4O4GA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o4gA05
4Z4GA 1N5YA 3HM9A 4IG0A 3BGRA 2BRKA 4CHQA 3NL0A 4CHPA 4K4YA 1NJZA 1JLEA 3G6XA 3T5LA 4JS5A 1FK9B 3PY8A 1VSKA 4FS1A 4KTWA 1WAFA 4DSIA 4CJFA 4OPKA 2QK9A 1IM4A 3SQ1A 4B3OB 3QERA 1S1UB 1RDAA 4PWDA 3B6OA 5JXSA 2G8FA 4HCCA 4KV8B 4NLYA 2JEJA 3ZCMA 4TN2A 3OVNA 3SI6A 4ZP7A 2YKMB 2RKIA 4E19A 1RDBA 5J2QB 5F8HA 3M9OB 2OPQA 1RT2B 4CJSA 3C94A 5KFHA 2Y1JA 1KVCA 2IC3A 3TVKA 4CFBA 3V4IB 3VQ8A 2R2RA 2J6UA 4ED2A 4AHVA 4NCGA 1RYRA 4DFJA 1LAWA 1S10A 4FLXA 4KAZA 2F8EX 4FLUA 5HRNA 5KFOA 4B9MA 3CDEA 5C5JA 4M3XA 4RZRA 5DQIA 4IRDA 3MR5A 2E9TA 5FDLB 4JRPA 1HNIB 2I1RA 1UA0A 4RW8B 2PYJA 4FZYA 3LP2A 4CGDA 1TK0A 5J2PB 1FKPB 3NMAA 5KFXA 1KTQA 3EZ5A 3PO4A 1T94A 4CIFA 2A1RA 1L3UA 1IKVA 3GQCA 3QNOA 3KJVA 4NLSA 1RCHA 2UVUA 1X9MA 3RBEA 1JLBA 5KFGA 3KOAA 4J9OA 3ZSWA 3UR0A 2ZQBA 4I2PB 1YTAA 1S9GA 4TYBA 4X2BA 4DTPA 4B8CA 1HQEA 4IG3A 4NRUA 4K50A 4MKBA 3P5JA 1RBVA 4Q8FA 4DQQA 4URGA 4CESA 4EEYA 4DQIA 3HHKA 2B6AA 1RTHB 3KD5E 4IRKA 3DI6A 1HYSB 2PZSA 4F4ZA 4IFYA 4DG1B 3VQCA 1Y97A 1JL2A 3HPHA 3SCXA 2P5OA 4ECXA 5EUHA 3QEXA 3KLEA 4KRFA 2IA6A 4ZP8A 4Y1CA 3DRRB 2AGQA 3IG1A 4IH7A 2D41A 4RU9A 5JS2A 2BGGA 5CZ1A 4I9QA 3M8QB 3P83D 2WTFA 3QLHA 1SV5B 3MTKA 3HL8A 1ITGA 3BQ1A 1ZTWA 3QZ8A 3K58A 4HTUA 4MFBB 4MH8A 2ASJA 4KHNA 4YNQA 1EETA 4HKQA 2OPPB 2DPJA 4U6PA 3ZT2A 1TL3B 4CJWA 4O4RA 2HW3A 3HVRA 1GOCA 4QAGA 2CKWA 3ZSOA 3CM5A 3MEDA 2C28A 4EYHB 4F4XA 4IDKB 4ECVA 1RT1B 2KZMA 3CWJA 1D9DA 3QNNA 1C2PA 3AVAA 3WNGA 4EBDA 4R5PA 3OL8A 1GOBA 3H4BA 4OVLA 3TAPA 5CYQA 5KFPA 4AHTA 4N76A 2VWJA 3DLKA 5KFCA 4WFZA 1TKXB 3OL9A 4ZVEA 2ILYA 4R8UB 1N6QB 4KHYA 4CGIA 4KHSA 3O4QA 2X74A 5HRRA 4GC6A 1QTMA 1L3VA 5KFZA 2FBXA 1ASUA 3M8PA 4KHMA 3TABA 1SH2A 5HROA 4M94A 1Z25A 2QE5A 2UVRA 2DFEA 3A2FA 3V6DA 4NLQA 2GC8A 3VQ9A 1F21A 4B9SA 4KB0A 4K8XA 4YR2A 3B6PA 3CFOA 1S5JA 3G10A 3NH2A 3LP0B 3FQKA 1BCOA 1WSEA 2RPIA 2XY7A 2O4GA 3GV7B 4OLAA 1B9FA 3BQ2A 1RT3B 4J2BA 3UDLA 3CJ5A 4B8AB 5DK5A 2IJFA 3PX4A 4CEEA 3NCIA 4H4MA 3OYJA 4CEZA 3P1GA 5HBMA 3UPFA 4DFKA 3EY1A 2D0AA 2GIQA 4ECUA 3NGYA 3BREA 4KTZA 1RDRA 4J2AA 4J9KA 3SV4A 4EO6A 3H98A 4N41A 4O3PA 4RW6A 4CGFA 1RT7B 4CEAA 3FFIA 3HK2A 2AQ4A 4DTRA 3MR3A 2XCPA 3AO5A 3PW4A 4CJTA 4ZPBA 3IGVA 1RBRA 1J54A 4KTQA 4LD0A 3Q8RB 4RW4A 1S6QB 1VRTB 2E4LA 4CF9A 3ZSXA 1JLFA 4M3WA 5I42B 4DLGA 2IAJB 3QIDA 1IH7A 1ZYQA 2KFZA 1K6YA 1TKZA 2ASLA 3D28A 2LSNA 1TKDA 3QINA 5KFSA 1B92A 4PQUB 2HAIA 3LP3A 4PUOA 2P1JA 2HHXA 3LWMA 3ITHB 4YFUA 2UUWA 3HPOA 4KFBB 4RW9A 2HVHA 3MEGB 1UA1A 3VA3A 3OLAA 3OS2A 4ICLB 1BQMA 1HMVA 2R2TA 1OS5A 3DOKB 2WOMA 1WSHA 1SH3A 4XPCA 1DLOB 2RF2A 4ZPCA 2IM1A 3DLGB 4LSNB 4NLRA 3VQEA 1WLJA 3DOLB 3AVKA 4Z4CA 3CG7A 4CHZA 4DF8A 4ED7A 1C0UB 3NAEA 1EKEA 5F9LA 1JXEA 5FROA 1W25A 2D3ZA 3H4DA 1TVRB 4ECZA 3E51A 1GX6A 1BIUA 4E3SA 2JLEA 3GIIA 5F8NA 4W5NA 4RG8A 4DS5A 1NKCA 2WK4A 3IAYA 1NK8A 1XHXA 3K5OA 3QIPB 1HPZA 3QESA 5KFLA 1LWCA 4KB7A 1BI4A 3OHAA 1KFDA 4TQRA 5C24B 4LQ9A 1U04A 2V9WA 2DFFA 4DTXA 4WXWA 2R8GA 3AA5X 4O4GB 3OL6A 1JLQB 1UWBB 3MECA 4KSEB 1K1QA 3SFGA 2A1SA 5F8MA 1J5OA 4E1NA 1S0OA 3AA3A 2ILZA 3LANA 3BSCA 4ZMMA 4E7LA 5FRMA 2ETJA 4NLVA 4O3QA 4I7FA 3RMCA 4O44B 3D0PA 1JLCA 4CK1A 1XC9A 1SH0A 5KG1A 4CEOA 3JSMA 1O1WA 1NK5A 4RNMA 3G0ZA 3NH1A 4J9MA 4ZVGA 1S1VB 2JGUA 3ZT3A 3HT3A 3AVMA 2WRMA 2FLPA 1HQUB 3MR2A 3O3GA 1QUVA 3KLGA 4MK9A 2W8LA 1C1AA 1KHWA 1JLAB 4OJRA 3ZT1A 1TKTB 3HVAA 3GILA 3H5YA 2V4QA 2OZSA 4OKJA 4TY8B 2VG5B 4EYIB 3CM6A 5KG6A 4G1QA 3AVFA 3LDSA 3AO1A 4KI4A 4J9QA 5DGAA 3U3YA 4FK2A 3E01B 3HVTA 3VQPA 2ZE2A 1HNVB 4M42A 2AGPA 3ZSYA 2JC1A 4AHRA 4IFVB 2Z1JA 2HMIB 4DTOA 1S1WA 3EYZA 1NHUA 3T1AA 4DQRA 4RW7A 4Z4HA 4ECYA 1BISA 3PUFA 3RB3A 2D3UA 1IKYA 1S1TB 1JL1A 3CFRA 1UOCA 3PW2A 3NHGA 4PY5A 3QO9B 5J1EA 4O3RA 4KBIA 2B43A 2W9CA 1LW2A 2FJVA 3CFPA 2BANB 3KMSA 5EWFA 2X6NA 1LW0B 2R2UA 2XY5A 4CK3A 5J2NB 3HJFA 1KFSA 4URSA 4FJHA 3ICLA 3C95A 1RDDA 3I0SB 2HWHA 3F73A 3KHGA 4DLEA 3PVXA 3OYMA 1MU2A 2ZD1B 2VWKA 3D5MA 3K5MA 1JLGB 5EWGA 3KLHB 2WONB 2IM2A 2AGOA 2OPRB 3HYFA 3V9ZA 2NUBA 3HSTB 3N6MA 1D1UA 5KFUA 3QGIA 5HP1B 2E9RX 1FXXA 3RMDA 3SJJA 2ATLA 2R8IA 5K14A 2W9BA 5L9XA 4GW6A 3C6UB 4LSLB 4MK8A 3KLVA 1U48A 3OSNA 3M8SA 5CYMB 1VRUB 3IRXB 3V81A 1R0AA 2IMWP 3MXIA 3WNFA 1T05B 2IS3A 2UVWA 1RTIA 3HPGA 3V1QA 1NJYA 5D3GA 4DSKA 1T03A 4FS2A 3DLEB 4ELTA 1TP7A 4QCLA 3RAXA 2DTUA 1NK4A 4O3OA 3GYNA 4K4VA 1RT4B 4XIUA 4KKOB 3IS9A 3KK2B 4CF2A 1CZBA 4ZHRB 2HNZB 4CIGA 1S9FA 4DL2A 3NE6A 3C6TB 4K4ZA 5HRPA 4O3NA 1IO2A 1NHVA 5EWEA 1C1BB 2I5JB 4DL3A 1RBUA 3SYZA 1LWEB 4WE1B 5I3UB 3SQ2A 1GX5A 1NK9A 1C0TA 3K59A 1S0NA 3KHRA 4DL7A 3RB4A 1RYSA 1X9SA 2G8HA 1KLMB 3SQ4A 5J2MB 2OYQA 1LWFB 1SV5A 1HJRA 5HLFA 2VG7B 1REVA 3DM2A 2RN2A 4Y1DA 2FC0A 3NF9A 3KNAA 1ZBHA 1RT6A 2OPSB 4DU4A 1MMLA 4EP5A 3MXJA 3NBPA 1N5YB 4WFYA 2HHQA 2C2RA 4IG0B 5KT6A 3BGRB 4Q45A 2W7PA 5DMRA 1DTTA 4M3TA 2C2EA 3LZIA 2E6MA 2DPIA 4OGCA 2YNFA 4KAIA 3BSOA 5KGXA 2IM3A 2XY8A 1JLEB 2Y1IA 4E1MA 4OKKA 4FXDA 4DS4A 1D5AA 3OYBA 4Q8EA 5DG7A 1ZBFA 1QAIA 1IKWA 1T8EA 4Q44A 