4O4GB

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o4gB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o4gB03
3KMQA 2YNHB 5HLFA 2OPQB 4IFYA 1HNIB 4DL3A 2R8KA 2IA6A 5CYMA 3TAMA 4MFBB 3HVTB 1JLQB 4PUOB 4DEZA 1TL3A 2UVRA 4LSNB 1S6QA 1MMLA 4TYBA 4ID5B 4U7CA 3GIKA 2B6AA 2ILZA 4JV2A 3D5MA 4PWDA 3DOKB 1LWCB 1T03A 5KFHA 3DLEA 3MEDA 1JKHA 3MR5A 2ALZA 2AGQA 4TN2A 4NLGA 5KG2A 4K4XA 1HYSA 3DM2B 2RF2A 5FDLB 4F4WA 4ICLA 3BQ0A 2VG7A 1DLOA 3MEGA 5HBMA 2IJNA 3TVKA 1KLMB 2OPRA 1NNDA 3CVKA 1FKPB 1JLEB 4M95A 4ZVGA 3OHAA 2VG5A 1DTQA 4WE1A 5KFUA 4ZMMA 5KT2A 2FLLA 4IH7A 5KFDA 4TY8B 2R8HA 5F8GA 4O3RA 3KK1B 2QE5A 5KG5A 5JUMA 4ZHRB 4RW7A 5D3GB 1C1CB 1RA7A 3QGGA 4KSEB 4WFXA 3IS9B 1SUQB 3DOLB 4J9MA 2DPJA 5C25A 1RTDB 3NAIA 5KFGA 3T5JA 3FQLA 4QWAA 3KOAA 5I42B 5F8IA 1FK9B 3H40A 2R8IA 1REVA 1RT3A 4IG0B 1RT6B 3M8PB 3M8QB 1TL1B 4KHRA 4NLQA 2AX0A 4JV1A 3H59A 5C42A 2HNZA 1U09A 3KLIB 3LP2B 3FFIA 3QIPB 4XPEA 2B43A 3IG1B 2FVCA 4M94A 2IC3A 3JSMB 3BREA 5KG7A 1FKOA 3D28A 3HHKA 4ZPBA 5KFPA 4RW4A 2WB4A 2FLPA 4RW6B 1JLCA 1RAJA 1RTIB 3DLKB 2C2RA 3MECA 2BRKA 3UDLA 1EETA 1R0AB 1JXLA 2E9ZA 3ISND 2I5JA 3UPFA 4RNHA 3MEEA 3FRZA 1HMVA 5J2NB 4WFZA 3SFGA 2BANA 4K4UA 2IM2A 2UVUA 1S6PA 4O3QA 5KFXA 3Q8PB 2YKNA 2J6TA 1J5OB 3PJXA 4NLOA 2XCPA 3CWJA 2JEIA 2GIQA 1SV5B 5KT5A 2C2DA 2HNYA 4IRCA 1IKXA 4QWEA 2VA2A 1JLAA 3CJ5A 2JEJA 1TKZB 4O3OA 1S1WB 1T3NA 5DLFA 4F4XA 4DL5A 4RNFA 2ILYA 3FSIA 3V6DB 1N5YB 3PW5A 2IM0A 4LSLB 4NLVA 3LALA 1VRTA 3IRXA 5J1EB 5KFRA 4YQWA 1C0TA 4Y34A 5J2PB 2IM3A 3IGNA 3N6MA 4WXWA 1JLBA 2YKMA 3KLGA 5J2MA 2AX1A 4NZ0A 3MFHA 2W9BA 1D1UA 1XR6A 4GC7A 4B3OB 4H4OB 4QWDA 2YNFA 2J6UA 2AGOA 4KFBB 3V81B 4IG3A 5KFKA 5EWGA 4ED1A 3CDUA 