4O4GA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o4gA05
2OPQA 5L9XA 2CJQA 3VQ7A 4RW7A 4KPYA 1S0MA 5KFSA 3F73A 3ZSYA 4CJWA 3U3YA 4FK4A 1EETA 4IRKA 3BREA 4MH8A 4PQUA 3IS9A 2NUBA 2CKWA 4H4MA 3PW2A 2XGQA 3BGRA 1KFDA 3HP9A 4JV0A 1REVA 4E0DA 1ZETA 3PO4A 1W0HA 4QWAA 3V9SA 4M3TA 3MEEB 2QV6A 3LZIA 1FXXA 2IBKA 3FFIB 1CXQA 2I1RA 4ZPAA 1S1VA 4PUOA 4DU1A 3G0ZA 4FJ7A 4ECUA 4ELUA 1UA0A 4O3OA 3CIZA 4TLRA 4NRUA 2ITGA 3OYFA 4DSJA 3OLBA 5CYMB 1F21A 5CYMA 4DL6A 2B5JB 4DEZA 2G8WA 1JLBA 4DS5A 4J2AA 4F4YA 3OYKA 1SV5A 2FBVA 2XCAA 1BIUA 1S9EB 1UA1A 4U6PA 5KFAA 3GIMA 2QK9A 1U4BA 4E3SA 1RT7A 4J9RA 3MXMA 1TVRA 2IMWP 3ZSRA 2FVSA 4CGJA 3D0PA 3G10A 4UQGA 3LAMA 4FLWA 4J9NA 2D3ZA 2GUIA 2FJXA 4NLSA 1RTHA 5KI6A 3IGVA 4ECXA 3SUNA 4F3OA 2IAJA 1N5YA 2HHTA 1BQMA 1RT2A 2ZE2B 4NZ0A 4WE1B 4KHYA 1IKWB 3PO5A 3AVFA 5F8GA 1JLCB 3ZSVA 1S1UA 3T5JA 4KAZA 1S1TA 2E9RX 3MEEA 2O4IA 1VSEA 3SZ2A 4KHNA 4DFKA 3P5JA 4B3OB 3KK2A 3CJ2A 3H2LA 1RNHA 1JLFA 3V9XA 3RR8A 3A2FA 1LW0B 4K4TA 4ZPBA 3EZUA 2WOMB 1RTDA 3VQPA 2ILYA 5SZTA 3O4QA 2G8FA 3DM2B 3L2UA 1ZBIA 2HHVA 4F4ZA 4RW7B 5HRRA 5L1KA 4YMEA 3CQ8A 5KFCA 2FVPA 1EP4A 1S1TB 4OPJA 1BI4B 2VA3A 3DLBA 4Y3CA 3U6FA 3ULDA 1EETB 1Z26A 5EWEA 4CHZA 1SH2A 4URQU 3SV3A 4RW6A 5J2NB 3CJ0A 4QWBA 4IKAA 5HP1B 4Y1DA 1DTTA 3MFHA 3DRRA 4OPKA 2HW3A 2UVUA 4BDPA 1K1SA 3KLIB 4GVMA 3PW0A 2BRKA 4RW9A 1QE1B 3GV5B 4RW4B 2OZSA 4MFBA 3VA3A 4M3WA 4WXOA 1HYVA 3NBPA 2LSNA 3LALA 1HMVA 4Z4FA 2VA2A 4DTXA 2RN2A 1TK0A 3V6HA 3AA2A 5F8HA 3TABA 4O0JA 1K1QA 4KTQA 4CJQA 3M9MB 1QS4A 4DL4A 1JL2A 1SH3A 3UPFA 2B4JA 1MMLA 3ZSXA 3SUPA 3H5XA 1XWLA 4CJ5A 4LSNA 1FKPA 3OYNA 2E6LA 1TKXA 3OYCA 4IH7A 5FRNA 4C8NA 4B9UA 2KFNA 5I42A 2XY7A 3HVWA 4FW2A 4CGIA 3SCXA 3THVA 1WNSA 3KLHB 4HUFA 3GYNA 1J9AA 5CZ2A 4MIAA 4O3PA 5DQHA 3AVBA 1JLFB 2ILZA 4K4UA 2RF2A 4M3YA 3RB4A 4DQRA 4ZPDA 3CM6A 4J9SA 1KLMA 4AHCA 4EP5A 3H5YA 1K6YA 1BHLA 3ZT0A 4N41A 5KFIA 3VQ9A 4IG0B 2D7SA 3MTKA 1XC9A 3TAMA 3HPHA 2OPRA 1NK7A 4RUCA 2IDOA 1C0UA 4DFJA 4QCLA 3ZCMA 5HBMB 1NK6A 4OJRA 4FCYA 2JEFA 3VQEA 3MEGB 2HHSA 1S6QA 1RA7A 1NK0A 4ED8A 1ZBFA 3LWLA 3QNOA 3SQ0A 5FDLB 1X1PA 2DFEA 3ZT2A 1HQEA 2BR0A 4J9QA 2ZD1A 5DGAA 3B6PA 2WTFA 3DLEA 1MU2A 3KK1B 3GV7B 3MAQA 5F8IA 1L3TA 3KK2B 3KLFA 1GX6A 3OYGA 1RT3A 3RBEA 2QE5A 2RPIA 1LWEB 2R2UA 4E19A 4DL7A 1WAJA 1TL3A 1TKZB 4FJLA 1CZBA 3KLIA 4YR3A 5J2MB 4YQWA 4CGDA 3IG1A 4FVMA 4Z4CA 3K5OA 4Z4GA 5T7BA 4JRQA 3RB6A 3Q8SB 1X9MA 1JLBB 2IM0A 3L8BA 1HNIA 4I7FA 4Z4HA 3VQ8A 4FXDA 3HHKA 4CIFA 5KRTA 3DLKA 4RG8A 3AVGA 1TV6A 2YNFB 4J9PA 4EYIB 1TL1A 1IKXA 1IKXB 4C8KA 5KFRA 3SQ2A 5KFTA 1REVB 2YKMB 1XHXA 2Z1JA 3K58A 3HKWA 4E1NA 5HLFB 2JLEA 5J2PB 2RDJA 3I5BA 1JX4A 3QZ7A 4ICLA 3KHLA 4YR2A 5KFGA 5C5JA 4DLGA 3H4DA 4O4RA 4FJ8A 3AO3A 4IDKB 3GIIA 4DSLA 1O1WA 1OS5A 3PX4A 4IFVB 4IG3B 3HO1A 2V4RA 3TWHA 1S0NA 4KAIA 5KFNA 3MECA 4DTSA 1DLOA 2AQ4A 4KTWA 2OPPB 4QWDA 1ASUA 4B8AB 1U47A 2D0BA 4NCGA 1A5WA 5HRNA 4NCAA 5F8JA 4CJSA 2HB5A 2Z1HA 4BWMA 4OKJA 1XR7A 3TAFA 1RTJA 2DTUA 3HPOA 3AO4A 2R8HA 3NGIA 4ECVA 4OGCA 4KREA 5EWFA 4B9NA 4Y34A 4J2DA 4EP4A 4JRPA 2YNGA 3HK2A 3KJVB 1LWCB 4DF4A 4NLYA 2OPSA 1JKHA 2JC0A 4CJFA 4BDYA 4B9SA 2KZMA 1KSPA 4M94A 1RDCA 3NGYA 2AU0A 2IOCA 4DTRA 1RBSA 3RB0A 3HSTB 2FBXA 1YTUA 1C0TA 2HNYB 4C8OA 3E01A 4CK2A 3AA5X 1WSEA 1LW0A 1HYSB 3KNAA 1T8EA 1YVFA 5I3UA 3EPGA 1T3NA 3G6YA 4PY5A 2VG7A 1VSLA 1LWFB 4NLQA 4ECTA 4ZVGA 5I42B 1SKSA 1J5OB 3NH2A 1J5OA 4GMJB 3LPUA 3WNEA 4Q44A 1JLQA 4GC6A 3QO9A 3H5SA 2AWZA 2JGUA 1IKVA 3GIJA 1NK5A 4FLYA 3L2VA 2W7PA 4KE5A 3V1RA 4CERA 5C25A 4DQPA 3OL7A 3OYLA 4O44A 4Z0UA 4DFPA 3OSNA 3NH0A 4Y2AA 3L2RA 3DYAA 1G15A 1N48A 1IKYB 3S9HA 3QIPA 3MR6A 1CZ9A 3TAPA 2GV9A 2ZD1B 4I2PB 3RRHA 3UDLA 3O4NA 5J1EB 4CEQA 3NDKA 4H4OA 3G86A 3OYIA 3KD5E 4RNMA 1S9GA 2HMIA 4IR1A 1TKTA 1FKPB 1VSFA 4IG0A 1HQUA 5C42A 1NJZA 4W5QA 4WZQA 4CCHA 3AVNA 4FM0A 1KVCA 1YVUA 1RT6A 1QSSA 2PYLA 3H98A 2XHBA 4ZP6A 3TAGA 2EX3A 3GV8B 3TR8A 3D28A 3ICLA 2UVVA 3CFOA 1LAVA 3LP1B 4E7IA 4M45A 3DRSA 4CIEA 5HLFA 5DG9A 3QERA 4FZYA 4ZHRA 1QHTA 5F9LA 1C6VA 4R8UA 1WSGA 4LSNB 3VA0A 1EXQA 3KMQA 4CJPA 1ASVA 4O3RA 3NAIA 3VN5A 3NAHA 4NLUA 1BCOA 4J9KA 3T5HA 4E89A 5C24B 4ZMMA 3HVTB 4FJKA 3DMJA 4I7FB 2BANA 2VG6A 5DGBA 3I0SA 4QOZB 2AX0A 3JSMA 2WOMA 2OH2A 4CF8A 4PQUB 4OLAA 4B9TA 2QXFA 3C6TB 4F3TA 3SI8A 4TYAA 2UUTA 5KFEA 4L8RB 3S3NA 3EPIA 2E6MA 1RDDA 2ASLA 2HHXA 3SFUA 4YFUA 4LD0A 4FZZA 3KK3B 4F4WA 3ZSQA 2W9BA 1BI4A 3NGDA 1J54A 3FFIA 1ITGA 3H4BA 3V6DB 3V6DA 3CDEA 3E51A 2HVHA 4K8XA 1ZBHA 4TQRA 2XI2A 2G8IA 1L5UA 1S6QB 3HVTA 4URSA 3RMBA 3CG7A 3VQCA 1NK4A 3RRGA 1C0TB 5L1JA 2VG7B 4AHSA 4M3ZA 4CHOA 3MR3A 2W8LA 2WHOA 3OYBA 1ZBUA 5KGWA 4CEAA 3KHGA 4DTMA 4J9MA 4I2QB 3FDSA 2OPSB 5KT3A 2F8TA 4ECWA 2HWIA 4R5PB 2YNHB 4N56A 4J9LA 5T14A 4CJVA 2C2DA 2A1RA 1NK8A 3KLFB 3O3HA 2W9BB 4RUAA 4OKKA 2W9AA 1YT3A 1TAQA 2JEGA 3KKSA 3AO1A 1RT1A 4KHRA 1TKZA 1NHVA 5KFYA 4E7LA 3M8RA 2VWJA 3M9OB 2IC3A 3CDWA 2B43A 1RT6B 4NYFA 4ZP9A 4CJTA 3K59A 3AVJA 1QUVA 3NAEA 3V9UA 4E7KA 4O4GB 1FK9A 3AVLA 2G8HA 4RNFA 1RYRA 2UVWA 4K4SA 2R8GA 