1L3SA 2VG6A 1SKRA 3VQQA 3U6FA 2G8VA 1QS4A 2X78A 4PWDB 4E7JA 3TAEA 1S6PA 4FZZA 2HNDA 3BSNA 2KFNA 1Q9YA 4B08A 2RKIB 4RUAA 3ZSRA 3OYFA 3H40A 2VA2A 3SFUA 3RRHA 4QWAA 2OPQB 2YNIA 5KFJA 1DTQA 4CF0A 1SUQA 3DYAA 2IC3B 3LP1A 2W7OA 1BHLA 5DGBA 4MKAA 4F2RA 4O5BA 4NCGB 1L5UA 2ATQA 2D0CA 1TL1A 3FSIA 4O0IA 4GMJB 3MF5A 1KVAA 1QSYA 4C8LA 1RT5A 2E9ZA 2IDOA 4JRQA 4GC7A 4O3SA 4LQ3A 5EDWA 4KO0A 3KK3A 2YNHA 3AV9A 2ITGA 4URQU 3LP2B 3AA4A 4CHNA 4C8KA 3TARA 2FVCA 4I9LA 3I8DA 3ZT4A 2YKNA 3GIMA 1QE1A 3OSPA 2AU0A 1ZETA 3HP9A 2BRLA 4WYWA 1N48A 1IKVB 5F8JA 3O4NA 3KTQA 5KFNA 4NLDA 2BQUA 3KJVB 1BQNA 4FLTA 4RNFA 4QWBA 2JEIA 1JLBB 1BCMA 4OPJA 1FKOA 4W5RA 1XHZA 3V9XA 3PO5A 3AO4A 4CECA 4EP4A 4CGJA 1S9GB 4BE0A 3N6LA 1HQEB 4IG3B 4BDYA 4J2EA 4H8KA 4ZTFA 1RBSA 4JLHA 4QWEA 2B6AB 5DG9A 2QKBA 4HVJA 3DI6B 3SUQA 4LH4A 5KFRA 4CJRA 2AX1A 4IFYB 1NK0A 1JKHA 3AVCA 4NLPA 4ED3A 3KLEB 2G8UA 4ECWA 4ECTA 4Z0UA 3QYYA 4EZ9A 3PJXA 3DDKA 4J9LA 4E89A 3IG1B 3V1OA 3MEEA 2UVVA 3NAHA 2XO7A 3KK1A 4BACA 4HHTA 2FLNA 2YHAA 4M41A 3QEIA 4IR9A 3QLHB 1GOAA 4DU3A 1A5XA 3ISND 2YV0X 4FLZA 4ED6A 4OKEA 2KQ2A 3Q8QB 2D7SA 3M8RA 4H4OA 4W5TA 1VSIA 1S48A 1EETB 2FVSA 3PHEA 3S3OA 1VSEA 3VQBA 1C0MA 3F9KA 1TAUA 2Z1GA 4ID5A 2HB5A 3MEDB 3T5JA 3SPYA 3OLBA 1S9EA 5KG0A 3BJYA 3QIOA 4R5PB 2W8KA 3BSAA 3I5AA 4C8OA 2YNGA 3TAMA 1X9WA 4NYNA 2AWZA 2ALZA 2GBZA 5KT4A 3OJUA 2IBKA 3H5XA 3AVJA 4FLYA 4DFPA 2BQRA 3DLKB 1WSGA 5C42A 3H5UA 5KG4A 1IKXA 2QKKA 4Z4FA 3KLFA 4FJIA 2JEFA 1J9AA 4FM0A 4F4YA 3NAIA 3RMBA 4ELUA 4ZVFA 1EP4A 1UAXA 3M8PB 5HROB 3T3FA 4CJUA 3NF8A 2AJQA 3V6DB 4ED1A 5DLFA 4K4TA 1Q8IA 2B5JA 5DQGA 4E7HA 3ZSZA 3PX0A 2XI2A 1TQLA 3CIZA 4NYZA 3T5KA 5C25A 4YR3A 1L3TA 2GV9A 2FLLA 4F8RA 4H4MB 5KFTA 4CJLA 5HBMB 3M9NB 5F8IA 3FDSA 4CEQA 4MIAA 3DRPA 2HHVA 1CXQA 4J9NA 2IGIA 3V9WA 2XWYA 5L1KA 4ELVA 4RUCA 5T14A 3CDUA 4E7KA 2HNYA 2C2DA 3LAKA 3KD1E 4CJ3A 1X1PA 4RW6B 4ECQA 4TYAA 5KFDA 4K4UA 3FFIB 1S49A 3LALA 5CZ2A 1LV5A 4FM2A 4F50A 3BQ0A 1WSIA 4TLRA 4F2SA 4FJMA 3JYTA 1RBTA 1VSHA 3DRSA 4Q0BA 4RW4B 3SNNA 4NCAA 1JIHA 3WNEA 3AVNA 2Z1HA 5KFAA 5T7BA 3QEVA 1S1XA 3KLIA 4FVMA 3I0RA 3H08A 1J53A 2V4RA 1JLFB 1NKEA 1TV6A 1C1CA 4F4WA 4B9NA 2ASDA 4CJ4A 4FJNA 3TAGA 3AVGA 1TKZB 2EHGA 4IR1A 3OYNA 1VSDA 4PUOB 4I2QA 3SI8A 2XC9A 2FVPA 4ED8A 2F8TA 3LZJA 2G8IA 3SUNA 3DMJA 1RTDA 4DL6A 1RTJA 1BQMB 1HMVB 5KT5A 1CXUA 1RNHA 4IH6A 2WOMB 2OH2A 4HUGA 2PYLA 4DQPA 4FJGA 2RF2B 3AVBA 4BWMA 1SKSA 4HUEA 3KKSA 4OL8A 4AHCA 3CJ2A 5KFWA 1VSFA 2BE2A 5SWMA 4U7CA 3UQSA 3LAMA 4ZP6A 1JXLA 2FBYA 5JS1A 1Z26A 3KMQA 4QOZB 4Y2AA 1WSJA 4F4KA 4DU1A 5F9NA 4CJVA 4K8ZA 2QV6A 1YT3A 2Z1IA 3PJWA 4ECSA 4N5SA 3V6KA 3L2UA 4J2DA 1TK5A 1FK9A 5KGWA 3LPTA 1HPZB 4LH5A 3PR5B 1QSLA 1VK0A 5KFYA 1K1SA 4KPYA 1LWCB 4DQSA 1S97A 3VQ4A 1NKBA 4XO0A 1BI4B 3CO9A 3PW5A 4BDZA 4B3OA 1S1UA 4CFAA 1RDCA 5KFFA 4JS4A 4KV8A 2R8KA 4DWIA 2YKMA 4NRTA 1YTUA 5KRTA 5J2QA 1VSJA 5F8GA 4CGGA 3MECB 2Q3SA 1RT2A 3K2PA 4FJLA 5KFVA 1J5OB 2RDIA 4FJXA 3G86A 1ZBUA 4KB1A 3MXMA 3V4IA 4TY9A 4YP3A 1G15A 4I7FB 2GIRA 4ID1A 4FYDA 2CJQA 3HXMA 4DSEA 1JX4A 1JLCB 3CJ4A 4KHWA 4B9LA 3JSMB 3NGZA 4DL4A 4CHOA 4TSXA 3NDKA 1B9DA 4B9UA 3QGGA 3V6JA 3RB0A 5FDLA 1HNIA 3GIKA 4RW8A 4FJ9A 3PX6A 1U09A 4IRCA 2R2SA 4DSFA 3KLGB 5J2PA 1FKPA 3ASMA 3OYIA 3L2QA 3ZSVA 2QXFA 1YVFA 3ZSQA 4KE5A 1NNDA 5KT2A 3GV8B 3QEPA 4PA1A 1QSSA 1TK8A 4G1QB 5KI6A 3AA2A 4F3TA 4W5QA 4I2PA 1ASWA 1QAJA 4Q43A 1CZ9A 4NLUA 1RAJA 1IG9A 3HVTB 2ZE2B 2W9AA 4LY7A 4DSLA 3EPIA 3V9SA 1RTHA 1C6VA 1S1WB 3ULDA 2FVRA 5L1LA 4RW7B 1HYSA 2XGPA 3RAQA 1SKWA 1IKYB 4DG1A 5KG3A 3QEWA 1QHTA 5J1EB 2HHUA 2W9CB 1LW2B 4NLTA 4K4SA 3MAQA 3DRRA 1U47A 4BDPA 1HARA 4FBUA 5KFEA 4QW8A 4Q5VA 1ASVA 3V6HA 3TANA 3M8QA 3G6VA 2WB4A 1TAQA 4O0JA 3I5BA 3TWHA 2BQ3A 2VA3A 2FBVA 1MU2B 3H5SA 3L3UA 3TAFA 3OS0A 1RA6A 2DY4A 1EXQA 4MFBA 4BWJA 2J6TA 2WHOA 4NLOA 5KT7A 4CF1A 3K57A 5CY4A 1HYVA 5SZTA 1RA7A 2OPPA 3THVA 3S3NA 1TL3A 1ZTTA 2IJNA 3V9UA 3RTVA 3EPGA 5KFQA 4ZVHA 4IQXA 3RR8A 4CK2A 1TGOA 5K14B 1D9FA 2W9BB 3NKYA 4IDKA 2V0NA 3TI0A 1RT1A 4CFDA 3OS1A 3OYLA 4RNHA 1WNEA 1BIZA 4BE2A 2B4JA 3V81B 4B9VA 1R0AB 2JEGA 5KT3A 4JV0A 1W0HA 2BDPA 1RTIB 3OY9A 5D3GB 2D5RA 1WNSA 3TR8A 1T03B 3OHBA 2G8KA 3Q8SB 4FJ8A 3L3VA 3D45A 2DFHA 3RMAA 1W9HA 3U3GA 3SUOA 3OYAA 1NOYA 4DMNA 1HYZA 3IS9B 4CE9A 4CGHA 1TKXA 4CIEA 1A5WA 4R8UA 1N6QA 2HWIA 4EBCA 3HVWA 2FBTA 3VQ7A 3Q8PB 1KHVA 2R8JA 4NYFA 4UQGA 2W42A 4AHSA 4KI6A 1Z4UA 4JUZA 3I5CA 3LP0A 4HUFA 1C0TB 5E41A 4E0DA 1U4BA 4M45A 4DTSA 4Y2CA 3KKRA 1YVUA 1RT3A 4AH9A 5F8LA 3CJ0A 5HLFB 1REVB 3QZ7A 2XRIA 3DM2B 3FRZA 4CFCA 4K4WA 2IOCA 4IH5A 2KTQA 4MK7A 3RB6A 1RT6B 2KW4A 2JC0A 4MQ3A 2PY5A 3SQ0A 2XI3A 3NBPB 1DTTB 4IKAA 5L1IA 3SZ2A 3CQ8A 1S0MA 5KFBA 2YNFB 1SL1A 2FJWA 4CEBA 4YMEA 4QWDA 2XCAA 3VQDA 3PR4A 1RT7A 5DLGA 4NLXA 3QETA 4J9SA 4TQSA 2IM0A 1IKWB 3RWUA 3PZPA 3DLRA 2VG6B 2R8HA 1S6QA 1VRTA 1RILA 1S6PB 4QWCA 4FW2A 3OYCA 2EC0A 2HNDB 4FJ5A 3DLBA 3S3MA 5I42A 3MFIA 2IAJA 1ZBIA 3M9MB 3T5HA 4QPXA 3WNHA 3CDWA 2YNIB 1DTQB 4PQUA 4FJJA 4KHRA 1NOZA 1U49A 4ZP9A 4CEDA 3DYAB 1SUQB 