3DYAB 1LW0A 4G1QA 3RB3A 1C1BA 1HPZA 1IKVA 1TKTB 1KHVA 3GIIA 3T5KA 3E01B 3MR3A 3GIJA 2ASJA 1RTHA 2VG6A 4RW8B 1BQNB 2WONA 4LQ9A 5KFNA 3DRRB 1LWEA 1S1VA 1S1UB 3QYYA 1BQMA 5EDWA 4H4MA 2WCXA 4IDKB 3VQSA 5I3UA 3PR4A 1S0MA 2UVVA 3IGVA 3LANA 1VRUB 1JLGB 4K4SA 3OL7A 2HWHA 2IAJA 1IM4A 3DMJA 1YVFA 4Q0BA 4MKAA 3M9NB 3LP1A 5HROB 1ZTWA 1HQUA 4ZVEA 1QE1A 4F4ZA 4I7FB 3DRSB 3FDSA 3RAXA 3I0RA 2BE2B 3I5BA 4J9QA 1DTTB 4ECVA 2D3ZA 4WYLA 4RW9B 4O4GA 4R8UB 2RKIB 3KJVB 4KO0B 1TVRA 4I2QA 1NHUA 2O5DA 2HAIA 4F4YA 4Q8FA 5KFZA 1QAIA 1S49A 3NBPA 1IKWA 1JLFA 4RNMA 2AU0A 3PZPA 2UUWA 4WFYA 3OL8A 2OPPB 4ECSA 3C6TA 2OPSA 5CYQB 4RZRA 4K4TA 2BQ3A 4URSA 3PW0A 1K1SA 1RA6A 3MTKA 4ZVHA 4ZP6A 3KK3A 2XGQA 1LW2A 3CIZA 3KLVA 4Q43A 4IQXA 1S9GA 4DG1B 3ITHB 1C0UA 4TQRA 5KFJA 4NCGB 4IH6A 3CJ0A 3QO9B 3KLEA 5KT6A 3OLAA 3JYTB 5HP1A 1N6QA 2XC9A 1S9EA 1N4LA 5KFFA 4F50A 1HNVA 4FS2A 3OSNA 4TYAA 1N48A 3GV7B 5JXSA 4YP3A 3DRPB 2OH2A 3ISNC 4RU9A 4FBUA 4JUZA 3RB6A 1S1TA 2UVWA 2W8KA 4I2PB 3NAHA 2ZE2A 5DG9A 3IN5A 3KK2B 3QGIA 5L9XA 3I0SB 4KB7A 2YNGA 5KFLA 4YR3A 3CJ4A 3IS9A 5DQIA 4Y3CA 3RBEA 4ED0A 5C24A 2BRLA 1RT7B 4IFVB 1CSJA 1S1XB 1UWBA 2CKWA 4ZP8A 2XGPA 2W7OA 4NLPA 3KMSA 2WOMA 3KLFB 3M8QA 1GX5A 2W9CB 4IOBA 4KV8B 5L1KA 4KAIA 3C6UB 3QLHA 5HLFB 2DPIA 1S9FA 4DL2A 4IFYB 3QIPA 5DQHA 4KKOA 4J9OA 4J9KA 5KFIA 5KFEA 4QW9A 4O3SA 2D3UA 5CYMB 2YNIA 3TAMB 5DLGA 4HYKA 1TL3B 4QWCA 3GILA 5J2QA 4EO8A 3HVAA 2R8GA 1S10A 1S6QB 4H54A 2B5JA 4MK9A 1W25A 4NRUA 5DG8A 2BR0A 4J9NA 1LWFA 1HQEA 4PWDB 2WK4A 1RT5A 4MK8A 1T03B 3DDKA 3LP0A 3H4DA 3DLEB 3MEDB 1JKHB 3T5LA 2IJFA 3G86A 2JLEA 4ZPAA 1HYSB 2RF2B 1RT4A 4ICLB 2VG7B 1DLOB 3MEGB 5HBMB 4ECYA 4ED7A 2OPRB 4IR1A 2R2SA 4DL4A 1RYSA 4G3IA 