4O4GA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o4gA05
3UIQA 3HKWA 5KFPA 1BI4B 3V1OA 5KFIA 3EY1A 2HWIA 3BSNA 3KJVB 1O1WA 4O4GB 3NH0A 4RW8A 2ATQA 2QE5A 3M9NB 4B3OA 4K4YA 4CIGA 1JLEB 4CEZA 3NBPA 1BQNB 4EZ6A 3PJWA 4NLRA 3ASMA 3PX0A 4F4YA 3RB4A 2G8IA 3SQ4A 1VSDA 3OHAA 3NE6A 3NHGA 3PY8A 3CJ3A 3SUOA 3NFAA 5C24B 4C8MA 4CJEA 1NOYA 4YR0A 1S5JA 2J6TA 4K4VA 2UVVA 4QWAA 1RT2A 3ZCMA 4KHWA 2BANB 2QKKA 1TV6B 4Y1DA 2ALZA 2JC1A 1C6VA 3PV8A 2RKIA 1CZ9A 4B9TA 1LW2B 5KFLA 4WE1B 4R5PB 5CZ1A 5FDLB 1S1WA 4F4WA 1TAUA 5EWGA 1WNEA 4H4MA 3K5LA 4PY5A 4DG1B 4IRCA 3ZSXA 4FW2A 1W9HA 1VSKA 3KLHB 4CHNA 4OKKA 3OVNA 3EPGA 4QOZB 4G3IA 3KMQA 2ZE2A 4CIFA 3G6YA 3DDKA 4F4ZA 1S1TA 3FQLA 1RT7B 3ALYA 4DLGA 3F73A 3OJUA 3U6FA 2FVCA 4Z4EA 2R2RA 4KHSA 2KFNA 3H5SA 3Q8PB 1C0UA 3QGHA 4O3OA 1TL1B 3SI6A 3IN5A 4ELTA 3IS9B 1TL1A 2GBZA 5L1JA 4F4XA 4AHVA 1WAFA 3RRGA 3SUQA 5FROA 1HYSB 1ASVA 3ZT1A 4FK4A 1RAJA 1D9FA 4I7FA 4KHUA 4DTSA 1VSLA 4DU1A 5HRRA 3KLGA 2HHWA 1HMVA 5C25A 1JIHA 4NCAA 3K58A 4B9LA 4LSNB 4WYLA 2IS3A 4KTQA 3TVKA 3KHRA 4J9LA 1VRTA 1FKPA 2QK9A 4BWMA 2OPRB 1RBTA 3GIIA 4R0EA 4NLYA 1N6QA 3P83D 2F96A 4NYNA 1LV5A 2B43A 3OYKA 5KFCA 3TR8A 1N48A 3OHBA 5HP1A 5HRPA 1Q9XA 2AGQA 4CHQA 3GIMA 4IH5A 4NLOA 1QAIA 4FXDA 2E4LA 3QINA 1JLEA 3FDSA 4B08A 1EETB 5HROA 4TY8A 1T7PA 4Q45A 4LH4A 5F8IA 4QAGA 2PYLA 1NKEA 3DLEB 3SQ0A 2F8TA 3AA5X 4E7KA 4DL4A 4CERA 1YT3A 1B9DA 2X74A 2DTUA 1WNSA 1YVFA 4Z4HA 1BISA 4RW9B 3OL8A 2HWHA 4C8KA 3QERA 4OKJA 4MK8A 5HLFA 1G15A 3EZ5A 2KZMA 3G10A 1WSHA 1CXQA 3OYEA 1JLBA 4MIAA 2GIQA 1J9AA 1DLOB 4HVJA 5HBMB 4KI6A 4EYHB 1IH7A 4MQ3A 3KK2B 1UWBB 1FKOA 3OYCA 1NNDA 2E9RX 3V9SA 4I9QA 4W5RA 4CF9A 1D9DA 2R8JA 4TYAA 2YKMA 3OYIA 2E9ZA 4QWDA 3NMAA 2DPIA 4DL2A 3V4IB 3B6OA 4NLXA 5DG7A 1EP4B 3CQ8A 1RNHA 5I42B 4B8AB 2RPIA 2ZE2B 3AO5A 2IM1A 3DMJA 1XR5A 2W7PA 2BGGA 4O0IA 4KSEB 1XR6A 4QPXA 3PX4A 5C5JA 5KG7A 4DU4A 2WOMA 3NH2A 4FJ9A 3QIPB 2BQUA 5KFDA 2WOMB 2EHGA 4N5SA 4XPEA 4MIBA 1ZYQA 2AU0A 2A1SA 4CF8A 1KLMB 5F9NA 3KKRA 1RTHB 3CJ5A 4OLAA 4HHTA 4RNFA 5KFHA 3PW5A 1HRHA 3DLKA 4FJXA 1J5OA 2R8GA 2QXFA 5KFZA 2Z1IA 4WYWA 4DSLA 1J5OB 4E89A 2IM2A 1Q9YA 4BDYA 4GW6A 1YVUA 5DQGA 5F8MA 5JXSA 1S1XA 3MEEA 4NLTA 1U09A 3V81B 4FLVA 1JLAA 4WXWA 3PVXA 4F8RA 3OS2A 2UUWA 3RAXA 4JRQA 4PWDB 4DSFA 5DQIA 4KB7A 4CJWA 3SUPA 4O3NA 5KG2A 1X1PA 3C6TA 3NF8A 3TANA 2HHXA 2G8WA 3VQQA 4FJLA 4KHNA 4ZVHA 1T3NA 2G8UA 5CYQA 3AO1A 1N6QB 3HPOA 4N47A 4IDKA 3OS1A 4KO0A 1T03B 4URSA 5J2QA 3VQAA 4XPCA 4TLRA 3DOLB 3HO1A 4MK7A 4NLPA 3V6KA 1HARA 2VG5A 2KFZA 5JS2A 1KFDA 4NLDA 1IG9A 3NGDA 3ZT2A 2B4JA 4Y2AA 4NCBA 4CGFA 3AO4A 1BQMB 3RB0A 2YHAA 4CJFA 1JXLA 3O3HA 3OL6A 4CIEA 1LWFB 4ED6A 1SV5A 1IO2A 3L3VA 4CJSA 3T5JA 1TVRA 3SYZA 4E19A 4KPYA 3CDUA 4MK9A 1TVRB 1QUVA 2OPQA 4AHRA 2OPPA 4ED1A 1VSEA 3K5NA 1RA7A 5KFTA 4ID5B 4NRTA 4G1QA 1VRUA 2HB5A 3DYAB 4CJ5A 5HLFB 1IKVB 4RZRA 4DTPA 2HHQA 2ITGA 3V1QA 3KLIB 2QV6A 3CJ4A 3G6XA 3RWUA 4WFZA 4CF2A 3H40A 4CJ3A 1L5UA 1FKOB 3KLIA 1KCFA 4O55A 3LP0B 1KVAA 5DMRA 3WNFA 1DTTA 3I8DA 4OLBA 3V6JA 3D0PA 3H2LA 2JGUA 1NK7A 1N5YA 3BJYA 3PJXA 4FJ5A 2PY5A 3AVGA 5KFQA 3KTQA 2IAJB 5J2NB 3OL9A 1NJXA 4DFPA 4H4OB 4J2EA 4M94A 4FVMA 2XI2A 4CK3A 4DSJA 4F3TA 3BQ0A 4Q0BA 4QWCA 4FJIA 3E51A 3AO2A 4MH8A 1NKBA 3E01B 5C42A 4NLUA 4CHOA 4DFJA 4JUZA 4NLGA 4Z0UA 4YP3A 1ZBLA 3U3GA 2KW4A 3E01A 2HVIA 1S1WB 3V1RA 4YMEA 1REVA 1GOCA 4ZVGA 4AHTA 3WNHA 3M9MB 1TK0A 1RCHA 3H59A 4E7IA 4Y2CA 4JRPA 1CZBA 3Q8QB 3KLHA 1ASWA 4IRDA 3AVKA 2XY7A 2G8HA 1HNIA 2D0CA 3MR3A 1XHZA 5KG0A 3L2VA 1RT2B 4E0DA 3AVIA 2WCXA 4BWJA 1KHWA 3AV9A 3SNNA 2Y1IA 4CGHA 3H4DA 2AX1A 4ECWA 1X9MA 3VQDA 2HHVA 5KRTA 4M3TA 1JLQB 4ECSA 4IDKB 3NAEA 4CEQA 2DPJA 3GQCA 3QZ7A 4EBEA 4CCHA 3V9UA 3VQ8A 3KHGA 4PUOA 4ZP6A 3HT3A 5KFMA 2R2SA 5KT6A 3I0RA 1MU2A 2I1RA 3RMDA 4CF1A 1SH0A 4O5BA 3BREA 3UDLA 3PW7A 5KFJA 3P5JA 2VG7B 2YNFA 3S3OA 1RDRA 4IG3A 3BQ1A 4KFBB 2YNFB 5KFOA 3SQ1A 3NH1A 4YFUA 2WONA 3GIJA 3CIZA 3FSIA 1KLNA 1XC9A 3K2PA 5I3UA 4J9OA 4YQWA 3LP1A 1K1QA 3RR8A 4IR1A 2ZKUA 3HVTB 1RILA 3CVKA 4FM0A 1HPZB 4CFCA 2Y1JA 4IG0A 2W8LA 4FK2A 2I5JB 4RW7A 4DL7A 1VSIA 4M3RA 4Z4GA 4CJTA 4XIUA 2FVPA 3M8QB 3DLBA 5EU7A 2ZD1B 1RDAA 5KT3A 4RW8B 5EUHA 5KI6A 1W25A 3VA0A 4WFXA 3SV3A 4N76A 3HVWA 1VSHA 2X6SA 2ASJA 1SH3A 3PX6A 3TARA 2IA6A 1S10A 2F8EX 1U47A 2JC0A 4K4WA 4ECUA 4QW8A 1S0NA 1BI4A 2B5JA 3CFRA 4H4OA 5JS1A 4ED7A 2IDOA 2B5JB 2BANA 3SPZA 1QSLA 3TQ1A 4TQRA 3AVCA 3MEDA 4FYDA 4AHSA 1RTDA 1QSSA 1N4LA 1U48A 4M42A 1S6PA 3VQCA 4Q44A 5FDLA 3PR5B 4K4TA 1S9EA 5HBMA 1TQLA 3HP6A 4ELUA 1T05A 1S6QA 4RNHA 4KB0A 1EKEA 3VQPA 1RYSA 3OYAA 3VQ5A 4K8ZA 2B6AA 3NF9A 2YKMB 2WB4A 1FXXA 1KVCA 5E41A 4IFVA 4M3YA 4CFAA 1D1UA 3TAQA 1UA0A 2FJWA 3VA3A 1QAJA 4ZPBA 1HNIB 3MFIA 2GV9A 1TV6A 3WNEA 1NK6A 3DRRA 3RMCA 2DFEA 1LW2A 3DM2B 2C2RA 3RBEA 3VN5A 2IOCA 3NGZA 2W42A 2BQ3A 5DGAA 3AVBA 1IKWA 4I2PB 1C0TB 2HHTA 4MKAA 3NF6A 1IKYB 2C2EA 1JLQA 2V9WA 1IKWB 2HNDB 1U4BA 5KFVA 3MFHA 3GYNA 1X9SA 3S3MA 5L1IA 3QEVA 3IRXA 4IR9A 3KHHA 1A5XA 4BDZA 3I0RB 2OPSA 1EP4A 4RU9A 2W9BA 4ED2A 5F8HA 