3F9KA 3ZT4A 4Z4IA 3VQ6A 3IN5A 3QLHB 2HNYA 4W5TA 3FQLA 1S1WB 2RKIA 1JLAB 5CYQB 1B9FA 3LWMA 2IM2A 1SUQB 1RYSA 3V1QA 4DSIA 3FRZA 4KSEB 2DPIA 1KHVA 4K50A 4EBCA 4M95A 2KTQA 3TQ1A 4QAGA 4AHTA 3S3MA 4CE9A 2YNGB 1WSFA 1HPZB 1JLGB 3RAQA 4CEFA 3AVHA 4W5RA 1CXUA 3HVAA 5FROA 3RMAA 3H5UA 4DF8A 3GILA 2W9CA 4LH4A 4ICLB 4Y2CA 4OL8A 1TQLA 4I9QA 4DG1B 3PR5B 4CJLA 2XO7A 3I0RB 4IG3A 3AVKA 4CJKA 4G3IA 3BJYA 3HXMA 1NNDA 4MK9A 1GX5A 2WONA 4BE0A 4N5SA 1EP4B 4U7CA 3OHBA 4RW6B 5KFZA 4B3OA 3HJFA 1J53A 2VG5A 3QNNA 1LWFA 1VSMA 1RDRA 5I3UB 4ED3A 4TSXA 4RW9B 5JS1A 3NF9A 2BQUA 1VRTA 1S4FA 1I3AA 3DLRA 1C1AA 1D1UA 1NOZA 3NBPB 4CF2A 3EY1A 5F8NA 3DLHA 2JEIA 1MU2B 3RMCA 3L2QA 4KHUA 4QWCA 5K14B 2I5JA 3QINA 3JYTB 1U49A 4ED0A 1UWBA 3LP2B 4KFBB 3OY9A 4KKOB 4H54A 4CF9A 5HRSA 4IQXA 1RDBA 2BE2A 4CECA 5KFWA 3NCIA 4CGFA 1VSIA 4DTJA 2O4GA 3SPYA 1N5YB 2BANB 1QQCA 3CJ5A 3NF8A 4NCBA 3VQ5A 3AVMA 1S9EA 4NLDA 3FQKA 2YKNB 4FLVA 5C25B 4EBEA 1IO2A 4OLBA 1S48A 3QYYA 2OYQA 4IFYA 5E41A 4DU3A 2J6SA 3N6LA 4IFVA 5KGXA 2Y1JA 3KLEB 3AO2A 3LP2A 1HARA 3LZJA 1JLGA 1C0UB 1N4LA 2VG6B 3MEDA 3AVCA 3ITHB 5JS2A 3BDPA 3SFGA 1HYSA 4RNHA 2X74A 2W9CB 3ZT3A 1S9GB 4RW8A 4LQ9A 4ELVA 3AVAA 3DRPA 5CYQA 3DM2A 4HTUA 3V81B 4TXSA 4WZMA 2YHAA 1TP7A 2RDIA 4M3RA 2HNZA 1NJWA 1EX4A 5D3GA 3KLGA 4KHSA 1Q8IA 3VQAA 4O4GA 1HMVB 4AH9A 3LP0A 4EEYA 3BQ0A 5J2QA 4FBTA 1Q9XA 4EZ9A 3IAYA 3CO9A 2EHGA 2OZMA 3M8PB 2F8EX 4DL3A 4DSKA 1JLAA 1U04A 4KV8B 3ALYA 2C2RA 1B9DA 3TARA 3KTQA 1N56A 5KFLA 1B92A 1D0EA 2FJVA 2IM1A 1JLCA 3P1GA 2D0AA 4K4VA 4M41A 4FS1A 2FVQA 3MR2A 1SV5B 3LANA 4FJ5A 2J6TA 3ZSWA 2HNDB 3DOLA 3RB3A 3BSNA 4MFBB 4CEZA 1NJXA 4NYNA 4AHUA 4FYDA 4CGGA 3M8QB 4OVLA 1XI1A 1RBTA 5KG7A 3HPGA 1RT1B 2VG5B 3L2WA 1TKDA 1LV5A 3OS0A 4O44B 4KHQA 3NF6A 1DTTB 5HROA 4ED1A 1XR6A 1LWEA 4KI6A 3WNGA 4Q0BB 2WCXA 3QEVA 3C6TA 4C8MA 2OPRB 1JXLA 1ASWA 4DFMA 3V6KA 3V1OA 1BCMA 4DWIA 1LW2B 3DDKA 1A5VA 3EYZA 4ED2A 4IRDA 1VRUB 3K5LA 2F96A 4WE1A 2AGOA 2PY5A 3QLHA 2A1SA 3RMDA 4NLXA 1BISA 3NGZA 3S3OA 3OYJA 1S6PB 4CJ4A 4FJGA 4KFBA 3OL8A 5KFUA 3I0RA 5KT2A 1SL0A 4F2RA 1GOAA 3O3FA 3SNNA 1W9HA 4Q0BA 4NLRA 4Q43A 5DQIA 3KOAA 1Z25A 5KT5A 4PWDB 4IH5A 2FLLA 2WONB 3AV9A 1S1XB 5EU7A 4B8CA 2KW4A 2QKBA 4NLPA 3M8PA 3CM5A 2AGPA 2ZE2A 2O5DA 4DQQA 2YNIB 2YKNA 3C95A 4KO0B 2E4LA 3VQBA 3SYZA 4IH6A 1HQUB 4ECRA 3DOKB 4CEEA 2V0NA 5F8LA 2OPPA 5KG3A 1XHZA 4M42A 3G6VA 1D9DA 4ECZA 4BACA 1T03B 3OHAA 4RW8B 4K4YA 2IJNA 1RT5B 4Q45A 2DPJA 4EZ6A 2D0CA 4HYKA 2ATLA 1TL3B 3TI0A 4DG1A 1L3SA 4ZTFA 3OYDA 4QWEA 4ED6A 1Y97A 1TGOA 4EO6A 4HHTA 3IG1B 5EDWA 4KB1A 5HRPA 3TVKA 3GQCA 5CZ1A 2HNZB 1RA6A 3KMSA 1HRHA 1RCHA 3BR9A 1IH7A 3SUQA 1U45A 4B9MA 2Z1IA 4CHYA 4AILC 1KHWA 2I5JB 3L3UA 3HT3A 4LY7A 3KLEA 1TK8A 4FM2A 1S0OA 3ZSOA 3SQ4A 3OJSA 1LAWA 1X9SA 3Q8RB 5DLGA 3CDUA 3VQQA 2ASJA 1KLNA 4OGEA 1HNIB 3DOLB 2V4QA 4WFXA 3KLVA 4CIGA 4F4XA 3CJ3A 1RTIA 1RTIB 4RNOA 4Q8FA 2R2TA 2XC9A 4LH5A 3QEPA 1A5XA 1BGXT 1KVBA 5F9NA 1DTQA 4J2EA 1VRTB 2GIRA 3LPTA 4CK1A 1FKOB 2XY5A 4WXWA 3TAQA 3PVXA 1RTHB 4FJMA 3DMJB 4DTPA 4MQ3A 4ID5B 4DTOA 4RU9A 2D3UA 4BWJA 4J9OA 2D5RA 4JUZA 1SUQA 1ZTTA 2BRLA 4BE2A 3V4IA 5JUMA 3DRPB 2X78A 3C6UA 4YP3A 4O0IA 1LWCA 4HKQA 3SPZA 4ZTJA 3MEDB 2P1JA 2IJFA 1U48A 5L1LA 2C28A 3D45A 4ZVFA 5KG4A 3OS2A 1IM4A 3MEGA 3SUOA 3BSCA 2DY4A 5KFHA 3HYFA 1QAIA 1RT5A 1UAXA 2FBTA 4B9VA 1HNVB 4CEOA 2HWHA 4XIUA 4K8ZA 3ASMA 4I2PA 1RDAA 3VQDA 4KRFA 4JS4A 2G8VA 4XPEA 3PW5A 4O3QA 1JL1A 1WSIA 3C6UB 1NKBA 2IA6A 4DSEA 4YR0A 4FW1A 1HJRA 3P83D 3AO5A 4N76A 3WNHA 4MK8A 2AX1A 2BGGA 5KTQA 4CFBA 2KZZA 2C2EA 1SKWA 3QIPB 3OL9A 4ZP8A 4R8UB 4CGHA 3T5LA 3QGIA 4ECQA 3PZPA 2R2RA 4W5OA 3MF5A 1NHUA 3BSOA 4RW4A 2YNHA 3DLGA 4EYHB 1S1VB 4PUOB 1VSDA 4JLHA 2B6AB 1WSJA 1S1WA 3N6MA 1VK0A 2GIQA 2OA8A 2XI3A 1I6JA 3NFAA 5JXSA 2HHQA 4HUGA 5KG5A 5J2NA 4ZP7A 2G8UA 4I9LA 2IC3B 1VSKA 5KFMA 2FBYA 1D8YA 2YKMA 4HCCA 3V9WA 2BDPA 3AA3A 4B9LA 3UQSA 3MFIA 3RAXA 4O55A 4MKBA 3DI6A 1C1BB 2XWYA 1VRUA 4R5PA 4G1QB 2R8JA 3SI6A 2YV0X 4Q5VA 4KO0A 1HYZA 5K14A 4Q8EA 2YNIA 4XO0A 2XGPA 3KLGB 4JV2A 4FK2A 2UUWA 1NKCA 1TL1B 1DLOB 3K2PA 4I2QA 4IOBA 4FBUA 1WSHA 1I39A 1S1XA 3MXJA 1JLEA 1RT4B 1ZBLA 3NMAA 3KLHA 3NF7A 4O3SA 2P5GA 4CEDA 5KRSA 5FDLA 4DQSA 4N47A 4JS5A 3QEWA 2AJQA 3VQSA 5KFKA 1KFSA 1KCFA 1CSJA 4CJUA 5D3GB 4CESA 4DQIA 3T3FA 4GC7A 3SV4A 5L1IA 3KIOA 4CFCA 3CFPA 3CVKA 3K5MA 4TY8B 5J2QB 2EC0A 3OVNA 3ITHA 2RF2B 1RAJA 4HUEA 2GC8A 4FJIA 3RWUA 3BGRB 3PR4A 4M3UA 1RTDB 4FS2A 3CYMA 3T5KA 2Q3SA 3QEXA 2W8KA 4NLOA 3SJJA 3V81A 5KFFA 2W42A 4O5BA 2VWKA 3TAMB 3PV8A 4KB7A 1JLQB 4R0EA 3QIDA 2OPQB 2GBZA 1C1CA 4KBIA 4ID1A 3OYMA 5EUHA 5DLFA 3ISND 4FZXC 4EBDA 2AGQA 2UVRA 4TY8A 3QIOA 3ZSZA 2YHBA 3OS1A 4LQ3A 3QGHA 1HNVA 4F50A 3QGGA 2JEJA 4FJ9A 1UWBB 2FC0A 3NH1A 3QZ8A 1QTMA 4KKOA 2HVIA 3DLGB 2QKKA 3NKYA 3QETA 4ID5A 3DRSB 3PHEA 3IRXB 3N6NA 2JC1A 1WAFA 3PJXA 4DSFA 4WFYA 4FJNA 5KG1A 3H59A 4G1QA 2G8KA 2R8IA 1YTAA 3AA4A 2V9WA 4CEBA 3DRRB 3V4IB 5KT7A 3RR7A 2FVRA 1QAJA 4WFZA 3C94A 1S10A 4AHRA 3GIKA 1FK9B 4PA1A 3DI6B 3KD1E 3K57A 4WYLA 1N6QA 