4O4GA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 134
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o4gA05
1CSJA 3G10A 4KBIA 3O3FA 4ID5B 3VQAA 1YVFA 4LH4A 1TK8A 1RTHA 3IG1A 3C94A 4ECQA 4PWDA 4IH6A 2F8SA 4DTRA 3QETA 2OYQA 4ZP8A 4MK7A 3KMSA 1IKVA 4AHCA 4DF4A 4FLUA 4E7IA 3QEXA 3PW4A 1VSMA 1NJWA 1XR7A 1NJYA 3BSOA 3OSNA 4GC7A 3OL6A 4FK0A 4RW4A 4Q44A 4EBCA 4QWCA 2WOMB 3SYZA 2DPIA 3KHHA 4XIUA 4CF1A 4CIFA 4O3PA 4J9PA 5I42B 3OL9A 3I8DA 4KHQA 3DMJA 4ECRA 3DLKB 4OLAA 4FJGA 1QAJA 3AVIA 4NLDA 5KFFA 1RBSA 3SZ2A 3QNNA 2OZSA 4W5RA 3KLVA 3DLRA 3ISND 4K4XA 3V6DA 5KFNA 3GV5B 3RMAA 3L2VA 2VWKA 3PW5A 2ZKUA 4DTSA 2JEFA 1NK4A 3MFIA 3H5YA 3DRSB 2FLPA 3G6XA 5CYMA 1RDDA 5KFJA 4RW6A 4DLGA 4FBUA 5DGAA 5SZTA 3HK2A 3DDKA 5KGWA 3KK1B 4CJLA 2XY5A 2HHWA 4IDKB 1T05A 1S1UA 5C42B 3RMBA 2UVWA 4CFDA 3AA4A 5T14A 3LANA 3KLFA 3RMCA 2E9TA 2E4LA 3D5MA 1KTQA 3V9SA 4DTOA 3KMQA 3OS2A 3NGYA 1ZTWA 3AVJA 1HJRA 3KK1A 4YR2A 5KFGA 3OYAA 2QXFA 4KHWA 1D9FA 3KJVB 3V81A 4ZVEA 4TQRA 1WAJA 3T1AA 3Q8SB 4IDKA 2WB4A 2FBYA 4KB1A 1RDRA 4K4VA 4Z4FA 3T3FA 3QZ8A 1IKWB 4I2PA 2DFFA 3V9ZA 1N6QB 3H4DA 3VA0A 1OS5A 1D0EA 4OGEA 1S9GB 4NCBA 4ECUA 1WSHA 4CEZA 4CGJA 3OYCA 3KLGA 2XI3A 3DRRB 4MKAA 3TARA 3L2QA 4O44A 2EHGA 2W7OA 3AVBA 1IKYB 2RF2B 4DWIA 3IGVA 2X6NA 1GX5A 1NOZA 3M8PA 3P83D 4CJ4A 4YMEA 3KD1E 3L2UA 3H59A 2IDOA 1VRTA 1MMLA 1S9GA 4I9LA 2HAIA 1XHZA 4MH8A 4CHNA 4DU3A 5KFMA 1TVRA 3MXJA 1HQUA 1HPZA 4KHUA 4F3OA 3QGGA 3WNGA 2IMWP 1ZYQA 1C0UA 1JLCA 1JLEA 3GQCA 3ZT1A 1LW0B 4E0DA 2AGPA 4FZXC 1SL1A 4PQUA 4ZTJA 3V6KA 2XY6A 1GX6A 3SFUA 4ICLA 4NLOA 4Q0BB 1ZBLA 3AVMA 3OYEA 4FLYA 2OPQB 1VSJA 3BSNA 1RBVA 2DFEA 5DQGA 1L3TA 5HROB 3SI8A 5CZ1A 3BGRB 3LP2B 1S4FA 4K8XA 3H5UA 1LW0A 4F4YA 3MR2A 1VSDA 1TKXB 3OYHA 1CLQA 4LSNB 4Y34A 4IG3A 3OL8A 4KO0B 4HCBA 4KV8B 4O5BA 3OYLA 4LH5A 3SQ4A 4I2QB 4URGA 1LWFB 3LZJA 4G3IA 2YNFB 3M9NB 5HROA 4Q43A 4DQIA 3VQ9A 1XHXA 3CWJA 3LP2A 4IRKA 2AU0A 4U7CA 2HNYA 4BE1A 3PO5A 1B9DA 1TKXA 4KI4A 3CJ4A 4RW9B 3QINA 3B6OA 3T5KA 3AO2A 2IJNA 5KT4A 3FFIB 4WZQA 1JKHA 5KFBA 3JSMB 1VSEA 2BRLA 3CJ2A 3ZSRA 3EPIA 4EZ9A 4DFMA 4U6PA 2YNFA 4YR3A 2AJQA 2V4QA 2ZE2B 4IRDA 4DG1B 3RRHA 2XGQA 4NCGB 1RT6B 3HPHA 4RW9A 1RDAA 3DM2B 1QE1B 3T19A 2KTQA 4PUOA 2HVHA 4AHTA 4FJ5A 3PY8A 2R8HA 1TKTA 4NYFA 1T94A 4M3XA 1NK6A 1REVA 2AWZA 2YNHB 5KFOA 2CKWA 3HL8A 4CGGA 4IR9A 2YNIB 2ZE2A 1X9SA 4DG1A 3E01B 4KTQA 2G8FA 4NCGA 4ZP9A 1RT6A 1DTQB 4RNNA 3NGZA 4O3RA 4CFCA 1X9MA 3FDSA 3KHGA 4YQWA 4FM2A 3E51A 4O55A 1S97A 1I6JA 4EO6A 3V9UA 2RKIA 4Q8EA 1NHVA 3RB0A 3E01A 4DL2A 2IOCA 4O3NA 1D8YA 1BCMA 3OYJA 3OYFA 3NH2A 1HNVB 1S1XB 4CHPA 1TK0A 1HYSB 4RUCA 1TK5A 1YVUA 1DLOA 3CIZA 2P51A 4IG0B 1ASWA 3TAGA 3SPYA 4HUFA 2FBVA 3A2FA 1RTJA 4F2RA 5KFXA 3C6UB 2Y1IA 1JL1A 4K8ZA 4ECSA 1RDCA 4L8RB 2BR0A 5EWFA 4HTUA 1TV6B 1HNVA 1S1XA 5JUMA 4NZ0A 2FJWA 1ITGA 4KKOA 1RT5B 4B8AB 4FXDA 3EYZA 2QE5A 3I0SA 2ITGA 2F8EX 3K57A 2W9BA 3L3UA 3PZPA 1B92A 1ZBHA 4W5OA 5F9NA 2IM3A 2FVCA 3KK3B 3SNNA 4RNHA 1JXLA 3KTQA 5DG7A 2WRMA 4DQSA 4E1MA 1NKEA 1ZTTA 4YFUA 2HHSA 4ZMMA 2OPPB 4DTJA 1S9EA 1NKBA 1C2PA 5HP1A 3V1RA 1RAJA 3FQKA 4RW8A 3D0PA 2YHBA 3MEGA 1BQNB 3KKRA 4CJ5A 4DFKA 3UPFA 3SUQA 1RT7A 1J54A 4Z0UA 3QEPA 4KB7A 4EYHB 4F4XA 5KG2A 2FVPA 2XRIA 4IFYB 1XWLA 4CJWA 4Z4IA 1RYRA 4R5PB 2Z1JA 5KFCA 4FS1A 1HQEB 4CJTA 4BE0A 4DL6A 4QOZB 3KD5E 4KHNA 1RTDB 3CFPA 2BDPA 1S49A 3NF8A 4OKJA 4O3SA 5KTQA 3RR8A 2KFNA 3NBPB 4IOBA 4HVJA 4IFYA 4ZP6A 1TKZB 5DLFA 3H5SA 4AHSA 3H5XA 4WXWA 1U09A 3PVXA 3NMAA 3HVWA 3ZSWA 4J2AA 4DSIA 2HB5A 3ZT4A 2D3UA 3DOKA 5EUHA 3N6MA 2V9WA 4FVMA 2BE2A 1LWCB 3C95A 1HNIB 4J9LA 3V6HA 1UOCA 1TKZA 4QW8A 3TR8A 2GC8A 4EBEA 4ECWA 4K4TA 4W5TA 1JLFA 4IFVB 4CF8A 1HARA 5KFHA 1C0TA 3TWHA 1QTMA 3OY9A 5KFIA 1JLGA 1HNIA 1Y97A 2UUTA 4NLSA 4OKKA 3CDUA 4ZP7A 3ITHA 2G8VA 2D3ZA 5J2NA 2KZZA 3TAMA 3CYMA 1NK0A 4KFBA 2R7YA 4JRQA 1FK9B 1EETB 1B9FA 4J9NA 4W5NA 3VQ6A 1SH0A 4CFAA 3NF6A 2Z1HA 4DQQA 1ZBFA 4MKBA 1UA1A 4LD0A 1RT3B 4B9VA 4CHOA 1RNHA 2DFHA 4I7FB 4MIAA 4FJIA 4KHYA 1C1BB 3GIMA 1VRUA 4TXSA 4DF8A 1N56A 1WSIA 4J9MA 4FK4A 2ASDA 3O4NA 4Q5VA 1FK9A 1EETA 3NGDA 3SQ0A 3EZ5A 3GIIA 1RT3A 3BQ0A 3HVTB 4M95A 1JLAB 4X2BA 4ED8A 3WNFA 4O3QA 2R2TA 3FRZA 1QSYA 3MR5A 1HYZA 1TL3B 4M3UA 4J9QA 3RB4A 3OHBA 1RCHA 1TKDA 4ECXA 3G6VA 3G6YA 4HCCA 4CJUA 1S1TA 2PYLA 4NRTA 2HHXA 1JLAA 3UR0A 4FJHA 3HXMA 4TY9A 1D5AA 4F4ZA 4R8UA 3KNAA 3SV3A 3TI0A 2F8TA 4B8CA 4CESA 4NLTA 1QHTA 4W5QA 1VSHA 3TQ1A 1A5WA 4BDYA 2JC0A 4ID5A 4WE1B 4PA1A 3HYFA 4OPKA 2Z1IA 4Q45A 4ED6A 1JIHA 4NRUA 4KI6A 4F3TA 4PY5A 2I1RA 1GOAA 1J5OB 1WNEA 3Q8RB 3KHLA 3PX0A 5DLGA 1LAVA 2W7PA 4QWBA 3I5CA 2WOMA 3QIOA 3SFGA 4CECA 3OYMA 4WE1A 4FW2A 1Q9XA 5C5JA 2ETJA 5I42A 3ZSYA 2DPJA 4DSJA 2XY7A 4DU4A 3KHRA 3DLKA 4B9UA 3SUNA 3SV4A 3AVKA 5KFDA 4CIGA 2WCXA 3AVNA 4DTNA 3IRXB 4DTUA 1KVAA 4M94A 3OS0A 1U49A 2W8KA 2G8IA 3DRSA 3QZ7A 4CCHA 4MK8A 1SH2A 2JEJA 4MFBB 1SKRA 4FLTA 4KHMA 4C8OA 1LAWA 3CM5A 5KRTA 4Y1DA 4FJ9A 4DQRA 3M8QB 5KG7A 4B9MA 4C8LA 5J2MB 2ATLA 4O0IA 4E7KA 5C42A 4EO8A 3MXIA 3RBDA 4MQ3A 5KG6A 1NKCA 