1WNEA 2VG5B 1DTQB 3DI6A 4WE1B 5KFTA 3G6XA 3M9MB 4FBTA 1S48A 4ED2A 2FJWA 2FVPA 5J1EA 1RT1A 4IRKA 3QZ7A 4ECQA 3BSCA 2QV6A 3T1AA 3LAKA 4RW7B 2WHOA 3MFIA 1RTJA 4J9SA 3DLGB 2EC0A 1SH2A 2XWYA 5C25B 5KFVA 3RB0A 4B3OA 2XCAA 4K4ZA 3V4IA 2FJXA 5DGBA 1REVB 1RT3B 4TLRA 4HKQA 4ED6A 1QUVA 5KT4A 1Z4UA 4JV0A 3BQ2A 4DL6A 3OL9A 4OL8A 5C42B 2HNZB 3BGRA 3PVXA 3FFIB 2V9WA 4R5PA 2FJVA 3EPGA 1BQNA 5F8HA 4J9RA 3DRRA 1FKOB 1SH0A 3H5SA 1TKXA 3GV5B 2D41A 4RW4B 3QZ8A 3SI8A 2AQ4A 3OL6A 3KLHA 1JLCB 1IKYA 4RUCA 2WTFA 2WRMA 3MECB 1EETB 2HWIA 2W9AA 4J9LA 2I5JB 2C2EA 4URQU 1S0NA 1HMVB 2R2RA 2BANB 4O44A 4Q45A 4GC6A 3V6KA 4PQUA 1S6PB 2BE2A 3I5AA 3V6JA 2ATLA 2YKNB 3SFUA 1T05A 3GYNA 1QAJA 2ZD1A 4RNOA 4EO6A 3MF5A 3KHHA 1RYRA 1EP4A 2HNYB 1IKXB 3H5XA 3KNAA 4O3NA 1JLAB 3GQCA 5KFBA 5KFSA 2E9TA 5KT3A 3TQ1A 1RT2A 3H2LA 3G6VA 2HMIA 2HNDA 1VRTB 3IRXB 4IKAA 4O3PA 2E9RX 3N6LA 1C0TB 5KG3A 2YNHA 2JC0A 2OPQA 4KBIA 1HNIA 4EYHB 4ECRA 1JLBB 4NLTA 2YKMB 3KLGB 5J2MB 4PUOA 2W9BB 4MFBA 3HVTA 1JLQA 3NGDA 1TV6B 1TP7A 4IR9A 4LSNA 2YNFB 3OHBA 4ID5A 4MIAA 3UQSA 4ZPDA 4IG3B 3BSOA 4QW8A 1S0OA 4G1QB 1LW0B 4J9PA 3H5UA 3DOKA 1ZETA 2IBKA 1HPZB 1IKVB 1LWCA 3HVWA 5F8NA 5KFOA 3CDWA 1RTHB 4ZVFA 2VA3A 2VG6B 2ZKUA 4NRTA 3DM2A 1LWEB 5FDLA 1S1VB 2R2TA 4KE5A 1BQMB 2JEGA 4H4MB 3UR0A 3T5HA 2ASDA 3EPIA 4U6PA 1KLMA 1FKPA 4Y2AA 5KG1A 2IAJB 1JLEA 3CO9A 4YR2A 2BQRA 3DMJB 4Q0BB 3BJYA 1S1XA 3LP1B 3QGHA 4LQ3A 1HQUB 5KG4A 1QE1B 4ECWA 1HARA 2C22A 4Q8EA 4EEYA 3I5CA 4TY8A 1S97A 4NYZA 4Q44A 1MU2B 4RNNA 3KK1A 4NLUA 3CJ3A 3E51A 4ECTA 2BQUA 4EYIB 4ZHRA 5D3GA 1C1CA 4O4GB 4R0EA 1SUQA 3DOLA 4ECXA 1TVRB 4I2QB 3N6NA 3KHGA 1RTDA 2J6SA 5K14B 2V4RA 5I42A 3NBPB 4MKBA 1IKWB 1FK9A 1JLFB 4NLDA 2RDIA 