2LSNA 4GMJB 4FJGA 3VQBA 5KFUA 4EZ9A 5J1EB 1J53A 1Z25A 2XC9A 2CKWA 1NK5A 1JLAB 1SUQA 2YNHB 1DTQA 2YKNB 1D0EA 1RDDA 1MMLA 4RUAA 4DFMA 2FJXA 5DG8A 2WONB 2G8KA 3S9HA 4KB1A 4TN2A 4FLYA 4YR2A 3L3UA 1XR7A 4W5NA 1HPZA 2FC0A 3SFUA 4CGDA 4IH6A 3MR6A 2G8FA 1S1VB 3CFOA 4KTWA 5KG4A 3M8RA 1CLQA 2D5RA 3D28A 4NZ0A 5KFNA 1ZBFA 5SZTA 1HQEB 4RNMA 4DL5A 4O4GA 4LH5A 4OPKA 2VG6A 1WLJA 3VQ9A 1BQMA 4I2QA 1BL3A 3QGIA 1SL0A 1S4FA 5F8NA 2XGQA 3P1GA 1SV5B 1BHLA 1RYRA 4J2DA 3BGRA 4O3SA 1NK9A 1NJWA 4X2BA 3DRPA 1C1CB 1KTQA 1NK4A 5J2QB 5C24A 4UQGA 5HP1B 4FLUA 2IC3A 2R7YA 5KFYA 2VG5B 1HYVA 2E9TA 3QGGA 3T3FA 1IKVA 3PO4A 2VWKA 2AQ4A 1GX6A 3SJJA 3BSCA 3N6LA 5KFEA 4WE1A 4RUCA 1TKXA 1VSFA 3ZSWA 4KHYA 3OYDA 4CGJA 4FJ7A 4ICLA 5I42A 1IKXA 2ILZA 5KG6A 4QWEA 4CJKA 3OYBA 4JV1A 4FJJA 5KFFA 5DLGA 4CFBA 4LD0A 3OLAA 1XHXA 2XWYA 3HVRA 4FLTA 2O4IA 4K50A 4ZTFA 3LP3A 3THVA 2C22A 4BDPA 5KG5A 1RDBA 3KJVA 4DTJA 4E7HA 3H5YA 5KFXA 4OGCA 4K4SA 4ECRA 1JKHA 4MKBA 2IMWP 1WAJA 2D0BA 3ZSVA 3PO5A 2W9BB 4W5OA 3CJ2A 3PUFA 4E7JA 4CJLA 3NAHA 2DY4A 3RB3A 2UVWA 5SWMA 3QIPA 3N6NA 4ZVFA 2IJNA 1HQUA 3M8SA 3ZT4A 4ED8A 2P5GA 4IOBA 4KI4A 1XI1A 4B9NA 5DK5A 1RTHA 4DTUA 4FZYA 4ID1A 3AO3A 3T19A 2ASLA 4OL8A 3BQ2A 2Z1HA 4CHYA 1FKPB 2BRLA 5EWFA 1TKTA 3IG1B 5J2PB 2OPRA 4KO0B 2P51A 2IM3A 4FW1A 4NLVA 1KSPA 1I3AA 3AVHA 2HMIB 1REVB 2BE2B 5L1KA 4H4MB 1WSEA 3CJ0A 2YHBA 3SPYA 2HMIA 4FLZA 4EEYA 3DLGA 2YNIB 1HQEA 4F4KA 2RN2A 4EO8A 1RBUA 3V6HA 4B3OB 4FJNA 5KFAA 4EO6A 1RT6B 2BRKA 3PR4A 2Q3SA 1ZBIA 4YNQA 4F2RA 3DI6A 3H98A 3FFIB 2FBYA 5JUMA 1UAXA 3AA4A 4B8CA 5HRNA 2AX0A 2IBKA 4Y34A 3DLEA 4O3PA 3BGRB 1CXUA 4FM2A 4CEFA 3UR0A 2VA2A 3DOLA 2FVSA 3DRPB 3FQKA 3NGIA 3C6UB 3MTKA 2WK4A 2GUIA 3LP1B 5F8GA 3LZJA 3TAMA 2V4RA 3FRZA 1HYZA 2OA8A 3C95A 1BIUA 4KAZA 4RW6B 1NJZA 2ATLA 1JLBB 4DS4A 5CY4A 3LANA 3KIOA 1R0AB 4M95A 3QYYA 1BIZA 5KT7A 4DQQA 1L3UA 3MF5A 1TL3B 4ICLB 2RF2B 3PZPA 1WN7A 4FJMA 5KT4A 3ZT0A 2OPQB 2RF2A 4DF4A 1NKCA 4PQUA 1TGOA 1SH2A 5KG3A 4Z4FA 4K8XA 2DFFA 4G1QB 4FS2A 1RT7A 2JEGA 3QEPA 4EP5A 2I5JA 3HPHA 4NLSA 3TWHA 4NYZA 2EX3A 3Q8SB 5KFBA 5KT5A 4HUFA 3DRSB 3SQ2A 4DSIA 2W9CA 4ZPDA 5EWEA 2W7OA 4RG8A 1BQNA 1RTDB 3MR2A 3U3YA 1EX4A 1YTAA 4NYFA 1C1BB 3GV8B 2D7SA 4F2SA 3NKYA 5F9LA 2AGPA 4DSKA 1S9EB 1C1BA 3MR5A 2D3UA 4N56A 1JLFB 3SV4A 2BQRA 3LWMA 1RT1B 4ZVEA 4CJRA 3V9ZA 4LQ9A 2UUTA 4CGGA 2VA3A 1BGXT 3QNOA 1RT1A 1TAQA 1S1XB 3HVAA 3ZSQA 5C25B 4J2BA 3G86A 1LWEB 4CJQA 4LSLB 4I9LA 4H8KA 2DFHA 4ZHRA 4CEDA 2D3ZA 3MEDB 3HHKA 4FJHA 3BSAA 4DTNA 2VWJA 4CHPA 4J9PA 4DQPA 1C0TA 5T14A 3CFPA 4F3OA 2O5DA 5CYQB 1TP7A 3VQ4A 4KV8B 4FLXA 3D45A 1U49A 4U7CA 4ZP9A 3BDPA 2OZMA 1C2PA 3V4IA 4E1MA 1D5AA 3DLGB 1S1TB 2YNIA 1RT5A 5KT2A 4M41A 3DMJB 5KG1A 1RTIB 2CJQA 3AA2A 4CJ4A 4DS5A 4O3RA 1RT6A 4DLEA 3QLHA 1JLGB 5J1EA 4ZP7A 2VG7A 2HNZB 5KFGA 3FFIA 4KKOA 3JSMB 3QIDA 4W5QA 3F9KA 3LAKA 4NLQA 2PYJA 2JEFA 3LPTA 1Y97A 1SUQB 3DOKB 1A5VA 3KLEA 1KLMA 3V9WA 4J9KA 4GC7A 4Y1CA 3H4BA 4YR3A 4FM1A 3KK3B 3TAMB 3WNGA 2OPPB 2HVHA 1RTJB 2JLEA 2OPSB 4I7FB 2J6UA 3EZUA 3LPUA 3KLGB 4TYBA 2P5OA 3M8PA 4JLHA 1L3VA 4J2AA 4OPJA 3M8PB 1B92A 1DTQB 3OSPA 3T5LA 1TL3A 2FVQA 3QO9A 2R8KA 4IFYB 4EYIB 2VG6B 3C6TB 5KTQA 3QO9B 1OS5A 4ZPAA 1TKZB 3RBDA 3V6DA 4Q8FA 4CK2A 3V6DB 3SFGA 2FLNA 4DSEA 4RW7B 1U45A 3H5UA 5DLFA 4M3WA 3AVLA 2OZSA 2FLLA 5J2MB 1LWCA 3NGYA 2V0NA 4WZMA 3LDSA 5K14B 1J54A 5J2MA 2Z1JA 2IC3B 4BE0A 3I0SB 1XWLA 1Z26A 3TAPA 4C8OA 3OYMA 1EETA 3K5OA 4DL3A 1UOCA 1VSMA 4J9NA 3I0SA 2O4GA 2FBVA 4Q0BB 4ECQA 4GC6A 3NBPB 4M3XA 3DLRA 4URGA 4B9MA 4IRKA 2B6AB 1TKXB 1KVBA 1NOZA 4BE1A 4KHRA 4CEBA 1IM4A 5D3GB 3I5BA 4DG1A 1QTMA 3MEGB 4PWDA 4DTOA 1KHVA 2J6SA 1C1CA 4IH7A 3DRRB 3MEGA 4LSLA 4FS1A 4ID5A 3SUNA 1U04A 2UVUA 4TY9A 3L2RA 4ECYA 3KK2A 4KHMA 4J9MA 2RKIB 3RR7A 2FLPA 4EBDA 3JYTB 2WHOA 3CM5A 1IKYA 3KHLA 1S6QB 1QQCA 4IKFA 4DFKA 4WXOA 4IBNA 4E7LA 2BR0A 1CSJA 1QSYA 4CEAA 2HNYA 2IM0A 1S48A 2XHBA 3ITHA 3IS9A 2RDJA 3KMSA 3RRHA 3VQ6A 2GIRA 2KTQA 3I5CA 3RAQA 1LW0B 3OJSA 4HTUA 4FZXC 3C94A 2X6NA 3LP2A 4CF0A 4C8LA 2HNZA 4KKOB 4AILC 1NHUA 4NRUA 3LZIA 2ASDA 3TI0A 2F8SA 2FBXA 2XY6A 3EPIA 2AWZA 2QKBA 1RT4A 3CWJA 2PZSA 4MFBB 1LAVA 2HNDA 3RTVA 3DLKB 2JEIA 3M9OB 4HCCA 1VSJA 4O44B 1KRPA 4R8UB 2Z1GA 4O3QA 2XCAA 3T1AA 4RW4B 4OJRA 4CJUA 4KRFA 3OYFA 2HAIA 3NCIA 3L2QA 1S1VA 4CK1A 1TK5A 1YTUA 4ECXA 1S1UA 3K59A 1N56A 4NLWA 1HMVB 4JV2A 3ZSOA 3KKSA 1SL2A 2YNGB 1TKZA 2FVRA 2RDIA 2R8IA 4HYKA 3RB6A 3ZSYA 3KD1E 3ZSZA 3K5MA 1T8EA 1HJRA 4DQRA 2KQ2A 3GIKA 3HM9A 1JLCB 4FBUA 3L8BA 3QEXA 5J2PA 4KBIA 1JLCA 4EP4A 2HHSA 2XGPA 4NCGB 2AGOA 4Z4CA 1ZBUA 2BE2A 1S9FA 3VQEA 3BSOA 1KFSA 1I39A 4L8RB 2BDPA 3TAFA 4NCGA 1S0OA 4KREA 3D5MA 4ZPCA 4XO0A 4ED3A 1RT3B 3ICLA 4DQSA 4B9UA 3AA3A 3NL0A 4R5PA 1K1SA 1NK0A 4FLWA 1GOBA 3DI6B 1Z4UA 4ZTJA 3KLVA 1T05B 4OGEA 4KFBA 1GX5A 3PHEA 2D41A 1QHTA 3PW0A 4Q5VA 2XRIA 3TAEA 3GV7B 4RNNA 4OVLA 3IAYA 5DG9A 5EDWA 3QESA 3QETA 2XO7A 3AVFA 2C2DA 4KE5A 2E6MA 4Q43A 3DLHA 2FBTA 3OL7A 4EBCA 2W9AA 5FRMA 3M8QA 1C0UB 5KFWA 5FRNA 3OYNA 1S9GA 4ECVA 1WSIA 3T5KA 2HNYB 