3LP1B 4W5OA 3ITHA 3SV3A 4KFBA 4M95A 4K4XA 3QGHA 3MEGA 4ICLA 2O5DA 4DTJA 4ZTJA 4ZPAA 1KVBA 3DOKA 4KREA 1TL1B 1S4FA 3VQ6A 1DLOA 4OGEA 5EU7A 1RT5B 4CF8A 3EZUA 3HP6A 3L2VA 3DLGA 4LSNA 4AHUA 4JV1A 2HHWA 3DOLA 3S9HA 4KO0B 4FLWA 2C22A 3KK3B 2YNHB 3MR6A 1C0UA 1Q9XA 1TVRA 3VQAA 3VA0A 1BL3A 5FRNA 3MFHA 2RDJA 4FK4A 1EX4A 2D0BA 3NF6A 2YKNB 3L2WA 1QE1B 1WAJA 4CJKA 4CJPA 4Z4EA 2XY6A 4DL5A 4RNOA 3GIJA 1BQNB 3QIPA 2HHSA 4H54A 1FKOB 3KHLA 3OYKA 4N56A 4WZMA 4J9PA 5CYQB 1KSPA 5DG8A 3AO3A 4N47A 4DTUA 3O3FA 1SL2A 4ECRA 2ZKUA 1WSFA 5C24A 3OYEA 2OZMA 4DTNA 4CJQA 2XGQA 3HO1A 1I3AA 4NCBA 4KHUA 1XWLA 4WXOA 4GVMA 1D0EA 4O4GA 3OYDA 1LAVA 3H2LA 2YHBA 3V1RA 1BGXT 3K5LA 1JLQA 4FLVA 1UWBA 4YQWA 1JXBA 4CJ5A 1JKHB 4TXSA 4C8MA 4BE1A 1NK6A 1A5VA 3MEEB 4O44A 3KK1B 2FJXA 5DQHA 3OYHA 1QQCA 4IKFA 4CEFA 3NGDA 2HHTA 4M3RA 1S1VA 4H4OB 3ALYA 4WYLA 4Y34A 2FVQA 4FBTA 1T7PA 1XR6A 1KCFA 1HQUA 2R7YA 4M3YA 3CVKA 3NF7A 1VSMA 4FCYA 4YR0A 3RR7A 3HKWA 1JLAA 1TKTA 3CYMA 4TY8A 4WFXA 4XPEA 4EO8A 4ID5B 1NJWA 3DLHA 3H59A 2VG5A 2AX0A 1S9EB 3PW0A 1N4LA 3LWLA 4RNNA 2YNGB 3TAMB 2EX3A 5L1JA 4E7IA 3E01A 4FJKA 1HNVA 1KLNA 4O55A 4FZXC 2OA8A 4IFVA 4C8NA 2HMIA 4HYKA 1D8YA 5C42B 3NGIA 1IKXB 3BR9A 3BDPA 3L2RA 1XI1A 4M3ZA 1S1TA 3KLFB 1I39A 5KFIA 4CCHA 3IGNA 4EBEA 1WN7A 3QO9A 2G8WA 4F3OA 4G3IA 5KG5A 1EP4B 4RW9B 2BANA 3KHHA 3VQ5A 1LW0A 3NH0A 4DTMA 1NK7A 5J2NA 2HVIA 4JV2A 2J6SA 2F8SA 1N56A 5KG2A 4DSJA 3UIQA 2B5JB 4AILC 3I0SA 2F96A 3ISNC 3FQLA 5KFMA 4FK0A 5C25B 2ZD1A 4QW9A 3CJ3A 3RRGA 4MIBA 3VQSA 1ZBLA 1KRPA 1JLGA 3KLHA 2WONA 2UUTA 2OPRA 3PV8A 1CLQA 4HCBA 5KFKA 3DRPB 3O3HA 4FW1A 5HP1A 3AVIA 5KTQA 4NLGA 2HNYB 3C6UA 3KIOA 4IBNA 4CHYA 4LSLA 3OJSA 3ZT0A 4NLWA 2E6LA 4NZ0A 3TQ1A 4KHQA 4ED0A 2O4IA 5CYMA 3GV5B 1VRUA 3IRXA 3N6NA 2KZZA 2BR0A 3RBDA 3LPUA 1T05A 5KRSA 4FM1A 4OLBA 1XR7A 3JYTB 3DRSB 4Q0BB 3L8BA 3PW7A 3TAQA 3IN5A 3DLEA 5KG7A 1S1XB 2WCXA 4IOBA 3KLIB 4Y3CA 3I0RB 4R0EA 3OYGA 1I6JA 1TV6B 1C1CB 1RT4A 4KKOA 3KK2A 3AVHA 4ZHRA 3G6YA 2HNZA 4Z4IA 4ZPDA 3VN5A 4DEZA 4CERA 4FJ7A 1XR5A 4I2QB 3C6TA 2P51A 3SUPA 2X6SA 1SL0A 3OL7A 5JUMA 3T19A 1C1BA 2I5JA 4DF4A 1U45A 1LWEA 3AO2A 3DMJB 1RTDB 1VSLA 4DFMA 1RTJB 4WE1A 5I3UA 1HRHA 1T3NA 3K5NA 3NFAA 5HRSA 3AVLA 2GUIA 1NJXA 4CJEA 1KLMA 1CSJA 5J2MA 4WZQA 1LWFA 4EZ6A 3SPZA 2VG7A 2BE2B 4B9TA 4L8RB 4J9RA 2OPSA 4M3UA 2XHBA 2P5GA
chains in the Genus database with same CATH superfamily
3P4UB 1N5YA 3BGRA 2X1BA 3ONQA 3O9QA 2BRKA 3NL0A 5E3QA 3G6XA 3PNIA 4DV7K 1KP6A 3F44A 4KTWA 4DSIA 1T44A 4CJFA 4OPKA 1YK9A 1UFLA 1B0VA 4DB3A 3GIRA 2MQNA 4EAHD 3MMJA 2V8VA 3PDNA 4Q2LA 3T6JA 1RDAA 3PIOL 3I55N 3AAWB 2G8FA 3M4XA 4DV3K 2Q66A 1M0SA 2ZITA 1TZ0A 3CO0P 3RUBL 2VF3A 5E5NA 3HFVA 2MKYA 3EGVA 3I96A 3VAKA 3M9OB 2OPQA 3CJBA 3C94A 4DPTA 4P75A 2IC3A 3KWGA 2DGQA 1ZXOA 3JSYA 4CFBA 3V4IB 3VQ8A 4V19S 3MPWA 2J6UA 2B56A 4ED2A 4NCGA 2CQ0A 4V19J 2XMTA 5GADI 2CQ4A 2HMPA 3D6MB 4NA1A 4LF5F 3FNNA 5HRNA 3A4TA 2DKOB 4OQJA 1IBMK 1VFJA 3WIVA 5LSRA 4IRDA 2LEBA 3VVTA 4DU7A 1IWAA 3OTBA 4RW8B 3LP2A 1FKPB 1RLCL 1KTQA 3EZ5A 1T94A 5SUHA 3CMES 1VQ9S 3UD3P 3A8IA 3A3NB 3VGLA 2WBRA 3CC4S 3W63A 4J5OA 4CO3A 3QNOA 4FNIA 2EPIA 4D3GA 1X9MA 1ZZNA 5GIPA 1Q8KA 5T7LA 1TU0B 4K5SA 3KOAA 1FX2A 3UR0A 4I2PB 2CJKA 4HDGA 4TYBA 1LQ9A 4K50A 3P5JA 5DETA 5JVHQ 3FVYA 1KS2A 3JB9k 4URGA 3EUNA 4CESA 4EEYA 4F02A 1QQMA 4I1TA 3D2EA 2O66A 4IOAL 2MZQA 4I64A 4IFYA 4DG1B 3SCXA 4ECXA 3KLEA 2F7TA 2IA6A 3O9RA 1HR0K 4KRFA 4NOHA 3SQOP 2UUBK 3G8SA 2D41A 3BEGB 1ROFA 3PKYA 2Z56B 1EWQA 3M8QB 3FZLA 1SXLA 3HL8A 2O8FA 1NGDA 1ITGA 3DRXA 3BQ1A 1ZTWA 3W62A 2MZTA 3OBYA 3IBWA 4ZCLA 3ULEB 5A0YB 1EETA 4HKQA 1AZSA 3TEGA 2OPPB 3UDEA 4PKIA 3ZT2A 4FVCA 4OIXA 1TL3B 1HHQA 2MQ8A 1GOCA 4QAGA 3ZSOA 2CADA 3CM5A 3BO2A 2QGFB 2FYXA 2C28A 1VBKA 2KL8A 2KZMA 3QNNA 1Q18A 1VQMN 4R5PA 5LL6Z 3OL8A 4U8VA 1DRZA 2B7CB 3P4IA 2W6KA 2IMOA 2ROEA 3M2VB 3H4BA 1RHRB 4OI3A 3TAPA 2YWFA 5K20B 2QZ8A 1HKCA 2CFXA 3IA0A 4OFZA 4UW2A 2ILYA 3OUYB 5HRRA 1M1KT 3M32A 4YDUC 3OTOF 2YQ1A 3M8PA 5HROA 4A8WA 2VFVA 3R9PA 2QE5A 2FQQB 3MAAA 2GTDA 2GC8A 4KB0A 3PACA 3CFOA 1S5JA 3MN7A 4BRCA 2VQEJ 2FHJA 4N7TA 4ILMA 3FQKA 4GY2B 1WSEA 1OIAA 3VALA 1B9FA 5HMYA 4QU7A 4J2BA 3UDLA 3CJ5A 3MM6B 3H3NO 4KHPJ 3NCIA 2R7OA 1M5SA 3EVOA 4CEZA 2NZCA 1VC0A 2BW2A 2GIQA 3VEZA 8ATCB 2YI1A 1Y00A 5E33A 4MIWA 1KWMA 2J5AA 4J9KA 3BY5A 4EO6A 1WDTA 3R1HA 3H98A 4O3PA 4CGFA 1YBUA 2YJFA 2LQ9A 1VQLN 3MHYA 3JSRA 2AD9A 3DXBA 5B09A 1G4CA 4FOIA 1RBRA 2EG1A 3T1HK 3Q8RB 4JI6J 2OFHX 2E4LA 3CI5A 3ZSXA 5KPRA 4NI2A 2Y1RI 1JCEA 1CC8A 1TKZA 4QR2A 2ASLA 3D28A 1YJNN 1TKDA 1OY8A 2XMMA 1B92A 3BF3A 1H7WA 4BC4A 4BS2A 2UUWA 4M5DB 3HPOA 4FF1A 2NXCA 1SJFA 3HHLD 3QSYB 1R8HA 3VA3A 3OS2A 1R89A 2QW9A 3DLJA 1APSA 3KKFA 2O3DA 3H90A 3DOKB 1GXUA 1SH3A 1N5TA 4MKVA 1DLOB 1GXLA 2C3YA 1YIJS 2HHPA 3QMQA 1SZ2A 2IM1A 3VQEA 2YTCA 3VERA 3DOLB 3CJKB 5FLXO 3TZXA 4Z4CA 2Q36A 1EKEA 3UN2A 4J91A 1CJUA 2IFXA 4BRHA 1U6FA 3KG1A 4LFBK 1X4HA 1JNZB 1VRQC 4NXNF 4E3SA 3TQEA 5F8NA 4YDDB 3WIUA 3WXKA 3A8KA 4B3RK 2Q1LA 3RW6A 1NK8A 1YI2S 4QYZJ 1VBXA 