4IG0A 1RT6A 3M8PA 4TQSA 5F8LA 3V6HA 3M9OB 1TL1A 4MK7A 3C6TB 2OPSB 2FVSA 3RB4A 4NLSA 3KLIA 3LP2A 2XI2A 3KK3B 3BR9A 4QPXA 1LW2B 3IG1A 4EBCA 3JSMA 3PW7A 2W8LA 1S9GB 3PW4A 4NLXA 1C0UB 3CJ2A 3MR2A 4RW6A 3G6YA 3KLEB 1RTIA 3DLKA 2B6AB 3EZUA 3ICLA 5HP1B 5DGAA 4MIBA 1R0AA 3HKWA 4WZQA 1N6QB 1S9EB 1HNVB 5J2NA 1K1QA 4TXSA 2FLNA 2AWZA 1XR7A 1S1TB 1J5OA 2ZE2B 1C2PA 1JIHA 1SV5A 2YNGB 3DLGA 4K4VA 2JEFA 4ED3A 3H4BA 5C24B 1TKZA 1KHWA 1OS5A 4IRDA 1S1WA 1UWBB 3BQ1A 3V6DA 1N5YA 1GX6A 4LSLA 5DQGA 2WOMB 1TQLA 3Q8SB 1SH3A 2F8EX 5J2PA 4WXOA 4X2BA 3QLHB 4Y2CA 1ZTTA 4WZMA 2AGPA 4KKOB 2YNIB 5F9LA 4H4OA 2FVQA 5EWFA 5J2QB 5KFAA 4O4RA 4NLYA 4KFBA 3V81A 1XR5A 3H98A 2B5JB 1NHVA 2C28A 4XPCA 3DYAA 1LWFB 4NLWA 5KG6A 3GIMA 1TKTA 1HQEB 2FVRA 3E01A 1I6JA 1RT5B 5C5JA 3KHLA 5F9NA 3LP0B 3RAQA 4RW8A 4EBEA 2IC3B 4ZPCA 2W7PA 1S1UA 4IH5A 2D7SA 2XI3A 3PHEA 4IDKA 5DG7A 1RT4B 2RDJA 5L1LA 1VRUA 1JLGA 3NL0A 2I1RA 2V0NA 4WYWA 5HROA 5T14A 3DI6B 3MEEB 3DRSA 4I7FA 4ZP7A 1S4FA 3PR5B 5L1IA 2CJQA 4K50A 3LAMA 5F8MA 1DTTA 3BSAA 3T19A 1RT1B 4MH8A 4RW9A 3RBDA 5KFWA 4R8UA 2RKIA 3KJVA 4KO0A 1RTJB 5KFMA 2UUTA 3H5YA 1TV6A 4ECUA 1T94A 3NMAA 4YMEA 2V4QA 3V4IB 4YR0A 2GC8A 4RUAA 2OPPA 3PJWA 5EWEA 2JC1A 5CYQA 4KHMA 4URGA 3BGRB 4QWBA 5KFCA 4R5PB 3BSNA 1JX4A 4DG1A 3ITHA 2GIRA 3CDEA 5F8JA 4K4WA 1TKXB 3PW2A 4NLRA 2R8JA 4NCGA 1N56A 3QO9A 3KLHB 1IKYB 3JYTA 3GV8B 4XO0A 3Q8QB 3OLBA 3MR6A 4ECZA 3NKYA 1C1BB 5KT7A 4ED8A 1D0EA 3DRPA 4O44B 3KHRA 5KFYA 4PQUB 2WONB 2IM1A 1MU2A 4I2PA 5KG0A 4K4YA 1T05B 3KK2A 3FQKA 3I0SA 2ZD1B 5I3UB 4DL7A 2IMWP 1EP4B 3Q8RB 2ASLA 5L1JA 5EUHA 3OSPA 2R2UA 5KFQA 1RT7A 4IFVA 5K14A 4ZP9A 4EBDA 4TY9A 3KLFA 3QIDA 1RT2B 3I0RB 2W9CA 4KV8A 2HMIB 2HNDB 1RDRA 4FS1A 3C6UA