4M3UA 4Y3CA 1S9GB 4ED0A 1JKHB 4FZZA 3MXIA 4K4ZA 3SZ2A 4HKQA 5DGBA 1N5YB 3IRXB 4CE9A 3NF7A 3PW4A 4CEEA 1L3SA 5KRSA 4DTMA 1B9FA 3CM6A 2IAJA 3OYJA 4OKEA 1NHVA 1D8YA 1JL1A 2D0AA 3HK2A 3KD5E 2G8VA 3ZSRA 4LSNA 4DMNA 4BE2A 4K4XA 4GVMA 3O3GA 2ILYA 2X78A 3KLFA 4DL6A 4CJVA 3QIOA 2E6LA 1SL1A 3HXMA 1VRTB 1RBSA 3KK1B 3KLFB 4M45A 3LALA 3GV5B 4R8UA 3CYMA 1HNVB 3KK1A 2EC0A 1QS4A 1S6PB 3HVTA 1HNVA 1HYSA 4IKAA 1QE1B 4J9RA 4CEOA 4FK0A 4WFYA 1ZTWA 5L9XA 5L1LA 4DTRA 3UQSA 4KV8A 4ECZA 1S1UB 3HJFA 4J9QA 4CECA 1LAWA 4IQXA 3O3FA 1RBVA 4JS4A 1BCMA 2HW3A 3NDKA 4J9SA 5HROB 1LWEA 4TY8B 3KOAA 3A2FA 1JXEA 2YNGA 3EYZA 5CZ2A 3QLHB 2A1RA 4F50A 3VQ7A 3JSMA 1TKTB 4FBTA 4CHZA 1LWFA 3I5AA 5T7BA 3DOKA 4DTXA 5F8LA 2WRMA 3SI8A 4HUEA 4PUOB 4DWIA 4QCLA 1MU2B 4JV0A 3O4QA 4KTZA 3KK3A 4ZP8A 2P1JA 4W5TA 2C28A 1VRUB 2GC8A 3CG7A 1RT3A 3OYGA 3N6MA 4Q8EA 1RTIA 2OYQA 2XCPA 3H08A 2KZZA 3HL8A 4LY7A 3MAQA 1R0AA 4IG3B 1S49A 4HUGA 1FK9A 1EXQA 3PW2A 3MXJA 3L2WA 4CGIA 1FK9B 1UA1A 3ISND 1L3TA 3GILA 5KGXA 3KLEB 1Q8IA 4IFYA 3OYLA 3MXMA 4RW9A 3B6PA 3TAGA 2FJVA 3MECB 1S97A 1IKXB 4JS5A 4K4UA 2HHUA 3OLBA 3HYFA 4TSXA 3MECA 4DEZA 3DYAA 4U6PA 2WTFA 1DLOA 1RTJA 4C8NA 4RW6A 3DRSA 2IJFA 4H54A 1UWBA 1C0MA 4I2PA 3ULDA 2W9CB 3TABA 2XI3A 1I6JA 3UPFA 5K14A 4URQU 3HSTB 5KFRA 1RBRA 1NK8A 3LP0A 4DF8A 1DTTB 3L2UA 2IGIA 3OY9A 4BACA 1WSGA 4M3ZA 5DQHA 4FJ8A 4PQUB 4I2QB 1S0MA 5C42B 1JLFA 3S3NA 3BR9A 2AJQA 2V4QA 3MEEB 4CJPA 3SCXA 3OS0A 1ZTTA 3OSNA 4CESA 1T94A 1WSFA 1JL2A 2JEJA 2YNHA 3QZ8A 5J2NA 4QW9A 3V9XA 1LWCB 1JX4A 2ZQBA 4ZHRB 1C1AA 1SKWA 3RMAA 3IGNA 5KFKA 2W8KA 4LQ3A 4WZQA 3K57A 4ZMMA 3CO9A 1A5WA 4FCYA 1W0HA 4N41A 2XY8A 4Z4IA 3ZT3A 2YV0X 4O4RA 3CDEA 3AVAA 1QE1A 3IGVA 3G6VA 4QWBA 4TXSA 4IFVB 3V81A 4PA1A 5KGWA 1NJYA 3H5XA 1BCOA 1TK8A 3LAMA 3ITHB 3AVMA 5D3GA 1RT5B 4E3SA 1ZBHA 1K6YA 4DU3A 4AH9A 4E1NA 3ISNC 1SKRA 1LW0A 3DM2A 3NAIA 4AHCA 4CFDA 1SKSA 2ETJA 3O4NA 4ECTA 2UVRA 3JYTA 1ZETA 3QNNA 1RT4B 4KAIA 4TQSA 1T03A 1RA6A 1GOAA 4AHUA 2R2UA 4O44A 3KNAA 4HCBA 4KHQA 5I3UB 1X9WA 5HRSA 4RW4A 4FJKA 3C6UA 1F21A 1TKDA 4IG0B 4B9SA 1JLGA 3Q8RB 1RDCA 3VQSA 2NUBA 4DQIA 3LP2B 2YKNA 3QEIA 3T5HA 1HQUB 1WSJA 3RMBA 1ITGA 2ZD1A 1ASUA 4O0JA 3QEWA 3OYHA 2XY5A 5CYMB 4MFBA 1VK0A 5KFSA 3AVJA 5CYMA 4ELVA 3CDWA 3G0ZA 5F8JA 1JXBA 4RNOA 4B9VA 3HPGA 3HP9A 3LWLA 2R2TA 3IG1A 3AVNA 2R8HA 2OH2A
chains in the Genus database with same CATH superfamily
1WC1A 5AXMA 5AT1B 1BI4B 1NGBA 3EY1A 1D3WA 1XBWA 2QL7B 4IQMA 1HUXA 4OYIA 1WI8A 3W5XA 2N7CA 2ATQA 1KONA 3MUTP 3M9NB 4K4YA 4WKYA 4H5RA 2IFXA 2K3KA 3PHTA 1CJTB 4B3SK 3NBPA 1FVSA 2ZJPL 4CYUA 1QVGM 1EAYC 5MAOA 3IWNC 1I94K 3MCOA 4XH4A 3RB4A 2J8AA 1WOOA 1YF5L 3VALA 3NE6A 3NHGA 1NOYA 2J6TA 3G82A 2UVVA 3EE8A 3Q24A 2CPDA 3CCLS 1FWKA 2I6WA 3W62A 4K2JA 4Z94A 2ALZA 4LF7K 1W7AA 1CZ9A 1GFWB 4B9TA 3HM8A 2NREA 1CS4A 4LFCJ 1R0BG 4R5PB 5B0DA 1OVQA 3FBCA 5DDRC 4F4WA 1EJ7L 4KH1B 5IS2A 4IRCA 1G99A 1W9HA 2IYIA 3KLHB 1JQGA 2KG1A 1VSKA 3PKMA 1FERA 4BC4A 2HBZB 4G3IA 2DPNA 1ZA2B 3KMQA 4H0XB 3D0GE 3OFHA 4CIFA 3HOTA 4DUZJ 4KHPJ 1S22A 3FQLA 2V2QA 4DLGA 1EKRA 3ALYA 3OJUA 3H3NO 3CJ8A 1V4TA 2PIIA 4KHSA 3H5SA 3Q8PB 3WXKA 3OFGA 4USIA 1PG5B 3VGKA 4DCHA 1C0UA 5FIIA 3QGHA 1U25A 3SIPB 4DR2K 3IN5A 3ETOA 3MR7A 3IS9B 4LR7A 3M1VB 2ZUAA 4JHDB 4AHVA 1QY7A 5A2QO 3RRGA 3SUQA 1HYSB 4IWVA 4JI5J 2MZQA 1UEUA 2DH7A 4G9ZA 2C2OB 2O8EA 2P9KA 4I7FA 2EKNA 4A2BA 2NXNA 2QN6B 3P45B 4ZKAA 4DU1A 2HHWA 2IYGA 5C25A 1JIHA 2N3OA 4RL1A 4WYLA 2IS3A 4KTQA 3KHRA 3JAMY 4CLFA 2ZJRQ 4PCQA 2UZAA 2BJ8A 1MWKA 1RBTA 1R43A 1DQ8A 2DIVA 1EHWA 5LL6Z 4BR2A 4NYNA 1PJ6A 3BGOP 3OYKA 2CGKA 1KAZA 2JWLA 5HP1A 1F2HA 3J7ZO 2FGOA 2ZC4A 1TUGB 1OH6A 1TR0A 3CCZA 3MEKA 4MJKA 2P9GA 3QINA 3Q7BA 3FDSA 4B08A 4KGVB 4F04B 3CUNA 5F8IA 2G0CA 2F8TA 2UV8A 2BJ3A 3VEXA 2XS5A 3MXHP 4E7KA 3Q8YA 4HEA9 1FDNA 2V94A 1YT3A 2DTUA 4P2SA 3SCKE 5CYJA 1XIQA 3F9MA 3CCWA 4PKHA 5IM0A 4RW9B 3OL8A 2V8VA 2Z56B 3QERA 3AXKA 2R7SA 5AZIB 4MYUA 5HLFA 1G15A 3DXSX 2ACMA 4MMOA 1QLNA 4HVJA 1DLOB 4HH0A 3C8YA 1UWBB 1NNDA 3O5TB 3V9SA 1WOPA 4C97A 1D9DA 2YKMA 1ELOA 2F8HA 5E3RA 1N88A 3NMAA 1EZZB 2VOPA 1S99A 3K89A 1EP4B 5A8RA 4B8AB 2ZE2B 2RPIA 3DMJA 1WKKA 1MG7A 2DNOA 2R3VA 4O0IA 3M8ZA 5A8WB 4KSEB 3BF1A 4B9QA 5H1SV 4QPXA 2N7YA 2WOMA 1DHMA 2UXDJ 1NO8A 2IVFB 4JK9A 3V2UC 2ZOMA 3SAHA 2WOMB 4N5SA 1KNZA 1HR0F 1YHQS 4OHXA 4XPEA 4MIBA 4CF8A 1VQKN 5F9NA 3G6EN 1OVYA 4OLAA 1OY9A 5KFHA 3DLKA 1GMVA 1EB0A 1J5OA 2R8GA 5KFZA 2QJ3A 2CJ9A 4A8FA 5C2GA 3QATA 4E89A 3NGUA 2MQNA 1RCXB 5ETMA 2J9CA 1UZHA 1NMNA 5BRHA 3FFKB 5C10A 4FLVA 3N0VA 4JRQA 4M7YA 1VJWA 1JJHA 3NVKA 4DSFA 4MLHA 4CJWA 4O3NA 1NH7A 1H1VA 2GQQA 3L4BC 1RHQB 1VQ6S 4FJLA 1E6VA 3J7YI 1T3NA 1N32K 5CYQA 1IG8A 3AO1A 1N6QB 5LJ3Y 4N47A 4IDKA 1KVJA 5CQGA 4ENOA 4QBUA 1RWXB 3VQAA 4XPCA 3PFEA 2XMUA 4TLRA 2ROGA 4KGXB 1VS3A 2BUPA 3BH6B 3V6KA 3M2VA 4LR9A 4OHYA 2KFZA 1IWGA 4NLDA 2LU2A 1WOSA 1YVNA 2VBZA 3TNVA 3OVBA 1PYTA 4CJFA 2VFVA 1JXLA 2QA4S 5D78A 4ED6A 1SV5A 4CJSA 4AL5A 3SYZA 4E19A 2HPUA 4MK9A 1VMBA 2Q3PA 2GAGC 3I82A 5H9EJ 1GLFO 1FRJA 2BM0A 