3VMFB 3K5OA 1HPZA 4A8SA 1UPPA 4DR7J 2MHEA 5F1XA 1LWCA 1BI4A 2L41A 2AJ0A 2BJ8A 1B99A 3L95X 1U04A 4DTXA 1TL5A 4X4PA 3NCQA 4WXWA 1A6LA 3IAS9 1YJ7A 3AA5X 2ZH1A 4GKJJ 2BKOA 4O4GB 2NQPA 4CH0S 4H0OA 1T6CA 2GVDA 1JLQB 3P5BP 3NCPA 1R31A 4P71A 4KSEB 1K1QA 3SFGA 3R2CJ 3EICA 3AA3A 3ID6A 2YXLA 4O23A 3D67A 4E7LA 2W4DA 5FRMA 3V5RA 2AJ2A 2J0WA 1VQON 3DRYA 4CK1A 1X3NA 3D6TB 2MQOA 1CQNA 3O9SA 1O6XA 1WKKA 3E1YA 4DKWA 4OYMA 4JI1J 3ZT3A 3HT3A 3AVMA 3MR2A 5KPZA 2KU7A 1KHWA 4J7CA 3CNQP 1B4SA 3O3LA 2SXLA 4OKJA 4TY8B 3HHLB 5AZIA 2O8BA 4N8NA 4OX6A 4M7XA 1XERA 1YJTA 3BO3A 4WCEL 4DDFA 2HGLA 3K5PA 2MKIA 4K59A 5F0WA 3B6BA 4KI4A 4J9QA 5DGAA 3U3YA 4L75A 3E01B 3VQPA 2ZE2A 4M42A 2Z0GA 1TUGB 3MM8A 2D0PA 4JKCA 3S8SA 1YXQA 3OXLA 1NLVA 1NHUA 4RW7A 3A8EA 1BISA 2EWSA 3RB3A 2A2CA 5KOXA 4TLQA 3GLJA 3CFRA 3DCAA 3DXSX 4ILLA 2HS0A 2CJYB 2QN6B 3PW2A 3NHGA 3QO9B 4O3RA 4KBIA 5L9NA 3OXGA 3CFPA 4UY8O 3WQUA 1LW0B 2XY5A 4FKXA 3G82A 5J2NB 2DIVA 3HJFA 1F0XA 1KFSA 1PJ6A 1KD1O 4URSA 2HWHA 2EFGA 3F73A 3KHGA 3T7ZA 4RBVA 2K06A 5AQLA 3OYMA 2F1FA 2BH1A 1SQFA 4NASA 2JNJA 5JLHA 2IM2A 3MCMA 2VH7A 2AGOA 3F9MA 2OPRB 4B1YB 4OYIA 3HYFA 4YB7A 2FHMA 1Y64A 1JMTA 5HP1B 4ZVRB 2E9RX 1LXJA 4GW6A 4K42A 3C6UB 2H65B 1N8RT 3AQOA 2JWNA 2YQ0A 3KJFB 4X64F 4UY85 1CS4B 2FDNA 5CYMB 1EARA 3ENAA 4B02A 2IMWP 4LF5J 3HPGA 1MSWD 2HZCA 4QCLA 1U7LA 2ZJRL 4CO5A 2DTUA 2LP4A 4C1NK 3O1WA 2DHGA 3GYNA 2HK2A 2M5YA 4KKOB 4DUYK 1XMQK 3H46O 4OPHA 1CZBA 4BRMA 1YHQN 4ZHRB 1XQSC 3Q22A 4MTPA 1S9FA 2CQHA 1NPKA 4CT8A 4WIIA 4KGXB 3C6TB 4K4ZA 5EWEA 3ENOA 3C3LA 1M5HA 3SYZA 1LWEB 1UVIA 1NRKA 3MUVP 1Q16B 5HJXA 3SQ2A 1GX5A 4MKYA 1U6ZA 2X3GA 4BRPA 1RYSA 3CJCA 4DV1K 2AZ1A 2OYQA 1SV5A 3QMLA 4BRDA 5J1PA 3DM2A 4Y1DA 4HI1A 1RHKB 4OZLA 4CWBA 1RT6A 4DV7F 4EP5A 2XZTB 1N5YB 2W7PA 3BGRB 4Q45A 4YDUA 5DMRA 3LZIA 2DPIA 4IDHA 4H0PA 2IM3A 4JI7K 1R0CB 4DZ6A 2VQFK 3C0BA 2UU9F 3SLCA 1D5AA 4Q8EA 1QAIA 1IKWA 5AQGA 1Q7YO 2LQ8A 2OEJA 1L3SA 3RG6A 3E66A 3U6FA 1MLAA 4LF1A 3GL1A 1S6PA 2D4WA 1WHVA 4FZZA 2HNDA 1NAQA 2X3DA 2F9JA 2AF6A 3CEDA 2COLA 5GAEU 3ZSRA 4RUAA 1IBKK 2PD1A 2LCWA 1H74A 4C4WA 3RRHA 4QWAA 2OPQB 5KFJA 3TZYA 1GMVA 2KJVA 2IC3B 3J7YP 5DGBA 4MKAA 3M05A 1IBMF 3OBIA 5GAHI 4NCGB 1L5UA 2ATQA 3HD2A 3PM9A 1G6BA 4I6AA 1KVAA 3H42A 3VF0B 2M2BA 2ZOMA 2VCPA 4GC7A 4LQ3A 1Q82T 3NEKA 4KO0A 3DDNA 3AV9A 1RJJA 1HWKA 3AJ2A 3LP2B 2ASYA 1K73T 3AA4A 3TARA 1UTAA 1WTFA 3L6QA 1C0FA 3HP9A 2BRLA 1VJQA 2M8HA 1N48A 3THXA 3FZHA 3O4NA 1K47A 5CCMA 1HHTP 1P9YA 3D0IE 2MJNA 2FY8A 4FLTA 2JEIA 2CVIA 1HLWA 1SIWB 4EP4A 4CGJA 4BR5A 4IO9Q 2FHJD 2IYGA 3DXMA 1BY9A 4XAKA 3G71N 3IR6B 2IHR1 3C8YA 4DHVA 2UUBF 2KYXA 3D2EB 5KFRA 4A61A 4IFYB 4ZN1A 1H7XA 3CW2C 3KLEB 2HBYB 3CD5A 4ECTA 2PMHA 1SJ1A 4OZJA 4E89A 4B1VA 3BGFA 2XO7A 1ZPWX 3J8AA 1HD1A 3QB0A 3CD0A 2O8FB 4DU3A 1NU4A 3ISND 3O6WA 3M8RA 5AQMA 1EETB 3RRKA 1AZSB 2FVSA 3PHEA 4HHUA 3FZMA 1QQNA 3S3OA 3WQPA 2Q3PA 2VZ9A 1FKAF 3CCLS 2DGVA 1X31C 2Z1GA 2V51B 2ZBQA 1V4SA 4K43A 1WB9A 3OLBA 5ETPA 1MWKA 4R5PB 2W8KA 1OQ6A 4QPTA 4M5JA 4L73A 3Q8VA 1X9WA 3VAJA 3QT8A 2QG9B 5AQKA 1HKGA 3ILLA 1VQYA 5I4MA 4EFHA 4DFPA 2X1GA 3I31A 2V68A 4DV2K 3CUNA 4NXNJ 3VWSA 3UDCA 1FWPA 1S72N 3NGSA 3I4HX 4FWLA 2JEFA 1JXVA 1S12A 3FRYA 4F4YA 3M32B 1N34F 1Y5IB 2HS4A 4ZVFA 1EP4A 3CC2S 1KR4A 3M8PB 5HROB 3OFFA 3T3FA 1F3VA 3CCJN 4FPIA 1PBAA 2ZZMA 1EX8A 3MAAB 2ALYB 1KEKA 2FLOA 4K4TA 1Q8IA 1H2UX 2GA7A 4E7HA 3TZZA 3PX0A 3CIZA 5BN8A 4NYZA 3AY9A 4YR3A 3TWZA 5MAOA 1XNQJ 2FLLA 2Q31A 4F8RA 4ES2A 2ZHBA 4DCPB 5KFTA 4C3KA 5GAGP 1VQ9N 4UZCA 3PXGa 1RAEB 3HDSA 4CEQA 2RQKA 2HHVA 2IGIA 1DKGD 1Q86T 2PI4A 4A8QA 2FTRA 5T14A 1CEZA 3H25A 2C2DA 1U2VA 2ROGA 2P8IA 2AKWB 2XS7A 1VCTA 4TYAA 4WJBA 3PSIA 4ETZA 3LALA 1LV5A 3JQJA 2G1HA 4F50A 4JI3J 4TLRA 4F2SA 3JYTA 1RBTA 2BZ2A 2ZBCA 3TA2A 4Q0BA 2W1BA 4RL1A 3JAMO 1ZM2A 1IN0A 1HI0P 3KK7A 4FVMA 1Z05A 4V19X 5A8RA 4ITSA 2D3O1 2V4RA 4AL6A 4O0NA 4BREA 1SKUB 1T9TA 2DXDA 4NI2B 1OH8A 1F9FA 2ASDA 2YPYA 2LECA 4FJNA 1TKZB 5D8HB 2ZJPQ 1LOTB 4IR1A 3OYNA 4AT1B 1VSDA 2ZH9A 1JJHA 3SI8A 4NMLA 2XC9A 2FVPA 4Z7YA 1S7HA 2G8IA 3OHRA 3PRBA 4DX8H 1NBEB 5IS2A 2DNMA 2OH2A 2GWJA 2BOPA 3SBMA 4CBUA 4B1XB 1J5EK 2BTFA 4KGVB 4HUEA 1B70B 2VOPA 3Q0AA 2EVZA 2BE2A 1HKBA 5SWMA 2VBXA 4B3RF 3UQSA 2OTLN 5IT9U 1Z26A 1CJUB 1WSJA 4HI2A 5F9NA 2G0IA 4K8ZA 1YT3A 3PJWA 4XH1A 4N5SA 3DXKA 4J2DA 1F2HA 5M1KA 1HBUA 1HPZB 2HWTA 3G8TA 4LH5A 5JMNA 1LWCB 3VHQA 1S97A 3VQ4A 1BI4B 3CO9A 2QWMA 2DPNA 4B3OA 2FHOB 3THWA 4QBUA 1T9VA 4CFAA 3BKUA 1RDCA 1DBDA 4RWWA 4QU6A 2CGLA 1YTUA 5K8PA 5KRTA 1NNEA 5J2QA 4OYBA 5JVGL 2GVDB 3M3ZA 3Q2TC 1RT2A 4A8YA 5C15A 1X4DA 3J81Y 2L9NA 2WSEC 5KFVA 4ATNA 1WG1A 3RGIA 3PYDA 2XHCA 1ZBUA 3I9V9 3MXMA 4N8OA 4RBUA 5D4LA 3FEYB 3WQTA 2G13A 3CJ4A 2CJ9A 3R3LA 1S77D 2A6AA 3C2PA 2W4CA 4A8FA 3PRVA 4DL4A 4BY9C 3H7HB 4ZA1A 3GG0A 1ZBTA 3CJ7A 2CQPA 5K8MA 2I9SA 5E3CA 2RHKA 4CO2A 2WB1D 2V2KA 4FJ9A 2M4MA 4UOCA 2R7VA 2R2SA 2GJFA 4I67A 3ASMA 3FGUA 5KQDA 3IC1A 2C3OA 2R3VA 1RACB 1SC4B 3L2QA 3AARA 2VB6A 4WFBL 4GV3A 5AZIB 2O8BB 3ZSQA 1MMNA 3GV8B 1QSSA 3KNGA 4YOUA 