chains in the Genus database with same CATH superfamily
4CTAA 3KMQA 1SKUB 2L9DA 5LMUJ 2O66A 1NSKL 1RAFB 2HQDA 4JV2A 2O1PA 2DNLA 4PWDA 3ZZOA 3A8EA 2KVIA 4Y2KA 2CQ4A 4JYAF 2NYIA 3KXDA 3RRKA 1KLMB 1SCJB 3FUYA 2Y0BB 5KT2A 1B99A 4OYZA 4YB5A 5D4PA 3KK1B 5SUHA 3ISZA 1N56A 4KSEB 4PPDA 4MKVA 3KOAA 1XTZA 4DV6F 1APSA 2LMIA 2FY8A 1QSSA 3SBMA 3MPYA 1HLWA 4LF6J 2F63A 4L72B 5G0RB 2RJZA 2LYVA 2DXEA 5BR8J 1LK5A 1JXLA 3UD3P 1OPZA 1RWKB 4WFZA 2NCKL 4ERDA 3IBCB 1CC8A 5CXTA 4N41A 3CCVS 1WKLA 3UFCX 3FEYB 4NXNJ 3IGNA 4C8MA 2AX1A 2AEJA 3MFHA 2WW8A 4ITSA 1VR6A 1RK8A 5HJYA 1IKVA 3HHLC 1RTHA 1BQNB 1RBLA 4LQ9A 3MR2A 3M6UA 4I0WA 2WBRA 1HQUA 5B0CA 2VZ9A 4NXMJ 4M5JA 2KJVA 4F4YA 5B7WA 2EI5A 2X1GA 2MLXA 4HR2A 2OPSA 3W60A 3CIZA 1B0TA 1U4BA 1PSDA 3JYTB 3FZBA 1EZZB 1J27A 1NCLA 5ETNA 4IFVB 1F60B 5CZXA 3KLFB 1IR2A 5HQMA 4I1TA 1X0PA 1NUEA 3W5ZA 3C16B 5J2QA 5ETRA 2GMHA 2BR0A 4J9NA 2OMOA 1FKAF 4FXWA 3T5LA 3DLEB 3UD4P 1S12A 3BO4A 1F9FA 5A2QU 2Y1LB 3KUEA 2B4VA 1UVIA 3CSKA 3D6HB 3LAKA 3MFIA 2HS0A 3E3XA 4EZ9A 3R9LA 2XCAA 4IYQA 1FWKA 3GONA 1RBOB 1H0HB 3LF0A 3M8SA 3VAHA 5LJ5Y 2V9WA 2LU2A 1WHWA 4RW4B 4RUCA 1ZM9A 2ZBQA 2C2EA 4U67Q 5IOLA 3MM9B 2BE2A 2R7OA 1QAJA 4RNOA 2V4JB 2HNYB 1IKXB 5KFSA 4BLGA 4P52A 4DV3J 3X3UA 3GLJA 1WKJA 4KBIA 4NLTA 2XMWA 4IR9A 1XNRJ 1NH8A 4MIAA 5D0RA 2VH7A 3R8YA 4K2JA 4RL1A 2ABYA 4UTGA 1YK9A 2Y1JA 3UR0A 1B0VA 2E44A 4C98A 2QRRA 4RNNA 2HHTA 4R0EA 3DDNA 1SB6A 1U1NA 1TFWA 1GEHA 4B08A 1FRHA 5HVGA 1R8PA 2GGPB 3A3NB 4KGZB 1RISA 2ZZTA 3PRDA 3NGRA 3VAMA 2CIMA 3ICLA 2FZCB 2LEPA 4DV4J 2FLNA 1XR7A 5CHCB 1RZMA 5A0YA 5B08A 3T3FA 1OS5A 2DNOA 4OQJA 2EFGA 2JVOA 3MAQA 2DBBA 2Z2MA 1ZTTA 6FDRA 3TJ9A 2NXUA 4FP9A 3EZ5A 2B0GA 3GIMA 