4DSEA 4MFBA 2FLNA 4URSA 4H4MB 3AA2A 2P5GA 3TAPA 4J9SA 4ED2A 3SUOA 3QO9B 4TQSA 3CQ8A 1QSSA 4DU1A 4ED1A 3M8SA 4M42A 3VQCA 3H08A 5DG9A 3KJVA 3LP3A 3ZSVA 4QWEA 2R8GA 2IGIA 4M3ZA 3DOLB 4FS2A 3V9WA 3F73A 2ATQA 4M3WA 1LW2B 4KHRA 2YNGB 1IKWA 3AVFA 3QGHA 3NL0A 2HNZB 3QLHB 1N6QA 4NLQA 4IKFA 1MU2B 2IS3A 5KFYA 4QCLA 4J2BA 1QAIA 3NE6A 4DL7A 4F8RA 3V4IB 2O5DA 3DRRA 3M9MB 1A5XA 4F2SA 3LP1B 4WZMA 4ED0A 1DTTB 3QESA 4KB0A 1LW2A 1IKYA 2RF2A 1RT1B 3BQ2A 5F8MA 4NLXA 2XGPA 3PHEA 1LWEB 4J9OA 1TGOA 3HHKA 4B3OB 3VQ5A 5FRMA 3PUFA 1BHLA 4CJ3A 3NAHA 3BREA 3VQSA 3V4IA 4RNOA 4E1NA 4B08A 3TANA 1DTTA 1UA0A 4FK2A 3V1QA 3OYDA 4KE5A 1RT1A 4K4ZA 2HHQA 2KZMA 3UQSA 4ZVFA 1S1VB 4OGCA 4AHRA 4BDZA 1KRPA 2KFZA 4WFXA 2E6MA 2VG5B 5SWMA 1W0HA 3L8BA 1NK9A 2HHTA 4DSKA 4Q0BA 4JV2A 2OPQA 4KAIA 4B9LA 2B43A 1KVCA 3SI6A 4CJEA 1BIUA 3ASMA 3BGRA 2LSNA 1KHWA 1CZ9A 2XY8A 4RNFA 3HPGA 3KKSA 4LSNA 2BGGA 1SV5B 4KO0A 4GC6A 1RA6A 4KRFA 3RB6A 4H4OB 5KFQA 4KV8A 5L9XA 4I2QA 3V9XA 1LWFA 1S10A 1K6YA 4ECTA 3CG7A 4BWJA 1RBTA 4QW9A 1RTIB 2AGOA 1JX4A 2HWIA 3BR9A 3KLIB 2W9CB 1UWBB 4NYZA 2D41A 2HW3A 1SV5A 2O4GA 4M41A 3T5LA 4CERA 3QIPB 3SJJA 1C1CB 3DYAB 1T8EA 3FFIA 2J6SA 1T03B 4CIEA 3JSMA 3KK2B 4NYNA 3QEIA 3LWMA 2WHOA 1S9FA 1L3UA 1WSJA 4TY8B 3NHGA 4F50A 3QERA 3KLIA 2W9CA 4EZ6A 4M45A 1GOBA 4K50A 4I9QA 1T7PA 3VQ7A 3VQ4A 3DM2A 1QE1A 3QIPA 1C1CA 1FKPB 4XO0A 3L2WA 5KRSA 3KK2A 5F8GA 2PYJA 3ULDA 3U3GA 3DRPB 2YNHA 3HPOA 1L5UA 3CJ3A 2YNIA 4QWDA 3G0ZA 3LWLA 4OL8A 1SL2A 1DTQA 5KT3A 4YR0A 2KQ2A 3ZSOA 4CF2A 4K4YA 2J6TA 3HT3A 5F8IA 4HYKA 3BSCA 1JXEA 4CF0A 4E19A 4Z4HA 4NLPA 3RBEA 3KOAA 1IKXB 2JLEA 2AX0A 4DTXA 4C8KA 2XWYA 1W9HA 2JGUA 4AHUA 2W42A 1CZBA 2A1SA 4CJPA 3S3OA 1RBUA 3HP9A 4CJKA 2RDIA 4LY7A 4Z4EA 1RT4B 1HYSA 3THVA 1KHVA 1LV5A 1U45A 1NK5A 4IG0A 2C2RA 3PX6A 3CJ0A 3EPGA 5E41A 4ELUA 2OPSB 3C6UA 3HP6A 5CZ2A 2G8KA 3K5OA 1L3VA 3H98A 3IAYA 1N5YB 1TV6A 3N6NA 1RT5A 5CYQB 4QWAA 2AQ4A 2C22A 5HRNA 1KCFA 2FC0A 4G1QB 5HRPA 4BDPA 1N48A 2JEIA 2ILZA 4FJ7A 4DSFA 2FBXA 3L3VA 2HMIB 1YTUA 5C24B 2YKNB 3UDLA 2OPSA 4ZPCA 2RDJA 4LQ3A 2D0AA 4FLXA 5FDLB 3KK3A 4WYLA 4FLVA 1S6QB 3C6TB 1VSKA 1FXXA 3DLGB 5CYQA 1HYVA 3PR4A 3NAEA 2OPPA 4G1QA 3V6JA 3MFHA 2IA6A 5KFTA 1FKOB 3OLBA 4Y3CA 3PW7A 2YKNA 1RT2B 1BQNA 4WYWA 1NK7A 3LPTA 1IG9A 5FDLA 2D0CA 3SQ1A 3LAKA 4JV1A 4F4WA 3SPZA 4RU9A 1WSFA 2R8IA 1TAUA 4AILC 4CFBA 5HBMB 3OJUA 3JYTB 4R5PA 4HUGA 5I3UB 2YKMB 3OJSA 1FKOA 4EEYA 1TL1B 1HQEA 4DFJA 4J2DA 4WFYA 5KFPA 1RT2A 1J9AA 5HLFB 1C6VA 3K5MA 5K14B 4E7JA 2X6SA 4MK9A 1RTDA 3I5AA 2ZD1B 1BI4B 4ZHRB 2YHAA 4CEBA 4CGFA 1R0AB 3CO9A 2EC0A 3GV8B 2G8WA 3OL7A 1ASVA 3NBPA 2VG7B 5D3GB 3MR3A 3JYTA 3PX4A 3DLEB 5I3UA 2YKMA 5CY4A 2BQ3A 3OYNA 4JV0A 4N56A 4YNQA 4TYAA 2OPRB 5HLFA 5K14A 2B6AB 4FJ8A 5FRNA 1BI4A 4ZHRA 5F8JA 4DTPA 3CDWA 4HUEA 2FVSA 3HKWA 1LWCA 2VG7A 2B5JB 4CEAA 4DS5A 5J2PB 3LP0B 5KG4A 4M3TA 4M3YA 3HM9A 4TYBA 5EWGA 1S0NA 1RDBA 5DK5A 4IFVA 4FCYA 4N41A 3ZSXA 4CJFA 3VQQA 3O4QA 4RW7B 2ALZA 3OLAA 3ZT3A 2OZMA 1RYSA 4AHVA 2B5JA 2R8JA 5J2PA 3Q8QB 3NFAA 1VK0A 5J1EB 3CJ5A 3LP0A 3D28A 2GV9A 5JS2A 4FM0A 2AGQA 5KFSA 3ALYA 2HHUA 4RNMA 3H2LA 1NJXA 2V0NA 3ZCMA 2J6UA 3RMDA 4FJLA 4RW7A 1J53A 2VG6B 3NF9A 4ZPBA 3HVAA 4I7FA 3GYNA 1XI1A 1C1BA 5KT7A 1X1PA 3IG1B 4IQXA 1TP7A 4OLBA 3H40A 3AVAA 4K4WA 2PY5A 4B9TA 4KTWA 1ZBIA 3OVNA 4CEOA 1W25A 3HVTA 1I39A 4RUAA 4F4KA 4GMJB 4JLHA 4JRPA 2Y1JA 4HHTA 1VSFA 4M3RA 4DL5A 3PV8A 3CVKA 3DLHA 3TVKA 5DGBA 1TL3A 3GILA 3T5HA 3CFRA 4NLWA 3GIKA 3CM6A 4KREA 1XR6A 3DMJB 5KG5A 5F8HA 1NHUA 3VA3A 4E7HA 2GIRA 1KLMB 1G15A 3PW0A 3NF7A 3V6DB 5KFWA 2RPIA 1U4BA 1D9DA 4B9NA 3M9OB 2F96A 5KG3A 3MECB 5KFKA 5CYMB 4RW6B 2IM2A 2XCPA 3HSTB 4KAZA 2BANB 3IS9B 4FYDA 3KLEB 1J5OA 2B4JA 1KLMA 2C28A 4ZTFA 3P5JA 3RR7A 3SCXA 1K1QA 3AVHA 1T05B 3U3YA 3AVCA 1S1UB 2IJFA 2DTUA 2V4RA 3MECA 4KPYA 3KLFB 3OSPA 3LZIA 1Q9YA 4C8MA 1S1WB 5KFLA 2FJXA 2BANA 3IS9A 2XCAA 3KLEA 1WNSA 2GBZA 5JXSA 3AO3A 3RTVA 2WK4A 3V81B 3KLHB 1F21A 4CHQA 3NH1A 3IRXA 3MEEB 4CHYA 2R2UA 4I2PB 3AO4A 1KFSA 4H54A 1SKWA 1SL0A 1S1WA 3MF5A 4LSLB 3MEDB 1HMVB 2QV6A 5EU7A 4UQGA 1NK8A 4FZZA 3S3MA 3KLGB 5DMRA 3M8QA 2P1JA 1JLQB 4O44B 3KLHA 2WONB 2FJVA 5J2MA 4RG8A 4TSXA 1WLJA 1KLNA 3MEEA 4DEZA 4FZYA 1S48A 3EY1A 3M8PB 4DMNA 3WNEA 4H4MA 2QKKA 1VRTB 4LSLA 3MEDA 2XC9A 1HMVA 1K1SA 4CK2A 3QO9A 4DTMA 1TVRB 2UVRA 2Z1GA 1WAFA 1EP4B 2FVQA 1HQUB 1JLQA 1HPZB 3PR5B 4ECYA 2WONA 4FJKA 4FW1A 3QGIA 2EX3A 2G8UA 1VSIA 3DOLA 1NNDA 4NLGA 4ED7A 1C0UB 1JLCB 2OH2A 2ASLA 1JLEB 1EKEA 1TAQA 3MTKA 2IBKA 1WN7A 2YNGA 2HVIA 2E6LA 2NUBA 4PQUB 2HNZA 3QLHA 1JL2A 2D0BA 3LDSA 3VQ8A 3BQ1A 2BQUA 3SQ2A 4NLRA 1MU2A 5L1JA 4ICLB 4GW6A 2I5JB 3WNHA 4FJJA 1EP4A 4NLVA 4ELTA 4K4SA 1WSEA 3RAXA 3LP1A 2E9ZA 1U48A 2Q3SA 2D7SA 1S6PB 1LWEA 4IG3B 4O4GB 3VQBA 2I5JA 4DSLA 4B3OA 4CGIA 3O3GA 1X9WA 4N47A 4CGHA 5L1IA 4O0JA 3LAMA 3I0RB 2FBTA 4Z4GA 3GV7B 2G8HA 3MR6A 2HNYB 3AVGA 3AA3A 1S0OA 3I5BA 4IKAA 1S1VA 1S6PA 4O4GA 3NDKA 4ECVA 5DQHA 2VG5A 2KW4A 5KT2A 3VQDA 1JKHB 4DQPA 5KFZA 1UAXA 2X78A 3AV9A 2C2DA 1Q8IA 3I0RA 5KFAA 4O4RA 3ZSQA 