4O4GA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o4gA05
3OHBA 3KK2A 2BQ3A 4DS5A 3LDSA 1KHVA 3VA0A 3DOKB 3OY9A 2DY4A 1Z4UA 1BL3A 2RKIA 5DQHA 4LSNB 1JXBA 3PUFA 3CO9A 3ITHA 2DPIA 4KHSA 1RT4A 4URQU 1JLFB 3PJXA 1WSEA 2BDPA 4LSLB 5DG7A 4NLYA 4QWCA 2O4GA 4X2BA 4FLUA 3V6DA 4FJKA 4M3YA 3KLEB 5J1EB 2XWYA 4CJQA 1X9SA 2FVRA 1ZYQA 2KW4A 4KHRA 1JLGB 4TYAA 3H40A 3TAFA 1TV6A 3ICLA 1HYVA 3DDKA 2BE2A 3S3NA 1TAUA 1HQUA 4N47A 3AO1A 1DLOA 1U09A 1S1XA 3TR8A 5KI6A 1TL1B 4KBIA 4M45A 3Q8SB 1XI1A 1O1WA 2R8HA 5J2MA 3VQEA 4LD0A 4Y1CA 4NLPA 4J9PA 3SQ4A 2YNHB 1QE1A 3DOKA 1QTMA 1S9GA 1JLBA 4N56A 1NNDA 2IJNA 3TAMB 1TP7A 4XPCA 4LSNA 4QWAA 2P51A 3T3FA 4K4UA 1X9MA 4CFCA 1YTAA 3IN5A 5KFPA 4Y3CA 2GV9A 1A5WA 4RZRA 1T05A 1S97A 1NHUA 3NAIA 1S9EB 1NK5A 4CIGA 4C8OA 2FJWA 2GC8A 1SKWA 4I9LA 3QGIA 3H5UA 3AVNA 5HRNA 2YNGB 2YHBA 3KLEA 5J1EA 3KJVB 5KT7A 4B9VA 2BRLA 1ZETA 4I2QB 4NLTA 3SV4A 4W5QA 4E1NA 3MXIA 3KTQA 1BQMB 3KD1E 4O3SA 2E4LA 5FDLB 3MR5A 5KFTA 2C2DA 2OPRB 2XY7A 5EUHA 3OYAA 3GV7B 2Z1HA 2IM0A 1JXEA 4DTMA 3SPZA 3Q8PB 1A5XA 4FLVA 2A1RA 3KHRA 1SL1A 3SQ1A 4YQWA 2YNHA 4IG3A 1EKEA 2DFEA 2OPSB 1RT3A 1IM4A 5KG2A 4CFBA 1EP4A 3TAMA 3FRZA 5KFFA 4CJFA 3SQ2A 3HPHA 1S1UB 1NKBA 5KTQA 3TAPA 4TSXA 3UPFA 1KLMA 3LP0A 4JUZA 3I5BA 3GIIA 3SZ2A 4DLEA 2ZQBA 5KFOA 2YNGA 3AVBA 3I0RB 3HVRA 4IBNA 5KFRA 1YVFA 3HYFA 5DMRA 5F8GA 1EETB 1BQMA 3ZT2A 3QZ8A 4ECUA 3HHKA 4WE1B 2V0NA 5EWGA 4N41A 4IH5A 4CJ4A 5CZ2A 3LALA 3K59A 2HMIA 2XGQA 3DYAA 1SH2A 1N5YA 4FBTA 2OPSA 3DRPA 5J2PB 1IH7A 3NAHA 4AHSA 5DK5A 3RBDA 2W7OA 4DQQA 2HHVA 1S1UA 3S9HA 2E9ZA 1WSHA 3K2PA 3SUQA 2UUTA 1Q9XA 4J9QA 4ZVEA 3IG1B 5KG0A 1GOCA 1YTUA 4FK2A 3DM2B 4CHNA 4KSEB 3E01B 1S10A 3NDKA 4KO0B 4I7FA 4MIBA 4J9NA 4LQ3A 4FJHA 4CK1A 3H4BA 3HM9A 4KI6A 3M8QA 4KPYA 4M3ZA 3CDUA 2WRMA 1N4LA 4MQ3A 1VSLA 3OS2A 4K8XA 1JLQB 2XY5A 1RTDA 2PYLA 5KFYA 3U6FA 1HNVA 1EETA 3L2QA 1NKCA 4FLWA 3KIOA 4M3RA 3QETA 3QIOA 2B6AB 4CF2A 3RAQA 2IGIA 3P83D 4NLWA 2RN2A 2J6UA 3K5LA 2ITGA 4RNOA 1ZBFA 1S6QB 4E7HA 5HLFB 5KFNA 4I2PB 2VA2A 5DQGA 3WNFA 2Z1GA 4FZYA 3M8PB 4Z4IA 4R8UB 3MEDB 1C0UB 1S1TB 4PWDB 2YV0X 3RBEA 4CJRA 5KFCA 4QOZB 5KFIA 4OKKA 3RB6A 1B9DA 3IG1A 4CGGA 3DM2A 4ZHRB 1RNHA 1T3NA 2QK9A 4DEZA 1CSJA 3E01A 1FKOA 5D3GA 1RAJA 4KO0A 2XI3A 2OZSA 4TN2A 4BDPA 1Z25A 4W5TA 4RW7B 4ZPAA 4DSFA 4YFUA 3NAEA 4ID5B 4YR2A 4ECZA 2G8WA 4CK3A 4GC7A 4H54A 4DL7A 4J2BA 3UQSA 3EY1A 3FQKA 1KVCA 4TLRA 2HVIA 4FW1A 4KREA 4OPKA 4WZMA 1NJZA 3H5YA 3CJ2A 4H4MB 3AVAA 1RCHA 3RRGA 4FJ8A 3OS0A 1Y97A 1ZBIA 2FVPA 3T5KA 3RMAA 4DSIA 1SUQB 1WSFA 3L8BA 3M8PA 4CJ3A 1HQEB 3NHGA 1LWFB 4R8UA 1C0UA 3HJFA 4CHZA 4CESA 4PWDA 4ECQA 3TWHA 5CY4A 3OYNA 4RW8B 3WNEA 1J54A 1CLQA 1XR5A 1NJYA 1HMVB 5HRPA 3D5MA 3V1RA 4O55A 4ZHRA 2YKNB 4CF9A 4ZVGA 3SUPA 1C1BA 1XWLA 4M3WA 3V6KA 4MKBA 4FLXA 4RW7A 1UWBB 4R5PB 3AVIA 3OHAA 4ID5A 2OPPB 4EP5A 1JKHA 4ECTA 1VSEA 2AJQA 3M9NB 4CERA 1N48A 1KFSA 2ILZA 3AA5X 5KFGA 4YMEA 3M8RA 2V4RA 1FKPA 1LWCB 3F9KA 3ZSOA 2IC3B 3DOLB 4ECWA 3L3VA 5L1JA 4Q44A 5I42B 3UR0A 4G3IA 2HNZA 4DWIA 1NHVA 1RTHB 2IJFA 4CEBA 4DU4A 2EX3A 5F8MA 4H4OB 1RTIB 1SUQA 4BE2A 3QZ7A 1WN7A 4ZTJA 1HQEA 1LWFA 1S0NA 2YNIA 1VSKA 4FVMA 3OYFA 3MXMA 4FBUA 3OYBA 3KHLA 3HVTB 4IFVB 2YKNA 4CK2A 3MFHA 4Q45A 4AHCA 4EP4A 5C24B 4NZ0A 4K50A 4R5PA 4M42A 2Z1IA 5HROB 3SFUA 3KK3B 3TAQA 5DLGA 4IRDA 4B9MA 2OPPA 2B5JB 4CJEA 3RR7A 1QAIA 3L2UA 2P5GA 4GMJB 2D3ZA 4NYZA 4M41A 1SKSA 3QO9B 1RDRA 3B6PA 1RDCA 4FM0A 1D0EA 3NE6A 3QGGA 3NF7A 3MR6A 2ZD1B 4IFYA 1TVRA 3K5NA 4OGCA 1LWCA 4HCCA 2R2UA 2IC3A 2HAIA 3QNOA 5I3UA 4B8AB 1T8EA 4LH5A 2HHUA 1NK6A 1XR6A 5I42A 1XHXA 2BANB 1N6QA 1S1VA 5KG1A 4ED2A 4NCGB 4FCYA 1QS4A 5K14B 1RDDA 1JLCB 3HXMA 4FJMA 4LH4A 2JEGA 1ZTWA 4DQIA 1QHTA 2XHBA 4QWBA 4DL6A 2BR0A 1RT1A 1VSHA 3IRXB 1U4BA 4CEQA 2AQ4A 3KK2B 4KHMA 4BACA 5C24A 1ITGA 2C28A 1RYRA 2R8IA 2RKIB 3GILA 1TGOA 3KK3A 1KVBA 3EYZA 1W0HA 5KT5A 3V81A 4QW9A 1S0MA 3QO9A 3RAXA 1L3SA 1C0TB 4KB7A 1X9WA 5KRTA 2GBZA 1RT4B 2ZD1A 1YT3A 1RBUA 4M3UA 4RW9A 4CJVA 3VQ9A 2VG7A 3OJUA 3V6DB 3D45A 4KI4A 1LW2B 4HUEA 4Z4EA 5KFVA 4J9SA 5JS1A 4CJUA 4Q0BA 1T03A 2G8VA 4NLRA 5KGWA 2BE2B 2FLPA 3RR8A 2D0AA 4FJNA 3OYDA 3KLIA 1S1XB 4BWMA 3CDEA 3BSNA 4U7CA 3D28A 2YNFB 4J9MA 2KFNA 4O3OA 3KLGB 3IRXA 5J2MB 1DTQA 4OL8A 1JXLA 3FFIA 3PVXA 4CF0A 4QPXA 4DTRA 1IG9A 4FZZA 1QE1B 1SH3A 1JIHA 4NLGA 1S9GB 4FW2A 1JLBB 3TQ1A 5JUMA 5KFQA 3SI8A 4IRKA 5KFBA 3OL8A 1RTJA 4IR1A 4ZVHA 3OL7A 3LP2B 4E1MA 3RMDA 4EBCA 1VSFA 3DRRB 1REVA 4XIUA 5SZTA 3RMBA 1TKTB 3O3GA 1C0TA 2FLLA 1LW0B 3VQBA 4N76A 4G1QA 3PV8A 1T05B 4C8KA 4RUCA 4ED1A 3LP3A 4ZP6A 3PZPA 2LSNA 1RT7B 3V9UA 1LW2A 4Y1DA 3DLHA 4KAIA 1VK0A 3M9MB 4OGEA 3AVCA 2IM1A 3KLFA 3PX6A 2W9CA 1L5UA 2FVQA 3K5OA 4K4SA 3VQQA 1S49A 2DFFA 4HVJA 3MEEA 2YNFA 4FLYA 4KKOA 2DPJA 2XY6A 3KLGA 1NOYA 3Q8RB 4FJ5A 3KKSA 2W8KA 3LPTA 4ECVA 4IG3B 2R7YA 1RA6A 4ECRA 3H08A 3SI6A 2E9TA 1RT3B 1NK9A 4Z4CA 4KTZA 4RG8A 4JS4A 1EP4B 2R8KA 1RBRA 4O4GA 3EPIA 4WYLA 4HUGA 3KLVA 2ILYA 2VG5A 2WOMB 3LP2A 2ASLA 5CYQA 4Y2AA 3DRRA 3G10A 1KLMB 3V6HA 4XO0A 1TKTA 3LP0B 