3VF4A 1NGIA 4HT5A 4F3TA 1OY6A 1ASWA 1QAJA 1CZ9A 5HMZA 2LKZA 1IG9A 2ZE2B 4UOGA 3MM8B 2KDOA 4RW7B 1HYSA 2GGPA 4J8FA 1KOOA 5KG3A 3CCMS 1D4XA 4U95A 3HJVA 2ZDOA 3DRRA 3LM2A 4FBUA 2UU9J 4QW8A 3G82B 2NNWA 2B9WA 4A48A 2LU2A 3WXJA 2IVFB 2VPWB 1HW9A 2FBVA 3TSUA 2A18A 3H5SA 5U47A 2XMUA 2DBBA 3TAFA 2E5LJ 4FYVB 4MDBA 4M8LA 5BR8K 4CF1A 3THVA 4WQ4C 4FWNA 3R3TA 3LH2S 2J0QD 1T6DA 2MGZA 2B4PA 3EPGA 4IQXA 2RSQA 5IV4A 3NKYA 1RT1A 3OFEA 4RNHA 2K7JA 1BIZA 3MCOA 4NXMK 4B9VA 4JNEA 2JEGA 5KT3A 3SCKE 3OY9A 3GJTB 2D5RA 3OHBA 3Q8SB 2VFUA 2Z2LA 2MEWA 2B8PA 5DO2A 2OD4A 3CCUN 4CIEA 3HVWA 2FBTA 2CXEA 1SQGA 4CZCA 4OX9K 1KHVA 1HHSA 2R8JA 3M8WA 2LXIA 1FRKA 3LGHA 4USKA 3G6EN 4UQGA 2DNZA 3I5CA 3LP0A 3LTOA 4HUFA 1HUXA 4W4MA 5E41A 1U4BA 4RKUC 4DTSA 2UUAK 2P9LA 2E2PA 5ETKA 1RT3A 2PFUA 3IWNC 4AH9A 2YX1A 1WD6A 3H20A 3DM2B 4K4WA 2YKQA 5JICA 2BJ9A 3B78A 1OYEA 4CF2A 1RT6B 2JC0A 3GTYX 2LQ5A 3AA9A 2VU5A 2HHHJ 3MURP 1JJ2M 1IJEB 3W5YA 3R27A 4CLSA 3SZ2A 1SL1A 1VQSA 2FJWA 4CEBA 1VS3A 4FP9A 3BN7A 1RT7A 4WF9L 3R7SB 2XMVA 3QETA 5LSOA 4J9SA 1IKWB 2MKJA 4ZCMA 3DLRA 3CCSN 4FZVA 3ZTQA 1QVFR 1S6QA 1VRTA 3CJSA 1S6PB 3OYCA 2R7WA 4A57A 3C6HA 2HNDB 3IFRA 3O1LA 1YRUA 3CCZA 1ZBIA 2NUHA 3HSZA 3M9MB 3VEOA 2R7UA 4FWMA 3WNHA 2QSFA 3CDWA 1MN9A 4ZP9A 2ZEJA 2ZGYA 3ZC4A 5AZJB 3U1LA 4M95A 2WBNA 4H03B 3DKDA 3QGHA 3MEGA 4ICLA 2O5DA 3C46A 4ZTJA 5I9EB 3I9ZA 1KVBA 4KREA 2B4OA 4GKKF 4LSNA 4JV1A 3J80O 2HYIB 1SQKA 3MCAB 3W66A 4KO0B 4FLWA 2C22A 3QT5A 2HRUA 4PG8A 2UV8G 1Q5VA 4RBTA 4WK3A 3EX7B 1N34J 4FK4A 3QJJA 2A3ZA 3W3DA 2ZZNA 1M5OC 4AUKA 4RUHA 1IBLJ 3TPQA 4BLGA 1WAJA 4Z4EA 4G1IA 3THXB 2E5JA 3GONA 2Z2YB 1MA9B 1OH7A 1MMDA 3QIPA 2V2ZA 2HHSA 4PHTX 1V3RA 2B9EA 1VK3A 3OYKA 2PFFB 2FJBB 2B51A 4FKYA 4WZMA 2VICA 2LDIA 5IXUA 3AO3A 5LSLA 1WSFA 3DXMB 3OYEA 5K5MA 2XGQA 5G4DA 1H0HB 4DR2J 1KVIA 4WXOA 1RWVB 3OYDA 3V1RA 3K5LA 1UWBA 4YQWA 2RRAA 4U67Q 3S41A 4C8MA 4BE1A 4I6WA 3TA0A 1HIYA 4ES1A 4JK9A 4MLHA 3CJ8A 1GLBG 3UCZP 1QM9A 1UEVA 3IBCB 4IYQA 1VMBA 3VZHA 1PBUA 2GQCA 2M7SA 4FBTA 4ZIWA 1T7PA 1HQUA 2DXEA 2R7YA 5CHCB 3UNYA 5HMXA 1VSMA 4YR0A 1JLAA 5BPMA 4DR4K 1E6YA 1RAOA 4QIVA 3VGMA 5A76A 1F9EB 3H59A 4OHYA 2Q0UA 2WW4A 3PW0A 4Z94A 4DPWA 1N5QA 4DV2F 4LRCA 3LWLA 4BCAA 5L8RC 1HNVA 2NRXA 2MTLA 3IKMA 4LFCF 3MPYA 3BZKA 2OA8A 2QRRA 1ICEB 1LK7A 4C8NA 4YDXA 3Q89A 1OSCA 3EZOA 4ALZA 3FCWA 3L2RA 4M3ZA 4X4UA 4LR7A 1VQ8N 4FPAA 1WN7A 4F3OA 2G8WA 4G3IA 5A6WA 1EP4B 1N0UA 2BANA 3CF5L 3G2XA 4DTMA 4CO0A 1NHKL 2GX9A 4JV2A 4BR9A 1N56A 2WFBA 3DC2A 4OZ0A 3D6FB 5KFMA 3SSQA 3G87A 1VQ6S 1Y5NB 5GADP 3I8BA 2LEAA 1ZBLA 5E3RA 1KRPA 1JLGA 5EXWA 2N4CA 2PT0A 2DY1A 3FCVA 3O3HA 3PRDA 1RFQA 3BPSP 4FW1A 2DRAA 1U2VB 4FWSA 3ZT0A 4NLWA 2E6LA 3UFCX 1CG2A 3UN3A 3N6NA 3B4MA 2BR0A 4OZ2A 4U7UK 5KRSA 1YX2A 3JYTB 5AQTA 3EKSA 4Q0BB 1OKJA 4LBIA 3PW7A 1RABB 2RIJA 3IN5A 3A8YA 3DLEA 3NVKA 5KG7A 4WFNL 4PZVA 1WELA 5IV3A 4CZEA 4FF4A 5A8RB 3OYGA 1IUJA 5C2GA 1RT4A 3JTPA 4WQ4A 2ZM6F 1YQHA 3VN5A 4DEZA 4CZJA 3CD6S 2N4DA 1IR1A 1MDUB 3SUPA 3OR1A 4ZLLA 5FLXU 3OL7A 5IWAK 3BBFA 1J5EF 2DO4A 2I5JA 4NL5A 4DF4A 3WBZA 1U45A 4DPYA 4WFAQ 3CJ9A 1GEHA 3HHEA 5E26A 5F0UA 2NRTA 3F56A 3SPZA 3W60A 4DV5K 1M90T 1XQIA 2BE2B 3R8EA 4B9TA 4L8RB 2A40A 2OPSA 2XHBA 2CJAA 4Z4GA 1V5IB 4ID8A 4LF6K 3KVGA 4IG0A 2DHXA 3GP9A 4CHQA 3CMAS 3DXKB 4KH4A 1NJZA 1JLEA 2V67A 3CQXA 2E2QA 2P9EA 4W98A 3PY8A 2IVOA 2ZDPA 1WAFA 1HBUB 5LMUF 1IM4A 2VC1A 4UUXA 4J9UE 3R6GB 4B3OB 4DUZK 3THWB 3B6OA 4NMXA 3OFHA 4OHVA 1XMOJ 3OBWA 2OLWA 4NLYA 3ZCMA 2V8HA 1NZ8A 3SI6A 5GMDA 2RKIA 2CJXB 1YJWN 1RDBA 5J2QB 3CDBA 1WI6A 1OH5A 5F8HA 4F4AA 3A1YG 1RT2B 4CJSA 2V8GA 2Y1JA 3NRBA 3TVKA 4G9ZA 4ED4A 2V52B 1M1GA 4WWSA 2JOQA 3VTHA 1U8WA 2HZAA 1S10A 4FLXA 2W2OP 1VDHA 2NREA 5C5JA 4RZRA 2HOEA 4ZVTB 1NGAA 1RISA 1JCGA 3MR5A 4FXWA 4QOTA 1UA0A 1RAIB 5CABA 3ETMA 4X62K 2RDDA 3EDQB 4FZYA 2QWRA 1XNRK 1WF1A 3NMAA 4XK8C 2XSJA 2OEKA 1DY3A 5B8HA 1R8CA 1IKVA 4W90B 5HK4A 1U1PA 3WXIA 4NLSA 4OX8A 4LR8A 1VQPS 2UVUA 1E4GT 3RBEA 1JLBA 1KVKA 1RWWB 5KFGA 1IVZA 3DHWC 3T1YJ 3ZSWA 1NMEB 4X66K 1S9GA 5C10A 2IA0A 1HQEA 2ASOA 1RBVA 5D78A 2D1KA 3QGPA 3HHKA 1XNRJ 3KD5E 4CZHA 1HYSB 4M1KA 5LL6d 1QVGR 1K0VA 5JLFA 2GGPB 4LBPA 4F4ZA 3VQCA 1Y97A 2ZZTA 3HPHA 2P5OA 4F36A 3NMRA 1B64A 4ZP8A 3NNAA 1RWXB 4MLEA 3DRRB 3TO8A 4BR0A 2F4VK 3OTDA 2OTJN 5BR8F 4LVNP 1FD8A 4LF9F 3HFZB 1MWQA 4CD1A 1GLDG 1KKHA 3QZ8A 5HMWA 4HTUA 1ILYA 4OYXA 5IT4A 2Q1NA 2LQBA 2DTJA 3R9LA 4ISFA 2AT1B 1VR6A 1KC8O 2I2YA 2DPJA 5D77A 4CJWA 4F26A 1NPRA 2E1ZA 2CNOB 2MGZB 3HVRA 1BU6O 3MEDA 1RCXB 4EYHB 2DHAA 4ECVA 1RT1B 1NSPA 1PG5B 1C2PA 3DN9A 2C2OB 2J0SD 2HRTA 1FFGB 4GKKJ 4JK7A 5KFPA 4P72A 3U7JA 1RWOB 2HRYA 2E29A 2VWJA 3DLKA 1BWEA 4WFZA 1SJRA 4QR1A 3G4SS 3CXCM 3MN5A 4F25A 4KHSA 4KGMA 3O4QA 5CD4A 2MZRA 1QTMA 1MNEA 4PABA 5KFZA 2UUAF 3NGTA 1ASUA 1RI7A 1FEEA 1XBWA 3TW0A 3TABA 2UVRA 1N5SA 1HBMA 1FDNA 4B9SA 3U1NA 1ZM9A 5B7WA 3NH2A 3LP0B 2RPIA 1KQSR 2BUNA 5EOYA 2P9LB 1NEEA 2GX8A 2YQ3A 1RT3B 4B8AB 1A7GE 3HSCA 3PX4A 1NLKL 1UVJA 4R79A 3WC2A 5HBMA 4Y0FA 5CD4H 5AQIA 4C9DA 3LQVA 4OZ5A 3NGYA 