3DI6B 1A5VA 4J9RA 3S9HA 4DLEA 2R2SA 2AX1A 5T7BA 4R0EA 2UUWA 1O1WA 2A1RA 3D45A 3K58A 4WXOA 4CE9A 1S0MA 4PUOB 3QEVA 4GVMA 3MAQA 4J2EA 3NKYA 4NLUA 1TKTB 4J9KA 3NCIA 4H4OA 1BQMB 1REVB 1SUQB 3DI6A 5HRRA 3QEWA 1Z26A 1RTIA 2XI2A 4DL3A 5KGXA 4ID1A 4H8KA 3BDPA 2UVVA 5KFVA 1UWBA 2W8LA 5F8LA 2BQRA 5C25B 4CEQA 3HO1A 5KFRA 4CJRA 4CF9A 4CGDA 4ZPAA 3DYAA 2W9AA 2QK9A 3HJFA 2BRKA 1T03A 1BQMA 5EDWA 1SUQA 1Z4UA 2P5OA 4E3SA 2RKIB 4IH5A 4Y2CA 4ZVHA 4XPCA 3K2PA 3KIOA 4TY8A 3OYGA 2IM0A 4QAGA 3BSAA 3TABA 3TAEA 5C25A 5F9LA 1KSPA 4E7LA 4N76A 1ZBUA 1XC9A 1ZETA 2RN2A 3OYKA 4FLZA 1FKPA 4CEEA 1L3SA 1DLOB 3P1GA 2R8KA 3ICLA 1BIZA 4KSEB 1BISA 3DRPA 1RTJB 2ASJA 3PO4A 1HRHA 4B9SA 1BGXT 4FM1A 4ZPDA 4XPEA 4FLWA 3OYIA 1QQCA 1VSLA 2HNDB 4KKOB 4JS5A 3IN5A 5JS1A 1CXUA 3I0SB 4OVLA 4EP5A 1IKXA 4EYIB 4N5SA 4MIBA 2FVRA 2W9BB 2JEGA 3OYBA 5KFUA 1WSGA 2R2RA 2D5RA 4OJRA 1RILA 3L2RA 1KFDA 4FJXA 3T5JA 5DG8A 2UVUA 1IH7A 4CEFA 5L1LA 1EXQA 2HNDA 3M8RA 1I3AA 4OKEA 1RT4A 2DY4A 3ZSZA 4BE2A 4ELVA 3ISNC 1S9EB 1JLBB 5HP1B 5EWEA 3HVRA 1RBRA 2JC1A 3FQLA 4RW8B 3MEGB 1JXBA 3GIJA 1CXQA 3F9KA 3QNOA 4HKQA 4IRCA 1RT7B 5KT6A 1EX4A 3BJYA 2VA3A 2OA8A 1U04A 3UIQA 1IM4A 2CJQA 4KTZA 1NOYA 2VWJA 1N5YA 2PZSA 2X74A 4IBNA 5J2QB 1YTAA 3H4BA 3ZT2A 1JLBA 1QSLA 3TAFA 4ZVGA 3CFOA 4E89A 4URQU 2HMIA 2IM1A 5HRSA 5C24A 2E9RX 3QIDA 1NJZA 4IR1A 4FBTA 4TN2A 3NH0A 3SUPA 3B6PA 4JS4A 1S6QA 3C6TA 3VN5A 5J2QA 2HWHA 3DLGA 3PJXA 4EBDA 3V1OA 3NAIA 2IC3B 5KFEA 3VQEA 3AO5A 5KI6A 4FJNA 3DOKB 4JUZA 4CHZA 4NCAA 2BE2B 4ECZA 4DFPA 4FJMA 1KVBA 3QYYA 4K4UA 4CEDA 2O4IA 4KHSA 3S3NA 5HBMA 3PJWA 4CK1A 4QPXA 5L1KA 2IC3A 4DL4A 3G86A 1TL1A 1U47A 4IH7A 1JLFB 3PW2A 1BL3A 3CDEA 1C0TB 1IO2A 3LALA 5FROA 2ZD1A 4AH9A 5KT5A 1R0AA 1JLGB 1ASUA 1N4LA 3AA5X 4LQ9A 3U6FA 5D3GA 2XHBA 3ITHB 3FSIA 1XR5A 4OPJA 3OS1A 3K5NA 4RZRA 5J2NB 3DLEA 4Q8FA 3K5LA 3TAMB 5KG1A 4YP3A 1T3NA 3NGIA 1C0MA 5DQIA 4KFBB 2VA2A 4CJSA 2OPRA 4O3OA 4EP4A 2B6AA 4Y1CA 3OHAA 1S5JA 1QUVA 3DLBA 2ZQBA 1QS4A 2YV0X 2C2EA 3IGNA 4ED3A 1VRUB 2WTFA 4Z4CA 1YT3A 3AO1A 3AVLA 3RRGA 4CJVA 2FLLA 3K59A 4Y2AA 1SH3A 1D1UA 1SKSA 5KG0A 3ZT0A 2IAJB 1C1AA 4C8NA 3RWUA 4CJQA 3TAQA 5J1EA 3MXMA 1BCOA 3RB3A 1TQLA 4NLYA 4TLRA 1RA7A 4CK3A 2HHVA 2GIQA 1RTHB 5F8NA 4PWDB 4BACA 1Z25A 2XO7A 1GOCA 2QKBA 1S1TB 1IKVB 2IAJA 4WFZA 3LPUA 3N6LA 4BWMA 2VG6A 2ILYA 3EZUA 3VQPA 3Q8PB 4R8UB 3RAQA 3O3HA 2GUIA 4DS4A 4RW4B
chains in the Genus database with same CATH superfamily
1CSJA 1RAAB 3O3FA 3A3NB 1RTHA 4LF7J 4ECQA 4PWDA 4IH6A 3FLCO 2QFJA 4ZP8A 4AHCA 4FLUA 3VQTA 3QEXA 1VIXA 4KHPK 1XR7A 3OSNA 1DQ9A 1Q8BA 4Q44A 2XMKA 3BZQA 5GAGU 1QAYA 4R0JA 5IWAF 2O8EB 4CIFA 4BG9A 5HVFA 1BD6A 3DLKB 1QAJA 5H9EK 3SZ2A 4O23A 2DJWA 4WTYA 3VTHA 4W5RA 2OZSA 3DLRA 3C6AA 2QTDA 1FEHA 3V6DA 1ATNA 2AYBA 3HHLA 3RMAA 4DR7J 1NU0A 3PW5A 2O8CB 2QWLA 4RKUC 1QQOA 3MFIA 3GR1A 2FLPA 1APSA 1RDDA 5KFJA 2HF3A 2EKNA 5FLXY 5JVGQ 3KK1B 3SCJE 1WOSA 1ITPA 2XY5A 4B3RF 4CZKA 4IDKB 1T05A 3FZMA 1S1UA 4NPOA 1QM9A 4DR4K 1ZAVA 4CFDA 5T14A 2OEJA 3TX0A 2E66A 1YI2N 2E4LA 1KTQA 4DTOA 4JI1F 2HOEA 5BXIA 3KMQA 3NGYA 2P9SB 1ZTWA 3AVJA 1HJRA 4YR2A 2EFGA 3L95X 3TUZC 4KHWA 4ES1A 3V81A 2RD5C 1UTAA 4TQRA 3ENBA 3KNGA 3Q8SB 1FJ7A 2A41A 4DQ8A 4KB1A 2CJ9A 1RDRA 4Z4FA 2DHHA 2DFFA 3H4DA 2PGCA 1D0EA 4ZA1A 4NCBA 1X4AA 4A46A 2HFOA 3M1VB 2NZCA 1UPPA 4V19S 4O44A 3W60A 2ROPA 4F9OA 2RF2B 4DWIA 1ZH5A 3P83D 1R6YA 4YMEA 4YB1P 3H59A 2RS2A 4PL8A 5GAHI 2HAIA 5AQWA 3ETMA 4FPBA 1IBCB 1TVRA 3SBTA 3MXJA 3T1YJ 3GL1A 1HQUA 1IBMJ 2UXDK 2HGMA 4HTLA 2Q79A 3QGGA 1REGX 5AQYA 3THYA 5TKWA 2P9NA 1NPPA 1BWFO 1ZYQA 4AF1A 4XK8C 4HT5A 2AGPA 1HWJA 1SL1A 4PQUA 4LF6F 3V6KA 3SK3A 2MLXA 4BRQA 1YX2A 3AOCA 2WFBA 3MCPA 2ZWHA 2MYFA 2AJ2A 2DFEA 1FD2A 4OFZA 4U9RA 3BGRB 4K8XA 3H5UA 1VSDA 1MNEA 2B7CB 5MLCQ 2BW2A 3OBWA 1OJ4A 5DDRC 4IG3A 2KXFA 3AHPA 1PJ5A 3MN6A 3EEQA 4KV8B 4O5BA 3OYLA 1MWMA 4G3IA 2Y0SD 3CCUS 4BE1A 2BM1A 4KI4A 2HFSA 2XZDB 4CDIA 3AO2A 3I31A 5IWAJ 3FFIB 4WZQA 2DIUA 3O80A 1JKHA 3JSMB 1VSEA 5A0YA 2B4UA 4EZ9A 4DFMA 4U6PA 3Q2SC 3AA9A 2V4QA 4DG1B 3PYEA 3TO8A 3ZEUA 5L38A 4I69A 1S99A 1NGHA 3FEZA 2K2PA 3CCJS 2KTQA 2HVHA 5B0CA 1TKTA 3ZZOA 2Z56B 1T94A 1FFWB 2BV3A 1NK6A 1NGJA 1KKHA 2A1BA 2YNHB 5KFOA 1EKSA 4CO4A 4DUZF 4CGGA 2ZE2A 3B6BA 2G8FA 2O8DB 3N4QA 2CWXA 3NGZA 1QQMA 5EVZA 3FDSA 3KHGA 3GSDA 3O8WA 3VGVA 3D2WA 4HR2A 4FM2A 1N5VA 1T9XA 4YOXA 1NHVA 1DHMA 3E01A 3TTFA 1Y00A 3TW0A 1GXLA 2QA4S 2NXEA 2MZJA 3A0IX 2G1DA 4CI0B 2YWEA 4X4QA 1HNVB 1D8ZA 1CULA 4A62A 3MN7A 2YH1A 2C3PA 1YVUA 4TKTA 2P51A 5THWA 1ASWA 3BS9A 2MQMA 4HUFA 2FBVA 1OQ6A 4V19J 1FTCA 5M2UA 3K89A 3J80Y 2DH9A 3KWGA 1DKGD 4ECSA 1D3WA 4MMOA 4NZ0A 2FJWA 1ITGA 2W2QP 4B8AB 1HI8A 2QJ3A 4FXDA 2QE5A 1KDNA 3I0SA 4W98A 4RCHA 1TL7A 2YHYA 4P2MA 1F9EB 3HBTA 4MO5A 4ZN1A 4X4RA 3GCWP 3K57A 1N32F 2W9BA 3L3UA 3PZPA 2FC9A 3PYGA 4B3MF 1OVQA 4OHXA 2NRXA 2FVCA 3JTPA 4RNHA 3HSZA 5DG7A 2WRMA 4DQSA 2KDOA 1ZTTA 4YFUA 4V1Ak 2V8DA 2OPPB 3BKFA 2V9KA 1S9EA 1C2PA 1IQZA 4LF6J 5AQJA 1RAJA 5I3PA 3MWPA 4RW8A 3D0PA 4OYMA 3ULHA 3LTOA 1BA0A 3CCUN 4CJ5A 4JI8F 