2JC0A 2UVVA 3L3UA 1OS5A 4WXOA 1S48A 2RDJA 3GV5B 1LW0A 1S9FA 4IDKA 1BISA 4ELUA 3T5JA 5F8JA 4CJLA 1RT7A 3CIZA 4DQSA 4AHTA 4DSEA 3OYIA 3RWUA 4FJ7A 3ISNC 3BGRA 4FM1A 4IKAA 4B3OB 1BHLA 2KTQA 2HMIB 2ALZA 5KT2A 3CVKA 1RBTA 4DU1A 3VQ5A 3DYAB 1RT6A 1BCOA 2ETJA 1L3UA 2VWJA 1N5YB 4DTUA 3GIJA 3DRPB 4YP3A 2OA8A 4O3RA 5C5JA 2R2TA 1KVAA 3LWMA 3JYTA 3MXJA 2WOMA 3NGZA 3OYEA 4UQGA 1U04A 3QEPA 1ZBUA 3ALYA 1NK8A 1RYSA 3ZSWA 1U47A 2A1SA 4DL5A 2FC0A 4TY8A 5DGAA 4I7FB 3OJSA 2EC0A 4FZXC 2HNDB 4RW6B 3OL6A 4NLQA 4DFMA 3M8QB 5KFLA 2W8LA 1KRPA 1WSIA 3B6OA 3D0PA 1VSDA 1RTDB 2W42A 5L1KA 1WSJA 3OYGA 4E7IA 1HNVB 1Z26A 2WONA 4EBDA 1VRUB 3BSAA 5F8IA 5E41A 5EWFA 1XC9A 4KHYA 3BQ2A 4B3OA 3V9SA 4DL3A 3WNHA 2D0CA 4ECSA 3AVFA 3O4QA 4O5BA 2W9AA 1L3TA 4H8KA 5L9XA 4B9NA 5L1IA 1CXUA 4K4XA 2W9BB 2P1JA 4KE5A 4F50A 2PY5A 1HYSB 3T1AA 4CHQA 2ATLA 1QSLA 1CXQA 4CGDA 1XHZA 3BQ1A 1K1SA 4CEOA 3IGNA 4O0IA 3DRSB 5D3GB 1FKOB 3CM5A 2JC1A 1TKXB 3HKWA 1BGXT 2HNDA 4RW6A 3CFOA 2UUWA 5KFZA 4Y2CA 1LAWA 1WNSA 4CGIA 1NOZA 4IR9A 1RBSA 3VQPA 3PR5B 3PY8A 1VRUA 3KLHA 3H59A 5EWEA 2XI2A 2KZZA 4QCLA 4F4XA 4RW4B 4OKEA 3HK2A 3RTVA 4EYHB 1GOBA 1RBVA 5KG4A 5L1LA 2Z1JA 2VA3A 3BJYA 3LPUA 2HNYB 4TYBA 3ASMA 4W5NA 2G8FA 5JXSA 1ZBLA 3L2WA 3ZSVA 3DLRA 3AVMA 2C2EA 4CFDA 2YKMB 2W9BA 2V4QA 3FDSA 1HYSA 4F4KA 4RNHA 1B9FA 3QLHA 4TQSA 4ED3A 1N56A 4B9TA 4I9QA 1GX6A 3CJ0A 3ULDA 4FM2A 1RDAA 2D41A 5DGBA 3ZT1A 3NF9A 4NCBA 2G8KA 4ELTA 1C1BB 3SV3A 3DRSA 4DTJA 4MK9A 1TKXA 4W5OA 1JLAA 2RPIA 4FYDA 2IAJB 2DFHA 4NLUA 1JL1A 3VQSA 1ZBHA 3S3MA 3C6UB 1JKHB 3PO5A 3HSTB 4J2AA 2J6SA 3PJWA 4IKFA 3CJ3A 3KHGA 4DFKA 2IM3A 4NLXA 3KD5E 3I8DA 4RW4A 4EO6A 1FKPB 1ASVA 2FBTA 1W9HA 4OJRA 2GIQA 5J2NB 2F8EX 4E3SA 4O44A 3GIMA 2HNZB 2HNYA 4O3QA 3V9WA 3PW2A 4FLZA 3O4NA 3ZT3A 3V1OA 3K58A 2YKMA 2R2RA 1S0OA 4J9OA 3V1QA 4N5SA 2YNIB 2G8IA 4ZPBA 2R8JA 3SCXA 2HHQA 4ED8A 1RILA 4B8CA 2IBKA 3OYCA 3TARA 4E89A 3BREA 2BRKA 3T5HA 4Q5VA 2D5RA 1QAJA 2FJXA 4F2SA 3H2LA 2IAJA 4DU3A 4GW6A 4JRQA 1NJXA 3C6UA 1S1WA 3BSOA 1G15A 1K1QA 4CJ5A 3QIDA 1GX5A 3NCIA 1NK7A 3NMAA 3OYHA 4IFYB 4ICLB 3OS1A 1TVRB 4FJJA 2OYQA 3HO1A 3NBPB 5I3UB 5J2NA 4QAGA 1NK4A 3I5AA 3GQCA 3QEVA 3H4DA 2O5DA 2HHXA 2VG6B 3H5XA 1N6QB 4BE0A 4DF8A 3AA4A 4F2RA 1S1VB 5KFAA 3PX0A 4DTOA 3NH1A 2Y1IA 4AHUA 3VQ6A 1W25A 4RU9A 1RT1B 3KNAA 1ASWA 4DG1A 4YR0A 4K4TA 1CZBA 2ZE2A 1QSYA 4DSJA 4B9UA 3MEGB 1RDBA 1TL3B 5KG6A 3MR2A 1TKZA 2C2RA 4ZP9A 3PR4A 3AA2A 4WZQA 1S5JA 4ED0A 1ASUA 4FJ9A 2CJQA 3MR3A 4NLVA 4M3TA 2XC9A 3DMJB 5F8NA 4YNQA 3DLKB 3KK1B 4FJGA 4F8RA 3V81B 2IDOA 3BQ0A 1UA1A 4OPJA 2XGPA 3NH0A 2I5JA 4NRTA 5KFDA 4DLGA 4ICLA 1VRTB 2QE5A 3L2RA 3NBPA 4C8LA 4RW9B 2VG7B 3SUNA 5KFJA 3PO4A 3QYYA 5KFHA 2IA6A 1IKWA 3E51A 4CJKA 2VG6A 1BIZA 4Q0BB 1T03B 1D1UA 2KFZA 4PQUB 4FLTA 3VQCA 3GIKA 1WSGA 3CFPA 2IM2A 3KLIB 5KT3A 1WAJA 3HPGA 3LZIA 2YHAA 4NLSA 4WFXA 2E9RX 1DTQB 4CIFA 3FFIB 2ATQA 4EEYA 4JRPA 4KV8A 3MEGA 3DLGA 1TL3A 4CJPA 4BDYA 3AO2A 2X74A 4ELVA 4WFZA 2XO7A 3KOAA 1RTJB 4E19A 3N6MA 2D7SA 1WLJA 2E6LA 3DMJA 3TVKA 3DLKA 3KK1A 3HVWA 5DG8A 3MAQA 4KTWA 2Y1JA 1REVB 5KFSA 4ZPDA 3KMSA 3QESA 1T7PA 4RUAA 4ZPCA 5HBMB 3DI6B 4DFPA 2HHWA 1U49A 4G1QB 3IAYA 2D3UA 1VRTA 4MK7A 3PW0A 3V4IA 4M95A 1NKEA 4GC6A 4QW8A 3AVLA 3PHEA 1BI4B 2IS3A 3NH2A 1KHWA 3LANA 1HRHA 5F8LA 3HP9A 2B43A 4Q43A 3DLBA 4DQPA 3ZT4A 1KTQA 4PQUA 3KKRA 4URSA 4CCHA 2QKBA 4KHUA 3KLFB 4IH6A 4KRFA 3I0SA 2W9CB 4URGA 2AWZA 4NRUA 5KRSA 3BSCA 3MEEB 4KKOB 3RB4A 4BDZA 1HJRA 3GYNA 5C25B 2FJVA 5F9LA 5J2QB 1LWEA 3AV9A 3TANA 3OYLA 4NLOA 3CDWA 5FRMA 4O4GB 2AGPA 5F8HA 4B9SA 2VG5B 5CYQB 2UVUA 4EO8A 3F73A 1DTTB 1CZ9A 3V9ZA 1TK8A 5HBMA 4MFBB 3DI6A 4R0EA 3MTKA 4K4WA 3C6TB 2FVSA 1BIUA 4DQRA 4IDKB 1MMLA 1BCMA 1D9DA 4ZTFA 1BI4A 3AO4A 3VQ7A 3O3FA 4OLAA 4CJSA 2G8UA 4MK8A 1C0MA 2OPQA 4NYFA 3CQ8A 4W5RA 3BGRB 3DLEA 3VN5A 3V9XA 3RB3A 4ID1A 4Z0UA 1MU2A 4TXSA 2W7PA 3K5MA 5C25A 5C42A 1VSJA 1RT6B 5J2QA 3G6YA 3P1GA 4AH9A 3G6VA 3SQ0A 3IS9A 3Q8QB 3JSMA 3EZUA 2AU0A 2HWIA 3HP6A 3JYTB 4IRCA 4CF8A 2R8GA 3CG7A 1DTTA 4J9LA 4MFBA 3T19A 3N6NA 4KTQA 2DTUA 1RA7A 3H5SA 5KG7A 1UAXA 3C6TA 1VSIA 4TY8B 3OLBA 4DL4A 3CM6A 3RRHA 1HPZB 3ZSYA 4KFBB 2HW3A 3G6XA 2BGGA 4QWDA 1IO2A 2RDIA 1S6PB 3IGVA 4IG0B 2WONB 3QIPB 4KAZA 1JLFA 4PY5A 4LSLA 3NKYA 5KGXA 2ASJA 1SH0A 1J53A 4HCBA 4KB0A 5HP1B 4PUOB 3VQAA 1BQNB 1EX4A 1JLGA 4HTUA 1C1CB 3ZSXA 4F4WA 3AO5A 5T7BA 1SKRA 3T5LA 5EU7A 1U48A 5CYMB 4DTNA 1TL1A 3A2FA 4MKAA 1C6VA 4K4VA 4DTXA 3SFGA 4MH8A 5KFMA 5KFWA 4F4YA 1KSPA 5FRNA 1NJWA 4FS2A 4IH7A 4FJXA 1HPZA 3PW4A 4KFBA 3PX4A 4K8ZA 2XCAA 2UVWA 2PZSA 1NK0A 3TAEA 1S6PA 4CE9A 3FSIA 4IG0A 2BQRA 3KLHB 5DG9A 3QIPA 1S9EA 4KHQA 2QKKA 4ECYA 3N6LA 3KJVA 5HP1A 4PUOA 4K4YA 4I2QA 1BQNA 4DMNA 4C8NA 2R2SA 2HHTA 1IKYB 1C1CA 2JEJA 5FDLA 4HYKA 2OPRA 2HB5A 3NFAA 3QLHB 5CYMA 2J6TA 1J5OB 1EXQA 2WB4A 4EBEA 2O4IA 1I39A 2F96A 2AGOA 3TI0A 4E0DA 4CEEA 4Z4GA 4FK0A 1GOAA 2QV6A 5KT4A 3CJ5A 4C8MA 3FQLA 2AX0A 1JLAB 5KFXA 3AA3A 4ED6A 5SWMA 4J9RA 3AO3A 1X1PA 1TK5A 4JS5A 4YR3A 4DTSA 3C95A 4L8RB 3LAKA 2AX1A 4FJLA 1QUVA 