VS7 A;  1JNK A;  1YHS A;  2VX3 A;  3QQJ A;  4MTA A;  4QYG A;  2V5Q A;  4RVK A;  2ZAZ A;  2ZDU A;  3VUG A;  4EI4 A;  2C6O A;  4U43 A;  3AXW A;  1Y91 A;  4WG5 A;  1H26 A;  3RPV A;  2BR1 A;  2XP2 A;  5M4C A;  2C6T A;  3CTQ A;  4OTG A;  4MBI A;  5FG8 A;  4HCT A;  4Q5E A;  4CZY B;  4YZ9 A;  5TF9 A;  2A2A A;  4GK4 A;  1YXV A;  3C4C A;  4EHV A;  2ZOQ A;  5AV3 A;  2VU3 A;  4DEE A;  3FQS A;  3VF8 A;  5CQU A;  3CQU A;  3CY2 A;  3OT3 A;  3II5 A;  3R21 A;  2ONL A;  5HVJ A;  4EL9 A;  2G1T A;  3R1Q A;  4IM3 A;  4GT4 A;  2W4O A;  4O4E A;  5HG5 A;  2EU9 A;  5EKN A;  3PSC A;  1GY3 A;  4JJR A;  4HYH A;  4WUA A;  4F4P A;  2QVS E;  1P4F A;  1SMH A;  3TNH A;  2IVV A;  4J95 A;  4G9R A;  5DG5 A;  4MNF A;  2YIS A;  2XEZ A;  3CC6 A;  3NW6 A;  3K2L A;  1LUF A;  5CI7 A;  3SC1 A;  3SOC A;  3KXN A;  3SW4 A;  3OD6 X;  3HRF A;  3OXI A;  5BNJ A;  2J7T A;  2WPA A;  2IJM A;  1ZZL A;  2J0I A;  4ZXT A;  4Z9L A;  4G9C A;  3QYZ A;  3R7E A;  2PUU A;  3RPO A;  3WZE A;  5J5T A;  3L8X A;  3GOK A;  4RPV A;  3HA6 A;  4RJ3 A;  4LOQ A;  5KUP A;  2J5E A;  3SLS A;  1GZ8 A;  3EQH A;  3R8Z A;  3ZBX A;  4LGD A;  3GUB A;  5ETA A;  3VUI A;  4EWQ A;  2J2I B;  3DDP A;  4PV0 A;  1YWV A;  3GC0 A;  5HO7 A;  5JFX A;  5AM7 A;  2WEV A;  2G01 A;  3B2T A;  3O51 A;  4KBA A;  3PXR A;  4RVM A;  2XNM A;  2PL0 A;  5BYZ A;  4W8D A;  2UW0 A;  1PXM A;  2B9J A;  3BX5 A;  2J51 A;  3KQ7 A;  4OBQ A;  5AV1 A;  3W2C A;  4NTS A;  3GB2 A;  3LHJ A;  5CAL A;  1Q62 A;  4BDK A;  5E91 A;  4C2V A;  4AN9 A;  2UW4 A;  4BTJ A;  3D5V A;  3FMM A;  3ZM4 A;  5I9Z A;  3NIE A;  5L6P A;  3RTP A;  2GNH A;  4XEY A;  2HZI A;  2JDR A;  3NRM A;  3QD4 A;  2O8Y A;  3GU6 A;  4C57 A;  4JS8 A;  3BHU A;  2XKC A;  5TR6 A;  3RJC A;  4NEU A;  3KVX A;  3QYW A;  3JUH A;  3ZXT A;  1FVT A;  5JQ8 A;  3BE9 A;  2OSC A;  3O71 A;  4C8B A;  2I6L A;  4EKL A;  2QLU A;  3C0G A;  3PSD A;  3OCS A;  2OH0 E;  4HNF A;  5A4L A;  4D4Y A;  2OWB A;  2X81 A;  3RNI A;  3GQI A;  2HY8 1;  5GJG A;  3RAH A;  3AOX A;  4YSJ A;  3IPH A;  4CTB A;  4IIR A;  3PVU A;  1H4L A;  2KUL A;  3VUD A;  2QOF A;  3A4P A;  3UMX A;  4BI2 A;  5BMS A;  5C27 A;  3OWK A;  4CFF A;  5LVN A;  4BCQ A;  2OW3 A;  4JL9 A;  2OIQ A;  3UIM A;  1WBP A;  2OG8 A;  1WBO A;  4GFM A;  4MBL A;  3R02 A;  4E1Z A;  4E8A A;  3HV4 A;  4QTC A;  2BRH A;  5BVE A;  2WTD A;  4UXQ A;  1PMV A;  5AUX A;  4ZS0 A;  4FEQ A;  4AFJ A;  2VAG A;  3BYO A;  3H9R A;  4CQG A;  3FMJ A;  4YZM A;  4D2V A;  2BRB A;  4P4C A;  2ZB1 A;  4LGH A;  3R9N A;  3UPX A;  4KB8 A;  4CLI A;  2IN6 A;  4YR8 A;  1DI8 A;  4FKS A;  1JKL A;  3ALN A;  2DS1 A;  4LRJ A;  5AUZ A;  4A4L A;  4XG4 A;  2P4I A;  1KE5 A;  4C62 A;  1FGI A;  2UVZ A;  3VC4 A;  4AZF A;  3NUY A;  4XLV A;  2Y4I B;  2G15 A;  5HG7 A;  2YWP A;  5CU3 A;  1WBT A;  2WOT A;  4FSZ A;  4JXF A;  2E9V A;  1PHK A;  4FUY A;  4P7E A;  3DKO A;  4KS7 A;  2R0U A;  5A9U A;  3QX2 A;  4ZK5 A;  2XYU A;  2F4J A;  3VBV A;  4JX7 A;  1Q8T A;  3KY2 A;  5BQ0 A;  3PVB A;  2GHG A;  2J6M A;  3LFC A;  4MXX A;  4XBU A;  4D2P A;  3UIU A;  5M4I A;  1H1S A;  3C0I A;  2QI8 A;  4EOK A;  4BKY A;  4YJV A;  3KRW A;  2HCK A;  2WMA A;  4L45 A;  5CU4 A;  5CT0 A;  3MIY A;  3RI1 A;  2IW9 A;  3ULI A;  3VBQ A;  5E8Y A;  1OEC A;  2CSN A;  3LFA A;  4PDS A;  4QMM A;  5CU2 A;  4AOT A;  4OAV B;  4R3R A;  3ZTX A;  5M44 A;  4TT7 A;  2Y6O A;  3DBD A;  4FV1 A;  2FST X;  4TND A;  4RX5 A;  1R3C A;  2C5O A;  3QL8 A;  5HKM A;  2VX1 A;  4D58 A;  3PIZ A;  4D55 A;  1YRP A;  5IZF A;  4CKJ A;  3RHX A;  3E7O A;  5IME A;  1SYK A;  4NST A;  2C30 A;  3OEZ A;  4Y8D A;  4QTA A;  4RA4 A;  2JED A;  4A06 A;  2C6E A;  2EB3 A;  1FMO E;  3R30 A;  4B8M A;  3VS3 A;  3LIJ A;  4NFN A;  1QPC A;  3ZBF A;  4HGE A; 
#chains in the Genus database with same CATH homology
 2X0O A;  4FRF A;  1W2D A;  2X0P A;  4O4D A;  2A98 A;  2AQX A;  4O4C A;  4O4B B;  2IF8 A;  1W2F A;  1W2C A;  1TZD A;  2IEW A;  4O4F A;  2X0Q A;  4O4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...