4LFBF 2UXBK 5KFTA 4ID5B 3D6MB 1NSQA 1KP6A 4L72B 3CSKA 5ETRA 4GKKJ 3H1VX 3DJCA 3M32B 2DRDA 4WFZA 3H40A 4FWQA 4DR1J 4L3NA 3L9ZA 5H9FK 3LP0B 1KVAA 4M63C 3I8DA 3CCMN 5IT9O 3EM1A 3GJSB 5AE2A 1ZH5A 1S6UA 1HHSA 1WC5A 1DAXA 4NMLA 1H7WA 1N5YA 2ZEJA 3BJYA 4FJ5A 1IBLK 2PY5A 3R7SB 5J2NB 3I8BA 4ZITA 4L3KA 4RR5A 4X4UA 4FVMA 1FT8A 4PQAA 3KDOA 1FWPA 4Q0BA 3Q8VA 3QJJA 2FJDB 3QRPA 1Q53A 4IO9Q 4MH8A 5C42A 1VIXA 3QFPA 4CHOA 4NLGA 4YP3A 1ZBLA 3U3GA 2HVIA 5A2QY 4YMEA 3CMAS 3TJ8A 1JJCB 1GOCA 4AHTA 4ILRA 1TK0A 1WC3A 4NXMK 4JRPA 4F0HA 3CMAN 1UP1A 1M90T 2NYIA 2DHHA 2FC8A 4CLTA 2G8HA 3UKRA 2AJ2A 1XHZA 3PNIA 4E0DA 3AVIA 4ANEA 3VPZA 4BWJA 1RFQA 1RWMB 1F5BA 1LFPA 4YB6A 4X62K 5AXLA 2DNMA 3J81j 4IDKB 3CGIA 2I7NA 1GLBG 1SQGA 4QS9A 4ZOSA 3ZNUA 4KT0C 5CCLA 2DPJA 3GQCA 1P8ZA 4C0HA 2HZCA 4PUOA 2YH0A 1SBRA 4CF1A 2D1KA 2QSWA 2W1BA 3UDLA 3M2RB 2H3EB 3DAWA 2YTCA 1HKAA 2ZUGA 1AFJA 4TU7A 3MAAB 3AQPA 1IBLJ 3M3ZA 5KFOA 3C14A 3FSIA 5IWAF 1KLNA 1XC9A 5I3UA 1CQNA 1K1QA 1M5KC 3HT0A 2ZKUA 3HVTB 3CVKA 4FM0A 2Y1JA 2ZNYA 1VSIA 1TZ0A 1VI7A 3A12A 1N5SA 2B7BB 4CJTA 4XIUA 4OJGA 2ZD1B 4JI8K 3K0SA 2LEPA 1W2IA 4WIIA 2CQBA 1XNQK 5EUHA 4WFXA 5CH7B 3SV3A 1C4CA 1DBDA 3KJQB 1YXQA 2FY8A 1VSHA 4QYZK 4CLZA 3CJRA 3PX6A 2IA6A 3FLCO 1ZZNA 1A9NB 2EVZA 2ATCB 1C0FA 3FMWA 2E66A 2ADCA 2B5JA 4FN5A 3CFRA 2ZM6F 4CD1A 2MKIA 5JS1A 2IDOA 3PIOQ 2BANA 2MSSA 4C4WA 2DGUA 1TMMA 2PEHA 4AM7A 3MEDA 4ZLJA 1KVIA 1R7IA 1S6PA 4Q44A 2CQPA 5FDLA 1TFYA 1S9EA 1TQLA 1RP5A 5AQMA 4RNHA 2H54B 4KB0A 3VQPA 2Y8WA 2F4VF 1RYSA 3EXYA 4K8ZA 2YKMB 4IFVA 1ZOTA 5AXNA 1H38A 4M5MA 2AYEA 1SZ2A 2BYCA 3VA3A 4A8SA 3B8AX 2CWKA 1Q8BA 3R7BB 4ZPBA 1TV6A 1QVFM 3QB0A 4HDGA 3TJ9A 4UUWA 3BGFA 3RMCA 3PXGa 2A42A 3VN5A 4JI7K 2IOCA 1XMQF 4A8QA 2WVDA 1RCOB 2V9WA 3G71S 1G6BA 3TVZA 1HNWF 3BF3A 3JQJA 1U4BA 3IRXA 4M5IA 1K9MT 1TUYA 2HK3A 3I0RB 2LEBA 3R5AA 3A5LC 3AAWB 5F8HA 3MI7X 2O3DA 4UY85 2X1BA 1Z25A 2UXDK 1FHTA 5AZJA 1WUUA 2XC9A 4WK3A 4EAHD 3AOBA 1SUQA 2V69A 2YKNB 2J8SA 4KB1A 4Y2IA 1CJVA 1M0SA 3L3UA 3FGVA 2VICA 4IJNA 1NBEB 4H0TB 1OQ6A 1SC3B 4U67L 3CCVS 2LQ8A 1NDKA 3MR6A 1S1VB 2HIYA 2OFHX 3SQGA 1CULB 2D5RA 5GIPA 4NZ0A 4LF4K 5DDOC 1VBXA 3TQEA 1U8SA 3NVMA 4LH5A 2KLAA 3GSIA 2HFOA 2VUGA 3VQ9A 1BQMA 4I2QA 5KOWA 1J5EF 4FWNA 1Z2ZA 1SL0A 4LF8K 1SV5B 1YBTA 1BHLA 2X1AA 1J5EK 4X2BA 3B82A 1C1CB 4P6QA 1RI7A 1HD0A 3VGMA 3K8VA 1HYVA 2E9TA 5HVGA 5F0UA 4DV2K 4WQ5C 1HWLA 3BSCA 3H0PA 3HHDA 1RDUA 2FJBB 4CIOA 1VSFA 4FNIA 3FZFA 4CH1A 2ZNZA 2AJ4A 1T44A 1NG9A 3GE9A 4BRGA 1SKUB 4PWUA 4A5AA 3BPSP 3P5TL 3TTFA 4CJKA 3OYBA 4FJJA 1MNEA 4CFBA 2O1PA 3ZX3A 4NPOA 2F40A 3H3OB 5GINA 1NPRA 2QO3A 2H5JB 3HVRA 3D2FB 4K50A 4ZTFA 4X66F 3G8SA 3LP3A 4DTJA 1VAZA 4E7HA 1F60B 3H5YA 4CZGA 5KFXA 4CZHA 3CB4A 2DRAA 4CNZA 4K4SA 4GO5X 3NCPA 4ECRA 4MKBA 4WJBA 2PO4A 2QLBB 2Q31A 5IC6B 1ROFA 2CQ0A 5HMZA 1EIYB 3CMQA 4CJLA 4IO1A 3C6AA 3RB3A 3PSFA 2UVWA 3N6NA 4JK7A 4IZ9A 3H8YA 2IJNA 4LF8J 3J7AP 1Y11A 1HQUA 4JD2B 2C3PA 5AFUH 3G82B 5DK5A 1FW6A 1TMJA 4DTUA 1NGCA 3UKRB 2DD8S 3S8SA 3BQ2A 2Z1HA 3L7OA 2MQPA 5GIOA 4JYAK 4DR5J 1FKPB 3ILIA 2BRLA 3OR2B 1RGIA 1RHMB 2QMUB 5JLHA 3IBCB 4OHZA 1FRXA 2EG1A 2JFDA 3AH6A 4NLVA 3MHYA 1KSPA 2NLXA 5GMEA 1A6LA 1REVB 1ATSA 4H4MB 3IRWP 4ALZA 2IVOA 4LBIA 3SPYA 5M1FA 2HMIA 4CP5A 4IJAA 1X5SA 3W8PA 2VONA 3A13A 4PEOA 3DLGA 4QOTA 1HQEA 2KRBA 1SAZA 4FJNA 4EO6A 1XMOJ 5GVQA 1K8AO 4F2RA 1FVQA 2XS7A 3AA4A 4B8CA 4K5SA 2IBKA 3ID6A 4O3PA 2IBOA 3MM6B 3VGTA 2Y0SD 2VB6A 3UR0A 2OANA 2VA2A 4DN0A 4BG9A 3CCUN 2E5LK 4YS2A 1SJ4P 2V4RA 3T1HF 2E5HA 1IWAA 2DGOA 2XNRA 1LK7A 4K2XA 2R7RA 2DEJA 2OA8A 2VASA 2V6AA 4OZ5A 4I1TA 4RW6B 2ATLA 1WKJA 1RWVB 1BIZA 2HVEA 5LXRA 3MF5A 2QFIA 1E4FT 3PZPA 1WN7A 4J90A 1N34K 2OPQB 2B9WA 1QUPA 4DF4A 1NKCA 1TGOA 4DU8A 4H0YB 4NXNF 4G1QB 3QWPA 4U9RA 4BC3A 3R97A 2MXYA 3QEPA 2XTJP 2I5JA 2DR6A 3TWHA 3Q8SB 2WSCC 4HUFA 3DRSB 1VQ7S 3S6EA 3SQ2A 4DSIA 3SSQA 2G2ZA 4ZPDA 1NHKL 2W7OA 4UT4A 2C2ZB 4RG8A 1BQNA 1PIEA 3U3YA 1C1BB 2DGWA 4C0OC 3NKYA 4FPBA 2P9EA 2M0GB 1R8BA 4LQ9A 2UUTA 4CGGA 2VA3A 3QNOA 2JLGA 1U2VA 2DVIA 3K8WA 1IBCB 3HVAA 3ZSQA 5C25B 2X51A 1BOTO 4LSLB 3GP9A 3WQTA 2DFHA 4ZK7M 4I69A 4P2MA 3MEDB 1W26A 4FJHA 1ULRA 2MMYA 4CHPA 2UXCK 2FJAB 2IA0A 1TP7A 3QBCA 2CNKB 3VQ4A 4FLXA 3D45A 3THWB 4ZP9A 4NYPA 1X4BA 5GAHI 4QPTA 1DQAA 4M41A 3DMJB 4DLEA 1JLGB 3O5BA 1TUWA 3UNYA 1UJ6A 2JEFA 3DXMB 1Y0HA 5BRFA 4GC7A 4Y1CA 1NAQA 3I31A 4FM1A 3CF5L 4FZVA 5DZ6A 3VGSA 4YHHJ 1Q16B 1RTJB 3TWZA 4I7FB 2EFVA 2J6UA 2ALYB 2QLJB 3WEEB 3KLGB 4FYWB 2GTDA 3BY5A 4QR0A 1N33F 4WFNL 3LOUA 4OPJA 2COLA 1WTBA 1DTQB 3JXOA 4GVLA 3W9HA 3AB2B 2E8AA 4EYIB 1B64A 5E3CA 3C6TB 3RBDA 2MB0B 3CCVN 5K8PA 4CK2A 4BRPA 3V6DB 3SFGA 5HI7A 4BC9A 4DSEA 3H5UA 2WVFA 5ETSA 2GJ2A 4C8YA 2JVOA 2HBJA 3AVLA 1UVMA 3LDSA 4BE0A 2XHCA 3I0SB 1XWLA 2PFFB 1Z26A 1WJ9A 1EETA 1I51B 1NPKA 1XERA 3WIUA 5D4OA 4RCHA 5HMWA 3VVUA 1U1OA 3VZHA 4FYVB 3UN5A 4GC6A 3NBPB 3DLRA 4B9MA 4IRKA 2UUBF 3D6RA 1KQGB 3M2UB 2FHKA 3S41A 2A5XA 3OQ2A 3TZXA 5D3GB 1XNRJ 1QTMA 5A6PA 1PC5A 2UU9F 1C1CA 3VEOA 3DRRB 4HR2A 1WWHA 4OO1J 1U04A 