4TQRA 4B08A 4M3XA 3VA3A 4JV2A 3OYMA 4ED7A 1SV5B 4J9KA 2E6MA 2G8HA 1S4FA 4K4ZA 1B92A 3I0RA 1TQLA 4O44B 3THVA 4TY9A 3QNNA 2XY8A 2GUIA 2VWKA 1QSSA 1IKYA 3M9OB 4BWJA 4DSKA 2IMWP 1D5AA 3LWLA 3UDLA 4WE1A 5F9NA 4JV1A 1D9FA 5KFKA 4FXDA 4RNFA 1J5OA 4HKQA 2FBXA 2WHOA 3QEWA 4CJWA 1TK0A 2PYJA 2ZKUA 3RMCA 4EZ9A 2OH2A 3WNGA 2QXFA 5J2PA 3LAMA 1C1AA 2X6NA 3BR9A 5JS2A 4F3TA 3OYKA 1JL2A 1XR7A 1T94A 4DSLA 4LQ9A 1S1WB 2FLNA 4E7JA 4EZ6A 4WFYA 1IKXB 4F4ZA 3PW7A 3MF5A 4PA1A 1SV5A 5HRRA 1IKVB 4CHYA 3I5CA 1JLQA 4Q8EA 2V9WA 1R0AB 4BE1A 1I3AA 2B6AA 2HHSA 4ZMMA 2FVCA 3QEXA 4DF4A 4CEAA 4CGFA 1S6QA 2X6SA 3QEIA 4OLBA 3NL0A 5KFEA 4JLHA 1K6YA 2RF2B 1WAFA 2NUBA 4HHTA 1HNIB 3ZCMA 4DG1B 4FK4A 4Y34A 5HLFA 1LAVA 3U3GA 2ZE2B 4I2PA 1LV5A 3SPYA 1JX4A 2C22A 5EDWA 1TKZB 3SYZA 4WYWA 2F8SA 4OVLA 3MEDA 3EPGA 2AGQA 4GVMA 3CJ4A 1S1TA 4E7KA 2KQ2A 4FS1A 5DQIA 3CWJA 3CFRA 2FBVA 4J2EA 4CEDA 2XRIA 2WK4A 3LP1B 4DL2A 1I6JA 2I5JB 1IKXA 5FROA 1SL0A 4NLDA 3KMQA 2IOCA 3TAGA 3P5JA 3VQDA 4QWEA 4AHRA 4M94A 4KB1A 3MECB 4IQXA 1Q8IA 1IKVA 2CKWA 2ASDA 4MIAA 1ZTTA 2JLEA 3CYMA 1IKWB 3QGHA 5KG3A 1R0AA 4FJIA 4NYNA 3NF6A 3U3YA 3H98A 3GV8B 1QQCA 2JEFA 3OSNA 4CGJA 2Q3SA 4CECA 1KFDA 5HRSA 4HUFA 3KHHA 3QINA 4O3PA 2B4JA 4Q8FA 4LY7A 2P5OA 4H4MA 3NF8A 3LZJA 3ZSRA 2RF2A 1HNIA 1HARA 3HVAA 1F21A 2X78A 3OSPA 3G86A 4KV8B 4AILC 3DLGB 4EYIB 3OLAA 4O4RA 3AVJA 3L2VA 3ISND 1L3VA 5KFUA 5KT6A 4RW8A 4E7LA 1HMVA 3LP1A 3C94A 3HPOA 3HT3A 4DS4A 3RB0A 1A5VA 4CHOA 1UA0A 3MFIA 1SL2A 2WTFA 4CGHA 3V4IB 3MECA 4CHPA 1UWBA 3NGYA 4JV0A 2JEIA 5CZ1A 4O0JA 3K57A 3S3OA 4CF1A 2OZMA 3QERA 4ECXA 1YVUA 3HL8A 2GIRA 1RT5B 3OVNA 3O3HA 3BDPA 1J9AA 3OYJA 1FK9B 3M8SA 2XCPA 3OL9A 3I0SB 5DLFA 1HYZA 1C2PA 1TAQA 3DOLA 4AHVA 3TABA 1FXXA 1JLEB 4ZVFA 2BQUA 3SUOA 3ZT0A 4WXWA 3VQ8A 1RT2B 1RTHA 1LWEB 4H4OA 1RTIA 4J2DA 2EHGA 3ZSZA 4F3OA 4CJTA 4B9LA 4NCAA 3HVTA 4IFVA 4ZP7A 2KZMA 4KHWA 5T14A 3SNNA 4ZP8A 1KCFA 5HROA 1KLNA 2B5JA 4CEFA 2OPQB 3ITHB 4CIEA 2HVHA 1RT5A 3AVHA 3PW5A 1FK9A 3V6JA 2JGUA 3EZ5A 3VQ4A 3DLEB 4DTPA 2F8TA 3NGIA 4XPEA 4O3NA 1D8YA 1UOCA 4KHNA 2WCXA 1JLEA 3ZSQA 1MU2B 4OKJA 3AVGA 4U6PA 2BANA 4CEZA 5C42B 1WNEA 3G0ZA 4CFAA 1Q9YA 2HWHA 1RT2A 1TV6B 4NCGA 4Z4FA 3IS9B 5K14A 4RNMA 3JSMB 1JLCA 1HQUB 2FBYA 1U45A 4RNNA 1TKDA 1DLOB 2D0BA 1VSMA 3UIQA 4IOBA 3AVKA 3NGDA 2UVRA 4Z4HA 5KG5A 2I1RA 3SJJA 4DFJA
chains in the Genus database with same CATH superfamily
2BQ3A 3VA0A 4KH0B 3VF2A 3Q0AA 2RKIA 3HD2A 3W8GA 4LSNB 2XMKA 4QU6A 1VQ4N 1HBNB 5AXNA 2BJ3A 1QLNA 4KHPJ 1V3RA 4F04B 4OYPA 5IOLA 3EWGA 5DDOC 3PJXA 4CYUB 3ZZPA 2BDPA 4LSLB 5DG7A 4FYVB 4QYZK 4Z37A 3V6DA 4AUKA 1SJ4P 2NLXA 5KPZA 3KLEB 2XWYA 4FF2A 1FJGF 1EB0A 4YY3F 5AQTA 2VF3A 2BMBA 1EWRA 3TAFA 1TV6A 3ICLA 1HYVA 4IOCQ 2BE2A 4DV3J 1TAUA 1Y10A 2YQ0A 1X9JA 1DLOA 4MMOA 3TR8A 5KI6A 4DV4F 2QFIA 3AGKA 9ATCB 3HSCA 3ZZTA 5AFUA 1PO6A 2XG8A 4Y1CA 2QW9A 4NLPA 4J9PA 3SAHA 2YNHB 5BYQA 1SPBP 1Q78A 3HHLA 5G4DA 4BROA 3O5BA 2LU1A 2KJVA 5ADXA 2MZ1A 1ATNA 2EFVA 2KFYA 4CFCA 2RRNA 1Y0HA 4EHTA 1NHUA 2BJEA 4YN3B 2C3PA 2FJWA 2B9EA 2GC8A 1SKWA 5J1EA 3KJVB 4LT6A 4G1PA 4I0WA 1HW8A 4O3SA 2IYGA 3MR5A 1IUJA 1OWXA 2OPRB 5HO4A 3SPZA 2MDAA 1RAIB 4QQBA 4C0HA 1YBTA 3OTCA 2E8AA 3J7Z5 3PJ9A 3KHRA 4FLVA 3SQ1A 3N5BA 4YQWA 4IG3A 1EKEA 2DFEA 2OPSB 5KG2A 1MLAA 3FE1A 1EP4A 3L4BC 1OQ6A 1SC4B 1YJ7A 2YVSA 2P9KB 3EEQA 4CJFA 1M5HA 3SQ2A 1U6BA 2JSXA 1WELA 1FJGK 2QG9B 3N5FA 4K5SA 1HNZF 3CCUS 2UV8A 4CVNE 3WZ0A 3ETMA 2AYEA 4DLEA 2WSEC 2ZQBA 4F0HA 2OSRA 3UNYA 2D3O1 4CRJA 2ZJRQ 3AVBA 1N52B 3CCUN 2UU9J 1YVFA 4JB8B 2W6LA 1RCXB 3TUPA 1DQAA 2HOEA 2P6TA 5F8GA 2B4OA 3EICA 4L75A 3OUYA 2V0NA 4IH5A 4CJ4A 2O66A 3UD5A 4ZKAA 3K59A 2X3DA 3VCDA 5AQXA 2XGQA 4LRDA 1M5KC 1URNA 3WQUA 4WWSA 4FBTA 3DRPA 1WF2A 1RGVA 2XSJA 3VAIA 3U8XA 3NGTA 3BUZB 3RBDA 2W7OA 3Q8YA 5CZVA 1QUPA 2BJDA 3S9HA 2E9ZA 4A59A 2HBRB 3K2PA 3SUQA 2UUTA 3CMES 4J9QA 3IG1B 3MPVA 1FRKA 4KO0B 3AJ1A 4J9NA 4DV5K 3CT9A 4HDHA 3CMEN 4KPYA 3CDUA 3CCSS 4K8XA 1JLQB 1RTDA 3PRDA 4OZ1A 1NKCA 3CJBA 3QETA 2Y8YA 1GK8A 2ZH6A 3OPKA 3QIOA 2B6AB 5CD4H 4L3KA 2PMWA 2RN2A 2J6UA 3CCSN 2V8HA 2O8DA 2HQGA 1UW9A 3D2FA 4K2XA 3W9JA 5HLFB 3SSSA 4I2PB 2PSZA 3EGNA 2VA2A 2OD6A 2R7SA 2OEJA 1UEKA 3JXOA 1U25A 3K9KA 4WK3A 4FZYA 4CQ1A 3M8PB 5F41A 2QLFB 4B1XB 3LUYA 3THPA 4PWDB 3O08A 1XMOJ 3MURP 2DO4A 4OKKA 2WC9A 2CADA 4U7UK 4HL9A 8ATCB 1H74A 1J5EF 3B8HA 3DM2A 2B7CB 1UCNA 4DEZA 3E01A 5D3GA 5M1KA 1YSJA 1YRTA 4BDPA 2IIHA 3S6EA 4P72A 4DSFA 4YFUA 3O9SA 2DNZA 4OJHA 4ID5B 2DGTA 1JQGA 4GC7A 4I4BA 4NB4A 3IDHA 3UQSA 3FQKA 4XH4A 1QDUB 1M5VC 2M8DB 4C0OC 3TQEA 4KREA 3AT1B 3DC2A 1RABB 4M5NA 2HPUA 3D3BJ 3AVAA 1RCHA 5A8RA 4A8YA 4E8UA 3GTYX 2XEXA 3OS0A 1KQSM 3RMAA 4I64A 4LF4F 1EKSA 5HMZA 3L8BA 3TWZA 2RMLA 2XMMA 1HQEB 4DHVA 1C0UA 4CHZA 4ECQA 3UDEA 3OYNA 1VQ5S 1CLQA 3BH6B 3T1YJ 3J7AP 1NMNA 3ZEUA 1EQMA 3ET6B 1HMVB 4ZHRA 1CC8A 2E2PA 4A8XA 4M3WA 4NZ6A 3MMAB 3BEXA 4U9RA 4A8SA 1VQ5N 3SAGA 4RL1A 2P9PB 1WKKA 2GJFA 1VSEA 2AJQA 1FDNA 1W26A 1RE1B 4DZ6A 1KFSA 2ILZA 4ZN3A 1V4TA 3DXSX 2DR7A 2NUUG 2R7OA 5AXMA 1W7WA 