4ZK7M 2W40A 1U2RA 1N54B 1UMJA 4IO1A 1R43A 4J2AA 3SV4A 1SQEA 1DEJA 4N41A 1RT7B 3ZX3A 3FFIA 1AUDA 2XCPA 3AO5A 3PW4A 2K3KA 4H5NA 3TU5A 2BUPA 2XBPA 3JAMY 5LXRA 1S6QB 1VRTB 4L3KA 4CF9A 5LJ5Y 3FZBA 4M3WA 1JLFA 2NS1B 1ZM3A 3QIDA 3RW7A 3MMVA 4LF8F 2HBMA 3QINA 2QLBB 1FERA 3LP3A 3I55S 4PUOA 1G2EA 3OVBA 1FESA 2HQIA 3KDOA 2ZBPA 3MEGB 3BF4A 1UA1A 4FPRA 4ICLB 1HMVA 1OS5A 2CWKA 2OSQA 5AJ3F 1WSHA 4XPCA 2GHPA 3ZZUA 4LF7F 4LFCJ 1Q4RA 1MWMA 3FCHA 2XMAA 4LSNB 2A1BA 1WLJA 4XDDA 1Q7LB 3AVKA 3R6MA 3CG7A 1CBKA 3WXLA 2A3JA 5J1NA 5F9LA 5FROA 2D3ZA 3H4DA 4BBYA 3LM9A 1UP1A 1GX6A 1TFWA 2M9KA 3R1LA 2JLEA 3GIIA 4XEIA 4DR3F 1NKCA 3IAYA 2G1DA 4CLWA 1IV0A 2DH7A 4A8KA 2EC2A 2RH3A 3QIPB 3QESA 2CRLA 5KFLA 3BPDA 2AA4A 2G9OA 1PILA 4YUDA 4TQRA 3S01A 2HF4A 4LQ9A 1KAXA 2GVZB 1N36K 2V9WA 2DFFA 4B3SF 3P96A 1KDNA 1D8ZA 1HNZK 1VIXA 4KIAA 1K8AT 2ZHAA 1UWBB 1FRMA 4F0HA 2R7TA 3LANA 3C6AA 3FZ2A 4OMFG 2ETJA 4NLVA 1NBWA 4I7FA 3RMCA 2UUCF 1S0VA 3IWLA 3D0PA 3HBTA 4CZGA 5KG1A 1ZZFA 1Y3JA 3JSMA 2UXBF 1NK5A 1O1WA 3G0ZA 3P3DA 1NM1A 5DM7L 4ZVGA 2MLZA 2JGUA 4L76A 4FVUA 1HQUB 2ZM6J 3S1TA 3ID8A 2GZOA 4MK9A 1RTZA 2W8LA 2A6MA 2I7NA 2E1MC 1JLAB 4OJRA 1R6YA 3ZT1A 1LOUA 1E6YB 2LMIA 2V4QA 4JI4K 2OZSA 2QYGA 5CR4A 2MQPA 4GVBA 1NSKL 3BH7B 3TOQA 4FN5A 3VV2B 3HTVA 2AIRB 2RRBA 4M5KA 2YH1A 1HNVB 2ACMA 3CE8A 4LF2A 2AGPA 1RWKB 4BRGA 5IC6B 1VQMS 1GK8A 4ZS6A 4Z4HA 3PUFA 2D3UA 3BBBA 1IKYA 2F9WA 5HOOA 5J1EA 1UCNA 2W9CA 4WKYA 1GTEA 2P9PA 2BANB 4H4KC 5EWFA 4BRIA 2CQ1A 5LMUJ 4DR5J 4DL0C 2FSKA 2DR8A 4FJHA 1N32J 2YHYA 4WIQA 1NDCA 2G0CA 1WWHA 2V8DA 2NXEA 4Y00A 4F7VA 2VWKA 2GNKA 3D5MA 1NM2A 3MCPA 1JLGB 2CZVC 3PSFA 3MPVA 3DAWA 4JN4A 2K1RA 3CERA 3ZX0A 3U4LA 3V9ZA 2NUBA 1D1UA 4LC9B 1ZAVA 1FXXA 2QM1A 3RVCA 4PYAA 3RMDA 3SJJA 4CM2A 2ATLA 5ETNA 1B7YB 4ILRA 1PGZA 1VHXA 1TL7A 2MPUA 3RU0A 2GIFA 3MXIA 4P52A 5HQ8A 1RTIA 5D3GA 4DV0K 5DDQC 4WQ5A 4FS2A 3DLEB 1VQLS 1NK4A 2QJ3A 4GMKA 2HIYA 5IWAF 3NWGA 4KQZA 4K4VA 1RT4B 4XIUA 4A5AA 3UD5A 2QWQA 4JI8F 4CIGA 5CAAA 1VQ7N 3NE6A 5HRPA 4O3NA 1IO2A 3OR1B 3DGVA 2I5JB 3CSKA 1YJRA 2E1RA 2Z58B 4YOXA 2QA2A 1C0TA 3K59A 1Q8LA 4BVOA 3OFGA 2RILA 2Q6CA 2H51B 1HJRA 1JNRB 3GMGA 4U96A 3EDRB 2RN2A 2FC0A 3M1FA 2M88A 2QX0A 1ZBHA 2OPSB 2RJZA 4X4VA 3MXJA 1A9NB 1G99A 2DGXA 2LYVA 1X5PA 1Y0HA 4IG0B 1DTTA 3MPUB 2C2EA 3JXUA 4C2MA 2Y8WA 5KGXA 1JLEB 2AW0A 3BKTA 2E7XA 2QFJA 4OKKA 4FXDA 4LF9J 5BYRA 4DS4A 4QS9A 1CQMA 1T8EA 3CULA 1T9XA 3NNHA 3IR7B 1SKRA 1DFDA 1QS4A 2X78A 3TAEA 3EE8A 5M2UA 5F0XA 3AXMA 1UKUA 1VHFA 3ENQA 3CCTA 4BRAA 4B08A 3PHTA 2RKIB 3H40A 4WTOB 1DTQA 4USUA 3CTRA 2W7OA 1BHLA 1VQ6N 5KAKA 2EFNA 5CZXA 3W5XA 3WT0A 1F9HA 3MWPA 4PKDB 1YLXA 3FSIA 5KPTA 2MY8A 2KFYA 2QMUB 1QSYA 1RT5A 4DZDA 2CPJA 2IDOA 4JRQA 3J80Y 2FF3B 3D1QA 2ZH2A 4DV4K 3N9UC 5EDWA 6AT1B 2MZJA 4AQYF 3GDQA 1HKAA 3KK3A 4JKFA 1VQOS 1NH8A 2OHDA 4C8KA 2CIMA 2XSJB 4ZJLA 4P73A 1LFPA 3ZT4A 3O2IA 4QYRA 3WEEA 3BYPA 4WYWA 1IKVB 5KFNA 4NLDA 1OPIA 1BQNA 1WORA 2QSWA 4ZVSB 1QZ6A 2NRWA 1JLBB 1BCMA 4OPJA 3W5ZA 3D1HA 4QJVA 3PO5A 3V9XA 2EXUA 1S9GB 2AYGA 3N6LA 1HQEB 1X4EA 2XZWA 2AEMA 4HR2A 4BDYA 4H8KA 3TNVA 1PJ5A 4OLOA 4ZTFA 2IBOA 2QKBA 3SUQA 4DR1K 3VAGA 3VCDA 3C65A 2AX1A 3AH6A 1NGGA 2HK3A 1NK0A 2GCFA 3AAPA 1FXDA 3AVCA 4PR6A 4ANDA 4FYWB 4ED3A 1NJIT 2G8UA 1X0PA 4ECWA 3QYYA 3GG4A 3DDKA 4J9LA 3NAHA 3OV7A 1X4GA 4HHTA 4M41A 5FPEA 4IR9A 1GOAA 2CPXA 5EX0A 4JYAJ 3IUCA 3K9KA 7FD1A 3TTFA 4FLZA 2YV0X 1U2FA 4ETXA 4ERDA 3Q8QB 2D7SA 4KPCA 3QT6A 4W5TA 2UZAA 3E2EA 4DV6J 4C97A 4EHUA 1M1HA 4LF8J 3SBGA 5M1FA 3ET6A 1HFEL 2KLAA 1S3XA 5LMNF 1C0MA 3CDAA 3JSBA 3MEDB 4QIWD 3C19A 1S9EA 4IUFA 2I0XA 3BJYA 5AJ3J 4XDCA 2RS2A 2QYCA 2RB7A 4LF7J 3TAMA 4JI2F 2CNNB 4DR6K 4NYNA 4FSVA 2E1PA 2GBZA 4JKGA 1SVDA 4EK2A 2Q79A 2P9SA 2DGWA 2EK6A 3H5XA 3QBCA 3QFPA 3DLKB 3AOBA 3GFXA 5C42A 2WVCA 4HDHA 2DNPA 4Z4FA 2K8GA 1S6OA 5IQQA 4CT9A 3BGLA 4FM0A 2IDEA 4WPAA 3RMBA 2CNKB 4DR3J 1UAXA 5C2DA 1GQEA 4CJUA 1GT8A 4BC7A 1HBMB 2DR5A 2AJQA 1TFYA 1WKLA 2IIRA 1YHQS 2OSRA 5ETQA 1UJ6A 3J7ZT 2NZ4A 3ZSZA 1TQLA 5C25A 3UI3A 5H9FK 4B3SJ 2ZF5O 2RE1A 2CPFA 1BD6A 1HNWF 1J2VA 3VEYA 4WP8A 2GAHC 4CJLA 5HBMB 4LFAK 1PIEA 2KVIA 4BG9A 3V9WA 2HQCA 1VQPN 2VBZA 4RUCA 4E7KA 2HNYA 3LO3A 1AROP 1FF2A 4IO9L 2UUCJ 4KH0B 4ECQA 2DNKA 1UEKA 3FFIB 4R25A 4MDAA 3P49B 2UXBJ 1HNXK 4FJMA 2GQQA 3DRSA 2ZBRA 4NCAA 4WYBA 1QLNA 4LT6A 3KLIA 2ZVIA 2RE2A 3H08A 1J53A 1DARA 1JLFB 1Q1KA 1C1CA 3LOUA 3EJMA 1SC6A 5I3PA 1IG8A 1HX1A 4A8XA 4F4WA 4B9NA 4CJ4A 4PWUA 2ZJRQ 2EHGA 3EWGA 1B0TA 5E84A 4PUOB 1SB6A 4YOYA 4ED8A 3WX4A 2F8TA 5LT5A 3LZJA 2UXCK 3SUNA 5GAEP 3GOIA 1RTDA 1P90A 1OH6A 3ENBA 1RTJA 1HMVB 5KT5A 1RNHA 4ZOSA 1WKJA 3CCVS 4FJGA 4CDIA 2ZWOA 1K8KB 1SJQA 3GFHA 4BWMA 4B3TK 1SKSA 4OL8A 2UXDK 2P5VA 2Z57B 4M5MA 2XLJA 4ZP6A 2FBYA 3W1YC 3QPIA 5DDOC 4QS7A 4IEIA 4DU1A 4YB5A 5I3QA 3KG0A 5HQLA 3ZNUA 1HQ2A 1FK9A 3CPWR 2ADCA 4OJHA 3PR5B 4DCJB 3IXQA 1NKBA 3ZZYA 4C3LA 4BDZA 2JVRA 1S1UA 5HSPA 3HMJG 4CZFA 4LIRA 2LA6A 4KV8A 3SMSA 1J27A 3VEWA 2YKMA 2Y3YA 4U9RA 3N4PA 1XJWB 2A5XA 4B3MK 5F8GA 4CGGA 3MPDA 1V3SA 1RWUA 