2J0XA 1O5JA 4TY9A 4KHMA 4CWBA 4CBXA 2VQFF 3JYTB 2WHOA 2Y1RI 4H4KA 2B0GA 3NGRA 4DFKA 1BA1A 4IBNA 2DNLA 1SQEA 4CEAA 3CI5A 1PC4A 1SIWB 2V8PA 4BCAA 3OR1A 1URNA 3IM9A 4RLEA 6FD1A 4FP9A 1LW0B 4FZXC 4IXCA 2OD4A 1Z6RA 3ONQA 4NRUA 2F8SA 4C3LA 2XY6A 3DXMA 1VBZA 4XH5A 1RT4A 3RTVA 4HCCA 1VSJA 3ILOA 1YZ6A 1CQMA 1Y00A 2PGCA 3T1AA 4RW4B 3JAMO 5K8OA 2LQBA 2DXEA 4JOUA 2HAIA 3LUYA 3QRQA 1XMOF 2BKPA 4CT9A 3K59A 2BXJA 1HMVB 4JV2A 3KKSA 4DV0F 4UY8O 2LQJA 4A8MP 4GV9A 3D54A 4ZVUB 3TOQA 3MD1A 5AQFA 4U7UK 3TSUA 2DR8A 4UUXA 4DV0K 3QEXA 5E7OB 3UCUP 3DOMB 2Q66A 1U1NA 1X5OA 3HRGA 3D7SB 3QNWB 4DJBA 3TAFA 2BJ9A 4LF8F 2F9TA 3D5MA 3DLJA 2WSEC 2B8QA 3N5FA 3DI6B 3NCQA 1JWWA 2KXHA 2GMLA 2Y0BB 1HKCA 1T05B 1YJWS 3PTWA 1T9UA 3PHEA 2D41A 3BKUA 2RH3A 2G2YA 1D8ZA 4ID8A 3HMJG 2XZWA 3GV7B 2I7PA 3IAYA 1H74A 1RXOB 2FZKB 2HFUA 1B0VA 4WCEQ 5IQQA 4Q43A 4H0OA 4OX9K 2FBTA 2W9AA 1TUUA 1NGEA 3M30A 3M8QA 1W2BR 5KFWA 1Y3JA 2R7QA 5M2PA 2MZJA 1QQNA 4ED0A 2HHHJ 2FHJD 4K4ZA 1VJQA 5DGBA 2WVEA 1L3SA 1B9FA 2AHOB 3CM6A 4DHYA 3M6UA 3OYJA 2AYGA 2YPYA 2PEBA 1PYOB 2D0AA 3KD5E 2G8VA 1R89A 4LSNA 3VEZA 2GJIA 2DHSA 4FPRA 4DL6A 1Y10A 2EBGA 3HZGA 4FF2A 3HXMA 3GV5B 2AEFA 3AOAA 2MKKA 2EC0A 1QS4A 2FZCB 1HNVA 4IKAA 3VEYA 4RWXA 1GT8A 3DLLQ 1QE1B 5F0XA 1KVKA 2ZJQL 4GRSA 3HSGA 2VFUA 3UQSA 4KV8A 5LSOA 4ECZA 3HJFA 3HFVA 2CJAA 3W66A 4IQXA 3HCXA 2MKCA 1RABB 3EN9A 4PG5A 3MMJA 4P10A 2K7JA 1H2VZ 4ETXA 5IXUA 3IR6B 3AT1B 1FXLA 2ZM6J 4CJ7A 4FBTA 4BRFA 4CHZA 1ACMB 3NY0A 2U2FA 1E6VB 1HA1A 3I5AA 5T7BA 2IY5B 1CJKB 1YKWA 3DOMA 5RUBA 3SI8A 4G6VB 2ZH1A 1OWXA 2AJFE 5E84A 4WP3A 1FJEB 3IMXA 2NPFA 1VRQC 4A5BA 4WF9Q 5EXWA 4W5TA 4RO0A 4OYXA 3Q86A 1RTIA 4OFZA 2XCPA 4M7XA 2AA4A 4A61A 4LY7A 5ETKA 1S49A 1Q82O 1EXQA 3PW2A 4OLPA 1NGJA 1BLUA 2FHJA 4CGIA 4OLOA 1FK9B 3PKYA 2MDAA 1UA1A 3ISND 3RUBL 3GILA 3MUVP 3B6PA 3MECB 3KDNA 1IKXB 1H98A 5AZIA 3HYFA 4TSXA 2GX8A 4IOCL 3K0JA 3CC7S 2CNOB 4RW6A 1N34F 2HBQB 1UWBA 1CJUB 3ULDA 4LBHA 2W9CB 2XI3A 1JNRB 3AB4B 4H0VB 3HSTB 5A76A 2E1ZA 3LP0A 4DF8A 2B4VA 4PABA 3MX5A 2CQ4A 1RHUB 4PQUB 3QPIA 4I2QB 1ILYA 1JLFA 5ETNA 2V4QA 4CJPA 2HEKA 2E1PA 3VESA 2FIUA 2YNHA 4DR4F 1U6BA 1UEKA 1NJIT 4L73A 3EGZA 2XLJA 1LWCB 1OPIA 1C1AA 1SKWA 1WG1A 2W8KA 4LF5F 4WZQA 3LW5C 3CO9A 2O8BB 3L09A 4N41A 2V8GA 4F3MA 3ZT3A 4F25A 4O4RA 1QE1A 3TEHB 3G6VA 4TXSA 4IFVB 3I56N 3V81A 1NJYA 3LAMA 3ITHB 3GL1A 1RT5B 3WC0A 3PRDA 1ZBHA 1WF1A 4V19X 1VHXA 1SKRA 2VJVA 4OZ0A 3Q22A 1ZM4A 2JRSA 4ZS6A 4Y0WA 3ZTOA 2UVRA 1ZETA 3P4UB 1RA6A 1GOAA 2W01A 3I33A 3ELHA 4JKAA 2LA6A 4O44A 4KHQA 4HCBA 1FDDA 1FD2A 1N8RT 2UXDF 4I0WA 1X9WA 2AP6A 3W64A 5HRSA 3M1VA 4H5VA 1K9MO 4IG0B 1ESVA 2DHXA 1J2VA 1GLAG 1S59A 1GLCG 3LP2B 3TA1A 3T5HA 1WSJA 3W2VA 2ZD1A 1JB0C 4X4OA 3D4JA 2XY5A 3DU6A 2R7UA 2JLFA 1YWXA 1VK0A 3QRRA 5KFSA 1UPPA 5T7LB 3HSDA 1A7GE 1JXBA 2GS8A 2IDLA 3CCQS 1PKUA 4AF1A 3ET6B 2R2TA 3IG1A 1H3DA 2WBMA 3MM5B 2QA2A 3AVNA 2R8HA 1N5TA 3VF6A 3O08A 2OH2A 1B70B 1Y9OA 3HKWA 4JI2J 5CABA 3J7A1 3V4MA 2QXLA 4HLBA 2Z8QA 2V2ZA 3EVWA 4RTFD 1VISA 1O1WA 4CO1A 2BJDA 4FF3A 3NH0A 1IVZA 3RBXA 3O9RA 3E1YA 2AD9A 2CPZA 1JLEB 4CIGA 4CEZA 2NUUG 4EZ6A 1N8RO 2RDDA 4CYUB 3VGVA 4F4YA 2G8IA 2L3MA 1M1GA 1VSDA 4JN4A 1WSVA 4FF1A 1GMUA 4JI7J 1HBNB 5ETQA 2O8CB 3CJ3A 3NFAA 3IDHA 3CD7A 3ZXWA 4QWAA 4P72A 2ZBPA 3CCJS 4Y1DA 1QDUB 2JC1A 2NQPA 2PA8D 1C6VA 3PV8A 4OHWA 5LMUJ 4J9VA 1B3TA 4WE1B 2CZVC 2XM3A 1S7HA 1JCEA 4IUFA 4PHTX 1Y5NB 5FDLB 1TAUA 3UKUA 2AZ1A 3GG0A 1RU1A 3LQVA 1U6FA 3D1QA 5EWGA 1WNEA 5U47A 4H4MA 3K5LA 3GFZA 4FW2A 3NNHA 3UDVA 5BPMA 2CGJA 2ZE2A 3G6YA 1U0SA 1R3NA 1RT7B 4HHHA 2HLTA 2DH9A 3U6FA 4JP8A 1NEEA 3J7AN 2FGCA 4L3QA 2R2RA 1LOUA 2XULA 3C7NA 3OVAA 2OLWA 1PCAA 1VQLN 1UMJA 1TL1B 1NXIA 1RAEB 4ELTA 1TL1A 1MDUB 5L1JA 2GBZA 4A8XA 2QTDA 1V4SA 1WEZA 3MAHA 1RAJA 4C9DA 4NLCA 3MMAA 3JSYA 2F9JA 4DTSA 1VSLA 2V9KA 1FJGF 3LDNA 2HRTA 4JYAF 3K58A 4B9LA 4LSNB 3E9PA 2MZ1A 3RG6A 5ETTA 5L38A 1P1TA 1ZBSA 4J9LA 2YKQA 2XMJA 2X7IA 2Z2ZA 4TU9A 2PMWA 4DR1K 5AQVA 4WCEL 1HLWA 4NLYA 4ZVSB 3P83D 1RHJB 5FJ4A 4LFCF 2V8HA 4LFAJ 3VOVA 3TR8A 1N48A 2DR7A 3FZBA 2N4DA 5HRPA 4CNYA 4CHQA 1QAIA 5KPZA 4FXDA 5HL7L 1JLEA 3BBFA 3FC9A 1Q0NA 5HROA 1T7PA 4LH4A 3ENAA 2P9CA 4CH7A 3BYRA 3HSZA 3DLEB 2QA4N 4DR7K 4X62J 4ZPVR 2MKYA 1NU0A 3IA0A 1CLFA 1Q5YA 2EFPA 5F2RA 3RBZA 1MN7A 1EQ0A 4FWKA 4NZ7A 2V5HG 4JKEA 4CZFA 3OUYA 1WBBA 2D69A 4QS7A 4OKJA 2IPOB 3BPDA 2DISA 3BH7B 3OW2R 3EZ5A 2KZMA 4QS8A 3KWMA 2QSFA 1WSHA 2P9LA 2R7OA 2GIQA 2M2BA 4EYHB 3IP0A 3KK2B 2DRBA 5E5NA 4CF9A 2R8JA 3MTJA 1VQKS 4YUDA 4DL2A 3V4IB 4NLXA 5DG7A 4B1WB 1DKGD 3AO5A 2B56A 1XR5A 2ZJPQ 1DFDA 1XNQF 1HNZK 5C5JA 4PAAA 4DR3K 5KFDA 3WQUA 4KGZB 2P6TA 1HNZF 1ZYQA 1KLMB 2PE8A 3KKRA 1RTHB 3UFCX 2VWBA 4HHTA 2J0SD 4RNFA 4CLWA 2QG9B 3CJSA 2HRYA 4BDYA 2A40A 1Q79A 1PILA 4J8FA 2QWPA 3LA0A 3C15A 4NA3A 5DQGA 4A48A 5F8MA 3MEEA 2MKSA 4NLTA 5GMKa 3V81B 4F7VA 1KEKA 2UUCF 4B1VA 3RAXA 3D2EB 3WX8A 4PWDB 4N77A 3C3LA 5AQZA 3U9ZA 1HIYA 5DQIA 1VQ9S 2UXCF 5KG2A 5JVGQ 3NF8A 2HHXA 4Y00A 1FEEA 4MKVA 1RISA 5CXTA 1MWMA 3CJ9A 3G25A 5AQIA 3OXFA 4JI1K 