4H0PA 1YJRA 3DOLB 3D7EO 4ECWA 4JK8A 1FNXH 3R1HA 4PXEA 1IBKJ 5I42B 4G3IA 2Q36A 1RTIB 3SEOA 4BE2A 1LWFA 1S0NA 4FVMA 2FIUA 4DCPB 1H2VZ 4OHYA 3OYFA 2DY9A 3UDVA 2ZC4A 4USMA 4NA3A 3OYBA 3KHLA 4CK2A 2Y1LB 5C24B 3WIVA 2KB2A 3A3OB 3KK3B 4IRDA 4CJEA 5AJ3K 3BPDA 1SKSA 3B6PA 3PTWA 4AFFA 3NE6A 3CE8A 3MR6A 4LF4K 2HAIA 3BM7A 1UEUA 1T8EA 2BANB 1R8BA 3ZZOA 4NCGB 4FCYA 2AEMA 4FJMA 3BZQA 2E5IA 2E2NA 1ZTWA 4DQIA 2WW8A 1QHTA 1XIQA 2XHBA 4CI6A 4DL6A 4BS2A 3MM5A 2OAUA 2YWFA 4YDDB 4DV6K 3KK2B 1NBEB 4F3QA 3TPQA 1OVQA 1Q1KA 2HK2A 3L7OA 2E5LF 1ITGA 1WC1A 2C28A 2E2OA 3NCQA 1TGOA 5AQSA 1W0HA 2BJ8A 3O1LA 4QW9A 5GADP 3QO9A 4M7YA 3RAXA 1L3SA 5M1QA 1C0TB 5EXWA 3L6QA 4OO1J 2K7JA 2V4JA 2I2YA 1T6CA 3VMFB 1RU1A 4OYOA 1XMBA 3FBBA 2P9LB 5KFVA 4CJUA 3OA9A 1ILYA 1ROFA 4Q0BA 2G8VA 2H1YA 5T7LB 2UXDF 1A9NB 5KGWA 3IR6B 4YHHK 2XO6A 1AZSB 4PL7A 3MAAA 3QSYB 3M2RB 3KYLA 3CDEA 3BSNA 1F3FA 3QJJA 1YJVA 4B3SF 5JVGQ 3GE1A 4J8FA 1NGAA 2HVEA 1IG9A 2GMJA 1X7VA 4FZZA 5D8HB 4IOAL 1VC5A 1JIHA 2NRZA 4FW2A 1V9OA 5JJBA 4IR1A 2HF3A 1X4AA 3OL7A 3LP2B 4A4JA 4EBCA 2L41A 2LXUA 4JKHA 3U4LA 4XIUA 3VGMA 1XJWB 3R7BB 2NRWA 1T3OA 3RYLA 3ZTQA 1RWVB 2F3JA 1JWWA 1W2BR 4KIAA 3HFVA 3GU0A 2E5LK 3FLCO 2ZVIA 3K5OA 3KWMA 1WUAA 2HHHJ 4NXNF 2YNFA 2XY6A 1FTRA 2AEJA 4F9OA 3KKSA 1N34K 2LEPA 3SBTA 1VLOA 3TA0A 3MHYA 3H08A 2DD8S 3SI6A 1RT3B 1NK9A 3TRGA 2CQPA 2DHSA 1D9AA 3EPIA 4HUGA 1T9UA 1U02A 2ILYA 3D2WA 2VG5A 2WOMB 2ASLA 2ZJQQ 3LW5C 3G10A 3V6HA 3I4HX 3I9ZA 1DBDA 2QWQA 1VBYA 2RDJA 2R3VA 1ZM9A 3SMZA 4LFCF 3A8EA 5F8JA 1V5VA 4IJAA 3VEVA 3WXJA 5K8MA 4B3SK 2BH1A 4AHTA 5T41A 3IM9A 3OYIA 1I3OB 1T9XA 4FJ7A 3POTA 4FM1A 4IKAA 5LY3A 1U24A 4K25A 4BR7A 4JOUA 3G9CA 1YJNS 2A10A 2DGSA 3M2UA 2ALZA 2V7ZA 2JVOA 1RT6A 4DV1J 2CH5A 1L3UA 3DRXA 2J9DA 4PXBA 2KG1A 1YJNN 4OYWA 2MB0B 5C5JA 4B3RJ 3AJDA 3LWMA 1D4XA 1G2EA 1H0HB 3OBIA 3BDEA 4UQGA 1V3ZA 3R9LA 2IRYA 1NK8A 1YITS 1RYSA 1VS3A 1OH6A 3FZKA 5ETPA 1E6VB 4ES2A 1L3KA 4I7FB 5CCMA 4CO4A 4NXNK 3M8QB 5IS2A 1YITN 2UUBK 4CDIA 1WSIA 3C46A 4EHUA 1WSJA 3CXCM 3DGPA 4E7IA 4AL6A 5HATA 4EBDA 4JEPA 5E41A 3Q83A 3K0JA 1XC9A 4PABA 2RAQA 4L3QA 3V9SA 1GLDG 1XNQF 3WNHA 3LDLA 3AVFA 2QEXS 2YX6A 4GV9A 1WEYA 5L9XA 3M5RA 1LNQA 3N9UC 4LFCK 3TSQA 4KE5A 4F50A 2QEXN 2D3OR 3T1AA 1NEEA 1S77D 1CQMA 4CHQA 4ILGB 5IT9O 4O23A 1EARA 2GZOA 3J81j 2ZH7A 1XERA 2PFFB 3BQ1A 3DRSB 3QBCA 1K0VA 1IJJA 3CM5A 4K2JA 5CH7B 3HKWA 3NG8A 2HNDA 2WBMA 4BRGA 1Q5VA 4Y2CA 5KFZA 1W2BM 2IIRA 4IOAQ 2N4DA 1NOZA 2LLZA 3PY8A 1VRUA 4GV6A 3H59A 1F3VA 4FPBA 2XI2A 1ATRA 3W64A 1S4EA 2QIFA 3HK2A 3JAMU 1U1RA 4FPRA 4K0KJ 1GOBA 1TL7B 1Z2ZA 5KG4A 2O67A 3ZTPA 1HNXK 2N7CA 1NWKA 2Z1JA 1VBKA 3N28A 1NM1A 2P9EA 4JI6F 3SBMA 3FR0A 5JXSA 3SIPB 4M5DA 4HLBA 5K9FA 4RUHA 3VENA 2YKMB 4PPDA 2OELA 5A0YB 2HSEB 4RNHA 3HFKA 1NNEA 1E6YB 1N56A 1RCOB 4F67A 1CZAN 1GX6A 3CJ0A 3ULDA 4OZ3A 1TUVA 4PYDA 4D3GA 1XN9A 2MTLA 2IY5B 2A2DA 4WCEL 4KT0C 1P9QC 1FX4A 1NGGA 4FYDA 2IAJB 1N0UA 1DARA 4NLUA 1WKJA 3C6UB 1JKHB 1WKLA 3PO5A 1EX8A 3SQGA 1KONA 4OJ1A 1T9VA 3GR0A 4LF9K 5DDPC 4DR7J 2YHXA 5KOWA 4U7UD 3H7HB 4NLXA 4HTLA 3W0LA 4RW4A 2NRHA 3MX2A 4EO6A 3OVSA 3OTOJ 3QQCD 3QT8A 4MYTA 3UE2A 4IOXA 4LF6K 3GIMA 2HNZB 4UW2A 1GH8A 3V9WA 3NOGA 3PW2A 3G82A 3O4NA 4CZHA 3MM8A 3K58A 3MN5A 1Q82T 1S0OA 2RVJA 4N5SA 4ZPBA 3MPUB 1PAUB 2R8JA 1Z6RA 2RHQB 2CGLA 4ZVRB 2MEWA 2LEAA 4LF1A 4A57A 2H9ZA 4JYAK 3S8SA 1QAJA 2FJXA 3H2LA 1W7AA 3UKRA 4GW6A 1NJXA 4I6MB 4WBFA 1B4SA 1G15A 4A8KA 2MGZA 4CJ5A 3NCIA 4NA2A 1NK7A 3NMAA 2HVZA 1TVRB 2OYQA 4IEIA 3HO1A 5I3UB 3M6UA 4JI2K 1MN9A 2AJFE 4DF8A 3CCMS 1AA1B 1MWQA 5KFAA 2OD4A 3PX0A 1VIOA 4DTOA 3NH1A 2WVCA 3S41A 2HG4A 1XBWA 3VQ6A 3CCMN 4DR3J 3IO1A 3OXFA 4OI2A 2IMOA 3KNAA 4YR0A 5EVZA 3MDFA 4QYRA 4DSJA 1RDBA 4JBCA 3AA2A 2OANA 4FJ9A 2Z0GA 4M3TA 2XC9A 4YNQA 4FJGA 2X1FA 3V81B 4DL0C 3JQMA 5DM6L 4ZS6A 4LJMA 4OPJA 3N4PA 3MN6A 2F63A 4QS8A 2LU2A 3AXMA 1HUXA 3L2RA 5KFJA 3GYGA 4JD2A 3LDPA 1IKWA 4BLGA 2VG6A 1BIZA 5D4PA 1T03B 3K0SA 2IRXA 4ITSA 1VHFA 1N36J 3W5YA 1WSGA 3CFPA 2MKKA 2IM2A 3KLIB 2KYZA 4EGLA 2YHAA 4WFXA 2ZH5A 1KC8T 1VI7A 3EGZA 3D66A 4CZIA 4ZCKA 5D4OA 2ATQA 3MEGA 2UXBK 1QZ5A 3DLGA 4CJPA 5DO2A 4NPOA 1PILA 5J1NA 3KOAA 2RRBA 4E19A 3N6MA 3TVKA 2EK6A 2Y1JA 2BACA 3ZETB 1B70B 3HD1A 2FB0A 4ZPCA 2J8SA 3EE3A 1HNWJ 2W2QP 4DFPA 5AQLA 2HHWA 4G1QB 3IAYA 2D3UA 1VRTA 4C2MA 1JK9B 3LA0A 3KJFB 3D4JA 1HD0A 3NMRA 1BI4B 2IS3A 3VF0B 2CAJA 1VQ8S 4ZA1A 1HRHA 5M2PA 4DQPA 4NE9C 2VOPA 4CTAB 3S1TA 4PQUA 1BDGA 4I1TA 4URSA 2QKBA 3RAMA 5B0AA 1KQGB 2W9CB 4URGA 5ETRA 1VQ8N 4NRUA 4H4KA 1Q8KA 3AY9A 3MEEB 2OIHA 3EVMA 3SJHA 4C8YA 1HKGA 3GYNA 1VQNS 3MD3A 3QAUA 2J0WA 3JTOA 5J2QB 1LWEA 3TANA 3OYLA 1YUWA 3OTDA 1F9HA 1VQNN 1X31C 3Q2SC 2CQGA 3QT6A 4MKVA 5M1PA 2G2ZA 3J7ZT 2ZWOA 3WX8A 4MFBB 4K4WA 2FVSA 2CPXA 3MMJA 4DQRA 3R5CA 1MMLA 4P2SA 2F1FA 3L4IA 4OLAA 2F7TA 4CJSA 2A42A 4OYZA 3K8VA 1NGJA 4P52A 4J7CA 3BGRB 4BC5A 2D0PA 3V9XA 4G6VB 4TXSA 2W7PA 2CA9A 4NOHA 2NRXA 4X62F 2OMLA 1R6VA 3P1GA 3G6VA 2DNHA 3SQ0A 3QDKA 4EMDA 1W2IA 3EZUA 4B1YB 1H98A 3MMCA 2HWIA 4JI7J 2DPNA 1BWFO 