5DZ7A 1SJ4P 5H9EJ 3G86A 3QATA 3GSIA 3G71S 5BRFA 3ZEUA 1X9JA 4H0YB 3MTJA 3P8BB 4I7FB 2LU1A 1RDUA 4H5RA 2CJQA 3HXMA 3QBXA 1JX4A 4KHWA 4JI5F 1ESVA 3MMCA 4B9LA 3JSMB 1F6TA 1ZM4A 2I8EA 2KXHA 3QGGA 2Y0BB 2CVEA 2D69A 5BPLA 4B1ZA 3RB0A 5FDLA 1BO5O 3P45B 1YRXA 2Q97A 1UVLA 3GIKA 4JI8J 2VBWA 2B4UA 5J2PA 1Z1ZA 2V9KA 3OYIA 2RVJA 4GV9A 4EIAA 3P6YC 1BWVA 1GLAG 4UTGA 3MCSA 3C14A 3PCOB 5GVQA 1YVFA 4GVBB 3CC7N 1BHNA 3QEPA 4PA1A 3SQGA 2AJ4A 4ANEA 1QVFM 5DJBA 3J81j 5B0DA 4W5QA 2B9XA 4KT0C 5EX3A 5D15A 2N7CA 2AJ1A 5BYSA 2W9AA 5HI7A 2N82B 4DSLA 3GJRB 2O1PA 1P6TA 1C6VA 2NCKL 3ULDA 1H3DA 1NWKA 1IKYB 2J9DA 4HEA9 5J1EB 2G2ZA 3IAM9 1FNOA 4YOVA 1VQ4N 2W9CB 4JKBA 1BUXA 3MAQA 2P9PB 1FI4A 1U47A 2ZVSA 4I0WA 4JV5J 2CQDA 1BOTO 2BABA 3ZX2A 1S72S 3FUYA 1T9WA 4O0JA 3TWHA 4OZNA 2VA3A 3QT7A 4C6AA 1Y11A 5FJ4A 3L3UA 4PKHA 2EG2A 3OS0A 3CCJS 4CLKA 5KT7A 2K1RB 5CY4A 1FJGF 4KY3A 5LM7E 3GU0A 1SS6A 1HWUA 4M63C 3RTVA 3VF6A 4ZVHA 4CK2A 3HOSA 1TGOA 1FJEB 2GJIA 3OW2R 4OJ3A 4DX6A 4IDKA 2V0NA 3T69A 4JI0K 4CFDA 1WNEA 4H5TA 1TL7B 3EXCX 4A62A 3MCNA 1K9MO 2B4JA 1W0HA 1RTIB 3OT9A 5D3GB 1WNSA 3P5TL 4L74A 4AQYJ 3RMAA 3TJ8A 2NRHA 3PG9A 2GMLA 4DMNA 1WBDA 5C0YA 1TKXA 1A5WA 1N6QA 4GV6A 4EBCA 2HBQB 3THYA 4FYXB 4JI0J 3L7OA 3UO0A 1K0TA 4NLBA 1F5CA 2VUGA 3HSDA 3VGSA 4ILHA 1U0SA 4A4JA 1K44A 4YHHF 5ETMA 4AHSA 4KI6A 2HFVA 1C0TB 3KKRA 1XUPO 4FF3A 4GO7X 3KJQB 2R7RA 3EGZA 4CFCA 4KBOA 2IOCA 3AFGA 2VGNA 4YY3F 4MQ3A 4DX5A 4CZIA 2XI3A 2C2NA 4DN0A 1DTTB 4K0KJ 1UEUA 1RAAB 4X65F 4QWDA 3VQDA 1IJJA 2E5GA 2RT3A 3TUJC 5DLGA 2OTLS 3ILJA 4TQSA 2F8MA 2IM0A 2A10A 1R6VA 3MGJA 3O1BA 1TELA 4LF4F 1WSRA 3CMQA 3Q83A 4LIWA 4EHTA 4FOEA 1O51A 3FEZA 2CPEA 2EC0A 2VQEK 2PFDA 5EVZA 3UCUP 5I42A 1Z2ZA 1WOPA 5LMNJ 4KHPK 1DTQB 3D2WA 1YUWA 4FJJA 4KHRA 1U49A 3AA8A 4C8YA 1UVKA 4CEDA 4W5OA 4USTA 3ITHA 3NP5A 5ETVA 5GAHU 4KFBA 4DV4F 4NO7A 3UR3C 4ENOA 1WTBA 4JI2J 1PKUA 3H1QA 3VQ6A 3AHPA 5EU7A 3V4MA 1RT5B 3N28A 5IFMA 3B8HA 2PMZD 3TEHB 3HP6A 4AHUA 3CCQN 5AXMA 1RXOB 4P9SA 2QWNA 3KK3B 2MSSA 3Q2SC 2ZJQL 2E2NA 2ZH3A 4JI6K 1TVRA 3VA0A 1UJ5A 5FRNA 2RDJA 4YS2A 1EX4A 2IDLA 3M2UA 2AP6A 1WJ9A 3R5BA 3US5A 3WEEB 1ZOTA 3CGIA 3TUIC 4IFEA 2V7YA 4DL5A 1YZ6A 2J7WA 1BQNB 3MEKA 5AQYA 2D9PA 2LXUA 3KHLA 4GVLA 4I68A 4WK1A 1P1TA 5CYQB 4DR1F 1M5PC 4DTUA 1MW7A 1SL2A 4IOCL 4FWOA 4XH4A 1I94F 4ECRA 1HNWJ 3BEXA 2CPIA 2V7ZA 5IT0A 5ETRA 1CVJA 1KXPA 4KHUA 1D0EA 3DOMA 2YHBA 3QFUA 4AL7A 1XK8A 2P9KA 4BC2A 4FLVA 2KO1A 1JXBA 3W61A 3SCJE 4DUTA 1NK6A 5JVGQ 1A5VA 4H0XB 2N3LA 4O44A 2FJXA 1Y9OA 5DQHA 1S76D 1YZ7A 3CHWA 1QQCA 1WF0A 2ZH6A 4QYZK 1PC5A 2KM8C 4CEFA 4K7QA 3NGDA 4DR7K 1OMSA 4WYLA 4CYUA 4LRAA 2F63A 5IZHA 3CVKA 3ET6B 3RR7A 3HKWA 2BKNA 1TKTA 2XMJA 1XEZA 1CJTA 4XPEA 3DLHA 4GKJK 4HWIA 2AX0A 4X4QA 3W9IA 4F9OA 1B3TA 1S9EB 2NLXA 5BR9A 3K9JA 4WFBQ 5K8NA 1FRHA 1W2IA 1N4LA 2XSFA 3TAMB 1UVNA 2EX3A 2JSXA 3HX9A 5L1JA 1N52B 5KOWA 4JKGB 1KLNA 4FZXC 2P9SB 3NVMA 4IFVA 1FJ7A 3HI0A 1RSCA 2HMIA 1PYSB 4HYKA 5C42B 2LLZA 3BDPA 5BN9A 2VFSA 1F1BB 1LCUA 1S6UA 2P9IA 2J7UA 5KFIA 3IGNA 1FRXA 4JI1K 2EFOA 5KG5A 4RW9B 2GWKA 3CXCR 1X3MA 4UOFA 4FNHA 3NH0A 5D4NA 1NK7A 2HVIA 2J6SA 4GVEA 3CCUS 4DSJA 3P31A 2F96A 2NZTA 4LFAF 3SAGA 5D0RA 4B17A 2DRDA 5AQHA 4FK0A 5C25B 3CJ3A 4MIBA 4CO4A 4ZVQB 3G6ES 4CM0A 4R0JA 3PV8A 2O8EA 1CLQA 1PO6A 3QJLA 2VBYA 2BA9A 4I4BA 2KG1A 1HNXF 3AVIA 5HJYA 5T41A 5KTQA 2HNYB 4NLGA 3KDNA 4IBNA 3OJSA 2X51A 3JQMA 4NZ0A 2O4IA 1VRUA 3IRXA 4JI5J 2BYCA 5IC4B 2I38A 4OLBA 2CGJA 1XR7A 3DRSB 4BC9A 1UZHA 3L8BA 2NPIA 5B0EA 1E3MA 4Y3CA 3KLIB 3LF0A 1QVGM 4ED5A 2QWOA 1Q81O 4JK8A 1C1CB 4P10A 3KUEA 2HNZA 4KGKA 3CCSS 1AFJA 4M63A 4CERA 3HHLC 4FJ7A 1N33F 3OXFA 1GXTA 4MYUA 1SL0A 3AT1B 3T19A 4IJNA 1C1BA 5AXNA 4OYWA 1RTDB 4DFMA 1RTJB 1HRHA 1DJ0A 2VPZB 4K8RA 3AVLA 3OPKA 2LXFA 3RZAA 1R0BG 5M1OA 5J2MA 4WZQA 1LWFA 4LF5K 2DISA 4J9RA 3C15A 1WEYA 4DPOA 3HM9A 1F3FA 2MJUA 3ZZZA 4IWVA 3KUHA 4LREA 4K4YA 4CHPA 3VAHA 3THTA 2AEFA 3T5LA 1FK9B 3VEVA 4FS1A 4HVZA 4HH1A 4IOXA 1GFWB 1RHQB 5AQWA 2H5EA 2J9DE 4ZLNA 2P9UA 3MXHP 5HL7L 4H5WA 2B3TB 2XULA 2FIUA 2BV3A 2VGMA 1ZPVA 3QERA 1S1UB 2JX2A 4PWDA 3D3BJ 4FXVA 3DDIA 1FJGJ 1FWLA 4KV8B 3BS9A 2D3OR 1EKSA 1X60A 2YKMB 2JHEA 4YORA 1T3OA 2CQBA 5KFHA 4LJMA 1WC6A 1KVCA 1M5KC 4MO4A 2VODA 2Z30B 1PAUB 3ZEUB 2RU9A 4CH7A 2C2KB 3OQ2A 2QLWA 2KRBA 1KQSM 1RYRA 3RSEA 3R8YA 4DFJA 1YBAA 1LAWA 3MMCB 3N4WA 4KAZA 2F8EX 2H4WB 2ZKTA 4B9MA 3CDEA 4M3XA 5FDLB 1IR0A 1QUPA 4JRPA 2I1RA 3NWRA 1OPZA 1ZA1B 1BC6A 5J2PB 1RBLA 3L7PA 3T9ZA 1ITPA 5KFXA 2YBVA 2RHSB 3D0GE 4PG4A 4CIFA 3C14B 2A1RA 2XTJP 4OZ3A 1L3UA 2OUGA 4OPAA 4YHHJ 1RCHA 4DX7A 3SQGB 5L38A 2ZQBA 4OYZA 4PKGA 2PEHA 4DV3F 1YTAA 4NRUA 5DS7A 2Y8YA 4MKBA 1X7VA 1CLFA 3E8OA 4DQQA 4DQIA 2AEJA 2B6AA 2F9TA 4PRFA 5A2QU 3K8VA 3DI6A 2RUGA 2HSEB 3QNWB 2ZHOA 4CBXA 2W01A 3N0VA 1FRIA 1CZAN 4A46A 1FEHA 1ZAXA 4X65J 3UCGA 3QEXA 5EUHA 4HLBA 2MXYA 3CCVN 1FFSB 2DK2A 1KTVA 3QJPA 1Q53A 2AGQA 4IH7A 2M3DA 5JS2A 2V2QA 4PL7A 5CZ1A 4LF4J 1VQ8S 3F41A 5AZJA 4OHZA 3FBBA 3QLHA 3MTKA 4DQ8A 1VLYA 4LMZA 2HQGA 1HWIA 2ZFHA 2H1YA 3D54A 