4KO0A 2BVZA 1K73O 1T03B 2OAUA 5J2QA 4RWWA 3DOLB 2QIFA 4MK7A 3DDIA 4ZVRB 3MN9A 1FKAF 4K43A 3HI9A 2L9DA 2XMVA 2KXNB 2B4JA 4X62F 4NCBA 3MCPA 2VKZG 4JKHA 4DV5J 2HURA 1BQMB 4ILLA 2OCEA 2B8PA 1NU4A 1TYQA 1F2GA 3EZOA 3QBXA 3OL6A 3H20A 3VEVA 3MM7A 4BC2A 3TSQA 2OPQA 4A8KA 2DNGA 3K5NA 2BH1A 3NMUA 1OSCA 2CDRB 1EO1A 3PLAA 2DNYA 2HB5A 3IUCA 3DYAB 4CJ5A 4DTPA 2YVSA 2UUAK 1WELA 1B0PA 2QV6A 3G6XA 3RWUA 4F67A 5L46A 2C1EB 1Q78A 5AQNA 1FKOB 1X3MA 3KLIA 1N54B 4O55A 3O6QA 1O6XA 5DMRA 5A6WA 1DTTA 1E4GT 2VFTA 3D0PA 1BXNA 3IR5B 3CCRN 1CJTA 3TX8A 2C3YA 2EBEA 5AQGA 4MKYA 5HJXA 5EOYA 2VDIA 4CO3A 1BE4A 2YJEA 3KTQA 2YPZA 1SIZA 1UVIA 1I5OB 5DS7A 1KQKA 4J2EA 5HN0A 2KT2A 2ASYA 4FVCA 1VLYA 1YI2N 2XI2A 4DSJA 3ZTRA 3FGUA 4QWCA 4FJIA 3PYFA 5EY4A 3L3CA 3AO2A 1I3OB 4NI2A 4JBCA 3W3DA 4DR4J 4DFJA 4JUZA 4Z0UA 4DV5K 3E01A 4FL9A 4BVPA 2DNKA 4FKYA 4ZVGA 4ZDNA 4CVNE 3AD8C 1RCHA 1NDLA 1CZBA 2RS8A 3Q8QB 1AW0A 2HF4A 3IBWA 3AVKA 5BR8K 3W60A 2V67A 3L6QA 4HTLA 4KQZA 5KG0A 2WCXA 3AV9A 3PM9A 3ZTQA 3SNNA 2UU9K 2Y1IA 4CGHA 5D6GA 3GU0A 4ECSA 2PFDA 1X0PA 1CJKA 3WZ0A 3QZ7A 4EBEA 1KKHA 3VQ8A 4JI0J 5IV3A 4X65K 2VGNA 3RMDA 3DGVA 4C11A 3BREA 3PW7A 3Q8UA 3VTHA 2O8FA 1REGX 3VAGA 1RDRA 7FDRA 3BQ1A 2YNFB 2WFBA 3NH1A 3KG1A 1HWJA 2VIHA 1IR2A 4WBFA 4LF9K 2QEXS 2JJ4D 2VFSA 2OI2A 5M1NA 1HPZB 4CFCA 4IG0A 1AZSA 3NOGA 4RW7A 3CCJN 2R7VA 2JVRA 4XK8C 1AZSB 2EFGA 1H73A 2ZBQA 4GKJK 2FVPA 3WC2A 3DLBA 2ZDPA 5EU7A 4JV5F 3TUJC 4FPIA 1RDAA 2EXUA 5KT3A 5A0YB 3SK3A 1W25A 3AQOA 1SJQA 3VZIA 1MSWD 4OYOA 3GFHA 2GEMA 1VQMS 2ASJA 1S10A 4R0JA 4CT8A 1FE4A 2JC0A 3DNCA 4QW8A 4LFBJ 3C2PA 3CD6S 2H4YB 3R27A 3LM2A 4H4OA 4BRHA 3P5BP 5AR0A 5C15A 2GVDA 3SPZA 1VK8A 4FYDA 5F1XA 3CE8A 1N4LA 1U48A 4B1UB 1SXLA 3CMES 2KH9A 3TP2A 3HP6A 1T05A 5C12A 5KPTA 2NRXA 1HD1A 3QT5A 3SMZA 3CQYA 3VQ5A 2YX4A 5E41A 2P9PA 5GAGI 3TAQA 1UA0A 2O8DA 2VF3A 2FJWA 1VR6A 3CERA 1U1PA 1QAJA 2YKOA 1HNIB 1NK6A 2XZDB 2DFEA 3DM2B 5K8MA 2CRLA 3RBEA 1RWKB 1LFWA 2P9SA 2W42A 5DGAA 2BTFA 2Z0GA 1C0TB 2J9DA 3NF6A 3MCNA 4OPAA 1IKWB 2YKAA 4GKJJ 2HNDB 2ROEA 5L1IA 2UUCJ 4ZJQA 3ZZUA 4QU6A 1SVDA 4BDZA 2OPSA 1EP4A 2O8EB 4RU9A 4C11B 1SJFA 1HR0J 1FCAA 4FJGA 2L41A 4EZ9A 4QIVA 3W8GA 2NXJA 1Q7YO 2MQMA 4DUTA 4AYBD 3A8IA 3HSJA 5MLCV 2RB7A 3OTBA 5K5MA 2FJXA 5DG8A 4DUZK 2WONB 1UEVA 3S9HA 5JVGL 4EFHA 4ZCLA 2HQGA 2ROPA 4YB1P 2BX6A 4FLYA 2MZRA 1XR7A 5HATA 1FFSB 3F2KA 1IXKA 4WFBL 5C2CA 5C0YA 4CGDA 2LQ9A 4IH6A 3CFOA 4KTWA 5KG4A 3M8RA 3EWGA 2OTJS 3FVYA 5KFNA 5AE1A 4U96A 3W5YA 2YHWA 4O4GA 1IBMJ 4OPKA 2VG6A 3FEYB 3ZZYA 2P9UB 4JKGB 4YY3F 1KQSR 3HBTA 4FSVA 3QGIA 2DB1A 5F8NA 5DDQC 2XGQA 4LRDA 3GSDA 1H7XA 2R42A 3O2IA 3FSXA 3LM9A 1HL6A 1RYRA 4LMZA 2DHAA 4QIWD 5JLFA 1NJWA 2FXUA 4J91A 1KTQA 2GZOA 3MWBA 5J2QB 3R5CA 2KHOA 4FLUA 3GG4A 4KYZA 2R7YA 2RS2A 1HNWJ 3QGGA 1IKVA 3SBMA 3SJJA 2MJNA 3N6LA 5EX3A 4WE1A 5AXKA 2RIJA 4KHYA 2UUAF 2M5YA 3QAEA 2R4FA 2FZGB 1KWMA 1UCNA 1MWYA 2D1CA 2QMWA 2RJZA 2RQKA 4QWEA 3CJKB 4JV1A 5GADU 5DLGA 2V2VA 3OLAA 3VETA 2R9LA 2J7UA 1XHXA 2FTRA 5AQHA 3SBGA 4FLTA 3BM7A 3GBTA 5KG5A 1YRUA 4UY8T 1RDBA 3GFYA 2BJ7A 4GMKA 2BM1A 2KJWA 3D3BJ 2OELA 2F4VJ 2DNHA 1JKHA 4X4QA 3ZZPA 4ES1A 1WTFA 2EPIA 1WAJA 1VFJA 4CTAA 4W5OA 1ZAVA 3PUFA 4E7JA 3KYLA 2HVDA 3ISZA 2G9OA 1R8AA 3G4SS 3TO8A 5SWMA 3QIPA 2V4JA 3WXMB 2YXLA 4RU2A 2MLYA 1UVKA 2DGXA 4ED8A 1G3OA 2P5GA 2QMXA 4TVAB 4JAXA 4KI4A 1X5PA 1XI1A 4A47A 4FZYA 2HOEA 2O8BA 3ENQA 2AEJA 2NR0A 1AUSL 4CHYA 4DR4K 3I9ZA 5AQPA 4B3MJ 1TKTA 3IG1B 2OPRA 1YBUA 3AVHA 5L1KA 2ZZNA 3FSYA 2HS0A 4EEYA 3J7ZT 4B1XB 2RN2A 4M5LA 1RBUA 3PR4A 1R0CB 3DI6A 1XQIA 3FFIB 2FBYA 4X65F 3GYXB 5AQTA 2HBYB 4Z7YA 4Y34A 1CXUA 5DETA 1FRLA 3QQCD 3DRPB 1DRZA 2HHPA 2D3O1 2B9EA 4WQ4A 3MUMP 4KGKA 2GUIA 5F8GA 3TAMA 4FWOA 1HYZA 4ZVTB 4J7CA 1SJ3P 3G9CA 3D0HE 1BIUA 3CHWA 1M1KO 5BYSA 4B3TK 3JSBA 5H9FJ 4RBUA 3FZHA 5CY4A 4M95A 2W7AA 3QYYA 3QT6A 3EDQB 5KT7A 2MPUA 5BPLA 4FJMA 4I67A 1URRA 2MQQA 5HL7Q 4USMA 2GVZB 5KG3A 4DV1F 4LVOP 4FS2A 1RT7A 4Y6IA 4E2FB 5HVFA 4L75A 4EP5A 3NP5A 3HPHA 3D2FA 4NLSA 4NYZA 2EX3A 4OX8A 5KFBA 2A1BA 2P8IA 2ZFHA 3VF2A 4USVA 5EWEA 1S72S 1RTDB 1EX4A 3PRBA 3GV8B 2D7SA 4NA2A 5F9LA 2AGPA 2RE2A 4DSKA 1S9EB 3EGNA 1C1BA 3JTPA 3KUGA 3SV4A 3WXIA 4WTYA 4ZVEA 4CJRA 1VQLS 1BGXT 1RT1A 1TAQA 1S1XB 3HZ6A 1M1KT 2QLFB 4J2BA 3N4QA 4CJQA 4FWPA 4I9LA 4WWSA 3OT9A 1G4CA 3HHKA 4LFAF 4DTNA 4WQ4C 2Q1NA 3A8EA 4DQPA 2XHWA 3CFPA 5T14A 1NZ8A 1FRKA 4F3OA 5CYQB 2JWKA 4Y2KA 3SDEB 4KV8B 3HLUA 1U49A 4DUYK 2WZ1A 1OH5A 2NXEA 4U7CA 3BDPA 1C2PA 2O01C 2VQFK 1D5AA 1S1TB 2G13A 1RT5A 3DC2A 5KT2A 2CJQA 2UUBJ 4O3RA 2V8DA 5KFGA 4BBYA 1T02A 4WU2A 3F9KA 5FPDA 2PYJA 3DOKB 4PWWA 1UVJA 3KLEA 2OEMA 4ZPTR 3RW6A 2HBMA 2EI5A 2I38A 4LSZB 4ANDA 1XJWB 4WP9A 4F36A 2ZHBA 3AAQA 5EGYA 2HVHA 2A18A 4C23A 2DTJA 3VTIA 3ET6A 2D0PA 2OPSB 4AQYF 3EZUA 2WB1D 1NUEA 3HZEA 4B1YB 2C3MA 2P5OA 3M8PA 1TU0B 4JLHA 5A0YA 4CRJA 1YSJA 4J2AA 1WEYA 1HFEL 3JQMA 3CD0A 3KJFB 3OSPA 2FVQA 4DPWA 5E2QA 2NSCA 3AGKA 2KYZA 4GKJF 3DLLL 4Q8FA 3GMGA 3A3PB 5LMUK 4ZN3A 2FLNA 3U1LA 1U45A 5DLFA 4YY3K 2DY1A 2CZ4A 