3FSIA 4TYBA 3UIQA 3OYHA 1C2PA 3E01B 4H4OB 1KLMB 4MIBA 5KFQA 4QPXA 1C1BA 1RT2B 3HVRA 4MK7A 4EO8A 2P51A 4CFDA 5J2MA 1IG9A 1NOYA 1GOBA 4CJEA 4CF0A 1JXEA 3PX6A 1T05A 3PW4A 5DK5A 1JKHB 5KG0A 5KFJA 4DLEA 4ZPCA 3OSPA 1NJYA 4DU4A 4MKAA 2BQRA 2XY8A 1RTJB 1TK5A 3D5MA 5KFVA 3Q8PB 1S97A 3OJUA 3JSMB 1RBVA 1ZTWA 2DFHA 3LAKA 4BDZA 3M8SA 1Z4UA 2FLPA 4H4MB 1BQMB 4K4XA 5KFBA 4QW8A 4HCBA 4ELTA 4Z4EA 1HPZA 3ZT1A 5J1EA 3HM9A 3NE6A 1RBUA 4NLTA 4Y1CA 1SL1A 3PY8A 4IKFA 2E9TA 3NL0A 3MR5A 4CFAA 3TANA 4XPCA 2XRIA 5HP1A 2YNFA 4DTUA 1BIZA 2Y1IA 4NRTA 3LP3A 3I0SB 3DLKB 4W5NA 5KFOA 3CWJA 5DG8A 3T1AA 4KI4A 2W7OA 5EWGA 2B5JA 4X2BA 2ETJA 4FLTA 4ED7A 2FVCA 5J2PA 4CHQA 4QW9A 4CJRA 2RKIB 5F8MA 3QO9B 3PJWA 4F8RA 5KT4A 4JV1A 4ZVHA 1C1CB 3JYTA 2X6SA 4CJ3A 4ZHRB 1NKEA 4TQSA 3IS9B 3RTVA 3B6OA 5DQGA 3MECB 1T05B 3KHRA 2WB4A 4B08A 3I5CA 2R7YA 1DTQB 2X6NA 4M3XA 4DTNA 1RILA 3OLAA 3TAEA 2WK4A 1W25A 4PWDA 4KHWA 2B6AA 2FLNA 3HL8A 3M8QA 1QSLA 1ZYQA 4KTZA 1VSHA 4J2BA 5FRMA 2IGIA 4KHMA 3M9NB 5SWMA 2R8KA 1T7PA 3KHHA 4DL2A 4FLUA 3H40A 4TY9A 1SL2A 1S49A 2ALZA 3DLEB 3KK1A 5KG2A 1S1UB 3IGNA 1Q9YA 3I5AA 1WLJA 1BQNB 3ISNC 1RT3B 5C24A 4URGA 2IAJB 2FJWA 2ASDA 3IRXA 1X9WA 4H8KA 3WNFA 2KFZA 3V6JA 1S9FA 4E1MA 4NLWA 4WYWA 4LSLA 4KV8A 3OL6A 1WN7A 4E7HA 4KB0A 1D5AA 1HQEB 1TVRB 4DL5A 3NHGA 2P5OA 1R0AA 1BL3A 4ECSA 4RZRA 3KK3A 4IR9A 2IM3A 4CHPA 3OYEA 4E7JA 2HHUA 4NCGB 5KFPA 1NK9A 4FK0A 3O3GA 2HMIB 3PUFA 5HROB 4ZVEA 1S6PA 4DMNA 1KTQA 3CJ4A 1S5JA 1RT7B 2Z1GA 5DMRA 4GW6A 1SH0A 1EKEA 3G6XA 2PYJA 3BSAA 4FJHA 4AHVA 4NYZA 3H08A 5KT6A 2HNDA 3DOKA 3K5NA 3QEIA 2C22A 3BQ1A 5DG7A 2J6UA 3LDSA 1RBRA 2XCPA 4FLZA 3LP1A 3V9ZA 1TKTB 1SKRA 4IDKA 3I8DA 3CFRA 2PZSA 3MXIA 5KFXA 3QESA 4BE1A 1TV6B 1T94A 1VSJA 3DYAB 2BQ3A 4RNNA 1QSYA 1TKXB 4ECYA 3U3GA 2XY6A 1L3VA 1N6QB 4TN2A 3HP6A 4IRCA 4OKEA 5CY4A 2ZKUA 1D9FA 4CF1A 1UOCA 1IKVB 1T03A 4DS4A 4FLXA 2ATQA 1IKWA 2E9ZA 4NLGA 2DFFA 1L3UA 4F2SA 3UR0A 4LSLB 5C42B 4FM1A 1KVAA 2IS3A 1KRPA 4IFYB 2HAIA 1JXBA 1XR5A 1JIHA 1U09A 1IKYA 1GOCA 5KG6A 4C8LA 3LP0B 2WRMA 4IBNA 4YNQA 3VQ4A 1BQNA 4O3NA 1CLQA 3Q8QB 3L3VA 3AVIA 2F8SA 4NLVA 2HHWA 3BQ2A 5HBMA 3KKRA 1FKOA 1LW2A 1JLEB 1RT4A 1C0MA 4HVJA 2BE2B 4F4KA 3PX0A 3PW7A 3RBDA 1WNEA 5KFDA 3SQ1A 4CHNA 4FJJA 2R2SA 2ZQBA 2KQ2A 2D41A 1QE1A 4K4ZA 4FJXA 4K4WA 1TAUA 3T19A 3KJVA 3EZ5A 1R0AB 3OYAA 4CK3A
chains in the Genus database with same CATH superfamily
3VGKA 1JXVA 3RAMA 2C2OB 3K8WA 2F8MA 4D3GA 2QFJA 3KKFA 2IPOB 2CZ4A 4H4MA 2HZVA 3BGRA 1FJGK 2XQCA 1KFDA 4F7VA 2OGUA 4J91A 1XN9A 2C3UA 4FYXB 3PO4A 1GFWB 1VQNN 2AT1B 2IBKA 3FFIB 1S1VA 4HDGA 4DU1A 4BRLA 2G2ZA 3IWNC 1UA0A 3P45B 4A8FA 4P6QA 4TLRA 3CC4S 1OVQA 3GJTB 1F1BB 4GRSA 2CJBA 3T1HJ 4MLEA 1N33F 1Q79A 4DSJA 5TKYA 4DL6A 5MLCQ 3A8JA 2BOPA 4C7QA 2B8QA 1JK9B 2Q97A 2G8WA 2FBVA 1N34K 1X5OA 3LQVA 4Q2MA 4LFCF 2O8BB 1BIUA 5CD4A 3CXCR 1S3XA 4E3SA 4J9RA 3CCUN 2E8AA 2NUHA 3QWUA 3VF6A 1F2GA 4FOIA 3JTPA 2FJXA 4M1KA 4ECXA 2O8FB 4B3SJ 3TJ8A 3JAMU 3ULEB 3BR8A 3M6VA 1U1NA 3FC9A 4NZ0A 3TZYA 1B7YB 2ZZTA 3AVFA 1YZ6A 4CT9A 4DR2F 2QLFB 4OZ0A 2I0XA 4X84A 2O4IA 1VSEA 2VQEJ 5FLXY 2NS1B 4B3OB 3TPQA 4CDIA 2L48A 4AFFA 4LF9F 1ZS6A 1RNHA 3V9XA 2KG0A 4ZPBA 3EZUA 2NRHA 5MLCV 5LSLA 3G4SN 3MN5A 2YQ1A 2CZ9A 1RWPB 3PYEA 3D1HA 1UFLA 5I4MA 2YKOA 2GAHC 3GBTA 1QQOA 2E44A 2QWMA 4DI6A 3D67A 3U6FA 4DPWA 1OSCA 4QWBA 5E2QA 4OPKA 3RSEA 3CO0P 3AAWB 1ULRA 2DKOB 1VLYA 1FJGJ 1GXTA 4WXOA 1SC1B 4CJ7A 3NBPA 1Q86T 1HMVA 4Z4FA 2VA2A 1X4GA 4FDFA 3V6HA 3C46A 3D68A 4FYVB 3BH7B 4CZLA 1KOOA 2A6AA 1RBOB 2LLZA 3M9MB 1RU1A 3F56A 2B4JA 3SUPA 3H5XA 4CJ5A 3OYNA 5DDPC 1TKXA 3J80U 4B1UB 4IH7A 3CC4N 1HWJA 4B9UA 2KFNA 3BDEA 2UUBF 3NS7B 2M4MA 4FW2A 1T9YA 3SCXA 3FCHA 2LU1A 2VC1A 3KLHB 1H2TZ 2ZJQQ 1WNSA 2FF6A 3CM6A 2L08A 4PL8A 2WVEA 2PDAA 4AHCA 1BXNA 3UNYA 1BHLA 3ZT0A 2DGVA 1Q0NA 5MAOA 3M7VA 4QR1A 2D7SA 3U02A 1NK7A 4NE9C 4CLFA 4RUCA 4FN5A 3ZCMA 2DPNA 1B0TA 1F60B 4ETZA 3M2RB 1U0SA 3MEGB 1U2VA 2JOQA 1S6QA 2BH1A 4UZCA 4ED8A 1IN0A 1NU4A 1Y00A 3J81U 1X1PA 1Y11A 1HI1A 4RCHA 2J4RA 2V4JA 2DY1A 4BR4A 3QB0A 3H25A 5F8IA 5HMZA 3KLFA 1GX6A 5ETNA 3OYGA 2PFDA 4FWNA 2VV5A 4E19A 4DL7A 1TL3A 5AQIA 3ILLA 1R8HA 3VAMA 2CPFA 1CQNA 1YJ7A 1XNQJ 4KPCA 2QSWA 3M32A 5AFUA 4DR4K 3K5OA 1XMQJ 4Z4GA 2P9KA 4X65F 1EAYC 3WUHA 1ZZFA 4DV1F 1YJUA 4JAXA 3GYGA 1MROA 3L8BA 1RGVA 4Z4HA 2DYAA 4FXDA 4JYAJ 4CIFA 2DTJA 4JI0F 3KHYA 5GINA 5JVGQ 2P9IB 2ZHOA 1TL1A 4F25A 4LR7A 1FA0A 5KFTA 4QQBA 4NI2A 2Z1JA 2PMZD 2D4WA 3HKWA 3LM9A 5J2PB 2EPIA 2RDJA 4XH4A 5AQFA 5ETSA 3QZ7A 2V51B 2WBRA 4DPYA 4ZCKA 4QU7A 4YR2A 5D8HB 2HBKA 3J80O 3H4DA 2CA9A 1A7GE 3GIIA 5DDRC 3M2VA 1OS5A 4F67A 1IQZA 1BO5O 4IG3B 5BR8F 2D69A 2VBXA 1WC5A 2DNOA 3FBCA 4Q2LA 2AQ4A 4KTWA 3U9DA 2W6LA 1U47A 1A5WA 2HQDA 4NCAA 4B3MJ 3EVWA 2LP4A 3TA2A 2M52A 2K8GA 3GSDA 2NSCA 1VC5A 2DTUA 2GHWA 3EVOA 5HATA 2R8HA 3NGIA 4KREA 4B9NA 4EP4A 3K5PA 4JRPA 1ZBSA 2V9KA 3M3ZA 5AFUH 2GHPA 2RMLA 1KSPA 3NGYA 4DTRA 2PA3A 1UFWA 3DXKA 1R8CA 2OFHX 4YEAA 1C0TA 5AR0A 4C8OA 4DPUA 4DV6F 3AA5X 1WSEA 2CH6A 3AXKA 5I3UA 3GL1A 2VG7A 