1S0VA 1M5SA 3JAMY 2M8HA 2MKJA 3ET6A 2RDJA 3MD3A 2LEAA 4C8ZA 4LMZA 2MQNA 2AYBA 2FJEB 1T0TV 3I6PA 2HHQA 2G4BA 1YJUA 2ATCB 2UUTA 1JMTA 1RAGB 1N54B 1D3WA 2XM3A 4HH1A 3UVJB 5GAEI 2MYFA 2VFUA 3P3DA 3R5AA 4I69A 2CNNB 4X65F 3EVOA 3MR6A 2GVDA 4CCHA 2FC8A 3X1LB 1SJ4P 3T6JA 1T05B 2JL9A 2IMWP 2C2NA 3Q8RB 5EUHA 3OSPA 2R2UA 1EB0A 1R0CB 1LK7A 2UZAA 3D1QA 1QUVA 3QRPA 4I67A 3OTBA 1L5UA 1S6QA 1Q4RA 1RU1A 2M2BA 1FJEB 2QLJB 4ZVOB 3HT3A 2HURA 2KU7A 1H72C 3M2VA 2IJNA 1VQLS 2J7KA 4NX9A 2ZM6J 2JX2A 2MQLA 5LOQA 3OHAA 2BDPA 3D3CJ 1SJ1A 5KFUA 2MHNA 4IH7A 1GMWD 2G2YA 2M52A 1TR0A 2DPJA 2DXDA 2AW0A 5CA5A 1RT6B 2QL5B 2DXFA 3MOZA 3DLLQ 2FVCA 2CJAA 2KFYA 1DARA 2NZCA 1UEVA 2F4VF 3SFGA 3FRYA 3PHTA 4FDFA 2XSFA 4LBIA 2B8QA 1H7WA 1UW4A 4F4XA 4DL5A 1VMBA 3LALA 1T9UA 3VZHA 2R42A 5J2PB 3IWXA 2OSQA 3MAAA 4QWDA 2AGOA 1SKSA 1WSVA 1FXRA 1T02A 3W7BA 4DV0F 2AJFE 1TKTB 4I4BA 3GIIA 4X66F 1UEUA 2DO4A 5HMXA 2H4YB 3LP1A 4ZVEA 1QE1A 1Q78A 2V2QA 2HSEB 2ZHAA 4WYLA 1PG5B 3HFZB 2RKIB 3KJVB 2FD2A 2JHEA 5I3QA 1JLFA 3PZPA 1N52B 2BOAA 4K4TA 1K1SA 5U47A 1LW2A 2B4PA 4IQXA 3TP2A 1ZA1B 3S6EA 3EVWA 4DUZJ 4FS2A 4LFCJ 4RU9A 2BUNA 1NXIA 3NGSA 4RR5A 3QGIA 1T11A 3NS7B 3CJ4A 1NEEA 1ZM2A 2CKWA 4CM2A 3JQKA 3M8QA 3Q83A 2UU9F 3O2IA 2EFVA 3BV8A 4WP3A 3G4SS 3TX0A 3AQPA 2EPIA 1TMMA 5KFEA 2YNIA 4HYKA 1NDPA 4I56A 1CJTA 3SSSA 2VF3A 5RUBA 1T03B 1U02A 3G86A 1RT4A 2VG7B 2RHQB 3HSDA 3CGIA 3KUHA 2VFTA 4LRFA 5GVQA 3G71S 3MI7X 3WHIA 3OV7A 2EWHA 2IFXA 4IRKA 1VK8A 1PBAA 5C25B 1LQ9A 1BXNA 2ZDPA 2L08A 4DL6A 4QR1A 1PJ7A 2AZ3A 8AT1B 4J9RA 2MQPA 4OFZA 1RTZA 2ZH6A 2HBRB 2WB1D 2RDDA 2ZH4A 1T8EA 1YJ7A 1S6PB 1CJVA 4GKKJ 3C15B 4ZJLA 1R31A 1RSCA 2XMAA 3AA8A 2F5GA 4BHQA 2YNHA 1D9DA 4JB8B 3VVTA 