3OBYA 3X1LB 4NX9A 3KWIA 2NRTA 4UOFA 4WIQA 2RU3A 3U8XA 3TAPA 4DL3A 5LSRA 1VSMA 4J9NA 3ZEUB 3WX4A 4ECQA 1R31A 3RW7A 4HL9A 4LF5J 5ADXA 2YX7A 1FNOA 1KVBA 1NOZA 2VC1A 4V1Ak 4KHRA 1UJ5A 3G71N 3I4PA 1HBNA 1Y5LB 3MEGB 1SQFA 5G0RB 2N4CA 4CO4A 2H5IB 2ZWPA 4FS1A 2XMAA 4ID5A 3SUNA 1ZPVA 2UVUA 5EX5A 3KK2A 1NBWA 1WC4A 2ZBCA 2RKIB 4YB5A 1NGIA 4BGAA 3CM5A 1V5IB 4UOHA 2XO6A 1IKYA 2AW0A 4OI1A 4IKFA 4WXOA 1CC8A 4E7LA 2BR0A 2VV5A 1S48A 2RE1A 3IS9A 4M5JA 3RRHA 1RE1B 2GIRA 4HTUA 1OIAA 4JV5J 3J80O 2EFNA 2Z4PA 2X6NA 2HWTA 4CF0A 1VDHA 4C8LA 2H5EA 2FB0A 3ZZ0A 1NHUA 3LGMA 1OY8A 5GAEU 3TI0A 3IBFB 2JDJA 2FBXA 2AWZA 2XYHB 2QKBA 2APOA 1X4CA 2HNDA 3JXUA 2JEIA 5B0GA 1DZ5A 1JJ2R 3ULHA 4O3QA 1RGVA 1HI1A 2XS2A 3UCGA 4NI2B 4OJRA 3E9LA 4CZEA 5BPNA 3G4SN 1QAXA 4N8OA 2Y9HA 1CULA 3D1HA 4ISEA 4F3QA 5DM7Q 1S1UA 1RKIA 3K17A 4JI1J 2P6SA 1U02A 1TUVA 3A8JA 3ZSOA 2J76E 3IKMA 5LY3A 2NRRA 1SL2A 2YNGB 1TKZA 4JI4J 2RDIA 4EGLA 2R8IA 1TL4A 2VPYB 4BRCA 3ZX0A 2QGFB 3HM9A 4FBUA 5IT0A 5GAEP 4KBIA 1JLCA 1H0HB 1I1GA 4EP4A 3M2VB 2XGPA 4UF4A 2ITMA 3VQEA 4QYZJ 3DGPB 2K7KA 4IO8A 4ZPCA 5IZHA 4XO0A 1CG2A 1RT3B 3AA3A 3BKTA 4W92B 4FLWA 1GOBA 4QIGA 2ZWHA 4ZCKA 1HNZJ 4MLEA 2O8FB 1RWPB 1WOQA 3KLVA 1ZM9A 4KFBA 4OGEA 3SBTA 1GX5A 4BRQA 3UR3C 3LDOA 3BZCA 3J80U 2ZH7A 3CJKA 3M05A 4OVLA 5EDWA 3QESA 2IVYA 4KHPK 4F9OA 2C2DA 3DLHA 1KOOA 1X4DA 4F02A 3FUYA 2CNLB 2E2QA 1HWUA 3WQPA 1P8GA 1WEXA 1NM2A 2KI2A 1S9GA 4ECVA 5GAEI 4ITSA 2BEFA 2HNYB 3SJHA 4JKDA 4M3UA 1JKHB 3MXIA 3SZ2A 4HKQA 3J81U 3PW4A 4CEEA 3Q7CA 1S79A 2ZH6A 4O23A 3NWRA 2CA9A 2AYBA 3HK2A 4RBVA 4Z2XA 1KD1T 4GVMA 2J4RA 1QJHA 4CZCA 1ZC6A 3BP8A 1SL1A 1VRTB 1RBSA 1RLDA 2NRZA 1VQ7N 1XN9A 4CO2A 3L4IA 3U4LA 4DPOA 1HYSA 1N5QA 2KRRA 5CD4A 1A0OB 4WU3A 1VQ5S 3FR0A 3QWUA 1F9HA 3JB9k 2Q79A 1ZTWA 5L1LA 5EN1A 5DJBA 4LFAK 2NRVA 1S1UB 4J9QA 4CECA 1FF2A 3O3FA 4JS4A 1M5PC 3K5PA 4J9SA 4ER8A 3D66A 4W90B 4BC7A 4TY8B 2Z57B 3A2FA 3TA2A 2YNGA 1ITPA 3CCEN 1WI6A 3QLHB 3CEDA 4E8UA 3VQ7A 1TKTB 2VOOA 2FHMA 4WKRA 3DOKA 4EI2A 3MDFA 2GW8A 3H6EA 4HUEA 4DWIA 1MU2B 1LK5A 3O4QA 2JOQA 3KK3A 4PXDA 2KM8C 4ZP8A 2P1JA 1PAUB 2XQCA 1RKJA 4AFFA 2IVNA 2UYTA 4ED4A 3H08A 4FPAA 5B08A 3OXLA 3PG9A 3MXJA 1GXTA 2Q1LA 2F5GA 4EMDA 4TLQA 2ZZMA 1L3TA 3KLEB 1Q8IA 3OYLA 3MM8B 4OYMA 3O9UA 3VHQA 5FLXU 2KFYA 2DR9A 1S97A 5E3QA 2DNQA 1N33J 3MECA 2KB2A 2YX6A 2E5LF 2YKPA 4AE5A 3CTRA 1DLOA 1RTJA 2E1RA 2GELA 4C8NA 3T69A 4BRNA 4H54A 2OUGA 3GR1A 4O5FA 4I2PA 1I6JA 3K9JA 4ED5A 3KG0A 2RHQB 5C2DA 1K47A 3ULEB 1RBRA 3P31A 4DV3J 4E98A 3THXB 2EWSA 1LEOA 3RYLA 3L2UA 3HJVA 1BA0A 3OY9A 4BACA 4ZVQB 5BR8J 4OJ3A 4MDAA 5C42B 3S3NA 1YIJS 4ES2A 2BV3A 3MEEB 3OS0A 1ZTTA 4HDHA 3W0LA 1T94A 2R7TA 3ZX2A 3PIOL 1JL2A 3G87A 1BG3A 5J2NA 4QW9A 3QGPA 3V9XA 3B54A 1LXJA 3BZKA 4LQ3A 1NDPA 1UAWA 3K57A 2PFUA 1A5WA 5TKWA 1YJNS 2JHEA 1W0HA 2FF3B 3CDEA 4OV6A 3R9PA 2V52B 2QWMA 3ZLJA 5KGWA 1BCOA 1TK8A 5CZVA 4EFAC 3CT9A 5D3GA 2Z2MA 4CLSA 3W61A 1X0FA 4AH9A 3ISNC 3DM2A 1W7WA 3NAIA 2Q0UA 2W2OP 4AL7A 2BA9A 4AHCA 4DR6K 1IQTA 5LL6d 4UOGA 4BS2A 1TL5A 2HKEA 3JYTA 3HHNB 4PKDB 1RT4B 4TQSA 4KAIA 1VQPN 2R2UA 3KNAA 2AYMA 5I3QA 5I3UB 4C8ZA 1FJCA 1DT9A 4P9SA 1T9WA 4X66K 1CC7A 3O9QA 4B9SA 3Q89A 1SQKA 2E1CA 3Q8RB 3VQSA 1X4GA 4PYAA 2AP1A 4EUVA 1OYEA 1ITGA 1Q82T 4G1IA 2CADA 3CJ7A 4O0JA 3QEWA 3TEGA 3OYHA 4L74A 4F0KA 2V7ZA 1DGKN 1CJVB 2HSEB 1C0GA 3M4XA 5CYMA 4P71A 1W2BM 4OJHA 3G0ZA 1VQ6N 5D4NA 4XH1A 3LWLA 7FD1A 2NXCA 3B78A 3UIQA 1K73T 1F9FA 5HOOA 5KFPA 2G1DA 5KFIA 2PMZD 3KK7A 3BSNA 3A3OB 3W9IA 4USWA 3KJVB 4X4RA 1HBUB 2KT5A 4GKKF 1PBAA 1H72C 1K0VA 4JI5K 3CF5Q 2GFFA 3ATVA 1BQNB 3PJWA 2EKYA 2OKQA 5E26A 2HIQA 3PX0A 3SQ4A 3AD7C 2CQ2A 4I6AA 2W2QP 1FRIA 4DMZA 3PY8A 3SUOA 3OW2M 1XNRK 5C24B 4C8MA 4CJEA 5BREA 4NXMJ 1ZA1B 3HD2A 4ILGB 4K4VA 2E7WA 1F3FA 3R6MA 1RT2A 1S4EA 4KHWA 1HI8A 1TV6B 2DNNA 2WAQD 1SI9A 3MMBB 4KBOA 1LW2B 5KFLA 2XMKA 5CZ1A 5HMXA 1S1WA 4YOYA 1Y5IB 3T1HK 2EEYA 4AL6A 3C66A 4PY5A 4MYTA 4DG1B 4ZCIA 3ZSXA 3M7VA 1ZM3A 2RUSA 4CHNA 3CC4N 4PYDA 4OKKA 3MDQA 3QMLA 3EPGA 2MGZA 2XEXA 2JNJA 4GV3A 3DDKA 2FUG9 1KD1O 5M1OA 2F4VK 1YJUA 4DPUA 3F73A 4FYYB 1R8CA 3RSEA 4Z4EA 2P9SB 3MPDA 4BY9C 1Z1ZA 4O3OA 4UZBA 4W98A 3M1FA 2WVBA 3FE1A 4F4XA 2BOPA 3OA9A 5FROA 2HRUA 1ASVA 2DO4A 2CQGA 4FK4A 4LF2A 2B4PA 2MZTA 1DEJA 1ATNA 2E20A 2ZITA 3C46A 4KHUA 3P96A 1BUPA 3KLGA 1HMVA 4NCAA 4USTA 1GMWD 2W2PP 3QAUA 5FPMA 3TVKA 4CO0A 4G65A 4JB8B 4LREA 2QK9A 2EFOA 3ILJA 3O80A 3GIIA 2GWJA 3W9JA 1N6QA 2F96A 4ZVPB 4DU7A 4D3HA 4A8WA 1LV5A 2CIMA 4USJC 2QX0A 5KFCA 4PPZA 3W1YC 1FNMA 3OHBA 2OEKA 4UOCA 4IH5A 4NLOA 5IC4B 2E4LA 1EETB 1UFKA 4TY8A 4JEPA 2XYGB 1T95A 4Q45A 4QAGA 2PYLA 1FEHA 1NKEA 1PSDA 3R2DJ 1FE0A 1RBAA 4M5NA 3RVCA 2ZJQQ 4M5GA 1NGGA 1U2VB 1B9DA 2X74A 1BISA 3KHYA 4C8KA 5GAGP 3FCWA 3EJMA 3FRYA 1BWFO 2RVJA 5IM0B 4MK8A 1V3RA 3ZFVA 1CXQA 3OYEA 5AQLA 4NASA 1J9AA 2R7WA 2J9EA 3SSSA 4MQ3A 4O0NA 5CHIA 3OYCA 2E9RX 2ADBA 4W5RA 4DV1K 2PBDA 3OYIA 2CDQA 1L3KA 5A8RB 2DPIA 4IEEA 2MY8A 4NEZA 1RNHA 2IM1A 1V3ZA 1YJ9N 2ZVIA 5AQJA 5AQSA 1WKLA 4CZIA 3C16A 5AZJB 3PX4A 