4DV4K 1LWFB 4PKDB 5I42B 9RUBA 3WNEA 3VAHA 4LF8J 5LMUF 2YWKA 2F4VF 1JLQA 3QO9A 5H9EK 3E3XA 1IKVA 4DCJB 1S77D 4P71A 2C2NA 4JKBA 2V8HA 3OYLA 4O44A 2P9NB 1UJ6A 4Y2AA 3VWSA 1TUYA 4PAAA 4B3RJ 2NPIA 1N48A 3S9HA 2ACMA 4DR3J 2HFVA 3TAPA 2CJKA 2VHGA 2WSEC 1B0VA 4DR2J 4X4PA 2BUPA 4I67A 2UP1A 3MDQA 4CEQA 4CNYA 1XMQK 2M2BA 4ZDNA 2FZKB 3KD5E 3HTVA 2B4OA 4K59A 1NZ8A 4IG0A 2OD6A 2VQEF 2KN4A 1HQUA 5C42A 2CQ0A 2DNKA 3HKZD 4WFAQ 1YVUA 1RT6A 3J81Y 4HDHA 2PYLA 3NS5A 3TAGA 2MGZB 3TR8A 3CFOA 3LP1B 4C11B 3O8MA 1KBRA 3ADAC 4M45A 1CG2A 5HLFA 5DG9A 2O8BA 1Y5NB 2HHHK 5AXNA 2PIIA 4K2XA 3KMQA 2P9IA 3H6EA 3BPDA 3QT8A 4J8FA 4JK7A 4NA3A 4LBHA 4J9KA 3QT7A 1NHKL 1X4CA 2BMBA 1CJTB 1NSKL 4FJKA 2EI5A 3ZTSA 4I7FB 1Q7YT 3A5OC 5DGBA 3I0SA 4QOZB 4DJBA 4CF8A 4PQUB 2FY1A 3UO0A 4ZLNA 2UUTA 1BWEA 3KFWX 2CG8A 1UVIA 3EE9A 1R0CB 1WEYA 4NLBA 3ZSQA 4JKAA 1ITGA 3V6DB 4K8XA 1YX2A 1U8WA 5AQTA 4PKHA 4TQRA 1S6QB 4DX7A 3CG7A 2VG7B 4AHSA 2HWTA 1NUEA 4CHOA 3PACA 3UE5A 2W8LA 2WHOA 3JTOA 4BR9A 4U96A 4NA1A 3RZAA 4NO7A 1KD1T 4DTMA 3FDSA 5KT3A 2F8TA 4ECWA 4DU8A 3OVSA 3IM8A 2B9XA 2UXDK 2ZC4A 2W9BB 5AQSA 2Z2LA 1QTNB 2VCPA 3E2EA 2O8EB 2LKZA 3WEEB 4E7LA 3M8RA 2IC3A 1KDNA 3UD5A 1YJWS 4CJTA 4ZP9A 3OVAA 1QUVA 3HZGA 3I4HX 4JI5F 3MZIA 2JRSA 4K4SA 1S7IA 1RUSA 3UB5A 4KGVB 1B0PA 3ZT4A 1K47A 3QLHB 2HNYA 3R5JB 4W5TA 4DCOB 2RKIA 2IM2A 2YBVA 2HGNA 3QAUA 4KSEB 1O5JA 3QMQA 4K50A 3LGNA 2H51B 2Z4PA 4L75A 4USVA 2KTQA 3TQ1A 4OPAA 4CE9A 3AARA 1WSFA 3RAQA 3PXGa 4CEFA 2Y3YA 1HKBA 3TX8A 4U7UK 3ET6B 1RWUA 1LEOA 3GILA 4B3SK 4G65A 1TZ0A 4X65J 3M1VA 4LH4A 4U67L 4ZA1A 4DG1B 3PR5B 2XO7A 1YBUA 4LF1A 1U24A 2FXUA 4IG3A 2B7BB 2HHHJ 4JI0J 4G3IA 2QWLA 4OZ2A 2NYHA 4UQTA 4QYZK 4KHPJ 4C48A 1EP4B 4U7CA 1DZ5A 1AA1B 5KFZA 4B3OA 1J53A 5H9FK 3QICA 4ZJLA 4TSXA 4MYTA 3TUPA 4RW9B 1FX2A 3QRRA 1WKKA 1S4FA 1KQKA 1D1UA 3NBPB 1S0VA 1X5TA 2VJUA 2LXFA 2C3PA 3OTBA 1GQEA 2YX7A 5BR8J 4WQ5C 3RMCA 5D78A 2A40A 3R6LB 4KHUA 4QWCA 1NU0A 3UVJA 1ZM4A 1TMJA 3UCGA 2KVQE 2Q31A 2QX0A 4B3MF 3G8SA 1RCOB 1FTCA 3OY9A 3KUEA 3MMCA 4LF7J 4M5HA 3O9UA 3IO1A 1NDKA 1UCNA 3J7A1 5KFWA 2QRRA 3FEZA 2D3OR 4DTJA 2FQQB 2O4GA 2BANB 4OX9K 3MXHP 1VJQA 3AVMA 4NYOA 2RHSB 2BE9B 4A62A 3N6LA 4I56A 3I96A 4F0KA 3R1LA 1NGEA 1Y4ZB 3LZJA 1C0UB 1KQGB 1FE4A 3E66A 2VG6B 1IWGA 1K9MT 3ITHB 3SFGA 1HYSA 1VQ6S 4RW8A 4CZJA 3DRPA 4OI3A 4LFBK 1C4AA 4HTUA 4KGZB 5HOOA 3DWLA 2YHAA 4M3RA 4UY8T 3POTA 5K8PA 4WP3A 3KLGA 1F5AA 2MKIA 2RHKA 1HMVB 4B3RF 4DPTA 5IS2A 2EFQA 3BZKA 1PG5B 4EZ9A 4DR3F 2EHGA 3M8PB 2F8EX 2UXBJ 5H1SV 4JI3F 3TZXA 4FYWB 3TARA 1NLVA 5KOWA 1B92A 1D0EA 1G3OA 3QRQA 1HW9A 2IM1A 5GAHP 3P1GA 4NMXA 3I87A 5GADI 4G9ZA 2FVQA 3HHEA 1WF2A 2J6TA 3ZSWA 3RB3A 3BSNA 3BGFA 4DUZF 1NJXA 4NYNA 3MCMA 4CGGA 1N52B 4OVLA 1RBTA 2Z57B 5FPMA 1TKDA 2PN6A 3TTFA 3QDKA 4KHPK 1NGJA 1KAXA 3QEVA 1Q81T 1HA1A 2OPRB 4DFMA 3D7EO 3V1OA 1VQNS 5ETLA 5H9FJ 1HKAA 1ZZNA 4ZCIA 1HHSA 1BCMA 3S01A 4DWIA 4DR6F 1HIYA 4IRDA 5M1NA 2F96A 1YRTA 4DV0K 2PY5A 4DXLA 1LFWA 1OWXA 4FXWA 2CADA 1NJIT 3V4MA 4FJGA 3I0RA 4BVOA 1SL0A 4H03B 4F2RA 4I6MA 3SNNA 2YJEA 1IJJA 1W9HA 2C1EB 4Q0BA 3MMAA 3A4TA 3ZX2A 4P74A 2WONB 1RHQB 5L39A 1IUJA 3AV9A 2AYGA 5ADXA 2ZJQL 1WOQA 1SPBP 1U1QA 1I5OB 1UWAA 4LFCK 1KN6A 3UN3A 4Y00A 2LXUA 5CA5A 3AY9A 2O5DA 1PAUB 3SYZA 3GE1A 1HQUB 1AUSL 3DOKB 3EMTA 1XHZA 4M42A 1R6YA 2DXEA 3G2XA 1GLCG 1CLFA 3LW5C 2RB7A 3LH2S 5CH7B 4Y6IA 2MYFA 3OHAA 1NB2A 3FZHA 4RW8B 2AEJA 4ZVRB 2IJNA 2FGOA 2P9LA 1RT5B 4Q45A 2Q79A 2OANA 4HYKA 3DNCA 1L3SA 2P5VA 2A3ZA 4AL7A 5CZ1A 1MG7A 1DBDA 2HNZB 5B09A 1WHVA 5EOYA 4RWTA 4B1ZA 1NGCA 1HR0J 3SUQA 4ATNA 1WUAA 5AE2A 5L9NA 2Z1IA 3UN2A 3VTHA 3AODA 4NA2A 4YHHK 2MLZA 2MB0B 3L3UA 3Q89A 1TK8A 3ENQA 4FM2A 3BBBA 5AJ3K 4DV4J 3ZSOA 3QSYB 3OJSA 1LAWA 2VIHA 2ZZMA 2NLWA 3VQQA 4EIAA 2XULA 2N82B 4DUYK 4OGEA 4BC7A 2V4QA 3G9CA 1NGDA 4F4XA 1IJFB 3CJ3A 1RTIA 3GR1A 4RNOA 4BRCA 4Q8FA 1LXJA 2R2TA 3OXLA 2P9NA 4I6AA 1A5XA 2KKZA 4WF9L 4J2EA 3BV8A 3LPTA 1FKOB 3ZTOA 4LFAJ 5AQXA 1RTHB 4DHVA 2HSTA 4MQ3A 3CMAN 4DTOA 1H2VZ 1NMDA 4RU9A 2D3UA 2YPZA 2H3EB 4JUZA 4M5MA 3SMSA 1I94J 5A8KB 2X78A 3B8HA 4I0WA 4YP3A 1LWCA 2HLTA 4HKQA 1E3MA 2P1JA 2MKSA 2UZAA 4ZJOA 1VCTA 5KQDA 3SUOA 3LDNA 3HYFA 1HWKA 3FCVA 1RT5A 3LDQA 3UD3P 1R8AA 2N4CA 3BF4A 3SXLA 2CQ4A 1PAEX 1X0PA 1A9NB 3H45C 3MD3A 1RDAA 4JS4A 2ZJPQ 2E5LK 2G8VA 3PW5A 1RAFB 2VONA 1JL1A 3PIPL 2IA6A 2R7XA 4DSEA 3D2EA 1HJRA 2AA4A 3T9NA 5AQNA 3VEZA 5KTQA 2VODA 1QAXA 1JJHA 4DV3K 5BN9A 2X3DA 3QIPB 3OL9A 3P96A 4ZP8A 3GJQB 4R8UB 2R7QA 2Q36A 4CGHA 5B0EA 4ECQA 2CIMA 3PZPA 3PM9A 4W5OA 3MF5A 2CQ2A 3NP5A 4CLLA 4JLHA 2B6AB 3FSXA 4JI7F 3FZ2A 1S1WA 3N6MA 3Q8YA 1VK0A 1UETA 2OA8A 1MWMA 1I6JA 4PWUA 3NFAA 1NSPA 1WOOA 1H6KX 3HSCA 1VQMS 2DRAA 1YBTA 2BJ7A 1D8YA 3BF1A 1J5EF 3AT1B 4JV5K 1WKLA 1IBCB 3PRVA 4B9LA 3M2RA 5AJ3J 3DI6A 2GUPA 1VRUA 4R5PA 1I1GA 5LT5A 3I32A 5C2GA 2W2MP 2UXDJ 4DUYJ 3DRYA 4Q5VA 2YV0X 4AQYJ 4KO0A 1ITPA 3CETA 3CD5A 2YNIA 3PYFA 3TR5A 3UDEA 3KLGB 4JV2A 3VAIA 3MN6A 2UUWA 5GMDA 2UXBF 1TL1B 2GJFA 3D4JA 4JI3J 1EQMA 4BR2A 4IOBA 5IQQA 4WBFA 2VWBA 2KT3A 