3SUQA 3PTWA 3BF3A 4LF4F 2AEMA 4KB7A 1ZBTA 2XLKA 4IFYB 1N34J 3CDAA 2Z1JA 1K0VA 2J0WA 3WQUA 3PYFA 4BG8A 3THXB 3R7NB 5K8NA 2OKQA 4CJTA 3C19A 4DL6A 3J7AN 3KD5E 4QS7A 4X62F 2RUGA 2ZM6F 2VFUA 4DR2K 2HHPA 4FKXA 1U1NA 2DHSA 2KFNA 4IOBA 3D54A 3CCJN 4ZP6A 2VQFK 1WDTA 4BROA 2XZWA 5ETNA 2PEBA 4A57A 4FF4A 3H5XA 2RILA 4WXWA 2F9WA 4A8SA 3NMAA 2D3UA 4BR2A 3EKUA 3HSDA 4J9LA 3V6HA 1T9WA 1UOCA 4IO8A 4L74A 4ANCA 1Q79A 2E7VA 5LJVA 2MY8A 4K4TA 4M5MA 4IFVB 4CF8A 4XDDA 4JD2A 1HARA 3EGVA 2YWWA 3PDNA 2QA4N 3CJKA 1B0PA 1HNIA 2R7TA 3U1NA 3GR0A 4DUZJ 4ZP7A 1T3VA 3TAMA 2BZ2A 4P74A 1SS6A 2M8DB 3Q24A 1EETB 4J9NA 1SH0A 2XLIA 3HM8A 1VJWA 3NF6A 4EHTA 4Z7YA 1VHFA 2MQNA 1OY9A 1GQEA 3BUZB 3JQMA 4FJIA 4C0OC 2KJWA 3AODA 2QYCA 1XQIA 4B1VA 1CLFA 1N56A 1XMBA 4FK4A 2ASDA 1KD1O 3O4NA 3H3OB 3NGDA 4BRHA 3SQ0A 2ZF5O 4ER8A 5AZIA 4DR5J 2KYZA 4QIWD 1JLAB 4X2BA 1RWUA 2VU5A 4ED8A 1GLDG 3MCNA 5B0EA 8RUCA 2VGMA 2W6KA 5M1QA 4NMLA 4DPXA 2AV5A 2JL9A 4OI2A 1S1TA 1FRHA 1LFWA 2CG8A 4C1NK 1RXOB 1QZ6A 4OV1A 3TI0A 2F8TA 3MDFA 4B8CA 4B3MJ 4CESA 1QHTA 5ITHA 2AZ1A 3ZXWA 4ID5A 5D8HB 4OPKA 2Z1IA 4Q45A 5BN9A 2WW8A 1JIHA 4KI6A 1VBKA 2LEAA 5A8WA 1NM2A 3HKZD 4F3TA 3RU0A 3GFZA 2B8QA 4FDFA 2F4VF 1J5OB 5FPEA 3PX0A 4JI8J 4LF4J 3VF4A 2W7PA 3PFOA 2NXCA 2WOMA 2XQCA 3SFGA 3QIOA 4CECA 3A5LC 3OYMA 1N33K 4IOAL 3G8QA 1U2RA 3H2VE 1Q9XA 4LRAA 5C5JA 3NVKA 2DPJA 3HX9A 2UV8A 2OTJS 2VBWA 4B9UA 2DNNA 2AP1A 1MMDA 3ONQA 4F0HA 1HHQA 4X62J 1HLUA 3AVKA 5KFDA 2WCXA 3IWLA 3EDQB 4ID8A 1U49A 2W8KA 2HWTA 3DRSA 3TWZA 2MGZB 2W40A 4CCHA 3VAMA 3O8MA 2RMLA 4FLTA 4ISEA 5AQKA 5M2RA 1LAWA 3CM5A 3W62A 1ZPWX 3J7AP 4WCEQ 4CBWA 5AQHA 5J2MB 4E7KA 1IUJA 5BJRA 2DHAA 2GJ2A 3MXIA 3RBDA 4MLHA 3C16A 5B0FA 3VEYA 4DSEA 4MFBA 4XH1A 3AA2A 3KDNA 4J9SA 4ED2A 3GLJA 4JK8A 4TQSA 3CQ8A 4DU1A 3HZEA 2FQQB 4ED1A 3M8SA 4W92B 3VQCA 3KJVA 5FIIA 3DXSX 3ZTPA 2R8GA 2IGIA 3WT0A 4FS2A 3F73A 2K1RA 4DV5F 2YNGB 1IKWA 3QGHA 3NL0A 2CPYA 2GQQA 2UU9F 1VAZA 2O8FA 5D77A 1T9UA 4RR5A 5KFYA 1NH8A 4FWOA 3A4TA 4F8RA 3DRRA 1A5XA 1OKJA 3LP1B 4WZMA 3QESA 4OZ1A 1MWKA 4KB0A 4CZEA 3BQ2A 5A76A 3TUIC 5F8MA 3W5YA 2OELA 1RISA 4LBPA 4EGLA 2XGPA 4DMZA 3G71N 2ZH8A 4B3OB 5FRMA 3U4LA 1BHLA 5IQ6A 4KC5A 3KFWX 3PIOQ 3V4IA 4JV5J 1DZ5A 3P5TL 2RHSB 3EZOA 3DWLA 3C3LA 4DR3J 3MOZA 5HL7L 1YLXA 2HHQA 5U47A 1KAYA 1NDLA 2E2NA 1TTHB 1S1VB 4AHRA 4WYBA 3IBWA 4WFXA 4DV2K 5SWMA 2LA6A 1YTYA 4OX9J 2HHTA 1KOOA 4Q0BA 5HAOA 4C6AA 1F9HA 2DT9A 2O3DA 3TJ9A 2VFTA 2DXDA 3DXKA 4CJEA 5A8KB 3FCVA 2XY8A 3MM9B 1WOPA 1U0SA 3BYRA 2V7ZA 3H42A 2OTJN 2EEYA 3HPGA 1XUPO 4LSNA 3ZETB 3J81O 2DNPA 1LWFA 1K6YA 1QAXA 3U1LA 2QA4G 4QW9A 1PAEX 3BF1A 4DV0K 3BR9A 4UY85 1UWBB 2H3EB 4IUFA 3SJJA 3DYAB 4CH7A 1VBXA 3KK2B 4NYNA 4CI6A 1X4EA 1RWWB 1WOOA 4JKGA 2YWHA 1ZAXA 3LWMA 1S9FA 1L3UA 3TTDA 3NWRA 3MCAB 4F50A 2V4JB 3QERA 1LNQA 2W9CA 6FD1A 2WZ1A 1GOBA 2PEHA 4K50A 4CZJA 4I9QA 3VQ7A 3VQ4A 4X65K 1HNWK 3DM2A 3TJ8A 1QE1A 1B3TA 1WUUA 1FKPB 4XO0A 2VC0A 2VPWB 3D66A 1X3MA 5F8GA 3T1HK 2CA9A 4LMZA 4QWDA 1U6BA 3G0ZA 1SL2A 2KRRA 4RX6A 5KT3A 2BYCA 5J1NA 2KQ2A 2G0IA 4CF2A 3R7SB 2J6TA 3HT3A 4HYKA 4CF0A 4Z4HA 4NLPA 3KOAA 1YRUA 3OVSA 3H1QA 2G9OA 2JGUA 4CVNE 1CC7A 2A1SA 3MMBA 2RDIA 5KPRA 4LY7A 1VK8A 1HYSA 2RT3A 2AJ0A 5LMUJ 4U7BA 2CZVC 4AL7A 1NK5A 1IG8A 4AFFA 2ZC4A 1WBBA 5AT1B 3GJQB 4ELUA 3GIRA 3HP6A 4FOIA 3HHLD 1X5OA 1WBDA 2AT1B 3ZZYA 3HULA 4NX9A 4GV9A 1KCFA 2FC0A 3D7EO 1N48A 1Q81O 2ILZA 3R5AA 4OYIA 2FBXA 2HMIB 2OEKA 2CH5A 1SZ2A 5AXMA 4FSVA 4H5VA 4LQ3A 3KK3A 5GADI 5ELZA 3DLGB 5E26A 3O9UA 3M2UA 3RG6A 2DIVA 5KFTA 2IJRA 3GYXB 4DX6A 3VEWA 2XG8A 4JK7A 5FDLA 3SQ1A 4AUKA 4JV1A 3CCVN 2UXBK 3CULA 2BM0A 1Y11A 4M5KA 1NMEB 2XMVA 3L0QA 1D09B 4OHVA 3TZWA 4CFBA 5HBMB 3BV8A 4FZVA 1TZ0A 2B8PA 3OJSA 1FKOA 1JQGA 1RT2A 5HLFB 2P9LA 5K14B 3LH2S 4K8RA 4MK9A 4CEBA 4BRMA 4DV1K 2Y0BB 3O3LA 3GV8B 1AROP 3EZWA 3P96A 3JYTA 1BXNA 3L09A 5GMEA 2O01C 2GAGC 4LJMA 5LT5A 3THWB 4JV0A 2MKHA 4O0NA 1RU2A 5FRNA 1BI4A 5LJ3Y 4Q2LA 3SLCA 2JJ4D 4FXVA 4JI2J 3POTA 3F44A 3UKUA 1RK8A 4M3YA 5CQGA 4Y0FA 5EWGA 3C46A 4PWUA 1RHKB 5DK5A 4FCYA 4N41A 3ZSXA 4AL6A 5AQRA 3HSJA 1RI7A 1G99A 3ZT3A 2OZMA 2CGKA 2B5JA 4YOVA 2R8JA 5J2PA 2IPOB 1VK0A 3RRKA 2M9KA 2ZWOA 4FM0A 1XN9A 2CH6A 2PN6A 5KFSA 3H3NO 3H2LA 1NJXA 1BU6O 4DN0A 1FE0A 2IY5B 2Z4PA 1GMUA 1S57A 1AUDA 3IR7B 4FJLA 4CBXA 1VBYA 4YUDA 4I7FA 3FJ2A 1IBLF 2KJVA 2LP4A 2FY1A 1J5EF 2XYHB 1WC3A 4QIVA 4W90B 1Q4RA 3E1YA 4CH1A 2ZBRA 1PSDA 3K7RA 4IQXA 2G0JA 1TP7A 4TNOA 4K4WA 2N82B 2GGPA 4S0MA 5CAAA 1TR0A 4CBUA 5EN1A 3OBYA 3JQJA 3OVNA 1W25A 3P49B 1I39A 3RW6A 4GMJB 1OPIA 5DRKA 2R9LA 4AQYF 4B3SF 3P8BB 3LW5C 2JX2A 5EX0A 4M3RA 4F3MA 5ETOA 4L76A 4X4OA 4JHDA 3R3TA 4F26A 3GILA 4KT0C 1HBUB 4NLWA 3IM8A 3SQGB 4Y65A 5JMNA 1E4FT 3CM6A 2KYXA 2ZOFA 2H48B 3AQOA 3VA3A 2HRTA 1N54B 2MSSA 2GIRA 2KT3A 3OUYB 3PFEA 2E1RA 4MLEA 5KFWA 1V5VA 4YB6A 1D9DA 4B9NA 4FWPA 3M9OB 3AD9C 5KFKA 5CYMB 4H5NA 4C23A 1PBUA 2XCPA 3CD0A 4WK1A 3ZTRA 4BQZA 1IM6A 3IS9B 3FRYA 1VQOS 2IRUA 2C28A 3M8ZA 1H38A 3RR7A 1K1QA 3IFEA 4QYZK 2XMMA 3D0GE 3MPYA 2EWSA 4TLQA 2FD2A 3MECA 4KPYA 