3SK3A 3IWXA 1GLFO 4CF8A 2AP1A 2VJVA 3TYTA 3AARA 3IFEA 4ZLLA 5CYJA 4FOIA 1DTTA 4K8RA 2A6OA 8RUCA 2MJUA 4TY8B 3W66A 2HAFA 4DL4A 1HPZB 9RUBA 3M3ZA 3J81O 4PG4A 1HBNA 3R3TA 2RDIA 3TA2A 4IG0B 5IXUA 3QIPB 2D69A 1GEHA 4EUVA 1FVQA 2HIYA 2YKPA 1FWPA 4LSLA 4C11B 5LMUF 5A2QO 1KVKA 2HRTA 4FF1A 2D0OA 4CLFA 4C6AA 3DOMB 4NEZA 2AJ2A 3AQOA 2YPZA 2VKRA 3ZSXA 1DZ5A 2ZGYA 1IN0A 2KH9A 4JV5J 3KWGA 4DTNA 3ZTOA 3FKBA 1GXUA 4DTXA 2DVIA 4DX5A 2LCWA 1FF2A 4FS2A 4FJXA 2FTRA 2DCUB 2BBEA 3PX4A 1RAOA 3MCOA 4NL5A 1G7CB 2HQ3A 2VFUA 2I6WA 4JKDA 2OSQA 3KLHB 4PPZA 1NH8A 2W4DA 1TL4A 2RRAA 1S6UA 4GKKF 2MZQA 4LBHA 2QKKA 4ECYA 2Q2RA 3N6LA 5IC6B 3KJVA 4K4YA 4FO0A 4DMNA 2FSJA 4C8NA 2E1CA 2W40A 1VJQA 2HHTA 1NGHA 4HYKA 5BJRA 2OPRA 2J9CA 4LF7F 4Z7YA 3T1HJ 2J6TA 1EXQA 4JI5J 2LQBA 3E2EA 4LRAA 2K1RB 4K42A 4CWBA 2P2CB 5HMWA 5JVHL 4B1ZA 5BR8J 4A8WA 2Y0SD 3VPZA 4C8MA 5FLXU 5LMUK 2NREA 2CNNB 5GAHP 4B1WB 2D1KA 3AO3A 1FFGB 3LAKA 4CH7A 4QR2A 4FJLA 1SJRA 4B08A 3M1FA 1Q8BA 4ANCA 4ED7A 4UUXA 4K4ZA 2ASPA 3H90A 4CP5A 4O44B 2J0SD 3D1OA 3V2UC 3SQOP 3THVA 3QNNA 2XY8A 4OHWA 1IKYA 4DSKA 1HBUB 4KY3A 4HDGA 1CJTA 3HSGA 4EU0A 2AIRB 5F9NA 1NB2A 4OJ3A 4FXDA 3RW7A 2FBXA 4CJWA 1TK0A 2NXJA 1T44A 4AQYK 4JI3J 2RE2A 3VEWA 3RMCA 3ISZA 3QAEA 3E1YA 4O8UA 2LDIA 1CG2A 5C15A 1OH8A 4WPAA 1XTZA 2DR5A 4GKKK 2X6NA 3BBFA 1PJ6A 4ED5A 3CIMA 1XR7A 2JWKA 2UUCK 1T94A 4DSLA 3BV8A 4LQ9A 4FP9A 1M90T 1VQKS 4EZ6A 4J5OA 1WORA 3A3NB 3JAMY 3PW7A 2ASOA 5EX0A 4GKJF 4WFNL 3PEJA 4LRCA 4LF7K 1SV5A 4IO8A 3FJ2A 4CLTA 3J80O 3I5CA 1VQKN 5CAAA 1P90A 1JLQA 5LMNJ 2V9WA 1U26A 2LQ8A 3AAQA 4YOVA 4U7BA 2B6AA 4NI2B 2XMAA 1VJWA 2VPXB 4CGFA 3OVBA 1RHRB 4F0MA 4HACB 3A8YA 3VETA 4JLHA 2RF2B 2QWLA 2C2NA 1HNIB 4IUFA 5HLFA 1FDDA 4LR7A 2ZE2B 4I2PA 4Z94A 2Y8WA 4F36A 4TU8A 4C3MA 2HFOA 2MKJA 2C22A 2AYGA 2U1AA 1R59O 3US5A 4WYWA 3EPGA 2NR0A 2G1HA 4GVMA 4E7KA 4FS1A 2K7KA 1T6DA 1RWMB 4CEDA 3CJ9A 2Y0BB 1Q81T 4BC7A 2I5JB 1IKXA 3UB5A 3VQDA 4AHRA 2M9KA 4LFBF 4M94A 1R8CA 4DHYA 2V5HG 3ETOA 2ASDA 4MIAA 4AF1A 1I94K 3OQ2A 3QGHA 2ZBIA 5KG3A 2PEHA 3B78A 2DGVA 1R0AA 3AA9A 4BG8A 2Q3SA 2V2QA 1KFDA 4FVUA 5BPNA 2B4JA 4H0TB 4LY7A 3LZJA 4UF4A 2ZBCA 3L09A 2QJ3A 1F21A 2CZ9A 4OZJA 3G86A 5E3QA 5C2GA 1VBXA 4EYIB 1R3NA 3ULEB 2QFJA 3L2VA 4BRKA 3ISND 1FI4A 2BKPA 3R97A 3GFHA 3ET6A 1HMVA 3LP1A 1TMJA 5EGYA 3HPOA 1R6YA 3D6TB 4DS4A 4KGZB 1UA0A 1NGEA 2ASMA 1SL2A 3V4IB 3MMAA 5JVHQ 2P9PA 2HIQA 4ZDNA 3QERA 3M8YA 4ECXA 4P75A 4LFAF 1ZA1B 2EW9A 4QYZJ 3O3HA 1OPIA 1FK9B 2DHGA 5I4MA 3TVZA 3M8SA 4BY9C 1ZM4A 5TKYA 4PWWA 1B0PA 1TAQA 3DOLA 4AHVA 2HGLA 4KGVB 3WT0A 2EK1A 3DXBA 2DNMA 4ZVFA 1QVFR 3TNVA 4ZPWR 3C15B 1RTIA 4J2DA 5FPNA 2GQ2A 4LFBK 4ATNA 3MM9A 5D0HA 3G8TA 3VZHA 5F0XA 1OVYA 3K89A 2BJ9A 3WBZA 5GAGP 5HI7A 3R6LB 1MSWD 4Y0FA 4ZP7A 3KXDA 4M63A 5GAEP 1P1TA 1ZM3A 3GBTA 4ZP8A 3SNNA 2ZNZA 2MZTA 5AQOA 2C3UA 2MJNA 4CEFA 2DXEA 4N7TA 1WG5A 3KG4A 2HVHA 1E4FT 3OTEA 4IO1A 3EX7B 3DLEB 4XPEA 1UOCA 4KHNA 2P9IA 3Q8VA 4L6V3 4U6PA 2BANA 3G0ZA 4B17A 1Q9YA 2HWHA 4ZITA 1TV6B 4IDHA 4WFBL 4NCGA 4Z4FA 3IS9B 1HL6A 4FF4A 3GIRA 3HHNB 1LK7A 1DLOB 3T69A 3CCQS 4IOBA 3O1WA 1UZDA 3THTA 4ILMA 4DR6K 3VF6A 5KG5A 3SJJA 4DFJA 3KK2A 4DS5A 4AXIA 4HI2A 3CCQN 1EIYB 1KHVA 1YX2A 2MMYA 1BL3A 1TYQB 5DQHA 4OLOA 2GAHC 1U8WA 1FWLA 4OZLA 3WIUA 4QS7A 4RUBA 2LVWA 1VR6A 2VC0A 3J7YU 1IR2A 2DPIA 4UY85 4URQU 5EHHA 1JLFB 4Y6IA 3M6WA 4NLYA 4QWCA 2Q6CA 2O8BB 2O4GA 3LM2A 4X2BA 4FLUA 3AJ2A 1S6OA 1T11A 2E1RA 4FJKA 4M3YA 5J1EB 2PO4A 5CQGA 2X51A 5T7LA 2KW4A 2ZH2A 1IR0A 1AZSA 3QWUA 4BRPA 1RACB 2U2FA 3M2RA 2E7XA 2VGNA 5C12A 3GFXA 2YXLA 1TL1B 4KBIA 4OYMA 3Q8SB 1XI1A 3CCJS 2M0GB 2PE8A 4CLYA 3CCVS 3VQEA 1VK8A 4DV0F 1B3TA 4DUYF 4Z7CA 3KJNB 1U1MA 3CJSA 2ACYA 1NNDA 3CCJN 3CCRS 3CCVN 2VBZA 3WXKA 2ZOGA 1YJWN 3CD0A 3AOBA 1X4BA 3BH7B 3U1NA 3VAKA 1X9MA 3IN5A 3T6BA 3W7BA 4DV5J 2KU7A 4Y3CA 2GV9A 2M2BA 4RBUA 2R7QA 3AD7C 3CCRN 2GV1A 2EPIA 4RZRA 5JLHA 3NAIA 3TZWA 5HJYA 1NK5A 4C8OA 4KJIA 4CIGA 1S79A 4LF8F 4I9LA 3QGIA 3MM6A 2GO9A 2YHBA 4OYXA 5KT7A 2DTJA 1ZETA 2GO8A 1WF0A 4W5QA 3RBXA 1XUPO 3MXIA 3ZYYX 5H1SV 2AJ0A 5C0YA 1NZ8A 3PNIA 5AFUH 1S3XA 2XZDB 4J91A 3RSEB 1A5XA 1OPZA 2NNWA 5ADXH 2JVRA 1RT3A 1IM4A 2VGMA 2RHKA 3GSIA 3T9NA 1IBLF 2HBKA 3TJ8A 1RKIA 3FCHA 5AQGA 5BREA 3CB4A 2RE1A 3TAPA 4TSXA 3UPFA 4D3HA 2VC1A 3DLLL 2VFVA 2ZM6K 2FSNA 4DZDA 4QR1A 3HSZA 2GX8A 3BKFA 1VQ9S 2DH8A 2YNGA 4OIXA 4JI0F 3I0RB 4X65F 5KFRA 4DOZA 5HL7L 2JWNA 1N33F 1NGBA 4DV0K 3HF5A 3HRGA 1QAXA 1BQMA 3QZ8A 4DU8A 5B0FA 4DUYK 1KKHA 1QD1A 1VQ9N 1NPPA 2W4PA 4WE1B 1YJUA 5EWGA 4PKDB 5ELZA 2DNQA 3LALA 2WSFC 1HHTP 1IXKA 5FPEA 1KAYA 1SH2A 5B0CA 3I96A 1Q0NA 5U47A 1U1OA 5J2PB 1BU6O 4J37A 3FC9A 4AHSA 3NVMA 4LF8K 3AB4B 3HULA 4DQQA 3M1VA 4A5AA 5KG0A 1YTUA 3CD6S 3DM2B 1GXTA 2CQ0A 1O8BA 1Q86T 1NGIA 3E01B 3C8YA 4I7FA 1YXQA 5LM7E 4LQ3A 4CK1A 3H4BA 5BRDA 3M8QA 2QGFB 2GCFA 3UFCX 3CD6N 1VSLA 4A2AA 3HHDA 4GY2B 2PYLA 2N7YA 5GAHU 2CPZA 5L8RC 3KIOA 1WOQA 3LPYA 5CHIA 3ONQA 4B9QA 4U8VA 3P83D 1IBLK 5B08A 4MAKA 2LXFA 2HFVA 1ZBFA 1S6QB 2JH3A 3OBYA 4BRDA 3HI9A 4LBIA 3T6JA 3WNFA 