2OEKA 4JI1J 2VUGA 3G71S 3M2UA 1TELA 1M1HA 5BPNA 3R5GA 2QJ3A 3DRXA 3ENOA 1DARA 1Y5IB 4A8KA 1RISA 2FUG9 2P9PA 2AJQA 3QEWA 4ENOA 2J9EA 2XYHB 3TUIC 4NXNK 1KCFA 4USTA 4CJUA 3SQOP 2ZZNA 2GJ2A 4B3TF 4CFCA 1I94K 4WFBQ 3K5MA 2LQ5A 2EC0A 3OVNA 4RR5A 3OTOK 1YRUA 3ITHA 1RAJA 4HUEA 4FNIA 2HS0A 3PR4A 4M3UA 4X4RA 4LF5F 1VHFA 3WXMB 3QEXA 2ZITA 4NLOA 3QPIA 4P10A 1RHRB 4JKHA 4O5BA 2VWKA 3PV8A 2EXUA 2OPQB 2XEXA 1C1CA 1NZAA 3D6MB 1VQ4N 5EUHA 1R8BA 5DLFA 3CTRA 3GWCA 4LF6F 1OIAA 3O1BA 3H8YA 4TY8A 1JNRB 4P2XA 3BPSP 2GIFA 1U6ZA 2VKZG 1UWBB 1IBKK 4KC5A 3DLGB 3US5A 4ID5A 3TEHB 1WORA 2V2ZA 2MQ8A 2AMCB 2G8KA 2LA4A 3W61A 3TWZA 1YTAA 4I1TA 2EEYA 4CEBA 2DHXA 3V4IB 2FVRA 1QAJA 2UU9K 2QL5B 3GIKA 2W2PP 4DKWA 4LF7K 1FK9B 3Q23A 5HL7L 4NXMJ 3OYHA 2R3VA 5JVGL 4Y2KA 1UJ5A 1Y0HA 4MK7A 3VF0B 4EO8A 2HKEA 2DGOA 3SK3A 1JXEA 2CVIA 5M1FA 2IRYA 3PW4A 2QLJB 5BRHA 4ETXA 5DK5A 4AQYK 1QVFR 3NGUA 3CMAS 1Q5YA 4ZPCA 4WKRA 2H1YA 2MXYA 2XBPA 1NJYA 4MKAA 5L8RC 3D5MA 4IOCQ 3Q8PB 3OJUA 1S97A 5F0UA 1DRZA 1UW4A 1RBVA 1N0VC 2V2QA 2PO4A 2W2NP 1KAZA 4H4MB 2V67A 4Z37A 4OYOA 3D6TB 1N34J 1HPZA 1X4EA 3NE6A 4QS9A 1Z6RA 4NLTA 4CVNE 3NL0A 1KVJA 2DB1A 1VQMN 2XRIA 2QLBB 3GCXP 4NRTA 4FWSA 4W5NA 5KFOA 2OLWA 5DG8A 3T1AA 4CLYA 1XMOJ 3A1YG 2NZ4A 2GAGC 2NSBA 3B78A 3MM9A 2QL7B 3HD1A 2UUAJ 2XS5A 2WFBA 1OPIA 2BTFA 4CJ3A 1RSCA 5J1PA 5KAKA 1H7WA 3MECB 1BWFO 1MWYA 2WB4A 2EBGA 4B08A 2XYPB 5A6PA 1ELOA 1RILA 3W64A 3OLAA 1LOUA 1RKIA 5F0XA 4DMZA 3M8QA 2FHKA 2HFZA 3Q7CA 1BDGA 3VZHA 5AQGA 4DR1F 3POTB 3IWLA 4TY9A 1SL2A 1S49A 3DLEB 3BBCA 3IA0A 2KFYA 1Q9YA 5LMNK 4QPTA 4URGA 1R8PA 2DO4A 2P9GA 5TKWA 3IRXA 2VPYB 3TP2A 5I3QA 1DT9A 4U8VA 3WNFA 3UKRA 3JS9A 5GADP 3CDAA 1N5TA 1BQXA 4KV8A 3OL6A 3FVYA 4E7HA 4KB0A 4LSZB 4USJC 1HQEB 1TVRB 2ASPA 4USIA 1DJ0A 4IR9A 4ZLJA 1RDWX 5KFPA 5C10A 2MY8A 4ISGA 5HROB 3TZWA 5GIOA 3R6MA 1S6PA 4CO3A 4ZPTR 4BC5A 1EKEA 3G6XA 1RB0A 3OW2M 1K0VA 4AHVA 1JJ2M 4Y0WA 2Z58B 2HNDA 4C98A 5IZHA 1OQ6A 1RADB 1OMSA 2MLXA 2XSFA 4GVLA 1ZAVA 1M1KT 1SKRA 4KBOA 2CPXA 4IDKA 3SSQA 2PZSA 4OYPA 3MXIA 5KFXA 1HR0K 3R9PA 4BE1A 5FIIA 4N7TA 5GMEA 3MCAB 1QSYA 1I3OB 1KD1O 4M5LA 4ECYA 2XY6A 1WKJA 4ZVSB 1H7XA 4IRCA 3OXFA 4LC9B 3FR0A 3NEKA 3GG1A 2QO3A 3D1OA 3NNCA 2DFFA 1IKWA 5C42B 3MWPA 3KG0A 4FM1A 2ZM6F 1VQ9N 1HWLA 1UZHA 1NPPA 2HAIA 2LEAA 4HVZA 1EIYB 3EDQB 1S76D 1IKYA 4PYDA 5KG6A 4TU9A 5GAEU 3D0GE 3VQ4A 4LF5J 3AVIA 2F8SA 1DQ8A 2RHQB 1FKOA 4F4KA 3KKRA 4HVJA 4P9SA 3H20A 4KGXB 3CCES 1WNEA 4CI6A 5KFDA 4V19S 4DB3A 4E98A 3HDSA 2R2SA 2ZQBA 5IWAF 2KQ2A 4DV2K 3TOQA 4KR0B 3VEOA 3AB2B 3HHLA 3KJVA 3A12A 1R0AB 3OYAA 2OPQA 2HZCA 5L9XA 4DBQA 4C8YA 3I56S 4KPYA 1S0MA 3VHQA 3FJ2A 5KFSA 2IVYA 2Q6BA 4PG5A 1MSWD 1EETA 4IRKA 2FHOB 2NUBA 2F3JA 1IG8A 2CJYB 1FRXA 5LJ3Y 3HP9A 3Q2TC 2FLOA 2L41A 2CQGA 2BACA 1ZETA 1W0HA 3UN5A 3V9SA 1W97L 2QV6A 4USWA 4XDDA 3H2UB 2QEXN 4CLPA 2MQPA 4UOFA 4OZ5A 1VQLN 2I1RA 5B08A 4PUOA 2KI2A 4B3RK 2IDEA 1VC0A 2R7SA 4FJ7A 1XQSC 1HBUA 4XK8C 3P3DA 4ELUA 4FL9A 1W2BM 4DR3K 2ITGA 1ZXOA 2AHOB 4N77A 5BREA 2DITA 3OR2B 2G13A 4W4MA 2B5JB 2HFSA 3M32B 2HF3A 4DEZA 2UXCF 4BC9A 1JLBA 1G4CA 1GLAG 5D4LA 1FD2A 1VBXA 5DDOC 3W3SA 1QQMA 4U6PA 1B4SA 1DAXA 5F3ZA 2VICA 5D0RA 1RT7A 5B0BA 3G10A 1FWLA 2VFUA 3CCWA 4UQGA 2NRWA 4JI6K 3U1MA 3SMPA 2P6TA 1QLNA 2D3ZA 1PKUA 2OD4A 4IO9Q 3LA0A 4F3OA 3SUNA 2XB2D 2IAJA 1Q7LB 1W7AA 1N34F 1N5YA 2ZE2B 2EK1A 4WE1B 3FEYB 1RKJA 2V5HG 4DV0F 3G8QA 5F8GA 5D4OA 3AQPA 1LKZA 4BGAA 1R27B 1HBMA 4KAZA 2CNOB 1FJCA 1WC4A 2X1BA 2R7WA 3P5JA 2HBYB 2QEXS 3KK2A 1IR0A 3MMBA 4RWXA 3A2FA 4ZKAA 4K4TA 4AL6A 1RHMB 3VQPA 3C8YA 2G8FA 2GV1A 3QMLA 2DEJA 2FB0A 2PSZA 5HRRA 4GMKA 3HRGA 3PNIA 3PEJA 2CPIA 4HH0A 4BS2A 2BX6A 4OYZA 1JJCB 4BC3A 4HI1A 1WEZA 3DLBA 3MM6B 1EETB 1Z26A 2F63A 1SH2A 1R3NA 4URQU 3AJDA 4RW6A 5HP1B 1DTTA 4LF9K 3R2CJ 1IBLF 2UVUA 4BDPA 4FYYB 4GVMA 4ES1A 1HNWK 5M2UA 5DM6Q 3W65A 3CCQN 3M6GA 2C3YA 4MFBA 3VA3A 3ZZYA 4M3WA 2YCHA 2IYIA 4UY8O 1RJJA 3H1QA 3LALA 4CZGA 1TK0A 5A8WA 4JNEA 5AE3A 4X64F 3AA2A 4O0JA 4KTQA 4MDAA 4DL4A 1JL2A 5FPNA 3UPFA 4JD2A 3ZSXA 5BRFA 3IUCA 3GJSB 1YF5L 3HHDA 4DPXA 5FRNA 3W9IA 3THWA 4CO5A 5I42A 2XY7A 3HVWA 3ZXWA 4UY85 1FRLA 2P8IA 3RBZA 4ANEA 4UT4A 2FC8A 4MIAA 3CMQA 3T9ZA 3FZKA 3BO3A 2D0PA 4M3YA 1RWWB 4ZPDA 4IOAQ 4B9QA 1HBUB 4IQMA 3H5YA 3SIPB 5KFIA 5A8RB 3VQ9A 3W2VA 4IG0B 2H54B 3DGPA 2E1AA 5A8KA 2PI5A 2ZGYA 2IDOA 1NAQA 4HI2A 4DFJA 4IFEA 3EE8A 1FVQA 2V2KA 3VTIA 1VRQC 5HBMB 1NK6A 1OH7A 1WOPA 2GVZB 4MYUA 3W9JA 3T1HF 2UV8G 2P9CA 1WHXA 2B4UA 3SQ0A 1ZBTA 3ZT2A 1HQEA 5BYQA 4RO0A 2BR0A 1G1XA 1KEKA 2ZD1A 1FXDA 1SQFA 5DGAA 4O0NA 3B6PA 4IWVA 3DLEA 1MU2A 2Q43A 4P2FA 3GV7B 3CCMN 2KL8A 3H2VE 4MKYA 2GEMA 3KK2B 5A0YA 4DV7J 1UMJA 3A5LC 4JOUA 3MI7X 1LWEB 2RPIA 3D7SB 3RBXA 1TKZB 2HRTA 4FJLA 4AUKA 1CZBA 4LJMA 3KLIA 3D3BJ 3I55S 4CGDA 3CJTA 2FHMA 3SEOA 3D0HE 4Z4CA 4F04B 3EE3A 2H65B 4FZVA 1RAIB 5T7BA 4OZLA 2X7IA 3RB6A 3W7BA 1N8RO 4I4BA 1MROB 4I7FA 3F0NA 2A5XA 5KRTA 3D6FB 5AQHA 4RG8A 1R7IA 5FPDA 4EYIB 1U25A 4JI2J 1IKXB 2MKYA 2XWXA 3SQ2A 1REVB 2YKMB 1XHXA 1FDAA 1BOTO 4E1NA 3NGSA 