5FPDA 4LFCF 2BANA 1N88A 2H3GX 3KLEA 2GBZA 4USJC 3TUPA 3PG9A 4J9UE 1WHVA 4LBIA 1F21A 2FGCA 2WVDA 3RUBL 4YEAA 3SSRA 4NE9C 4K25A 4LSLB 3MEDB 1E6YB 3MPUB 1HMVB 3ATVA 4K41A 2YKQA 1NK8A 4FOEA 1KP6A 1NGCA 4DV7K 3KLHA 1B64A 2HVEA 2FJVA 1SC4B 2HS4A 5IT9Y 2MKIA 4FZYA 1RZMA 1S48A 2IIRA 4OJ1A 4CT8A 3M8PB 3CF5L 4H4MA 4LF8F 1K1SA 3UO0A 4JI3F 3QO9A 5GAGI 1D9AA 1F2GA 1KAZA 1VQYA 5CH7B 3A8YA 2FVQA 5CCMA 3U1MA 1HPZB 3F0NA 2WONA 4K42A 4FJKA 2EX3A 4RBUA 3DOLA 3FE1A 2IYIA 1JLCB 1FW6A 2ASLA 2P9KB 1WN7A 1H73A 3MK6A 1JNZB 3QGPA 4A8MP 2BQUA 3DN9A 3SQ2A 1HIYA 4OYBA 1MWZA 4BHQA 3WNHA 2GX8A 2A10A 3DAWA 1WSEA 2V7YA 2HQ3A 2R42A 3L7OA 4NL5A 1IBLJ 1Y5IB 1J5EJ 2W6LA 2KHOA 4JKCA 1T0TV 3C15B 1HR0J 4IXCA 1S0VA 2HRUA 3NCRA 4H0PA 2HBYB 4JKBA 2I5JA 3CJRA 3G6EN 3LGHA 1PKUA 4X64J 1OO0B 3LAMA 2QMWA 1YJWS 2A3JA 3JQKA 2E7WA 5DS7A 3GV7B 2FJEB 3MR6A 2HNYB 2W4DA 4B3SJ 4JI6J 3AA3A 4ZVTB 5AQMA 1R0BG 4GRSA 1S0OA 4IKAA 3R1HA 1RCOB 4J9VA 4O4GA 4ECVA 2VG5A 2KW4A 2MLYA 1LCUA 1B99A 4ILJA 1X4DA 4DQPA 5KFZA 3N4WA 2C2DA 3NGKA 5KFAA 2CG4A 3S9HA 2R2SA 4OZLA 2YKPA 2UUWA 2ZH6A 2XSJA 5AQUA 5CD4H 4PXDA 3WXMB 5JVHL 2H5EA 4GVMA 3O5BA 3MAQA 3NKYA 2JNJA 4H4OA 3LL3A 1BQMB 3CMQA 1REVB 1HL6A 2XHWA 2VPYB 1SUQB 2Y1RI 3QEWA 1FNOA 2J7KA 1Z26A 2XI2A 4DL3A 4FYWB 5K20B 2DYAA 4NASA 2O8BA 7FD1A 3D4JA 4TU7A 4CJRA 4CGDA 2FC8A 4KGMA 4CYUB 1G6BA 4DB3A 2HYIB 4LFCJ 2ATCB 3OTBA 4IH5A 5ETVA 1NMDA 4TY8A 3OYGA 2IM0A 3D6TB 2BEFA 5F9LA 1TMJA 3D0HE 1QY7A 1KSPA 3U02A 2LMIA 4N76A 1FVQA 1K73O 4NOHA 4EMDA 3A5OC 4CEEA 1DLOB 5AJ3K 1H2VZ 2VQEK 1XMQK 3Q23A 2KLAA 3H0PA 2HF4A 3PO4A 1XMOJ 5ETPA 2DGSA 2MJUA 3MEKA 2I0XA 3OYIA 5DM6L 3VGMA 4V19X 4KQZA 4KKOB 5D15A 4RBTA 4DU7A 1QUPA 2H4YB 3D1QA 1WG5A 4LF8J 3GFHA 2V8VA 2OP5A 4B3TF 3OYBA 1WSGA 4LVNP 4JI3J 2JVRA 2D5RA 4FNIA 1J27A 4LIRA 4M5NA 1RILA 3HFVA 5DG8A 5AQPA 4CEFA 1FFGB 1EXQA 1M5HA 3VWSA 5DDPC 2ROGA 3M8RA 2W2NP 2UV8G 3ZSZA 1RUSA 4BE2A 3ISNC 2A2CA 1YJWN 5HP1B 5EWEA 1NZ8A 5C15A 3MWBA 1NGBA 3QNOA 4LFBK 1XNRF 2GFFA 2VA3A 2OA8A 3UIQA 2HS0A 1H72C 2CJQA 3D2FA 1QVFM 1U1PA 2PZSA 4IBNA 3J7YP 3SAGA 3A1YG 1JLBA 3DOMB 2IVYA 2O67A 1FESA 1U1KA 1RKIA 4AM7A 2E9RX 4H0XB 4IR1A 3NH0A 3B6PA 3PRDA 4JS4A 1S6QA 2HS3A 2NR0A 3C6TA 3L6QA 3U27A 3BN4A 1T11A 3V1OA 2QO3A 2A3ZA 2HPUA 2X1FA 3W9IA 1D4XA 4CD1A 4IWVA 3O44A 4P9SA 5LMNF 3UD4P 1DGKN 4X66F 3UB5A 3HZGA 3DOKB 3LDOA 5KOWA 3JAMY 3M8YA 4DV3K 2G2OA 4FJMA 4K4UA 4WU2A 5HMXA 4CEDA 2HURA 1FERA 3AD7C 2C3YA 1HI0P 2R7OA 3BP8A 1TL1A 1JLFB 1HNZJ 3DKDA 3QMQA 1DBDA 3IC1A 1C0TB 3MMAB 1IO2A 1JLGB 2PD1A 3AA5X 5D3GA 1NH7A 3KWMA 4I6MB 2ZBCA 1S3XA 1SC3B 2YPYA 5M1OA 3UE2A 4KFBB 2VA2A 4RLEA 2OPRA 2EXUA 3W2VA 2B6AA 1PG5B 1DQ8A 1S12A 2XHCA 2VL1A 3DLBA 3GMGA 4WF9Q 2FPHX 3PHTA 2RE1A 2WTFA 4A47A 4KBOA 5HOOA 3HLUA 4CJVA 2IA0A 3IBCB 2KB2A 3B54A 4HHUA 1TL4A 4EUVA 3M32A 4FWKA 1YK9A 5GADP 3ZT0A 1JNRB 2B4VA 3RWUA 2QM1A 1YXQA 3TAQA 1K8AO 2XMTA 4NEYA 2XS7A 2FYXA 4LF7K 4NLYA 3FGUA 3CW2C 4N77A 1NSPA 1RTHB 1R8BA 2ZHOA 4PWDB 5C2FA 1W97L 1PAUB 2CAJA 4WFZA 3N6LA 3VQPA 4FN5A 3RAQA 3O3HA 4NI2A 4J8FA 4OI0A 4M5LA 5GINA 4MTPA 5ETRA 4NXNJ 3VQAA 2BBEA 2OHDA 1IWAA 1V3ZA 2ZH5A 2F8SA 3C14B 3QETA 1NJWA 3U9ZA 4BRPA 3CEDA 2OTLS 3G82A 4FK0A 4USUA 4DR7K 1LQ9A 4EBCA 3CCTA 3UI3A 3UKRB 2GELA 3VAHA 3KHHA 4K0KF 4XIUA 1KAXA 1OH7A 4CF1A 2QMUB 4O3PA 4QIFA 5I42B 3OL9A 2QMXA 3I8DA 3DMJA 4ECRA 1GH8A 4OLAA 4FJGA 2BJ9A 1MSWD 2YJFA 3QNNA 1OPZA 3KLVA 3G8TA 3THPA 4K4XA 4OV6A 3GV5B 2JFDA 3Q86A 3L2VA 2VWKA 2ZKUA 4DTSA 2WSEC 4CO0A 2JEFA 2CDQA 2PFDA 3IWXA 4ZVQB 4RW6A 1N5TA 3SMZA 1UFWA 2CQCA 1VLOA 4FBUA 5DGAA 3HK2A 4IOCL 3Q8UA 5KGWA 5LMNJ 2GNKA 4A8XA 1SIZA 5B0GA 2E7XA 2CPZA 2UYTA 3CCQS 5C42B 4CIOA 3D1HA 3H2UB 3W65A 3NVMA 3VV2B 3KLFA 2CQHA 3MUVP 2VICA 2E9TA 3D5MA 5T7LA 1LXNA 2GCFA 2E1MC 3VGKA 1V3SA 3W9JA 2QA2A 1D9FA 3AJ1A 3T1AA 3PEHA 4K4VA 2GX9A 2M2BA 3T3FA 4I2PA 1RWXB 5CZXA 2HEKA 4CO5A 5CYJA 1WSHA 3T1YK 1R43A 4CGJA 1IBMK 4IFEA 1NWKA 3KLGA 2DKOB 4HI2A 5IXUA 4M63C 3EO3A 1IKYB 2D4WA 3THYB 2P9NB 1NOZA 4CJ4A 3S8SA 4PRFA 2IDOA 2VWBA 1MMLA 4I9LA 3WHIA 2NRRA 1XNQF 4FPIA 3JB9k 3MCOA 3R6MA 2C2ZB 3JXOA 1HD0A 5EX3A 1C0UA 3C0BA 1JLEA 1VLYA 4UOHA 4FZXC 3R5BA 4O5FA 5GIPA 2OTLN 4ICLA 1BDGA 2HQDA 3AVMA 3OYEA 4JI0F 2HQCA 4JKFA 1BWVA 3BSNA 5DQGA 1L3TA 1NRKA 3CJ9A 2KG1A 2CZ4A 1LW0A 4F4YA 3BR8A 3MMVA 5IWAK 3OYHA 2VV5A 3OL8A 3MUTP 4KO0B 4LF9F 3WC0A 3O08A 1FA0A 4I2QB 1UWAA 3LZJA 2V2KA 4IOXA 2JH3A 2RHQB 3M9NB 5HROA 4N7TA 4Q43A 4DQIA 3VQ9A 3ET6B 3LM2A 4U7CA 4IO9L 1TKXA 1BQXA 2J9DE 3ZEUB 3K0SA 4K0KJ 2PA3A 1VDHA 3CJ2A 1RAFB 2IDLA 3EPIA 4DL0C 3J7ZO 2B4PA 4DBQA 2ZE2B 1Q81T 3HPHA 4RW9A 5GAGP 2WTUA 1RAGB 9RUBA 1FVSA 3K8WA 3PY8A 3TQEA 1ZC6A 2DO0A 4M3XA 2PT0A 2AWZA 3IR5B 1NBEB 3DU5A 1Q53A 4IR9A 2YNIB 2V2VA 1BMQB 1Y10A 1X9SA 3E01B 1U2CA 4NCGA 4ZP9A 1RT6A 1WTFA 3E66A 4KGZB 4O3RA 1GEHA 2KU7A 4X4TA 1X9MA 4CFCA 6AT1B 2ASOA 3BGUA 3AD8C 3AA8A 4YQWA 4KYZA 1ESVA 4H0VB 1WUAA 1HLWA 3C6HA 5E3QA 4LR7A 3UVJA 2JWNA 4DL2A 2DVIA 4ZVSB 1S7HA 1P1TA 1D8YA 3HHDA 3OYJA 2J76E 2DY1A 1VQMS 4RWWA 1TK0A 4RUCA 1YITN 4BC5A 