4U7UD 2KT2A 4M5HA 2K2PA 1WI8A 4YOWA 3B8AX 1Y4ZB 1RBOB 3Q7CA 4UY8T 1UPMB 1WHWA 3Q24A 1KD1T 2CKWA 3OTOJ 4IDKB 5TKWA 3CWJA 1IWGA 1U1KA 3BO4A 1KN6A 3WNGA 3AVAA 5GINA 1REGX 2ATCB 2B0GA 5IT9Y 4USIA 2VPXB 1JJ4A 2E20A 1SJ3P 2P9NA 1PAEX 4D3HA 2QXLA 1Q79A 4DPUA 5KFCA 1AT1B 4LUBA 3IWXA 2ZH8A 1TKXB 3K8WA 1HR0F 4E1JA 1N6QB 4CGIA 3MMAA 2B9YA 2X74A 3THYB 4Z7CA 4GC6A 1TMJA 1L3VA 3FBEA 4I69A 4UUWA 2Z4PA 1I1GA 4USMA 4KHMA 1SH2A 3QFWA 1AYEA 1Z25A 2DFEA 3GZ7A 3V6DA 4NLQA 3VQ9A 1BUPA 4ILGB 4YR2A 3B6PA 3G10A 3GYXB 5ITHA 2H9ZA 1BCOA 1S57A 2HSTA 2BJEA 1I94J 3O5TB 1WDDA 2EKYA 2O4GA 3UKUA 4OLAA 3BQ2A 2RRNA 4J9VA 2FXUA 2IJFA 4CEEA 1ZS6A 4H4MA 3OYJA 3P1GA 2IY5B 3HZ6A 3UPFA 5E7OB 4DFKA 3BBCA 2NSBA 3EY1A 2D0AA 1JQGA 4ECUA 3CB4A 3BREA 1B0PA 4ZPVR 3D68A 3GE1A 2DNLA 4RW6A 3D7SB 4CEAA 4NXNK 2OMOA 3HK2A 3ATUA 2AQ4A 2VQEF 4ZPBA 3IGVA 1J54A 4KTQA 4ISGA 4JB8B 4LD0A 3VTIA 2Q6BA 2BM0A 1V6HA 3B54A 4BRNA 3SIPB 1G1XA 4CIOA 3ENHA 1MG7A 2PA8D 2B4VA 5I42B 4DLGA 2P9GA 1IH7A 4ZPTR 2F4FA 4WFNQ 1K6YA 2KXNB 1XNQK 5H1SV 1L3KA 3HSJA 2LSNA 5KFSA 6FD1A 2HAIA 3AY0A 2C2MB 3NCRA 2RQ4A 2P1JA 3EO3A 2XNRA 2DR9A 1Q7YT 2HHXA 3LWMA 4AM6A 3ITHB 4YFUA 5LJWA 4KFBB 5EN1A 3WUHA 2HVHA 1YJWS 5JMVA 2R2TA 1BQMA 2V69A 1WC1A 3ZXWA 2WOMA 4P2MA 4HL9A 4UOHA 3PIPL 3GFYA 4ZPCA 2W4PA 1VK8A 5BXIA 2CQCA 1BG3A 3CCRN 4JI3K 4DF8A 2OGUA 4ED7A 3NAEA 1W25A 1TVRB 2MZSA 3E51A 2MMYA 3N01A 3KUGA 3M2UB 1BIUA 2HURA 3MAHA 4RG8A 5AXLA 4CLTA 4DS5A 2OKQA 2QL5B 2L9WA 1XHXA 3T1HF 2J4RA 1X0FA 2QMXA 4CLYA 2X7IA 3OR2A 2LFVA 5A6PA 3FLCO 3OHAA 1U24A 1KFDA 4A47A 2CJBA 4M5GA 2GELA 1V4TA 1EZZB 3DOMB 2HFSA 1C4AA 3OL6A 1X5SA 2P9KB 3D4JA 3MECA 3ELHA 1TMMA 2ILZA 3BSCA 4ZMMA 2CH5A 2WW8A 4O3QA 4O44B 3A5OC 5HO4A 2JLGA 2WTUA 4RNMA 2XZDB 3W65A 1FE4A 2BEFA 5AE3A 4LFBF 1NPPA 4CYUB 4GKJF 1SPBP 2OTJS 3FEXB 3DJCA 4BRFA 2FZCB 3O3GA 1QUVA 2R9LA 2M52A 2JFDA 1N33J 1TKTB 3HVAA 3GILA 5B08A 2MQLA 3H5YA 1CJTB 3NOGA 3E9PA 2HQ3A 2AYMA 4EU0A 4XH5A 4CH1A 4EYIB 1KAYA 5KG6A 4PAAA 4YB6A 5A8KA 3GFZA 4ZJOA 1NDKA 4FK2A 4HHHA 2OAUA 5FPDA 2JC1A 3ILOA 4IFVB 2YHWA 3JS9A 3CCWA 2HMIB 1S1WA 1NG9A 1FDBA 1VYAA 3T1AA 1CPZA 3LDQA 4OYOA 4ECYA 1BWFO 2P9IB 4PYDA 1UOCA 5AR0A 4PY5A 2B43A 4P7VA 3GE9A 3KMSA 2WZ1A 2X6NA 4HTLA 3OA9A 5EHHA 3IP0A 3F0NA 4X64J 1UZDA 1DZ5A 1RDDA 1HI8A 3PVXA 1MU2A 2K7KA 3K5MA 1RB0A 2HBLA 2ADBA 2O8EB 4C8ZA 1X5TA 2YH0A 2DNQA 3MR7A 2M8DB 2AP1A 5K8OA 1Q0NA 2R8IA 5K14A 2W9BA 4MK8A 3KLVA 1U48A 1BA0A 2WVBA 3DU5A 2VWBA 3H6EA 1VRUB 3IRXB 3P38A 1M1KO 2G2OA 1NU0A 3FMBA 2IS3A 1BLUA 4L3QA 5HATA 2UVWA 3V1QA 5AQXA 5CA5A 4DSKA 1T03A 4KH5A 2UU9K 1JB0C 3WHIA 1TP7A 2GHVC 3I82A 4O3OA 4A2BA 4PG6A 2CPHA 1TYQA 4DV7J 2JJ4D 3J81O 1YITS 2HNZB 2DO0A 2D9OA 3EGWB 2W2PP 1VQ5S 5BPNA 5AQJA 4PEOA 2E5LK 1ZAWA 2GO8A 3SDEA 2CPDA 3OD2A 1HBNA 2PI5A 1C1BB 1RBUA 4AM7A 3I87A 2OANA 4DV3J 3RJMB 1NK9A 4CTAA 3H3OB 1W2BR 1S0NA 3KHRA 4DL7A 3RB4A 2P6TA 3AD8C 5LXYA 4C23A 2HIQA 4QZVB 3SQ4A 5J2MB 1LWFB 1BE4A 3K2YA 2FJAB 4FF2A 5HLFA 1QAYA 5MLCQ 3KNAA 3C15B 4OLPA 2V6AA 4DPXA 4DU4A 1MMLA 1WC0A 2HPUA 3DLLQ 1BXNA 3BB5A 3NBPA 1E6VA 4WFYA 2HHQA 2C2RA 5DDPC 3EE3A 4M3TA 3R2DJ 5HANA 3BSOA 2DITA 5BREA 1AUSL 2XY8A 3MD1A 4CRJA 1U02A 4HHJA 2IVMA 2Y1IA 1IBMJ 3OYBA 5DG7A 1ZBFA 2Y1LB 2HAFA 2P9UB 4Q44A 2YVSA 2VG6A 3GJQB 2I6WA 2NSCA 1TUVA 2G8VA 4DUYF 1TL4A 1XMQF 4PWDB 4HACA 3CJQA 1FFWB 5AE1A 3UDVA 3BSNA 2KFNA 1KAZA 3OYFA 2E5HA 2VA2A 2D74B 3M30A 3SFUA 2YNIA 3FGVA 4DN9A 4CF0A 1HBOA 1SUQA 3DYAA 3LP1A 3MK6A 1YG0A 4F2RA 4O5BA 4DV1F 2HFZA 1T95A 2V2VA 2HHHK 3RSEB 4LR9A 1TL1A 1RHMB 4O0IA 4GMJB 3MF5A 4C8LA 1N5VA 1AFIA 4CLLA 4O3SA 3TSPA 1RAHB 1UVMA 4BHQA 2YNHA 2UP1A 3I56N 1HR0J 1GTHA 4DXLA 3KHYA 2DGSA 2UUBJ 4JI7F 4CHNA 1RUSA 5L46A 4NLCA 2VQFF 4I9LA 2YKNA 5FPNA 3EL2A 3OSPA 1ZETA 2E1AA 5F8JA 1KQFB 1F5BA 2QMWA 2BQUA 2CWXA 4RNFA 4QWBA 3PJ9A 3AO4A 4CECA 1FNMA 3POTA 4BE0A 4Y2MA 3NGUA 3Q8YA 1IBKF 1NUEA 1WG4A 4NA2A 1QAXA 1RBSA 4JLHA 2YHXA 2GMJA 2B6AB 4QWEA 5DG9A 3DI6B 2BM1A 3AD9C 4LH4A 1NO8A 2QA4N 1VQNN 2JRSA 3D6RA 2VC0A 2DB1A 3ATVA 3MEEA 2UVVA 1N34K 2V50A 3H2UB 2FLNA 1IBLK 2QO3A 3GCXP 1H73A 3QEIA 2NUUG 3QLHB 1GNKA 3KXDA 4CLFA 4OKEA 2XLKA 1WC5A 3RBZA 4RU2A 3A0IX 4Y28C 1S48A 4HH0A 5FLXY 5DM7Q 2CQGA 1D9AA 3A3PB 2J8SA 1EAYC 1R27B 2FC9A 2IVPA 4I56A 2PAVA 4F67A 3F9KA 3CPWM 4DR2K 4ID5A 2HB5A 1RHJB 1H1VA 3SPYA 2A6OA 2RQCA 3Q8UA 4G1PA 2GHWA 3LDPA 3CIPA 2ALZA 2PDAA 2KM8B 3OJUA 1KOHA 3GYGA 4NA3A 2ZC3A 3AVJA 4FLYA 2P9NB 2RD5C 5FPMA 1BQXA 5KG4A 3H5UA 2HBRB 2GVZA 2R4FA 3HULA 4WP3A 3KLFA 4FJIA 3MMAB 3VOVA 4ZCKA 3NAIA 4ELUA 1X4AA 5G0RA 2P6SA 3T1HJ 2XYGB 2W24A 4ISEA 3UVJA 3LPYA 3NOCA 3V6DB 4MJKA 2ZC4A 5DLFA 4AXJA 5BJRA 1RQ0A 2B5JA 5DQGA 2NR0A 1U1LA 4Y2KA 2XI2A 1VQ7S 2J9CA 5B0BA 1N8RO 4HTIA 3UKUB 3PEJA 3DU6A 2GV9A 3EN9A 2XS5A 4IQMA 3O80A 2FD2A 4H4MB 3FKBA 2PSZA 3SAHA 2IIHA 4ZN3A 2HLTA 3M9NB 5CE3A 2FC8A 5F8IA 4MIAA 3DRPA 1CXQA 4J9NA 2BJ1A 2XWYA 2VDIA 3WX8A 3ZZTA 1IM6A 4ELVA 5GIOA 2ZUAA 3CDUA 1RAGB 4USWA 4ZVUB 4CNYA 5E0OA 2MKKA 1JK9B 4CJ3A 3ZZOA 4RW6B 1NB7A 4K4UA 1FVQA 1S49A 5CZ2A 2ASMA <