2I0XA 3FUYA 1C0UB 3TZXA 3RBEA 2DGUA 5KFCA 4RWWA 1ATSA 5KFIA 3PLAA 4PG8A 3RB6A 2ZEJA 4A61A 2P5VA 4ZHRB 1RNHA 2KT2A 3ENHA 2ITMA 4TN2A 3HCXA 2AJ1A 5AJ3J 1Z25A 4YB6A 4QIVA 4ZPAA 4JK7A 4WF9Q 3NAEA 3B4DA 4PQAA 4YR2A 1RFQA 4LF4J 3HZEA 4H54A 3C19A 2CPDA 2FJBB 3NGSA 2OTLS 4FW1A 2LKZA 2PDAA 2B9YA 1G1XA 1TL7A 3H5YA 2F9TA 2GQQA 5ITHA 3GP9A 3MMBB 3SDEA 2OUGA 4YEAA 3CUNA 5FD1A 5ETTA 3W65A 1SQGA 5DETA 2QMWA 1WSFA 2YHWA 2CJYB 3THWB 2IJRA 1LWFB 1BUXA 3P5BP 4R8UA 1IBMF 2F9JA 2XHCA 1XNRK 3C0BA 2AJ4A 4DV6J 4C97A 3TWHA 3AH6A 1J54A 3CF5Q 3O3LA 1NJYA 2O8EB 5IV3A 3F9MA 1EZZB 5HRPA 1VYAA 3D5MA 1RP5A 3A8KA 4CF9A 3D0GE 4ZJQA 3V6KA 2LQ9A 4F25A 3MX5A 3R2CJ 4RW7A 3OHAA 1WDDA 4EP5A 1JKHA 4LF5K 4U95A 4ECTA 5IT0A 1R31A 3ZX2A 1QM9A 1ZM2A 3G96A 4CERA 4YMEA 5ETQA 3IBCB 1DFDA 3K17A 3F9KA 2EKNA 4YHHJ 3UR0A 2DXDA 2HNZA 2HS3A 2YH0A 5CHCB 1BWEA 3RG6A 1WJ9A 3CULA 4JKCA 3QZ7A 1QQOA 2G0IA 3J7YI 4ZTJA 2YPYA 2V2ZA 2K06A 1K73T 4DR5F 1RXOB 2C1EB 3F0NA 2YKNA 2CIMA 2FQQB 3MFHA 3MDQA 3GJQB 1T9WA 2XS2A 4TVAB 2P9UB 4K50A 4BHQA 4R5PA 2XM3A 3CPWR 3SFUA 3CHWA 3G8SA 4B9MA 4I6MA 1RK8A 3RR7A 1QAIA 2YWGA 4B3TJ 3L2UA 3ZTRA 1AW0A 2D3ZA 3UN3A 5L46A 4M41A 2AW0A 3P8BB 4BR4A 3QO9B 1Q5YA 3FRYA 4FM0A 2VQEF 2OHDA 3MN7A 4IYQA 7FDRA 1TVRA 3K5NA 2V4JB 1LWCA 4HCCA 2R2UA 1JCEA 2IC3A 2KXNB 5I3UA 1SJ3P 2HHUA 1NK6A 1XHXA 1T9YA 3R2DJ 2MQQA 3ENWA 2E5LJ 3LF0A 5KG1A 2O01C 1HWKA 2QWMA 3MAAB 1RDDA 1N34J 4LH4A 3SCLE 1PG5B 2BR0A 1VSHA 3ENQA 5CCLA 1U4BA 3IMXA 3OHRA 2QMUB 2ALYB 2NXCA 4KHMA 2MKCA 2VPZB 4DV7J 2UXCF 2VYPA 3ILJA 2B4PA 1RZMA 2YX7A 2JFDA 4OX8A 4H0YB 3VEOA 3V81A 2LDYA 1S0MA 4DR1F 1X9WA 1OO0B 2ZD1A 5HMXA 3G71S 2BJ1A 1YT3A 4B3SJ 2V7YA 2WZ1A 3UN5A 4M3UA 4CJVA 1Q16B 4DPYA 3TX0A 4DR5K 4KI4A 1VK3A 3SXLA 5GAEU 4HUEA 4Z4EA 2UZAA 2VU5A 1T03A 3ULHA 2YKAA 3H20A 1FTCA 4MJKA 4GV3A 2FLPA 2GELA 4ED4A 4H03B 2ZH3A 3KLIA 1S1XB 4EFHA 4BWMA 1WOSA 2YNFB 3W3SA 2KFNA 1SXLA 4TKTA 3G6ES 1JXLA 4C3KA 1ZH5A 2M5YA 3FK4A 2CQ4A 1S9GB 3CD5A 1JLBB 3TQ1A 2GA7A 1DEJA 1QQMA 2Z57B 3JSBA 2XWXA 4YORA 5KFBA 4ZVHA 3G6EN 1VSFA 2HS4A 3ZETA 4GVLA 3RMBA 3O3GA 1S72S 3H1VX 4ZN1A 3VQBA 4G1QA 1YZ7A 3PV8A 4C8KA 2UUBJ 1LOTB 7FD1A 4CNYA 3PZPA 1QVGR 2Q6BA 4USWA 1LW2A 4H0XB 5MLCQ 2C3YA 1S72N 2ZH4A 3DLHA 4CTAA 1VK0A 2J7WA 2IM1A 3WDOA 2UXCK 4DPUA 3VAGA 4KHPF 3PX6A 2W9CA 4Y2KA 3CDBA 4K4SA 1S49A 2DFFA 3MEEA 2DPJA 3KLGA 4FJ5A 3JQKA 2FLOA 5LSLA 4CI0B 3J81U 1U6FA 2R7YA 2FZGB 4Z4CA 5GAHI 4RG8A 3E8OA 1HIYA 4ZLNA 3NNAA 1HBOB 2ZHBA 4W98A 5D4NA 3PIOL 4DV3F 2KI2A 5A2QU 3DRRA 1KLMB 2ZNYA 1TKTA 3LP0B 2JC0A 4WXOA 1S48A 1WC3A 1WF1A 3CIPA 4ELUA 2BW7A 2Z8QA 2WBNA 1RT7A 5ETOA 1F5AA 4DQSA 1FCAA 1UJ5A 5F3ZA 4RU2A 4PG5A 3O6WA 4UOFA 4DCJB 1HWLA 3W2VA 3BGRA 3VR1A 1HNXJ 1WC5A 3C2PA 3MUVP 1RLDA 4DB3A 2L9DA 2KTQA 2HMIB 2H54B 3CVKA 1RBTA 4A8MP 3CPEA 2ZH1A 2VWJA 1N5YB 4DTUA 3GIJA 3WXLA 3AB2B 5DJBA 3HMJG 3V4MA 1EWQA 2HRUA 2GX9A 3BN7A 1LOUA 1ZBUA 3ALYA 2RS8A 3ZSWA 2ASYA 2G1DA 2J0XA 4TY8A 2AF6A 1FDAA 2HNDB 1PC5A 4LF9J 3OL6A 4DFMA 5KFLA 1YLXA 2RIJA 5L1KA 2CPFA 5AQMA 3MUTP 2Z4PA 2XB2D 1HNVB 1Z26A 2QA4S 1VRUB 3BSAA 1WG1A 5EWFA 2QL7B 2N3LA 1V6HA 4LF6J 3MI7X 4DL3A 3P5TL 2D0CA 4ECSA 3O4QA 4OQJA 3FZHA 2QA4N 2DNGA 2H48B 3DOMA 4H8KA 2XMUA 5L1IA 4M5DB 2UU9F 3GOIA 1KEKA 1Q7YT 3O5TB 2PY5A 5MLCV 2HBQB 5F1XA 4YOUA 3GDQA 4WIIA 2ATLA 4CGDA 1XHZA 4JYAJ 3B82A 2HLUA 3R7SB 1K1SA 3IGNA 2JC1A 5E0OA 3BO3A 3SBGA 3NWRA 2WAQD 3D1HA 1BGXT 4RW6A 2ZKTA 3TA1A 3CFOA 5HJXA 4CGIA 4IR9A 5IT9Y 3CO0P 4JI1K 3VQPA 2XLIA 3KLHA 3Q2TC 3A1YG 2ROPA 4AL5A 4JI2J 2KZZA 2V34A 4P74A 4QCLA 4F4XA 4RW4B 2WSCC 5DZ6A 3P96A 3RTVA 4EYHB 1Q82O 1ESVA 5L1LA 3L7UA 1ICEB 1D09B 3AD9C 1VDHA 2CQCA 4USJC 3LPUA 1RAFB 4TYBA 4W5NA 1ZBLA 3CJTA 3DLRA 3G82B 3MM8B 3GJTB 3OD2A 2FHJA 2XNQA 4TQSA 4ED3A 5H9EK 4CZCA 4FM2A 2KJWA 1RDAA 1U1LA 2D41A 1VLYA 2GGPB 4NCBA 1C1BB 4HTJA 3SV3A 1FFSB 3M8ZA 2IVMA 1TKXA 3F2KA 1X4CA 4CBUA 3UKRB 2G2YA 1ZBHA 3HSTB 3QRPA 2EC2A 4IKFA 3CJ3A 4LREA 3PIOQ 3I8DA 3KG0A 2FBTA 3KG1A 5DM7Q 1FD2A 1W9HA 4FWQA 2F8EX 4Y2IA 4E3SA 2VPWB 4O44A 2FHMA 1HA1A 5BYRA 2HNYA 1YJ9S 1OIAA 3V1OA 2M52A 2JLGA 2BE7D 2YNIB 1NJIT 2G8IA 2YKOA 2YX1A 4CJ7A 4ED8A 2UXBJ 1AUSL 4OLPA 3A5LC 1YJ9N 3P3DA 3KKFA 3IMQJ 3BB5A 5F0WA 5CXTA 2MZSA 4OX9J 5GAEI 2F8HA 1NMEB 2ZWHA 4ZVPB 2D5RA 2EBGA 3BYPA 4JRQA 3D6MB 2DGQA 1K44A 3D2EB 1K1QA 3T1YF 3OYHA 4IFYB 3VVUA 2GQCA 5THWA 5J2NA 4QAGA 2DBBA 3A13A 2O5DA 2QO3A 2VG6B 3E9PA 4C9DA 1KC8O 4BE0A 1YRUA 3L95X 4X4TA 3FMBA 2WVDA 3Q23A 2XMWA 3H8YA 3VAFA 1JJ2M 1HR0J 1YHQS 3BO2A 1VHIA 2ZE2A 1QSYA 2A41A 2GMLA 1BOTO 1IBKF 3CJCA 4B9UA 3MEGB 5ETSA 3MR2A 5KG6A 3X3UA 4X66F 1SS6A 4WZQA 4ED0A 1PC4A 1ASUA 2CJQA 1YJTA 5CR4A 4NLVA 2HHPA 2F8MA 4YB1P 2IDOA 2CXEA 1MDUB 3TZYA 2CPHA 1UA1A 4LVNP 2B8QA 1CBKA 4O0NA 2I5JA 2YI1A 1RUSA 3PYDA 4DLGA 1VRTB 3NBPA 4C8LA 4RW9B 2VG7B 1IWGA 3SUNA 3PO4A 3MGJA 2E1PA 3QYYA 4PAAA 3E51A 3IKMA 1D1UA 4PEOA 4PQUB 1DY3A 2P9GA 4R79A 3GIKA 4UY8T 3FSYA 2ZOFA 4CM0A 2P9CA 1KP6A 2QSFA 1WAJA 3HPGA 4X4RA 4NLSA 2RU3A 1OSDA 5EX3A 2CG8A 2ZGZA 2MSSA 2LECA 3PDNA 2E9RX 2MQPA 