4CO2A 1VQ9S 3VZHA 1GMWD 2IRXA 5KFXA 4F2RA 4OYZA 4ILLA 3AAQA 3C6UB 2Y1IA 1FJGF 4K8ZA 2XMAA 2VASA 4U8VA 4L8RB 4JAXA 4HTUA 1TV6B 5JUMA 5HJXA 1RT5B 3EYZA 1I94F 4LF6K 2W4CA 3MM8A 3PIPL 1E6VB 2M52A 1IR1A 1AZSA 3BEGB 2F8EX 2XS2A 2GVZB 2P6TA 4HL9A 2W2MP 3KTQA 3LDQA 1N34K 3HD1A 3HD2A 2FSNA 3K17A 1NKBA 2PI4A 1UMJA 4OZ5A 4HH0A 3VAJA 1NDPA 3MEGA 1BQNB 3UPFA 4G1IA 2RU3A 1J54A 1HHTP 2UP1A 5KG2A 1YAGA 4DPWA 2XRIA 2BXJA 2BUNA 1XWLA 4CJWA 1HWUA 4FWMA 4Z4IA 4R5PB 2DISA 3TSUA 1HQEB 5LL6d 4BE0A 3ENOA 2ASYA 5RUBA 4QOZB 4LF1A 4P75A 4O8UA 1RLCL 4E1JA 1NAQA 1RTDB 4LF9J 2AYEA 2BDPA 2VZ9A 1CJVA 2AP6A 2FSKA 2CQ3A 1CJTB 4OKJA 4O3SA 1FDAA 5KTQA 1YJ9S 2UUBJ 3CJTA 5AZJA 2QT7A 3MOJB 1F5BA 2K7KA 3H5SA 3CCMS 1R6VA 3OTOF 2I8EA 4UQTA 4YHHJ 4LRCA 2QWRA 1A9NB 2BX6A 4P71A 3ILLA 1A6LA 2CNKB 2B9YA 3ZYYX 3N6MA 4DUZK 4FVMA 3CJKB 3L4IA 1HNIB 2Q0RA 2H54B 1TKZA 1KTVA 4QW8A 1A0OB 2VPZB 3QQCD 5AQVA 2BJ8A 3L9ZA 3MMCA 5L46A 4ECWA 2H1YA 2K8GA 2Y8WA 1C0FA 2XEXA 2AEFA 5KFHA 2HFZA 2M88A 1VQMN 2UUTA 1FHTA 4OKKA 3CDUA 4KGXB 3FMWA 5AXNA 5J2NA 3CXCM 2ZH7A 2KZZA 3CYMA 1VQLS 1VQ9N 4CNZA 4DR5K 4PXCA 4JYAF 3GP9A 1JB0C 1HNXJ 2Z1HA 1NSAA 1KQFB 5AQGA 2R4FA 5AZIB 1ZBFA 1UA1A 4LD0A 4E2FB 4CHOA 2R7SA 2HZAA 4EIAA 2DFHA 4KHYA 1XJWB 3ZX0A 3SQOP 4DF8A 2ZNYA 3LGNA 1V4TA 3LM9A 4HTJA 1WSIA 2V50A 1WC1A 3MCMA 3CTRA 5JICA 1M5SA 1FRJA 2O66A 1Q7LB 1HWKA 3GIIA 1RT3A 2MQ8A 4M95A 2OSQA 4B3MK 2NS1B 3CJQA 3FRZA 1QSYA 1NXIA 2KT5A 1XERA 1K44A 1HYZA 5GAEU 1TL3B 1F3VA 1YQHA 1RCHA 1U0HB 3QBCA 2MDAA 4HCCA 1I94J 2PYLA 4DCPB 3ZNJ1 3NCPA 4OHYA 4JI8K 4R8UA 4LF4K 5E0OA 4BDYA 4DN9A 1PIEA 4USKA 4BY9C 1E4GT 4PA1A 1X0FA 4OQJA 4NRUA 3S1TA 4CJ7A 1HBMB 1YJ9N 4X62K 2FJAB 2ZM6K 1WNEA 4OX8A 3Q8RB 4H0TB 5DLGA 3CCMN 1W2BR 1QHAA 3IXQA 1MN7A 2QRRA 5AE3A 2O8EA 4FW2A 1N5QA 1T6DA 2VOOA 2ETJA 3DXMA 4DSJA 2I7NA 2XY7A 1GLEG 3AGRA 3DLKA 5CR4A 5ADXA 3SV4A 3CJAA 3W8PA 4CIGA 3TA0A 4D3HA 4NA2A 4YS2A 1SJ3P 1Q95G 4YORA 4ENOA 3IRXB 2O8CA 4FF1A 1KOHA 1KVAA 4PPZA 4C4WA 3C16B 3QZ7A 5BRDA 1HA1A 1SH2A 4MFBB 1SKRA 3BBBA 3OTOJ 3OR1B 1RHJB 2IFXA 3GG4A 5JLHA 4Y1DA 4FJ9A 1VQLN 2ZC3A 3HSCA 2ZOGA 1RJJA 1CS4A 2K1RB 1ROFA 4MQ3A 3VEZA 4CP5A 5KG6A 3EXYA 1NKCA 3AQPA 2P5GA 3TAPA 3ENWA 2O8FB 5CCLA 1V4SA 3SUOA 2LQJA 4DPYA 2RJZA 1K8KA 2P9SA 1JCFA 4DPOA 2A18A 5IC6B 3M1FA 3SAHA 1C0GA 3V9WA 4M3WA 2ATQA 1JJCB 2J4RA 2KXNB 1VIOA 2HNZB 2F4FA 2IVMA 1BLUA 4NLQA 4KH4A 3R6LB 2BJ3A 2D74B 2HAFA 4IKFA 1MU2B 1T3OA 3M6UA 1HWLA 1HW8A 4QCLA 4JYAJ 2NLXA 3M1VA 4DL7A 3V4IB 2O5DA 1MWQA 3M9MB 4UUWA 4DR3K 4C11B 4F2SA 5FPMA 3MXHP 2KG0A 4DV7J 3MAHA 1PYOB 2RF2A 2W41A 3J7YU 4JI7F 4OX9K 1LWEB 3I32A 3HHKA 3L3CA 3SIPB 1EZZB 4CJ3A 2C42A 3BREA 5F0WA 4B08A 3ADAC 2DXEA 4PAAA 1UA0A 4FK2A 2D3O1 4FNHA 3OYDA 4KE5A 4K4ZA 3IA0A 4F04B 2AEJA 1G2EA 1GLCG 2QWOA 2QWNA 4BDZA 2E6MA 2XYPB 4QU6A 4FWRA 4DSKA 1F1BB 2QLFB 4JV2A 2B43A 1C4AA 2BW7A 2DRAA 3QFHA 4TVAB 3BGRA 2P6SA 1I51B 2LSNA 4RNFA 3VCDA 2COLA 4EU0A 1UJ6A 4KRFA 3RB6A 4HDGA 2MZQA 4KV8A 3Q89A 3KKFA 4QS8A 3CG7A 1RBTA 1TUVA 2HFUA 2OFHX 3MZIA 2HWIA 4X4SA 3HDSA 2W9CB 4NYZA 2OI2A 1Q82T 4F3QA 2MPUA 2O4GA 2DNRA 3T5LA 4CT9A 3GJTB 3FFIA 3C8YA 2J6SA 3QFPA 3JSMA 2ZHAA 1R59O 2ZJPL 3QEIA 5E2QA 1FJCA 3HCXA 1UEKA 2H65B 3KLIA 2LU2A 4CNYA 2CQ1A 4IOAQ 1RB0A 2V68A 2D1CA 1C1CA 1GFWB 3MD1A 3DRPB 2YNHA 3T6JA 3CJ3A 4PKDB 3FZFA 2O8DA 4YR0A 1VISA 1IV0A 5LMUK 3ZSOA 1FNXH 2KHCA 4DV5K 3VMFB 3L7UA 4NWBA 3LPEA 2XMUA 4OI6A 1IKXB 2WVBA 4DTXA 2HIYA 1W9HA 1UFKA 2AYGA 4Y00A 4DXLA 3E9PA 3S3OA 2GWJA 1U1OA 1RT4B 2OMLA 1NLVA 2R7RA 3VAKA 3A5NC 4OZ3A 1U24A 4QS9A 2FF3B 2VQEJ 1RDUA 3BGFA 2C2RA 2QI2A 4ED4A 2OD6A 3NGSA 3O9RA 3TTCA 3PX6A 3CCLS 1VGYA 4IYQA 5HJYA 5CZ2A 3K5OA 2DCLA 1L3VA 3H98A 1N5YB 1GNKA 3N6NA 4QWAA 3R2DJ 4ZN3A 1WHYA 3M2UB 2OUGA 5HRNA 4JI7J 4BDPA 1RWVB 3H46O 2DHXA 4DSFA 1KVKA 5C24B 3UDLA 2OPSA 2MKKA 1AA1B 4FLXA 5FDLB 3DCAA 2P9IB 1CC8A 2VH7A 3OFHA 4C98A 1VSKA 4OIXA 4EI2A 3J80U 3P5BP 5CYQA 3W5ZA 1WEYA 1U8SA 2XLJA 2MKYA 3NAEA 2OPPA 1FKOB 1K8AT 7FDRA 3PW7A 1RT2B 1ZZFA 4WYWA 4QQBA 2NRWA 3LPTA 5C12A 4A8OA 2IVOA 1BG3A 1KEKA 4RU9A 1WSFA 2R3VA 5HL7Q 2R8IA 4CLKA 3US5A 1LK7A 4AILC 4BBYA 4ZPTR 3JYTB 1N33F 2OFGX 3HMJG 2I38A 3THXA 4DFJA 4HWIA 4DKWA 1SVDA 3VF6A 4P2SA 1O13A 4JI2K 4DPTA 4E7JA 4CZGA 2ZD1B 1BI4B 4U95A 1TUUA 2EC0A 2EC2A 1RQ0A 2HFVA 4RO0A 1JWWA 2G8WA 3VF2A 3E9LA 2NXJA 3P4UB 3C7NB 3DLEB 1N52B 2IMOA 3UKUB 1SQFA 2YKMA 5CY4A 1Q18A 1WF2A 2VJUA 3D3BJ 5D0RA 2EFQA 4FJ8A 3Q83A 2FIUA 5F8JA 2FVSA 1GT8A 4PG4A 2GA7A 4YDXA 2B5JB 1YJ7A 5J2PB 4DR1J 4OX6A 4U7UK 3G87A 2EWHA 4TYBA 2VKRA 3R8YA 2CPIA 3NOGA 2NXUA 4IFVA 2JVOA 4CJFA 2RAQA 3T6BA 3EE3A 1SBRA 2SXLA 2Z2YB 3O4QA 3OLAA 2F7VA 2MLZA 4F4AA 3Q8QB 3LP0A 3D28A 2GV9A 2AGQA 2X51A 2YTCA 2AA4A 3CJ8A 3AY0A 4GVBA 2D0PA 2HHUA 3NWGA 3AJDA 3VAIA 2V0NA 3BPDA 1FTRA 3CCLN 1AW0A 3JSBA 1M5KC 2IBOA 2J6UA 3RMDA 2GGPB 3MDQA 4H5WA 2VG6B 3NF9A 1OH8A 2HBRB 2JRSA 4ZPBA 1OSCA 1NPKA 1XI1A 4WP3A 5KT7A 3JTOA 1X1PA 4JN4A 3O1BA 3IG1B 3E8OA 3FC9A 3EDRB 3DJCA 3AVAA 1X4BA 1N36F 5ETQA 4L73A 1YJUA 2FZGB 1VHIA 5M1FA 4IJNA 3IAM9 4JLHA 