2HQCA 1U1PA 5HLFB 1CPZA 2FJBB 4PXBA 3I5BA 4DLGA 4IDKB 2ZH3A 3W2VB 2HIYA 4H0VB 3TWHA 2OELA 1S0NA 5KFNA 1AW0A 4BROA 2LDYA 3MECA 3R5DA 1DLOA 3O5TB 2OPPB 2VGNA 1ASUA 2D0BA 2O8DA 4JV5F 4CLUA 2Q6CA 4I69A 1KAYA 3SCIE 2QMXA 3BYPA 3HPOA 4OGCA 4GVBA 1HUXA 1X3MA 4ZJQA 3HK2A 1OJ4A 4NLYA 5FJ4A 1JKHA 4CJFA 4BDYA 4B9SA 1MWZA 3EEQA 3BP8A 4M94A 1RDCA 3ZZPA 4ZVPB 1H0HB 2QM1A 1NDPA 2XMWA 4GKJJ 3GFHA 1YTUA 2O8CB 2HNYB 2K7JA 2NRZA 4YOTA 3E01A 4H0YB 5AZIB 3RJMB 3IKMA 5HANA 3WIUA 1LW0A 1T8EA 3UKRB 2RILA 1T3NA 4NLQA 1S6OA 4U67Q 1SKSA 4GMJB 1X4AA 2HRUA 2JFDA 4GC6A 4NXNF 3L7OA 3IFEA 3H5SA 5LM7E 2AWZA 5A0YB 3BM7A 3HSJA 3J7ZO 4KT0C 1VQKS 4ERDA 3V1RA 2VQEK 5C25A 1YLXA 4BRQA 2VASA 2N4DA 3CCJS 3N79A 3OSNA 2DISA 3DYAA 1G15A 2HF4A 3ONQA 2KM8B 2UUCJ 2DGWA 3QBCA 4YB6A 1VQON 3MPWA 4ILHA 2JJ4D 2X1AA 2GV9A 2ZD1B 4I2PB 1LCUA 5JLHA 2BXJA 3WX4A 3O4NA 3NDKA 4H4OA 3G86A 1PIEA 3D66A 3C6AA 1RAHB 3OYIA 4RNMA 1S9GA 2G2YA 1Q4RA 2HBLA 4PYAA 5E33A 3WT0A 2VKRA 2AP6A 1NJZA 4A8OA 1WG4A 4ILLA 4XH5A 3CCMS 1TUVA 3NCQA 2HRYA 2HVZA 3GV8B 5E5NA 3PG9A 3ICLA 2UVVA 4Y28C 3MOZA 2JVOA 2LQ9A 3ZNJ1 2HVDA 2XLJA 3D2WA 4CTAB 1XMQF 2X1GA 3QERA 4ZHRA 2MZ1A 5H1SQ 1EXQA 4DV1J 4CJPA 4OIXA 3C16A 4O3RA 1BA0A 2W4DA 3VN5A 1U0HB 3P31A 4UF4A 2HQ3A 1BCOA 2UU9F 1G99A 2QA1A 2IRUA 3NGTA 2NQPA 4E89A 5C24B 4ZMMA 2M70A 2FC9A 3IR6B 3DMJA 2BANA 3ZLJA 2VG6A 3S7RA 3SBGA 2JH3A 1U6FA 3TU5A 4CD3A 2E66A 4OLAA 3VVUA 3C6TB 4HHUA 3SI8A 4F3TA 4H0OA 5KFEA 4X64J 3S3NA 4OYXA 3MHYA 3UE2A 1SJFA 2ASLA 3VETA 4P7VA 1XNRF 4FZZA 5A2QU 3KK3B 3JB9k 3F5TA 2BM1A 4J7CA 2NYIA 3K7RA 2HVHA 2XI2A 4URSA 3RMBA 3VQCA 1NK4A 4OLPA 3RRGA 2JLFA 4M3ZA 4EWTA 2ALYB 4X66F 4K0KJ 2OPSB 1Q8LA 4XEIA 3G25A 1VFJA 4N56A 3U1LA 4C2MA 2C2DA 1NK8A 2AJ1A 1BUPA 3DU5A 3O3HA 3L3CA 3BUZB 3FRYA 4XDCA 1RT1A 3THXB 2LDIA 1AFJA 1VOMA 1NHVA 5KFYA 3BGOP 2AIRB 2VWJA 5IT9Y 3C16B 3CDWA 4I6MB 1GT8A 3AVJA 3NAEA 1FTRA 3V9UA 1XNQK 1V9OA 2OTLS 2G1HA 1PC5A 4G6VB 4LUBA 4C6AA 4RNFA 1RYRA 3RUBL 4DR4J 4PZVA 1FRJA 2R8GA 4J37A 4Z4IA 4KGMA 3IN5A 4WJBA 1S1WB 2IA0A 1SUQB 5LMUJ 3M2VB 2DPIA 2Z8QA 3Q8UA 4M95A 2NZTA 3DGPB 4DV7F 3A3PB 4OHVA 1H1VA 2NXNA 2NXCA 1UVLA 2MZSA 4LF4K 1JLGB 1ZAWA 3TA1A 1PO6A 3OVBA 4AE5A 4LRCA 2C3OA 4ILJA 3HVAA 2C3MA 1N33J 1YRXA 4OJGA 4LR9A 5BYRA 3FK4A 1B99A 2W9CA 5ETRA 2MQOA 2RT3A 5LOQA 2ZDPA 2E5LJ 2K2PA 4PPZA 3R97A 4CJLA 5K8MA 3M6WA 1NLKL 1SZ2A 4V1Ak 3WQPA 2VYPA 4CH1A 2QMUB 4JI2F 4DOZA 3EKUA 4B3MK 1KWMA 2F8HA 2P9SB 2VG5A 1MMDA 3RYLA 4W90B 3UKUB 2X51A 2QI2A 4B3SF 1MN9A 2VOPA 3BH6B 1FT8A 1GXUA 1BMQB 1LWXA 5JS1A 3NF9A 1I3AA 1C1AA 3VGMA 3LDLA 2HS4A 3EY1A 3QQCD 3DLHA 2JEIA 2XLKA 5CCMA 4C23A 5K14B 1FXLA 1VQ4S 5JVHL 4JV5J 3DKDA 3CJKB 3CF5L 5AQZA 4K42A 4KKOB 5I3PA 4H54A 3U7JA 2IVPA 3FCWA 1X4HA 3NLCA 1H38A 4AL5A 3FKBA 3NCIA 2GZOA 1VSIA 3MN9A 1QQCA 5H9EJ 4NCBA 2J0XA 3CCSS 5C25B 4M5JA 4QIFA 4M5KA 2OYQA 2KDOA 4GKJF 1L3KA 4KQZA 5IFMA 3SSSA 2QW9A 3AO2A 2ZUAA 4CM2A 3PTWA 3MEDA 3AVCA 1IR1A 5JS2A 4LQ9A 4ELVA 3CCEN 4BVPA 2WSFC 3ZZ0A 3V81B 4TXSA 1SC4B 3PYGA 3EL2A 4DUZK 4ES2A 2RDDA 1SJ4P 3P4UB 3UR3C 4AH9A 3DAWA 4EEYA 5J2QA 2B4PA 2KJWA 4K43A 1KQSR 2EFVA 4KV8B 1B9DA 2VB6A 4OX6A 5DZ6A 1N56A 5KFLA 2QC3A 1TFYA 2OMOA 1JLCA 2D0AA 4M41A 3F2KA 3MUTP 5EX0A 4DV2F 3MR2A 4FJ5A 3BGLA 2HNDB 3LOUA 3O8WA 2DT9A 4FYDA 4ZVTB 3M8QB 2VOOA 1RE1B 4JI4F 3HPGA 5EVZA 1U2VB 3HZEA 3L2WA 2QMWA 7FDRA 3T1YJ 4P73A 3JS6A 4ED1A 2YX6A 2HBMA 3N5FA 1LWEA 1KONA 4Q0BB 2WCXA 3VR1A 4JI3K 4C8MA 1MWKA 4HTJA 1XBWA 2YQ3A 2XG8A 3SAFA 2CPJA 2DGTA 1T9TA 4CZMA 2XO6A 4L3QA 1YHQN 3AD9C 3A8EA 1RLDA 2AGOA 3QLHA 2WVFA 2ZEJA 4NLXA 3TRGA 1FKAF 2A1SA 1BISA 4FWOA 2UU9J 3CIMA 4KFBA 4DV5K 1CVJA 5AQQA 4DR5K 3IR5B 4XH1A 1GOAA 1IQTA 2GGPB 3ETMA 4IEEA 4Q43A 5DQIA 1NBWA 5KQ8A 5G4DA 2XYGB 4IO8A 1T6CA 1S1XB 5EU7A 3EXYA 4CQ1A 1DURA 4B8CA 3AB4B 2MSSA 2E5HA 3SDEB 5C2DA 5AQMA 4FWPA 3CJQA 2D9OA 4DQQA 5CXTA 2AD9A 4K25A 2CPYA 3AQOA 3O08A 2V0NA 5F8LA 3FNNA 1NPRA 3G6VA 4ZN1A 4QU6A 4WQ4A 1AT1B 1FI4A 5HL7Q 4K4YA 4LF2A 3UWTA 2MHEA 4EZ6A 3ULHA 2D0CA 1TL3B 4AD6A 2LEBA 3EGZA 1AZSA 3MM7B 3OYDA 1VBZA 1YVNA 4ED6A 1M5VC 3OFHA 4RJVA 1TGOA 3G6EN 4HHTA 2J9DA 1T9UA 5HRPA 3VAGA 1FVSA 2OSRA 4Q7AA 3WXLA 3ZZUA 1KS2A 4OHWA 2BUNA 2Y8YA 2VD3A 3E1YA 1CJUB 2RAQA 1SJ3P 2DNLA 1GTEA 2JSXA 1UPMB 3I8BA 3AOBA 1H3DA 5DLGA 3I82A 5T7LA 2ASJA 4USKA 1KLNA 2VBWA 1GNKA 3DOLB 2P2CB 2RUGA 2DR8A 3ENAA 4DX5A 2D1KA 2M8HA 2ZH7A 4BC4A 3AJ2A 3CCRS 1IBLK 1BGXT 5HN0A 5F9NA 1VRTB 3HSGA 2XY5A 2QN6B 1VQOS 5D4NA 3TAQA 3PVXA 4MMOA 2GWKA 1V3RA 2V8DA 4M5DB 2DRDA 4DTPA 4ID5B 3W5YA 4B1XB 3BN4A 2C2ZB 1SUQA 1ZTTA 3ZFVA 4BE2A 3V4IA 1PYOB 1U1OA 3UI3A 2A6MA 3ENBA 1LK5A 3M8YA 5IM0A 1F9EB 2E20A 2PA8D 3ZZZA 4ZVFA 5F41A 3OS2A 2W1BA 4YOXA 3MEGA 5DDQC 2DY4A 4DV3F 3TUJC 2CDRB 4C0HA 2HQIA 4B9VA 4OX9J 4CLTA 3VALA 2HWHA 3MM7A 4X65K 4XIUA 1AZSB 4DV1K 1XK8A 4XPEA 1U2CA 3W60A 1WSIA 2CJXB 3R2DJ 4YR0A 2LCWA 4IYQA 3P83D 3J81j 1N5SA 3ILIA 2RD5C 3CC2S 3WNHA 2AJ2A 2BGGA 2VL1A 1LNQA 1NGFA 4OYBA 4A2AA 3T1HK 4E8UA 1DFDA 3W8GA 5D4PA 3K0SA 3EGNA 1CZAN 1UEUA 2E2QA 3TA0A 2NXEA 