5KG7A 4DU4A 1HX1A 3NH2A 3MWTA 1VCTA 2EHGA 2OJ3A 4G1PA 3L0QA 2A1SA 1S0VA 3CJ5A 3R5DA 4DOZA 3US5A 3PW5A 2PSZA 1YIJN 4FJXA 2QXFA 1PYSB 4WYWA 4DSLA 2ZH3A 2NSBA 2IM2A 1JCGA 4OYWA 2XSJB 4GW6A 4LC9B 2H65B 1AA1B 2OTLN 5JXSA 3SQGB 1U09A 2QW9A 1JLAA 4WXWA 2DT9A 1AROP 4OZLA 4BRMA 2GMHA 4LF4J 2L9NA 1UTAA 2BOAA 1X1PA 3F44A 4F4AA 3DU5A 2XLIA 2G8WA 3VQQA 3TZWA 2MQ8A 2G8UA 2EK6A 2KHDA 2LEAA 5BR8F 3L95X 1OPZA 1P27B 3HX9A 4UZCA 5HQLA 1BUXA 1FFGB 3HO1A 1SJRA 1U7LA 3WXJA 1BO5O 2VG5A 4DX7A 5JS2A 4OI4A 1IG9A 4Y2AA 4CGFA 8RUCA 3D6HB 4ZLPA 3RB0A 1NDCA 2QL9B 2YY3A 2Q0RA 3MK6A 4UQTA 4CIEA 1LWFB 4Z7CA 3L3VA 3T5JA 1TVRA 2BABA 4X4PA 2QC3A 3CDUA 2W40A 4HWIA 1S6OA 2HLUA 3EO3A 4AHRA 2WC9A 3UN3A 1ICEB 2M88A 2RUGA 3P49B 1U1QA 2RHKA 4NRTA 4G1QA 1HR0K 1VRUA 1T6CA 2H3GX 3P39A 2HHQA 1UVNA 3V1QA 4WFNQ 3CJ4A 2XB2D 4CF2A 1L5UA 3TYTA 3U9DA 1FWLA 1GXUA 3WNFA 3SSRA 3BBCA 2M9KA 3D9BA 4BGBA 2QYCA 1Q5VA 3H2LA 2JGUA 1CBKA 4PG7A 3O8WA 1VQON 1GK8A 2VBXA 3JS6A 1HNXJ 4B3RJ 2P2CB 2PMHA 1UKUA 3N9UC 1MN9A 2K1RA 3PJXA 1JCFA 2CPEA 1N32J 1WD6A 2O8CA 1FDBA 3OL9A 1NJXA 4H4OB 5CR4A 2VL1A 1TL7A 2OGUA 3EXCX 1E6YA 5FLXO 3O8MA 4CK3A 1XC3A 4NL5A 3BQ0A 3CCTA 4LF1A 3W2WA 4ES3A 3MN5A 3J8AA 1T0TV 1NKBA 1UJ4A 1WF2A 4DR5K 2ZHAA 1IR1A 1S1WB 2W25A 4WTOB 3UKUB 1REVA 4Y2MA 7AT1B 1YITN 1XNQJ 5G0RA 5DM7L 4Y2CA 2KO1A 3KLHA 2O8DB 2HG4A 4ZJLA 1I94F 2VU5A 2D0CA 3MR3A 3L2VA 3E2EA 1M5VC 1RT2B 2WSFC 2NRHA 1KHWA 3ZZOA 4XEIA 1OSDA 3AA8A 5D77A 5LT5A 2QT7A 1X9MA 2AX1A 4ECWA 3DCAA 3VQDA 2HHVA 5D0GA 1QQMA 2QTWA 5KRTA 1VYAA 2BZ2A 3BEXA 1JLQB 5HSPA 2XNQA 3GJTB 1Q86T 2P5VA 3CJQA 5GADP 4JKBA 4CEQA 1LXNA 4CCHA 4V19S 3HT3A 2KJVA 5KT6A 3I0RA 2PDAA 1EQYA 2I1RA 1FDAA 2DGQA 4O5BA 3MMAB 4U7UD 3UNGC 4B3TJ 3PRVA 4U67Q 3DXKA 2YNFA 5J1NA 4EK2A 4IG3A 3TTDA 4YY3J 3MM7B 4YFUA 3MURP 2OSRA 3GIJA 4J5OA 3K2PA 4J9OA 3BR8A 4A8YA 1VBKA 3AODA 4QYRA 1VQMN 2IIHA 3H25A 2DGTA 3DN9A 1IUJA 1WHWA 2W8LA 2I5JB 4DL7A 3MN7A 2CQ1A 5JJBA 4A62A 2DH8A 4PR6A 4C3MA 2P9KB 2CJKA 3ATUA 4RW8B 1KR4A 5KI6A 4DX5A 4QIFA 4K8RA 4N76A 2X6SA 1SH3A 4KC5A 2LXFA 3TARA 5MLCQ 1X4HA 2LDYA 2F8EX 3EEQA 5FPNA 4ECUA 1O0PA 1S0NA 4YDXA 4JI4F 4LVNP 1BI4A 3AAPA 1YHQN 4ED7A 3GR0A 2B5JB 3A5NC 4OX7A 4CLUA 3VGLA 3VVTA 3TUPA 1UW4A 4JKCA 3TQ1A 4TQRA 3AVCA 2E1MC 2E1AA 4AHSA 1RTDA 5J1PA 5IV4A 1ZAWA 1YJWN 1M5HA 2CVIA 1B0TA 3DKDA 5HBMA 4ELUA 1S6QA 2A6MA 4NB4A 2DNRA 3THWA 4PXCA 1HKBA 3NF9A 2WB4A 3PYGA 1KVCA 4M3YA 4CFAA 1Q81T 1U1MA 3OR1B 1N36F 4OQJA 3PIPL 3P8BB 3QMQA 2UUBK 5CE3A 1OH8A 3OUYB 4B3MK 3DRRA 5AQXA 2FPHX 2YHYA 3IC1A 1DURA 2DGVA 3UVJA 2C2RA 1N36K 2ZOFA 3UD4P 3AVBA 2GQCA 3DXBA 4P2XA 2HHTA 4MKAA 2XG8A 2D9PA 1JLQA 1T3OA 2X3GA 2C2MB 2Q2RA 2VGMA 5IT4A 4DPYA 5KFVA 4M5KA 1X9SA 3S3MA 5ETLA 1X4EA 3GG1A 3HOSA 1VQ8S 3KHHA 1A5XA 1U24A 4P2FA 3W7BA 2W9BA 4ED2A 2L9WA 2LSNA 5KFUA 2EG2A 1J53A 2UUAJ 1XTZA 3C15B 3BF4A 4K5RA 2J9DE 2YNHB 1DTQA 2ACYA 5LMNJ 1MA9B 1WDDA 1D0EA 2FD2A 3DHXA 1RDDA 1MMLA 4RUAA 3BKFA 4LF6J 1SB6A 1X60A 5D15A 4YR2A 4W5NA 2MY7A 4OYZA 2FC0A 1UFLA 4MTPA 3A5MC 1RHRB 3HSCA 2V68A 3R3LA 5AJ3F 2G8FA 1CJUA 2NXUA 8ATCB 4DV4J 2V7YA 3D28A 3OTOJ 5C7PA 5IFMA 3QSYB 4P73A 5SZTA 1HQEB 4RNMA 4DL5A 5AJ3K 3BN4A 4I68A 1VHFA 1WLJA 4O8UA 2GWKA 1G2EA 1BL3A 4CI0B 1TYQB 4BR0A 1F1BB 4BR7A 3EVMA 2H48B 4LF6F 4J2DA 5GAHU 1YK9A 2DITA 4H0PA 5BXIA 3I55S 3DRPA 4AXJA 3EMTA 4LRFA 5HP1B 3NGKA 2IC3A 5KFYA 2VG5B 4ZN1A 2HFNA 3T3FA 4ILJA 3PO4A 2VWKA 2AQ4A 2DK2A 4LF9J 4JI6F 2AV5A 5KPRA 5KFEA 1J6ZA 4RUCA 4OI3A 3FK4A 1TKXA 1QQOA 3ZSWA 3H42A 2VODA 1K8KB 5HO4A 4ICLA 4M5DB 1GEHA 1N32F 5LMNK 1HLUA 2RU9A 2ILZA 3IAS9 5KG6A 1WACA 4X65J 3ILLA 2VBWA 2IVMA 5KFFA 2W4CA 4LD0A 1NB2A 3UVJB 2B4UA 2JSXA 2VFRA 2I9SA 4U8YA 5BN9A 2VHGA 1RAGB 3RSEB 4CBUA 2QWRA 1T11A 2QLXA 1RBOB 1P1LA 2KM8B 3THVA 3MCAB 1X4AA 2GJFA 2R7XA 2ZH4A 2QL5B 3O9SA 5I9EB 3HDSA 1Q4RA 3TA0A 4DV6K 3BN7A 3JS9A 3PO5A 4YOVA 3CJ2A 1IQZA 2CQHA 4CTAB 3OTEA 4GY2B 4ZVFA 3NWGA 4U7BA 5DDPC 1OJ4A 1Y7PA 4V19J 4IOBA 1OQ3A 4FWLA 4EHUA 4B9NA 1RTHA 2E5IA 2Q36A 1RACB 2LXIA 4ID1A 2WW8A 4BQZA 3BZQA 1BDGA 3T19A 5JVHQ 1QTNB 2QM1A 4HI1A 4RX6A 2GX9A 1N5VA 3W2WB 3D6TB 3THTA 5EWFA 1NH8A 2V63A 3MOJB 2P51A 2IM3A 1FI4A 1NSPA 1HBMB 2HMIB 4R79A 2BE2B 3H2UB 4TU8A 1OKJA 4FOEA 3CJ0A 1VLOA 3L7PA 4YORA 1HPMA 1HBUA 1OH7A 3UW1A 4H5TA 4F4KA 3VWSA 4EO8A 4LR8A 4B3OB 1NZAA 5KFAA 4ILMA 2BRKA 2Q3SA 4PL7A 2BE7D 1ZBIA 2UV8G 1X7VA 4ISFA 2ERRA 2HBKA 4ATNA 2XMWA 4ANCA 4CM0A 3BGRB 1ZZFA 4FM2A 4CEFA 4IYQA 1U2RA 4CM2A 2FVSA 3NGIA 3MCSA 3C6UB 2WK4A 3LP1B 1RB0A 1NGFA 2AT1B 3LZJA 2CGLA 3FRZA 3P38A 1F9EB 4RUHA 2DGSA 3ENWA 3C95A 3ZTPA 5CD4H 1YJTA 3QJLA 4KAZA 1NJZA 2RAQA 2RILA 1JLBB 2KHCA 4DPTA 3A8KA 3R5JB 2HF3A 2C3UA 1R0AB 1U8WA 2ZH2A 2C3OA 2IVPA 4YN3B 4USKA 1YI2S 3LDPA 1TL3B 3JTOA 1YTYA 5KT4A 3CD5A 5H1SQ 2RF2A 3UN2A 3MM8A 1UL3A 4Z4FA 3F41A 2DFFA 4IDHA 3R8YA 4BROA 5IT9Y 1SC1B 2GQ2A 3T9ZA 4DUZF 1WG5A 2JEGA 2MLZA 5FLXY 2JFKA 5KT5A 2YQ1A 1QD1A 3R6GB 1HHTP 3B8HA 3A5OC 3IR7B 2X1GA 1GLLO 3TR5A 3MR2A 3AHPA 2DYAA 1YTAA 4NYFA 1NNEA 3UE5A 3J7Z5 2AF6A 4HVZA 4JI8F 1S7IA 3MR5A