5EX5A 4FVUA 1WSRA 4C0BA 3R7BB 2J9DA 4DL5A 3PV8A 3CVKA 3DLHA 4BVPA 3TVKA 5BREA 3GIKA 4KREA 4CLSA 3BPSP 5KG5A 2PAVA 2Z8QA 5H9FK 2WBMA 5IT0A 1BUXA 2KVQE 1IJJA 2L48A 1UPMB 4HHHA 3PW0A 3NF7A 5LXYA 1HBNB 1T9TA 4F36A 3TU5A 1M1KO 3MECB 3UDVA 2VF3A 5E33A 3Q7BA 1MWYA 2IM2A 4IEEA 2BANB 3IUCA 4FYDA 4OO1J 3KLEB 5E3RA 1J5OA 2U2FA 4ALZA 3SCXA 2LDIA 3AVHA 4JK9A 4C9DA 5ETLA 3U3YA 4CO3A 1YGYA 2DTUA 1LXJA 2KFYA 2V4RA 2FSJA 1Q8KA 3OSPA 2NZ4A 2M8HA 4LFAJ 5KFLA 1UEVA 2XCAA 3WEEA 1DEJA 1VI7A 4DJBA 4M63A 2DGVA 1AFIA 3KLHB 1DY3A 1VQKS 2R2UA 1T44A 2MGZA 2V8HA 3AGKA 4F7VA 1HWIA 5D4LA 4PG7A 1SL0A 1S1WA 4MJKA 2QV6A 4JI4F 4P2FA 1R8HA 3T1HF 2NPIA 2A6OA 2QL9B 2E29A 3S3MA 1BE4A 5DMRA 1FDBA 1SJRA 5T41A 2WONB 5J2MA 4RG8A 4TSXA 1WLJA 4ZKAA 1PBAA 4C7QA 3EY1A 1Y3KA 3NS6A 3V4MA 3J7ZT 1VRTB 2PE8A 2XC9A 5LSRA 3EMTA 4DTMA 2UVRA 2Z1GA 1WAFA 1HW9A 2ASMA 1JLQA 3PR5B 4ECYA 3X3UA 4FW1A 3QGIA 1CPZA 1IBLK 2G8UA 1J5EK 4NLGA 1WWHA 2P2CB 1HR0K 1R8CA 1Y64A 1EKEA 2OH2A 1TAQA 3MTKA 2YNGA 3WZ0A 4FWLA 2HVIA 3LDSA 1WHXA 3Q0AA 1W7AA 4HHJA 2EK6A 4X64K 2I5JB 2PA8D 1EP4A 4AE5A 4B1XB 4NLVA 3O1WA 3OTCA 3IMQJ 3OTEA 3DHXA 4JI6K 3RAXA 4B3SK 3LP1A 2LKZA 3A13A 4EK2A 4BC2A 2E5JA 3P31A 2Q3SA 4FL9A 1KBRA 2D7SA 4O4GB 3VQBA 4B3OA 3O3GA 1YDLA 3I56S 1UL3A 4ZCMA 4J90A 4N47A 1N36J 4CGHA 4O0JA 1T95A 2VBXA 2BJDA 4Z4GA 4WP8A 1U1LA 2MJNA 2MY7A 3I5BA 1S1VA 1S6PA 2XSJB 5C10A 3B82A 1NUEA 2LEBA 1IBKF 4ZIWA 2C1EB 4KY3A 3AV9A 1P8ZA 3ZSQA 1A5VA 1HHSA 3EJMA 2PMWA 2UXBF 1QVGR 1GXUA 1O1WA 5A8KA 3MM9A 2J0SD 3K58A 2B51A 1NGDA 1Z2LA 4PUOB 1HBOB 4J2EA 3J81Y 3ZETA 4LFCK 3I55S 4FWQA 1VQKN 3ID8A 5HRRA 3UCUP 3R8EA 4DV1F 1ELOA 1RAEB 4ID1A 4H8KA 3IM9A 2UVVA 1UWBA 2HBLA 2HLTA 5KFRA 1Z05A 3JS6A 5LXRA 3ILIA 3DYAA 1R27B 2W9AA 3HJFA 2BRKA 2E1CA 1TFWA 3SCIE 1XMOK 1Z4UA 2QZ8A 5LM7E 3CJCA 1X4CA 3N4PA 2RKIB 1U2VB 4PKIA 3TVZA 4XPCA 3K2PA 3VEOA 3BSAA 4D3GA 4B3RJ 4ZIVA 4E7LA 3A8JA 3T41A 3EVWA 3SAFA 1FKPA 2HQFA 3ZZUA 2DNLA 5BR8F 4LF8K 3IBFB 1JJ2R 2W01A 2R8KA 3ICLA 4ITSA 4JI3K 4JI1J 5HMWA 1BISA 4I68A 1RTJB 4JI4J 2H51B 2OSRA 1UAWA 1ZBSA 1U8WA 4XPEA 5L8RC 2L3MA 5HVGA 2LQ5A 3CMAS 2FGOA 3IN5A 2XNQA 4OVLA 2EVZA 1FXRA 2FVRA 2R2RA 1UFLA 4HEA9 4FJXA 3T5JA 3BEXA 1DT9A 2Z57B 1NPRA 2HNDA 1I3AA 3CF5Q 3I56N 3NGRA 3AFGA 1H98A 1B7YB 2OMOA 1JLBB 2XNRA 3AXMA 3HVRA 5BYSA 1RBRA 1NCLA 3NNAA 3GIJA 1YWXA 3F9KA 3D6HB 2OCEA 1RT7B 3BJYA 1T9VA 4GMKA 4MO4A 3SCKE 1NOYA 2VWJA 2DR6A 1UJ5A 1SKUB 2DR7A 3H4BA 3ZT2A 1WOQA 3A8EA 3ID6A 3V2UC 1QSLA 3TAFA 3QFWA 3CFOA 2CZ9A 2DNQA 4Z7CA 1MROB 2HMIA 1WC6A 4MDBA 2A2DA 4FBTA 1AYEA 2PSZA 2ZZTA 3SDEB 3DLGA 3GBTA 2AYMA 2E5LF 1RADB 3NAIA 1M90O 3I55N 1HNZK 1M5PC 4Y2KA 3VOVA 5KFEA 1RWKB 3UNGC 1IBKJ 1T9YA 3AO5A 1H2TZ 1UETA 3FR0A 4Y28C 2AD9A 2BE2B 4ECZA 4DFPA 4RTFD 1KVBA 1U02A 3T7ZA 4KHSA 1QZ5A 3S3NA 3QNWB 2KM8B 5HBMA 3DXBA 4CK1A 4QPXA 5L1KA 5AQLA 4DL4A 4BS2A 1ZM2A 2DR5A 3OFGA 3DLJA 1PJ6A 1FXDA 3PW2A 1BL3A 2B0GA 3W2VB 5FROA 1HKGA 2XHBA 3ITHB 3GJSB 3VZIA 3K5NA 4U8YA 4BCAA 4Z37A 4GKJF 5KG1A 5JVHQ 1YRXA 3NGIA 3FZKA 1C0MA 3THWA 5E84A 4YOWA 4GO5X 2GWKA 1WC5A 2WVCA 1K9MO 1W26A 3EN9A 2YQ3A 2PBDA 1QUVA 1WEZA 2ZQBA 1RHRB 3KWIA 1QS4A 3I9V9 2YV0X 2C2EA 3IGNA 4FXWA 1VRUB 4Z4CA 1YT3A 2CVEA 2DGOA 3BGLA 3FZLA 3WC2A 4NLCA 2FLLA 4DCOB 2P9EA 3K59A 4Y2AA 3FVYA 2CJKA 1HJOA 1X5SA 5DETA 1C1AA 3KG0A 4CJQA 1LFPA 4GV3A 3DGPB 4NXNK 2J7UA 4JKEA 1YIJS 2HSEB 4NI2B 2KH9A 2K3KA 1M5VC 1TFYA 2HHVA 2GIQA 2PI5A 5F8NA 4OZ0A 5IM0B 5GIOA 1Z25A 1KS2A 1XBWA 2VGNA 2QKBA 3LPUA 4A2AA 3C66A 1CJUA 2CQPA 2MHNA 3Q8PB 3L7PA 5IS2A 3M6WA 1YJNS 4DS4A 5HMYA 3KUHA 5D4PA 3OPKA 3G10A 5DM6Q 2ZUAA 4LH4A 2B3TB 2ZJRL 2LDYA 2XS5A 4I67A 1IKVA 2J8SA 4DF4A 4E7IA 1PGZA 3PW4A 1N32J 3BSOA 2BE7D 4GC7A 4LF5F 1BY9A 2FY8A 4RW4A 3SYZA 3ULEB 2UUAF 3W2WA 4K5SA 3SQGA 3EVMA 1HQ2A 4ZDNA 1X4FA 1ZS6A 1DAXA 5LMNK 2Q6BA 1C4CA 4X66K 4NLDA 5KFFA 5MLCV 3ISND 4F02A 3BY5A 2V34A 3TOQA 4F0MA 1Y4ZB 1NK4A 3H5YA 1TL5A 5CYMA 2GMJA 1KR4A 2E5LJ 4QPTA 1T02A 3F2KA 4DLGA 2E5GA 4F0KA 1S5ZA 2YX7A 2DGTA 1GLJO 2GJIA 1U1RA 4H03B 2ZM6J 1NZAA 1KN6A 1VQ6S 5AXKA 2HHWA 3FEYB 3RMBA 4DR6F 4CZLA 3AA4A 3LQVA 3M5RA 2RSQA 3EGNA 3GPAA 3OS2A 5GAEI 2R7UA 2KKZA 4USHA 5G0RB 3OYAA 2QXFA 3RYLA 3LGMA 3R9PA 1YZ7A 2QLXA 4ZVEA 4BRGA 1U1QA 4Y0WA 4CZHA 4K7QA 2NRZA 4KH6A 1RWPB 4DV6F 1S79A 1N6QB 3VA0A 3MN5A 2BABA 1A7GE 3BF4A 4GKJJ 4OGEA 2ZH9A 1B0VA 2M4MA 4ECUA 2O1PA 2BOPA 4CEZA 4WIIA 1YIJN 5HO4A 2FHKA 3TARA 3L2QA 4YDDB 2DRDA 2W7OA 3AVBA 5E5NA 1F2HA 4IZ9A 2GVDA 3WX8A 4Z94A 2X6NA 5ETTA 3M8PA 3KD1E 1FRKA 3L2UA 1KVIA 3W1YC 1S9GA 2ZOMA 3RSEA 2QW9A 1XHZA 4MH8A 4CHNA 1YJNN 3PSIA 2G4BA 2ZBPA 1IJEB 2MMYA 3FCHA 4WIQA 3ZTQA 2E2QA 3MAAB 3Q22A 1HPZA 3UD3P 4F3OA 4WTOB 2KRBA 3CD5A 3R6GB 2DY9A 1X5TA 2CQ0A 2IMWP 2DNZA 1JLCA 4BRNA 4PKHA 2P9KA 3GQCA 1LW0B 2JOQA 2HBQB 1H6KX 4ZTJA 2CNOB 2FDNA 2XY6A 1P90A 2P9PB 4ZCLA 2I2YA 1GX6A 3SFUA 2OPQB 1P9YA 4P52A 4LFBF 3N79A 1NBWA 1OYDA 5HROB 3TEGA 3SI8A 5CZ1A 1ATSA 4P10A 3MR2A 4K0KK 3M30B 1TKXB 2Q3PA 4A59A 2PMHA 1S59A 2Q0UA 3CC4S 4CZFA 8AT1B 3R3LA 1F5AA 3CO0P 4LH5A 1RKJA 4A8YA 1FDDA 