2A1BA 1RHMB 4EEYA 4JRPA 4YB7A 1TL3A 3ULEA 2CG4A 3FBFA 2X74A 3AO2A 2F4VF 3J7ZO 4RCHA 2XO7A 1CPZA 4PKIA 1RTJB 4F7VA 2CWKA 5K8PA 2D7SA 1WLJA 3DJCA 3DMJA 3HVWA 1REVB 5KFSA 4ZPDA 3KMSA 1T7PA 1NDLA 3I31A 3PYEA 4CD1A 5HK4A 4ILHA 3UCUP 4MK7A 3V4IA 3NGUA 4DCHA 2PMZD 2BJ7A 3BYRA 2ZZMA 3LANA 3HP9A 1LXNA 4Q43A 4QU7A 4CZGA 4B3MK 3ZT4A 5GMEA 1KTQA 3KKRA 3E66A 3EL2A 5BN8A 4CCHA 4X66K 4X4OA 3LO3A 3KLFB 2FYXA 2WB1D 4AE5A 2AWZA 3X1LB 2XTJP 3JQJA 3R6MA 5KRSA 3BSCA 1OH5A 3HHEA 1HJRA 1FJCA 2FJVA 5F9LA 1KQFB 3PYGA 2ZITA 3C15A 2E29A 2BEFA 4NLOA 4BC3A 5CA5A 5CYQB 4RWXA 2VUGA 4CLUA 2UVUA 2BZ2A 5C7PA 2QWOA 1DTTB 4M5HA 4R0EA 1P8GA 3MTKA 2XSFA 1BIUA 3UD4P 1BCMA 3ZLJA 2UP1A 2FXUA 1GMWA 1ZA2B 1FNMA 4JI8K 1C0MA 1YBAA 2GVDB 3CCTA 1UEVA 2QWNA 5AQNA 2A0FB 3O9QA 3W5ZA 2L9WA 3MUMP 2F4VK 4BRQA 3DLEA 5J1PA 2ZF5O 5B7WA 3D7SB 2BV3A 5C25A 1VSJA 1FRMA 5IC4B 1RBOB 3QSIA 2A3JA 4M5GA 3IS9A 3HZGA 4UZCA 5MAOA 1BY9A 3HP6A 3JYTB 3ZC4A 2XBPA 2HHHF 3C6AA 5LMUJ 4J9LA 3T19A 2DTUA 4A48A 3EVWA 3C6TA 1VSIA 1TYQA 4DDFA 2BGGA 4QWDA 2IRUA 1IO2A 1FT8A 2MPUA 1NSKL 1JLFA 2O8BA 1T95A 1SH0A 1U6ZA 2JHEA 1J53A 4KB0A 5GINA 4AM6A 3BP8A 1NGCA 3J81Y 1YI2S 2EFOA 4UOCA 3MPDA 4HTUA 3QRRA 4AQYJ 3T5LA 1BQXA 3EZOA 5HVFA 1YI2N 3GONA 2IPOB 5A2QY 1TL1A 1N8RT 2HZCA 2QTWA 1BD6A 2DIUA 2RDDA 3H6EA 3PKMA 4M8LA 4GKKJ 4MH8A 5KFMA 1U1NA 5KFWA 4F4YA 2UUCJ 2I7NA 2FGOA 4DV1F 4RJVA 1KQSR 4IH7A 4K8ZA 1P1LA 4HHHA 2PZSA 4M5IA 4YY3K 5KPRA 5BXIA 4LF7J 3VGVA 1DURA 4PXDA 3N4WA 1C4CA 1UP1A 4DV4K 3OW2R 3U1LA 4BR5A 3H25A 1IKYB 1YDLA 1CJTB 3ENAA 2NRRA 1X60A 5CYMA 2AHOB 2WB4A 4EBEA 2OFGX 1RDUA 3GFYA 3RSEA 2AGOA 2YWWA 3EE8A 1CULA 4E0DA 2O8FB 1A7GE 2K3KA 4FK0A 3WQPA 3HTVA 1M90O 2IYIA 4Y0WA 2AX0A 2MY8A 2HSTA 2VASA 3AA3A 3FZFA 3I6PA 4ED6A 4J9RA 1X1PA 1TK5A 4YR3A 3C65A 4M1KA 4XDDA 1WACA 4FNIA 4K7QA 1YKWA 1I94J 4ZK7M 1SC3B 4FZVA 4M3XA 3OV7A 3OYMA 1JJHA 1SV5B 2E6MA 5L9NA 3I0RA 1TQLA 2ZJPL 5E7OB 1IBCB 5AQVA 2OFHX 2ZZTA 4TY9A 1SIZA 5AQYA 4A5BA 3CERA 3IWNC 4BWJA 3M9OB 2EG2A 3LGMA 4WE1A 1RLCL 4RNFA 2WHOA 2J9EA 3TJAA 2DKOB 4PG7A 2EG1A 3CSKA 4EZ9A 1HNZK 1WOPA 3WNGA 4HR2A 3AD8C 1NSPA 1Q81O 5J2PA 2MKYA 1WHXA 5D15A 4WKRA 1LFWA 2QL5B 4YOYA 5JS2A 2ZBRA 3K5PA 2H5EA 3KNGA 2MSTA 1IKXB 2YH1A 4FPIA 2MKSA 4PA1A 2YY3A 3ZZZA 4QPTA 2HLTA 1R7IA 1X3MA 1DKGD 1R0AB 3RU0A 1MMNA 2A18A 4HHJA 1ZPVA 4BE1A 2VV5A 1I3AA 2FVCA 3ID8A 1UW4A 1UVJA 4N8OA 1N5QA 1S6QA 2X6SA 3QEIA 4OLBA 3NL0A 4AYBD 1HBMA 3J80Y 3CJ8A 1WAFA 4FK4A 2GVZB 3OTOF 1WC0A 4LFBJ 3DDIA 3DU5A 4IO9L 2YTCA 1LV5A 3ATUA 5B8HA 1TKZB 3OFGA 4OVLA 1K9MT 3J7A1 4L76A 5DQIA 2RB7A 5AXLA 2X1AA 3CFRA 3VHQA 2FBVA 4J2EA 3LP1B 4J9VA 1OMSA 1S59A 4DL2A 4WP8A 4NLDA 3P5JA 4DPWA 3U1MA 4KB1A 3OW2M 4IQXA 1Q8IA 1ZTTA 2JLEA 4Y00A 4FJIA 2V6AA 1PCAA 3U3YA 1F6TA 4U8YA 3P49B 3QINA 1QY7A 1ZC6A 4Q8FA 2FC8A 2P5OA 2KHDA 3NF8A 3ZSRA 3HVAA 3FEXB 3MMBA 2X78A 2CVEA 2XMTA 1J5EK 3UWTA 4CZEA 4LRFA 4DR6J 4AILC 3THWA 4U67L 3MM9B 3AVJA 2DRBA 4DN9A 5KFUA 5KT6A 2D4WA 3WXMB 4E7LA 3QB0A 2O8EA 2N82B 2GFFA 2M4MA 4YUDA 3HT3A 2W2MP 3FGUA 3LGHA 3RJMB 1A5VA 4DR3F 3MFIA 3J8AA 2E1AA 5IFMA 3TSPA 4CHPA 4ISEA 1TL5A 2FY1A 3NGYA 2JEIA 4O0JA 2QA2A 3OFHA 2PFDA 2OZMA 3OTOK 2AYMA 2QTDA 1GT8A 2GIRA 3BDPA 1J9AA 3OYJA 3OFFA 3OL9A 1B0VA 4AD6A 3EGVA 4TLQA 2YX4A 3BF1A 4WQ5C 3SSRA 3N01A 2P9IB 2DH9A 4L73A 2BQUA 2G0JA 5HN0A 3C6HA 1K8AT 4FOEA 4WXWA 1WI6A 1Q18A 3QFWA 3O80A 4X4QA 2EHGA 2E1YA 1NZAA 1X0FA 1EO1A 3GJSB 3QJLA 1NXIA 1N36F 2JZ5A 2HZVA 4F3OA 4CJTA 2VB6A 4B9LA 3SMPA 2VCPA 4OX6A 2CQIA 1KOOA 3KK7A 3QATA 1KN6A 2P9UA 4FL9A 1KCFA 4DCOB 3NP5A 4CIEA 1XEZA 3JS6A 1Q95G 2MKHA 4ZIVA 1RT5A 4C8ZA 2VD3A 2JGUA 1HNWF 4O3NA 3O1BA 3UNGC 2LA4A 1JLEA 4ANDA 1MU2B 3AY0A 4K43A 1PYOB 4CEZA 1WNEA 3WXIA 1RT2A 3EVOA 3Q7CA 4N8NA 1NB7A 4J9UE 2YJEA 8AT1B 3JSMB 3CXCR 1U45A 4RNNA 1TKDA 5AQPA 1KDNA 3DWLA 3JTNA 3AVKA 3FZLA 3NGDA 1E3MA 1P9YA 2KYXA 2I1RA 4L72B 3DGVA 1M1HA 1MW7A 1NLVA 5AQFA 1JXBA 2CQ1A 2ZM6J 4CZMA 5DZ7A 1WWHA 2MLZA 3KVGA 4ZLJA 1AB8A 2RJZA 2VQFF 2P9SA 1Q4RA 2B9WA 2RNEA 2LP4A 2HK3A 1RDWX 5BN9A 2D1CA 3MM6B 2Z58B 4DV0J 1SZ2A 4LRBA 1X9SA 4V19X 2F65A 4DUYJ 1ZYQA 1M5SA 3R5BA 5AQZA 4KHRA 3H40A 2IVNA 3S3NA 3SCIE 3AO1A 1U09A 1S1XA 1YQHA 3A0IX 1LXJA 4M45A 1LWXA 1O1WA 3OR2A 4HT7A 1NMDA 4LD0A 5M2UA 3KDOA 3GG4A 3SQ4A 4LF8J 1FE0A 1SQKA 3DOKA 3EKUA 1QTMA 2R42A 1S9GA 1JLBA 4N56A 2IJNA 3TR5A 1IG8A 1TP7A 2P51A 1RWKB 3T3FA 4K4UA 1KWMA 2VL1A 5E3AA 3ZTSA 2Z30B 1M1GA 4R25A 2ATCB 4U67Q 5DS7A 2MHNA 5KFPA 5B0EA 1CJKA 2UXDK 2IVYA 1A5WA 3R8EA 4WTOB 2HQDA 3EE9A 3TVYA 3H5UA 3QFHA 3AVNA 5HRNA 2YNGB 3GYXB 2HFUA 2WW4A 4I2QB 2CWXA 4KH4A 4NLTA 1JCFA 3SV4A 2FJEB 1NG9A 1IBLJ 4QIEA 3KTQA 4E1NA 4GO5X 4NASA 1BQMB 2E4LA 4C7QA 4YOXA 4BRAA 3THXB 5KFTA 4QIGA 1U2VA 2XY7A 5EUHA 3OYAA 2BXJA 3GV7B 1TELA 1RWXB 2Z1HA 2IM0A 2C2KB 1JXEA 1F60B 4FWPA 1OYDA 1SL1A 2HQIA 4XAKA 3W2WB 2VBYA 2VQFK 2RH3A 3ZZ0A 4CFBA 3LDOA 1RWOB 3TAMA 1HBOA 1Q86O 1UVKA 3GB0A 5KFFA 3UW1A 3M1VB 3HPHA 1ITPA 3GLJA 3HDSA 1KLMA 2Z2ZA 2DNLA 3LP0A 4IZ9A 4P10A 4RPFA 1FW6A 2CJXB 4Q2LA 3I5BA 4USKA 2CYYA 