3B6BA 3GIRA 4PUOB 1VSDA 2J9DE 1WSJA 4WCEL 2XI3A 3SBTA 5JXSA 1MW7A 4OX8A 5J2NA 2G8UA 5BR8K 2UXBK 1VHIA 1IJEB 1FESA 4PL7A 2FBYA 5GAEP 1FDBA 4A4JA 5K8OA 1ZC6A 3ZETB 3V9WA 2D74B 1X4BA 1FJ7A 4FVUA 4DX6A 3EICA 4MKBA 1C1BB 4YOWA 1RHJB 2GHVC 1D3WA 4QIGA 1WACA 4Z2XA 4WWSA 1EKSA 1VQ8S 3CC7N 1HYZA 3NNAA 4C97A 4X4VA 3QGPA 1QZ6A 2GMJA 1NKCA 5LJWA 4NB4A 3FGVA 4I2QA 1S7HA 4M5DA 1WSHA 4JEPA 3MXJA 3VEWA 1JLEA 1ZBLA 2KHCA 3JQMA 2NLXA 1V3ZA 3NF7A 2XMAA 2VBZA 2WVDA 2HG4A 4CEDA 2FTRA 3G71N 1GXLA 4GY2B 3O44A 2LYVA 4M63A 1CSJA 5GAGI 1SS6A 1ZOTA 4WCEQ 3T3FA 4GC7A 3CCQS 2BJDA 4FKXA 3KIOA 4IO1A 4YB1P 3CVKA 5HVHA 2J5AA 4ED4A 4JI5J 2RF2B 1QZ5A 4EFAC 2AJ4A 1IBKF 3RWUA 3BGRB 4LFAF 2O01C 1RTDB 1W2IA 4A8QA 4RX6A 4AXJA 4LFCJ 4HTIA 4A47A 4OI1A 3SJJA 5DZ7A 3V81A 2W42A 3TAMB 3PIOL 5HO4A 2BKNA 1WF0A 2QG9B 5EN1A 4ID8A 3QIDA 1TUGB 3TSUA 2NR0A 1Q86O 1XUPO 2GBZA 3L09A 2ZKTA 4B3TK 1O8BA 3R5CA 4ID1A 2XMTA 4FZXC 3ZZTA 4EBDA 2UVRA 1BA1A 4FF3A 1KQSM 3QIOA 3ZSZA 1JNZB 4BBYA 3OS1A 3OFGA 2VQFF 2VH7A 1HNVA 4F50A 4FJ9A 3EGWB 3R3TA 2CJAA 2CWXA 1WI8A 1ACMB 3WXIA 4BR7A 4ISEA 4IZ9A 3N6NA 3ENWA 4WFYA 3HFZB 5KG1A 4FJNA 4G1QA 2KT2A 1QUPA 2R8IA 4H5RA 2J8SA 3N4WA 4F3QA 4P2MA 1FRHA 3AA4A 4GV9A 5LJ5Y 1IBMF 5M1QA 2E88A 1URRA 2OUGA 3VPZA 4FP9A 3C94A 3OHRA 4H0TB 1S10A 4OI4A 5E26A 2A1BA 3D54A 4PA1A 3CDBA 4NWBA 3AAPA 1C2PA 3E01B 4OI0A 4H4OB 1KLMB 5KFQA 4QPXA 3VESA 2B9WA 1OYEA 3HVRA 2P51A 3V5RA 2G1DA 2WUSA 2RRBA 2GX8A 4YB7A 4CF0A 1T05A 1GLDG 3IRWP 2QLWA 3SJHA 3CGIA 3TVYA 3C7NA 4DU4A 3PCOB 2BQRA 2ZBCA 3AOAA 3QNWB 3SLCA 1JCEA 5KFVA 1ZTWA 1RAOA 2ZC3A 4HLBA 2MHNA 2V94A 2NRTA 1Z1ZA 3ZT1A 2UXDF 2AZ3A 3ID8A 4AQYF 4BG8A 2KYXA 1SL1A 3PY8A 3UDVA 2H3GX 3IP0A 4P72A 1XQIA 4CFAA 1MLAA 3MPYA 1NGIA 5BJRA 5DO2A 6FD1A 3KYLA 2DCLA 2QSFA 2Y1IA 4DTUA 1LK7A 4KH0B 1KQFB 3CWJA 5GAHU 4PHTX 4KI4A 2W7OA 4WQ5A 4GV6A 2ETJA 4ED7A 2ZH5A 5J2PA 4OFZA 4QW9A 4CJRA 2RKIB 4P7TA 2XS2A 3OUYA 3VCDA 2AYEA 4ZVHA 2VFTA 2X6SA 4ZHRB 1NKEA 3IS9B 3RTVA 1Y10A 5DQGA 3VEYA 3W8PA 2GO9A 1T05B 4LVOP 4K5RA 2R7YA 1DTQB 4M3XA 3TNVA 3MWTA 1W25A 2Q2RA 1IV0A 4YS2A 4M5GA 3HL8A 4KTZA 1VSHA 1N5VA 1UVKA 3CJCA 1T7PA 2WW4A 3LDPA 1FRMA 3KHHA 3H40A 2W4CA 1UEKA 3LUYA 4Z7YA 2YTCA 5KG2A 3I5AA 1QD1A 1PYTA 3T41A 5EGYA 3M8WA 1XNQF 3P49B 2IAJB 4OZJA 2F65A 4ILGB 1X9WA 3ILJA 1S9FA 2EKNA 5BN8A 4DR6J 1R59O 2HFUA 4DR7J 3NHGA 3FMBA 1P27B 2P5OA 4JYAF 2ACYA 3WXKA 4ECSA 2IM3A 4CHPA 4LF4F 4E7JA 3UDCA 4NCGB 4OX7A 1NK9A 1Y3JA 4AM6A 4FK0A 2YHYA 3O3GA 2UYTA 3PUFA 2KRRA 3A13A 2E2NA 3GFYA 1NSQA 2A0FB 4DMNA 2MKJA 1S5JA 2F1FA 3U1NA 5DMRA 3ENVA 4FJHA 3H08A 1OY9A 1S72S 3TSQA 3BGUA 5ETKA 2ASMA 3QEIA 5BR9A 2C22A 4RLEA 5DG7A 2J6UA 2B4VA 1X5SA 3V9ZA 1TKTB 3TQEA 3AAQA 1VIXA 2M88A 3BB5A 3W2WB 4JI2K 5E3PA 2O8EA 2XTJP 2E5IA 4LBIA 4GVEA 3WC2A 3OTEA 4OHYA 1T94A 1VSJA 3C6HA 3QAEA 1NJIO 2BQ3A 2VFSA 4CO0A 2QA4G 2MQQA 1UL3A 3U3GA 4B1YB 4DL0C 3GR0A 2LVWA 5B8HA 3DLLL 5THWA 4IUFA 4JK8A 1T03A 5IQ6A 4K2JA 2AEMA 3K9JA 4FLXA 5IC6B 1L3UA 4NLGA 4F2SA 1D09B 1RWMB 1T9XA 1LFPA 2ADCA 2E2OA 1RU2A 3EX7B 3I55N 1JIHA 2RIJA 5I9EB 1HR0F 2PBDA 4ZCLA 2DXFA 3RG6A 4V19X 2WRMA 4YNQA 3Q8QB 3L95X 4NLVA 3P38A 3L7UA 1LW2A 1JLEB 2V63A 5LL6d 2BE2B 3PX0A 3Q24A 3QFUA 2ZH1A 1Q7YO 3B82A 2YWGA 4J5OA 3HSZA 3LO3A 2EC2A 3MMVA 1BD6A 2DGSA 1FD8A 4JHDB 3OFEA 2QWNA 3DFEA 1ATRA 1TAUA 5HJYA 4K4WA 2UUAF 2MTLA 2VGMA 4CK3A 2RU9A 2CJQA 4RW7A 2MSTA 4BREA 1RGIA 3F73A 4AM7A 2V7YA 4CJWA 3U3YA 4MH8A 2W4PA 2CKWA 4L3KA 3PW2A 3HM8A 3CXCM 2WBNA 1IM6A 2IRXA 4EI2A 3AA9A 3O4WA 5IWAK 2AYBA 3MEEB 2AZ1A 1HBOA 1FXXA 1K8KB 3BBFA 2GQQA 2FSJA 3I56N 3H3OB 4ZPAA 3A3OB 1SVDA 2RUSA 3CCJN 1S22A 4O3OA 4A61A 2HSEB 3OYFA 4BRMA 2AP1A 5HQMA 2OKQA 1B3TA 2NRRA 3I4PA 3OLBA 2LXIA 1YTYA 1BC6A 5CYMA 4R25A 2KB2A 1WB9A 4DS5A 4F4YA 3OYKA 1SV5A 3CD6S 2K3IA 1F0XA 2U2FA 2XCAA 3W5XA 1S9EB 1UA1A 3VGVA 1Q18A 5KFAA 1WELA 2QK9A 1U4BA 1VK8A 1TVRA 3NMUA 3ZSRA 1R89A 5ELZA 4LRAA 3DCAA 1FWPA 2OMLA 4LR8A 4HHHA 2OSQA 4NLSA 5KI6A 5GIPA 4FPAA 1XMOK 1WC1A 2EK6A 3OFFA 2HHTA 1NM2A 1RT2A 1IKWB 3VQTA 2DNZA 1JLCB 3WIVA 3ZSVA 4IOCL 2W24A 4A8XA 4UUXA 1Z2ZA 5B0AA 3WZ0A 3DDNA 2P9PB 5ETOA 3D2FA 4UZBA 3MEEA 3EN9A 3CUNA 4DFKA 4ISFA 4KRWA 1JMTA 1OH6A 4J90A 5L46A 3RRKA 1AXQA 3CJ2A 3H2LA 1JLFA 2FHJA 1LW0B 3B4DA 4RUHA 5BYSA 1RTDA 3JAMY 5AJ3F 3O6QA 3UKUA 3JQJA 3DM2B 1NNEA 1YUWA 4DUYF 2HHVA 4RW7B 4MDBA 4CM0A 3CQ8A 4PG7A 5KFCA 2FVPA 1S1TB 4OPJA 4EU0A 1ZM3A 2Y0BB 4Y3CA 3CIPA 3ULDA 2O66A 3WX8A 4CHZA 4FF2A 2BYCA 4IJAA 5J2NB 1BWVA 3CJ0A 3AGKA 1KVIA 4Y1DA 3HD2A 2YPYA 2M9KA 1FRKA 5FLXU 3G82B 4K0KK 3DRRA 4EHUA 1GMWA 5K20B 3WC0A 3PW0A 4RW9A 1QE1B 3J81O 3GV5B 2OZSA 3PDNA 3VF2A 3UCZP 3M1FA 4NI2B 2LSNA 5L38A 2KHOA 3R1HA 5IWAJ 1NH7A 2GMHA 1PBUA 4KH6A 4CJQA 1SH3A 3M4XA 2OAUA 1MMLA 2JHEA 5CYJA 1XWLA 1FKPA 2MDAA 1G6BA 4KYZA 4KH5A 1HNWF 4CGIA 2P9KB 3FGUA 4M63C 1VQKN 2G2OA 3GYNA 3NOCA 1M5HA 5CZ2A 2L3MA 2DNPA 4O3PA 5DQHA 1HX1A 1JLFB 2ILZA 4K4UA 2RF2A 3RB4A 2RU3A 2CPZA 4J9SA 4X64K 1KTVA 4EP5A 4CZFA 4N41A 3O9QA 4YORA 1YK9A 4OO1J 4OMFG 3MTKA 1XC9A 1JJ2R 3TAMA 2OPRA 