2XZTB 4C48A 1XHXA 3LP2A 4IRKA 2HNYA 3M6XA 3PO5A 3CJ4A 4RW9B 3B6OA 4ISFA 3T5KA 3DDNA 2UUAJ 2OD4A 5KFBA 2V52B 3ZSRA 1VQ6N 1OYEA 2QXLA 2YNFA 1J2VA 4P72A 2F4VJ 1VRQC 2HG4A 3CJSA 3RRHA 4EAHD 4NCGB 5BPLA 1EX8A 1RT6B 2MXYA 4C0HA 1RDAA 2GTDA 3T19A 1Q5YA 2A5XA 3SBMA 4AHTA 2F9TA 1X4GA 3I33A 4X4VA 3J7YI 1REVA 1FX2A 2Z2ZA 2L9NA 1J6ZA 3ZC4A 2CJYB 3G25A 2CPHA 3VGLA 1DTQB 2XB2D 4RNNA 1GXTA 3SJHA 1YSJA 1XTZA 4DR6J 4CYUA 2XWXA 5C2GA 3N9UC 2HSTA 3F56A 1IJFB 3E51A 4IOCQ 1I6JA 4JI5F 2UXCF 3PRBA 2C2OB 1BHNA 4O3NA 2MZ1A 1NGFA 3GB0A 2YWGA 3BM7A 3CCSS 1HUXA 4USVA 4CHPA 2FZCB 1TK5A 5AQFA 1DLOA 4DV6J 3TNVA 3CIZA 4DX7A 2QWQA 3H25A 4NA1A 4IG0B 1KC8O 3K8VA 3C65A 5AFUH 3TAGA 1XNQK 4ED5A 4WBFA 2NPFA 3GZ7A 4OPAA 1RDCA 4B1YB 1SPBP 4Z2XA 2YKAA 3SCLE 2EFPA 1S1XA 3BH7B 4KKOA 4DV5J 1K47A 3DRXA 5CD4A 2UU9J 1CBKA 4PEOA 4Q2MA 3I6PA 1IXKA 2B9WA 3W9HA 5B0BA 2YQ0A 4JI0K 1B92A 3PKMA 2IM3A 3SNNA 1JXLA 3FKBA 3CC4N 4G1PA 1VK3A 2N4DA 4E1MA 2RRBA 2HHSA 4OYWA 3BH6B 4DTJA 1XQSC 2HZVA 4K43A 5HP1A 2CRLA 4LF9K 3FQKA 2YHBA 4M5JA 5HQ8A 4DFKA 1CJKB 2UUBK 1UJ4A 4KGKA 4Z0UA 3QEPA 1CJVB 4EYHB 2FVPA 2ZKTA 3PNIA 2NUUG 5AZJB 2CXEA 4YHHK 1RYRA 4FS1A 5AQIA 3ILOA 5HMZA 4L72B 4B02A 2ZJQL 2MQOA 4KHNA 1HKAA 3CFPA 2CJAA 4LRDA 3MM7B 2ZWPA 3NBPB 4AD6A 4P7TA 1TKZB 2P8IA 2DGUA 1WKKA 4OZNA 4AHSA 3KUEA 4RWXA 1UEUA 4OYXA 3UN5A 3PVXA 5A8RB 3MM5B 3HVWA 1GTEA 3UN3A 3MM6A 3W8GA 4DSIA 4J2AA 3ZT4A 2ZDPA 1HKBA 3DOKA 2V9WA 1LWCB 3OTDA 3ATUA 3CD7A 4IO9Q 4A48A 1XIQA 3AT1B 5GMKa 5H1SV 2GC8A 4O8KA 4EBEA 3TSQA 2ABYA 4W5TA 1HNXK 2F8MA 4QYRA 1JLFA 1TMMA 4CQ1A 5AE1A 1ULRA 1YJVA 1C0TA 3MMAA 1L3KA 5IT4A 1QTMA 3ISZA 4X4PA 1JLGA 3QB0A 3CCSN 1Y97A 2GHWA 3R5CA 3M3ZA 1VMBA 4KRWA 2IVFB 1IVZA 4I6MA 3V5RA 5IV4A 4DDFA 1G3OA 1NK0A 4KFBA 2R7YA 4JRQA 2F63A 3M2VB 2PO4A 4W5NA 3VQ6A 4CFAA 4ILGB 1X4HA 2BTFA 5ADXH 3T1YF 2MEWA 1RT3B 5LY3A 3VERA 2W24A 1RNHA 4MIAA 3D2EA 1JXVA 2VBYA 1OIAA 4JI5J 2RH3A 2UXCJ 1C1BB 1SQKA 1U6FA 3QICA 1XC3A 1I94K 2XM3A 1FK9A 1LKZA 1QJHA 3KDOA 2HIQA 1JJ4A 5LJWA 2VFSA 3EZ5A 3BQ0A 3HVTB 4NXMF 3RW7A 5AQNA 4O3QA 3ZTOA 2R2TA 3MR5A 4GKKF 3GDQA 2CPDA 4M3UA 4JNEA 3OHBA 1TKDA 3G6VA 3BZCA 2EBEA 4NRTA 1KNZA 1R3NA 4C2MA 3OVAA 3KNAA 3SV3A 3CPWR 1YBAA 2FZKB 4W5QA 1VSHA 1ICEB 1A5WA 4C8ZA 1G1XA 2LXFA 2DNYA 3PIPQ 3HYFA 3C14A 4ILRA 4ED6A 4OYAA 4A8FA 3DXMB 4WP9A 3BKTA 5F2RA 3VVTA 4NYOA 4PY5A 3B78A 1N8RO 1GOAA 1GMWA 3NNCA 3KHLA 4GY2B 3FBCA 4QWBA 3RBXA 2IDEA 3UKRA 5AQSA 4WE1A 1R31A 3OTOK 3N5FA 5I42A 3ZSYA 2PMZD 4IJAA 4DU4A 3KHRA 3QSYB 3NP5A 3IR6B 5H9FJ 2QSFA 4HACB 3MX5A 3SUNA 4YY3F 4PXEA 1VQ4S 2NYIA 2WW4A 1M1HA 2C2NA 3H1VX 4DTNA 1ILYA 3NMRA 4DTUA 1IR2A 2Y8YA 1CS4B 3OS0A 3DC2A 5AXLA 2G8IA 2VDHA 4LF2A 4MK8A 3BO2A 2JEJA 3GE9A 3RGIA 1UKUA 4X4UA 4M5DB 5DJBA 4UOGA 1K8KB 4IEIA 5KRTA 3DLLL 3M8QB 3QRRA 1MA9B 1Y9OA 2ACYA 3VGSA 3VESA 1Q16B 2ATLA 4O0IA 4FYXB 5C42A 4EO8A 2V5HG 3W3DA 4CZIA 1H2UX 2CUYA 3I9ZA 5M1PA 2BH1A 2DEIA 4JYAK 1V5IB 1UVLA 3MPVA 4USMA 4M42A 4WK3A 3H08A 3KZBA 3LP3A 3ZSVA 4QWEA 2B7BB 4KHRA 4W4MA 2DRBA 2P9UA 3QLHB 4C1NI 2RIJA 1CVJA 2IS3A 1NHKL 2GHVC 1QAIA 2HGLA 1V3RA 2IRYA 3NGUA 4ETXA 4OX7A 1LW2A 1IKYA 1FWPA 3G2XA 3GFYA 1ATRA 4NLXA 3NNHA 1SC1B 3PHEA 1TGOA 3QJLA 4YDUC 1UCNA 1W2BM 3NAHA 3P6YC 1RP5A 1U2FA 1I3OB 1VOMA 4RNOA 4E1NA 2EW9A 2ROEA 3TANA 1DTTA 4CWBA 4NXMJ 1VC5A 1RT1A 1NGIA 1N34F 4EFAC 1ZM4A 2QFIA 4NEZA 4C8YA 2KZMA 3UQSA 4GKKJ 4ZVFA 3GTYX 3SMPA 2RNEA 4M5GA 1FKAF 1W0HA 3L8BA 1FI4A 3ZX2A 1GK8A 3OW2M 2QEXS 5B0AA 1FT8A 4KAIA 1KVCA 2HHHF 3SI6A 2POKA 3D9BA 4AQYJ 1BIUA 1SI9A 4UF4A 3ASMA 1ZXOA 3CERA 1KHWA 1URNA 1CZ9A 5GAEP 3EVOA 1NB7A 5DM7L 1VQON 2BGGA 4X84A 4KO0A 2BACA 2KHDA 1VQ4N 2MSTA 4FF2A 4I2QA 4CLTA 1S10A 1OWXA 3R1LA 4BWJA 1S7IA 1RTIB 2AGOA 3ET6A 3KLIB 4ZLPA 1W7WA 2VFVA 2OAUA 1WF0A 1CQNA 3R5JB 1SV5A 4M41A 4CERA 4DCHA 1C1CB 3OV7A 3OR2A 1T8EA 2DGXA 4U7UD 1T03B 3I82A 1KQGB 2VB6A 2NSCA 2OJ3A 1Q1KA 2K06A 1Y5NB 1NEEA 3EKSA 1WSJA 8ATCB 5D0HA 3NHGA 2VUGA 4YY3J 2ZFHA 4MIWA 4EZ6A 3ZO7A 3QBWA 3PEJA 4WWSA 3J7Z5 4ES3A 3DHWC 3QIPA 2MZRA 4GV6A 2DHGA 2LEPA 1MLAA 2WB1D 5KRSA 1UVIA 3ULDA 2GMHA 3O1LA 1FRIA 3EM1A 3OXGA 2YNIA 4OL8A 4U67L 1M90T 5E3AA 2LFVA 3CD6S 3W64A 2CQGA 3BSCA 1JXEA 2GV1A 2C3UA 2HBMA 2NLWA 2HBZB 3UDEA 4DR5F 4I4BA 3HHEA 4C8KA 4AM6A 1FFSB 1X0PA 1LK5A 1F3FA 3P3DA 4CJPA 1RBUA 3HP9A 4CJKA 4ILHA 4JI7K 3DNCA 3THVA 1LV5A 3O5TB 2JFKA 2JWLA 1NJIO 4DOZA 4BC3A 3CXCR 3CJ0A 5HVHA 2Q1LA 4WFNL 2OPSB 3C6UA 2YWFA 2G8KA 4J37A 4FYYB 2MKJA 4ISGA 1TV6A 1RAOA 2ZH2A 3W66A 1RT5A 5CYQB 1YHQS 2AQ4A 2C22A 1K9MT 2QEXN 1E6VA 2NRHA 2JEIA 3L3VA 1YTUA 3HOSA 3Q7CA 2GO9A 2GVZA 4ZPCA 2RDJA 2D0AA 2VJVA 4WYLA 4GVEA 5A2QO 4G65A 1HYVA 1CG2A 2FJBB 2LXUA 4G1QA 3KJQB 2IA6A 3OLBA 4XTTA 3R9LA 1GTHA 2YKNA 1BQNA 1NK7A 1IG9A 1H7XA 3CCRS 4PKGA 1KD1T 4F4WA 3SPZA 4WFAL 2AJFE 2HHHJ 3TVYA 1TAUA 4C3KA 4R5PA 2Z58B 4FVCA 2YKMB 4P7VA 5BN8A 3AB4B 5D4NA 3QT7A 1HQEA 4OYPA 2GS8A 4WFYA 5KFPA 4BRAA 2JZ5A 3K5MA 1C6VA 5C2CA 2X6SA 1RTDA 1VQNS 1RABB 1R0AB 3CO9A 4DR1K 5IFMA 1CJTA 1UW9A 3OL7A 1SB6A 1ASVA 3BGOP 2YX6A 3MR3A 5IC4B <