3GIIA 3SZ2A 4DI6A 3TTDA 1KD1O 3P39A 2O1PA 2JNJA 4J90A 4FKYA 3HVRA 4IBNA 1N32F 1I51B 2Z56B 4ANEA 3CMAN 1YAGA 2KT3A 2Q1LA 2OEKA 3I56S 4USIA 4ECUA 3HHKA 4N41A 2FY8A 5LXYA 2QYCA 5HANA 1OY9A 2HMIA 4W4MA 2CPEA 5A8KB 1N54B 1CQNA 3I56N 1N5YA 3MD1A 1XNRJ 1VAZA 1IH7A 4IFEA 5DK5A 2COLA 1KQKA 5IWAF 4AL7A 2EWHA 3LDNA 1VRQC 1MA9B 1S1UA 2HBMA 1WSHA 1AYEA 3T1HF 1Q9XA 4JI5F 4FK2A 3HT0A 1S10A 3NDKA 1SJQA 4PKHA 4LF5J 2A5XA 4FJHA 1FXDA 1QHAA 1UFLA 4M3ZA 4NMLA 1N4LA 4KBOA 4C1NI 4MLHA 5AR0A 3U6FA 4OPHA 1HNVA 1EETA 3W60A 1G99A 1ZZNA 3IAS9 3I87A 2HZAA 3EDRB 2FSKA 2IGIA 4HH1A 2QLBB 4NLWA 3IR7B 3K5LA 4I67A 2ITGA 2Y9HA 1ZBTA 4FWSA 5F0UA 4E7HA 4FWRA 4NYPA 2DHHA 3SDEB 3PG9A 5KFNA 1UZHA 5DQGA 5HQMA 2OI2A 2QLXA 3NCPA 4Z4IA 4R8UB 2PGCA 1S1TB 3NGKA 2YV0X 1X4EA 2UYTA 2E1ZA 4QOZB 1PBAA 2K2PA 5D0GA 1N32K 1I1GA 3H1QA 2R7RA 1YG0A 4MYUA 3R5AA 2DEJA 2POKA 1T3NA 2QK9A 3THYA 1RAJA 2OZSA 1OKJA 2YQ1A 4RW7B 1XNQK 1TFYA 4OJGA 3DXKA 5FJ4A 4ECZA 2G8WA 3IA0A 1QZ6A 4DL7A 4J2BA 2W01A 3VGLA 3EY1A 1Q8LA 1KVCA 1SIWB 1H72C 5E2QA 2B4UA 2B56A 3GCXP 4TLRA 1UPMB 2HVIA 4B02A 4H5NA 4OPKA 1X4FA 5IWAK 4V19J 2CQBA 4K59A 4FJ8A 2Z2MA 1K73O 1SBRA 1XQSC 2OJ3A 1VQMS 4USTA 3T5KA 1RU2A 4DSIA 2P6SA 5LMNF 3NHGA 4DU7A 4X4PA 1KBRA 4C98A 3M32A 4RW8B 4OI1A 1VQMN 1XR5A 3MPWA 3PYFA 1WOOA 3EXYA 4O55A 2GGPA 2YKNB 4S0MA 4ZVGA 3SUPA 1C1BA 1XWLA 2IDEA 1UL3A 1R0CB 2BW2A 1UWBB 4R5PB 3AVIA 4WKYA 4IOCL 2W41A 2NYIA 3DXMA 2Q0RA 1HPMA 3AA8A 2IBOA 4JI6K 1KR4A 4M5JA 1N48A 1HFEL 3M8RA 4DR5J 2ZZNA 2F5GA 5IM0B 2YBVA 1LWCB 4IJNA 3HHLD 2Q66A 2IC3B 4CNZA 3L3VA 5L1JA 2RU9A 3ATVA 3EM1A 3H2UB 5E26A 3HFZB 3ZZRA 2EX3A 2I8EA 3O6QA 5F8MA 4W90B 2ACMA 1SUQA 2FGCA 2R7UA 2R7XA 3A8IA 2LXIA 5AQRA 3Q7BA 2YNIA 1KTVA 4HWIA 4OV6A 1LCUA 4N77A 2DNKA 3W1YC 4IFVB 5IZHA 3WUHA 4Q45A 1BA1A 3F44A 4EP4A 4V1Ak 1P6TA 4M42A 2Z1IA 5HROB 4ZIWA 5DLGA 2OPPA 3D2EA 2P5GA 2QA1A 3UO0A 3DKDA 3OFEA 1RDCA 4YDUC 3NVKA 3NF7A 1YBUA 3O2IA 5HVHA 2ZD1B 4IFYA 4OGCA 4QIWD 3QNOA 4LH5A 3ZO7A 1Y3JA 1XR6A 1RJJA 2XZWA 3MK6A 1JNZB 1NDKA 2UXCJ 1X3NA 5GVQA 3PRVA 3DHXA 4USUA 1QS4A 4O5FA 2DNOA 3HX9A 1WDTA 4CO1A 5I9EB 2JEGA 3HKZD 3GL1A 5D78A 2OCEA 4ZPVR 4CEQA 2LQJA 2RUGA 2AQ4A 3DNCA 2ZJRL 3VEXA 1FRHA 2KVQE 3O9UA 3NNCA 2R8IA 2V68A 3GILA 4C4WA 4P9SA 3EYZA 1KVBA 5KT5A 4XEIA 2DGWA 2GEMA 4M5MA 5KRTA 2V50A 4CLKA 2GBZA 1RT4B 2RILA 2CJKA 3D68A 4BC4A 4WP3A 4P73A 4RW9A 2VG7A 3OR1B 1H2TZ 2ROGA 1LW2B 4WCEQ 4J9SA 3HSJA 2QLWA 2GTDA 2P8IA 3CC7S 3QJPA 4NLRA 1R8AA 4JAXA 3TUZC 1Y7PA 2D0AA 4FJNA 5GADU 1GLJO 2H51B 2ZBPA 4E1JA 3AXKA 3CC7N 4J9MA 4O3OA 2QZ8A 3KLGB 4M7XA 3IRXA 5J2MB 1DQ9A 3PVXA 4DTRA 3M6XA 1QE1B 1GLEG 1S22A 3HZ6A 2MY7A 5JUMA 3SI8A 1RTJA 4CLPA 5H9FK 2CPJA 3RMDA 2OEMA 3DRRB 1REVA 5SZTA 1H7XA 1TKTB 1TUGB 3BGUA 5E3RA 4N76A 1T05B 2EVZA 1LFPA 4P6QA 4ED1A 4WTYA 4JKBA 4ZP6A 4FDFA 2LSNA 1RT7B 2HBYB 3VEZA 4Y1DA 2FF6A 3M9MB 3W2VB 3AVCA 1ELOA 3KLFA 1HWUA 2FVQA 3EJMA 2XMVA 4CO3A 3VQQA 4HVJA 4FLYA 1CJVA 3VERA 4MT1A 3Q8RB 2W8KA 5E5NA 2H3EB 3LPTA 4ECVA 1RA6A 4ECRA 2E9TA 4JS4A 1LKZA 2HGMA 2R8KA 4WYLA 1S5ZA 4RLEA 5LOQA 1ZXOA 5CYQA 1SAZA 2VDHA 4XO0A 1YZ6A 4OI4A 2UVVA 1OS5A 4EFAC 2G2OA 1LW0A 4CLZA 5LSOA 3PACA 4JKGA 2JWLA 3BS9A 4CBXA 3T5JA 4CJLA 4JI1J 1CLFA 1MWKA 2G9OA 4ZJLA 1JJCB 2GVDA 1GXLA 2RUSA 4OZNA 5BYSA 6FDRA 4DSEA 3OXGA 4JKFA 5JMNA 2QI2A 2WUSA 4GO7X 3R9PA 2Q0UA 3O4WA 4DV5F 5DM6Q 1JCGA 1BHLA 1Q7YO 3EO3A 2JJ4D 5LL6Z 5KT2A 4DU1A 3DYAB 1BCOA 1EJ7L 2ETJA 4Y2MA 2Y3YA 5H9EJ 3VGTA 4YP3A 5TKWA 5ETVA 2HFNA 4O3RA 2R2TA 1KVAA 3JYTA 1C4AA 3L0QA 3MXJA 3NGZA 1J6ZA 3OYEA 3QEPA 3W5XA 1VQPS 1YIJS 4FWNA 1U47A 1QQNA 4DL5A 2FC0A 3OJSA 4DR2F 2RT3A 1P27B 1ZAXA 4RW6B 1VQPN 3JB9k 3LGNA 1YIJN 3D0PA 2W42A 4FYYB 1S7HA 4KRWA 4JI4F 4X62K 4NZ7A 5F8IA 3MEKA 4NYOA 3QFPA 4KGMA 4KHYA 3BQ2A 4B3OA 2KRBA 4OYBA 1RHQB 2D74B 4CLLA 4O5BA 2JOQA 1L3TA 2FHOB 5B0BA 4QIFA 1WTBA 2DRAA 1CXUA 4K4XA 3TJ9A 2RHSB 3W9IA 2P1JA 4CW7B 4YOEA 3PM9A 1I5OB 4JKAA 4L74A 1QSLA 1CXQA 1AUDA 1RADB 4O0IA 4CEOA 1FKOB 4A8FA 1TKXB 2CDQA 4TNOA 1UVIA 1H2UX 3DAWA 1S0VA 1IJFB 4PZVA 5ETLA 1RBSA 3UE5A 5FLXO 2X7IA 4EI2A 1GLAG 1S99A 2ZDPA 1Y9OA 3H3NO 4OKEA 5EOYA 3P38A 3ZNUA 2AA4A 1RB0A 1RBVA 1DHMA 2NLWA 4CZFA 3D54A 3AAWB 1GMVA 2J4RA 4JKEA 3BJYA 1NJIO 2HNYB 3HBTA 1UFKA 2CFXA 3M8WA 3UVJB 3ZSVA 2C2EA 2J76E 4CFDA 2W9BA 4BR9A 3CQXA 4DR2K 1EAYC 4KC5A 3FDSA 1HYSA 4LMZA 4USVA 4B9TA 1IWAA 4I9QA 1MROB 1BG3A 3ZT1A 2O8FA 2CQ3A 3NF9A 4JI4K 2CQHA 1EKRA 4ELTA 1M1KT 3H2VE 1KAXA 4P2FA 2RQMA 2G4BA 2DFHA 1JL1A 2YHYA 4DR4F 4GVEA 3KUHA 1F1BB 2MZJA 2J6SA 3PJWA 3KHGA 4CZKA 4DFKA 2IM3A 1FERA 4MKYA 4DUZF 2DEIA 5JVGL 1FKPB 3TTFA 2GIQA 5J2NB 2DHXA 3GPAA 2CQ2A 5AJ3F 3EKSA 4O3QA 1ACMB 1NCLA 5LXRA 3ZT3A 2R2RA 1FNOA 3MWBA 4DPOA 4J9OA 3V1QA 4Q2MA 4LIWA 5K20B 2MQOA 3SCXA 4B8CA 3W8PA 3OYCA 3BREA 2BRKA 4RX6A 3T5HA 3CNQP 4ILRA 4Q5VA 3R6GB 4F2SA 2NPFA 4DU3A 5GADI 2W1BA 2FC9A 3BSOA 4DV6F 2KHCA 4ZCMA 3M6VA 1GX5A 3QIDA 3W63A 1GLCG 4OPAA 4XH5A 3OS1A 4GVBB 4CH1A 4FJJA 3NBPB 4B3MJ 4UY8O 2VH7A 2FF3B 1NK4A 3I5AA 4PWUA 3QEVA 2DHAA 4ERDA 2HHXA 4X66J 1N6QB