3QRPA 3PYDA 4GO7X 4QCLA 1E6YA 4ZVQB 4OJRA 4FCYA 1P9YA 3MAAA 2ZH2A 1Y5LB 1E4FT 2JEFA 1F5BA 3VQEA 1WOSA 2KHDA 2DXDA 4FPIA 4LF8K 3QNOA 1U02A 5E3CA 5FDLB 2CNKB 2FJEB 2UXCJ 1HPMA 8ATCB 3BEGB 4RU2A 3KUHA 4K7QA 1NGHA 2KXHA 2RNEA 5EXWA 2JFKA 4WP9A 4L72B 4PKGA 4B1WB 2QWOA 1RAGB 1YXQA 5JMNA 2Y1RI 4H4KC 3G87A 2C2MB 2X1FA 1WAJA 4CO4A 4D3HA 2P9EA 1VQPS 3MUVP 4LBPA 2CQPA 5J2MB 1MNEA 3IG1A 1NEEA 4FVMA 2I9SA 4X4QA 4U9RA 3GZ7A 1FDDA 3EZWA 2Z30B 4YOEA 1HD1A 3Q8SB 1X9MA 5ADXH 1U2RA 1JLBB 1HNIA 3WDOA 1H72C 3VQ8A 5CD4H 2CGLA 2QT7A 2RQMA 3K0JA 1IKXA 4X4NA 4C8KA 3C14A 2CPHA 2DEIA 2J76E 1HQ2A 3K58A 3OBIA 5AQWA 4TU8A 5CR4A 4QBUA 1K8KA 2RE2A 2JLEA 3H7HB 3QT5A 4ICLA 5A6WA 3KHLA 5KFGA 4O4RA 4FJ8A 2P6SA 2HBQB 3PX4A 1E6VA 2PGCA 3HO1A 4KAIA 5HMYA 2R9LA 4FWMA 2I7PA 2RRNA 4QWDA 5HRNA 1YG0A 5F8JA 4OJHA 4CJSA 4PCQA 3FE1A 4BWMA 3NG8A 1XIQA 4Z7CA 4M5IA 3AO4A 1VHXA 1NXIA 1BHNA 4JHDA 4Y34A 4J2DA 5HAOA 4A8SA 2YNGA 4DF4A 3MX2A 3SAHA 2JC0A 1ROFA 3VGTA 2HBJA 3GMGA 2MZQA 2HGLA 2AU0A 4KH1B 2IOCA 3QJPA 1UPPA 4UUWA 1UVMA 3HSTB 1WC3A 2A6OA 2FBXA 4BQZA 1EQ0A 4OQJA 4YHHJ 4H0PA 4R0JA 1CJVA 5EHHA 2B3TB 1HYSB 1IWAA 3CCVS 3EPGA 3G6YA 4PY5A 1VSLA 2BJ9A 4ZVGA 1TFWA 4DCHA 1J5OB 3NH2A 4OYAA 3LPUA 4JI8K 2PE8A 3BN7A 4Q44A 1HNXK 2JGUA 2PFFB 5HVGA 1NK5A 4FLYA 5F3TA 3L2VA 4KE5A 2AJFE 1T3OA 2ZVSA 3OL7A 1VQSA 4DFPA 4Z0UA 3NH0A 2GNKA 2RSQA 4JB8B 3L2RA 1PBAA 4A8WA 3HCXA 4X4UA 1IKYB 1AYEA 2FPHX 2FYXA 2XS7A 3E9LA 2BJ1A 3QIPA 4FWRA 1VC6A 1CZ9A 2P9UB 3D3CJ 3RRHA 2MLYA 1S72N 3IBFB 2MQMA 3NGKA 5J1EB 2I7NA 2ROEA 3QBWA 1KNZA 1OQ3A 1NG9A 2HMIA 1OSDA 3EKSA 1TKTA 2KM8C 4WTYA 2QTDA 3W2WA 3THWB 2JWNA 2PD1A 4CCHA 3AVNA 1P8GA 1KVCA 5F1XA 2N3LA 1QSSA 3A0IX 3NXZA 4X62F 4ZP6A 5HQLA 2ASYA 2HPUA 3D28A 4JI6J 1LAVA 1UVNA 3OTDA 3A3NB 2GCFA 5DETA 3CD0A 1RP5A 2L9DA 1QHTA 5F9LA 1WSGA 2IMOA 5HI7A 1XNRK 1ASVA 5E3AA 4NLUA 3THYB 2PT0A 2GVZA 3X1LB 1S57A 3T5HA 4U7UD 3VERA 3QJJA 3IM9A 3AD8C 3IC1A 3DOMB 1TMMA 1FRIA 2XSJB 1FXRA 3NS6A 1Q8KA 3MCSA 2AX0A 1FDNA 3JSMA 2HHPA 4B9TA 1PGZA 5G0RB 1UZDA 4TYAA 4L8RB 5GMKa 3GPAA 2NPFA 2I8EA 1YKWA 1RDDA 3LTOA 2ZM6J 3GFZA 4KY3A 3SFUA 4YFUA 4LD0A 3HSDA 3A8KA 1J54A 3FFIA 5CE3A 3E51A 1A0OB 3AHPA 2OEJA 1L5UA 1U1LA 4YY3F 4BGBA 3HVTA 1FFWB 2DRBA 5L1JA 2O8CA 1NDLA 3BYRA 3L9ZA 3NVMA 1AROP 1N32K 3AH6A 4JKGA 5DJBA 4I6WA 4CLSA 3MR3A 4M7XA 1ZBUA 3IWXA 5KGWA 3KHGA 4LF9J 4I2QB 5M1OA 2CJ9A 1RABB 4WU3A 4R5PB 3OR1A 4J9LA 4CJVA 4BRKA 5CZXA 4JI8J 2A1RA 3KLFB 3SAGA 1YT3A 1CS4B 2W9AA 1TAQA 1ZH5A 4PRFA 2JEGA 3KKSA 3AO1A 3PRBA 3CPWM 1XERA 3M30A 2BBEA 3OR2A 4RUBA 3M9OB 1YHQS 1YJ9N 2B43A 1RT6B 4O8UA 4CH0S 2FF3B 4O4GB 1FK9A 2E5GA 4IO9L 3AVLA 3ZNUA 1DKGD 2UVWA 2B9EA 1URNA 2ADBA 3F9KA 3VQ6A 4LFBJ 2ZWHA 3TEGA 3DLLQ 1HW8A 3VVTA 1JLAB 2V7ZA 5CYQB 3LWMA 1WC0A 4QR0A 2GFFA 4E2FB 4DSIA 1YQHA 3N5BA 1RYSA 3OBWA 4PXCA 3MM8B 3K2YA 4AHTA 5C2FA 3U4LA 3VOVA 1ZA2B 2HQGA 1JWWA 2MGZA 3Q86A 4W5RA 1CXUA 5ETTA 5FROA 4C3LA 4DF8A 1X31C 3MM5A 3HX9A 4ZN3A 1WD6A 2X3GA 1PCAA 2DNQA 3FUYA 4ICLB 4N8OA 4I9QA 3N01A 4YUDA 1M5PC 2YX1A 4L73A 3HFVA 4LRDA 1H2UX 3AVKA 2O3DA 3VGSA 2NUUG 3LGMA 1O6XA 4ZLPA 2ZBRA 2IVOA 1GX5A 2IIRA 1WSRA 3OHBA 1J5EJ 2Y1LB 3HJFA 5DS7A 1SJ1A 1P90A 4BY9C 2OHDA 3ZTQA 5ITHA 4CLWA 3C0BA 1WDTA 1VQ5S 5T41A 2OIHA 3DLRA 5A2QO 4CF2A 3C15B 5E84A 2D9PA 1S12A 2ZM6K 2F4FA 1RWVB 3WHIA 4GKJK 1NM1A 4W98A 3OTCA 3KJFB 4ED0A 1E4GT 3K17A 4WFNL 4WIIA 4AF1A 3LP2B 5CZVA 4O23A 5HRSA 4IQXA 5JJBA 1EJ7L 1RDBA 4JKEA 4CECA 2XMMA 4JP8A 5F0WA 3WQUA 5IV3A 3NF8A 2KO1A 1S9EA 2M7SA 1ICEB 1MWQA 1HHTP 4FLVA 5B0FA 5D15A 4EBEA 1IO2A 4OLBA 4IFYA 1G7CB 4DU3A 3CCRN 1T44A 3BY5A 5KGXA 2Y1JA 4GKKK 3CNQP 4J9UE 1H98A 1KC8T 1MN7A 1N4LA 1YJ9S 1BUXA 1RBLA 1NMEB 2DR6A 1O0PA 2X74A 3W63A 1I51B 3QFPA 4CTAA 4I6YA 3DM2A 1VI7A 3FSYA 1VAZA 4WF9Q 1Q5VA 1SJQA 2H5EA 1AFIA 2GA7A 1P1LA 1IXKA 4OZ1A 3EO3A 1NJWA 1EX4A 5D3GA 4KHSA 1Q8IA 3MUMP 4O4GA 1P1TA 2ZFHA 2WAQD 3N28A 3ZTRA 2K7KA 4C0BA 3BQ0A 5KOXA 1Q9XA 1WSVA 3NCRA 3IAYA 1SB6A 4DL3A 2ERRA 1JLAA 3RW7A 1YI2N 2C2RA 3CE8A 1K8AT 4ITSA 2G0IA 1M0SA 5CHCB 3J7AP 1WDDA 4CWBA 2UXCK 2H4YB 3PEHA 3LANA 2HK2A 4K8RA 3DOLA 3EVMA 4MTPA 4MFBB 4CEZA 1G2EA 4XTTA 5KG7A 4Y0FA 3HT0A 1RT1B 3THXA 3NOGA 3VMFB 2KH9A 4DR5F 4O44B 5FLXO 3NF6A 4WFAL 5HROA 4QYZJ 2VJVA 4JI6F 3WNGA 1VGYA 3ZO7A 1VQPN 1ASWA 1JXLA 3P8BB 1TR0A 1LW2B 2EKYA 2Q66A 3DDKA 1VJWA 1X60A 4F26A 2EWSA 3K5LA 4WE1A 3JSRA 3R5AA 4WQ4C 4MLHA 3S3OA 3OYJA 4NOHA 4JI4K 3NWRA 4H5NA 5LSRA 1S6PB 2ZH6A 2E7VA 2ZVIA 3OBYA 4WIQA 5KT2A 3TTDA 5A8RA 3O3FA 1C4CA 4BLGA 3M05A 1Z25A 4CZHA 1ZPVA 3KOAA 5KT5A 2FLLA 3EM1A 1U1MA 3PHTA 2CQ1A 2YH0A 2HOEA 3O80A 4NLPA 2PEHA 3M8PA 3CM5A 2XMJA 4MT1A 3JXUA 4G1IA 2YKNA 1F9FA 3VAKA 1O13A 3C95A 2E4LA 3VQBA 5SUHA 4ECRA 5HK4A 2OPPA 5KG3A 2BV3A 1D9DA 1RXOB 4CBXA 2DK2A 4ECZA 4IDHA 2JLGA 2NREA 5GAGP 2XSJA 1WG5A 1XMOF 4A8MP 3KVGA 1BU6O 2WTUA 5HSPA 2N3OA 2F9JA 2RQKA 2WC9A 3P39A 2ATLA 4ZTFA 3CJ7A 2ZNYA 4QWEA 2XM3A 4IJNA 4ILMA 4OLOA 3GE9A 5EDWA 4KB1A 3MCPA 3GQCA 1Z05A 3KMSA 3AFGA 1HRHA 4K5SA 3BR9A 1M90T 3QJLA 1HWUA 1U45A 1F9HA 2VPZB