1R8BA 3UQSA 2ZUAA 4CT9A 2XMVA 5ETLA 3PO5A 4PEOA 2AJ4A 2F8HA 1S1VB 1RAAB 1NJIT 2KXNB 4F7VA 4Y2AA 2BQRA 1RHRB 3NCRA 4F67A 3Q2TC 3ZNUA 2PMWA 1HR0J 4EYIB 2DHAA 3RJMB 4MKBA 1IKWB 4EK2A 4O0IA 4TU9A 4MK7A 5EX3A 3L7PA 1U8WA 2HHXA 4B3RF 2J9DE 2B6AB 3KDOA 1R0AA 2D9OA 4Y00A 1HNVB 4A48A 1TUVA 2HBYB 2HFOA 4ZLNA 2VC0A 1J5OA 3FBEA 2FZGB 1MWQA 3MM7A 4FF3A 1UWBB 3TUPA 1N5YA 3D4JA 4OHWA 1W2IA 4PPZA 4HDGA 2QA4S 1XR5A 4OI4A 4DS5A 3W66A 1HQEB 1H2TZ 3LP0B 4RW8A 4F4KA 4F36A 1JNRB 2P9CA 4FXDA 3D6FB 3MR7A 5HI7A 1PYTA 1QVGR 3MD1A 2QJ3A 3MM6A 4I7FA 2VKZG 4L76A 1HFEL 4K50A 4DV5J 3CDAA 3DFEA 4DUYF 4KO0A 1RTJB 1L3TA 4OYWA 1TV6A 3J7A1 2FPHX 2J5AA 5K8MA 1Q7YT 3NCQA 1YRXA 2KHCA 1VC6A 2QZ8A 4NCGA 4M5DA 3GV8B 1IJEB 1C1BB 3QQCD 3LW5C 4ZP9A 4P71A 1SJ3P 4KV8A 2VFVA 3BGLA 3GIKA 5DDRC 2AP6A 2DISA 1I3OB 1OMSA 5KFHA 1VQ6S 1L3KA 2RSQA 4DV1J 3CCJS 4JI2J 3M6VA 2FGOA 4P2MA 5KG5A 2X1AA 4JI6J 1HBNA 2DNPA 3M30A 1X5SA 3T5JA 1REVA 4C8NA 1AT1B 4L6V3 1U09A 3LGMA 2LA6A 2ZJRQ 3MM5B 1RAJA 2CVEA 3PX4A 1X8DA 3J7YI 3JTOA 2C2DA 2GMJA 2MMYA 4JOUA 2M3DA 4HH0A 4YUDA 4C3LA 2MY7A 1C0TA 2DNRA 3UCUP 3KLGA 2YX1A 2YNFA 3V81B 4H4KC 2ADBA 3HD2A 4O23A 1C4CA 3QMQA 1HW8A 1X60A 4NCBA 3IGVA 3KJNB 1S7HA 3JTNA 1IWGA 4LR9A 2OSRA 1DTTB 3CIMA 4K8RA 2DR8A 1TVRA 4RLEA 3ZTOA 4WP9A 1N34F 3RZAA 4WIQA 2HGMA 1UFKA 2Y3YA 3MZIA 2G0JA 3OLAA 1NJYA 5KFFA 4M5MA 2HVHA 2W7AA 3UDCA 3GG0A 2CPFA 2PDAA 4ZVUB 2Z2ZA 3H0PA 3TJAA 2G0IA 1Y10A 2A10A 1EKSA 2HKEA 3PJ9A 2H51B 4RWXA 1UPPA 3KG4A 3NRBA 2XMUA 5DDOC 3R97A 1EKRA 2JRSA 2DHXA 4MMOA 2P6SA 3VVUA 3MURP 1XNQJ 1M5KC 5HSPA 1FJCA 3RAMA 3K7RA 1ZAXA 2VQEF 2WK4A 2R7RA 2DR9A 1QM9A 5ETPA 4J5OA 2R2SA 4DL4A 3M9MB 2MJNA 2FVPA 2GW8A 4ECQA 2ZH7A 2J9EA 4LF4F 1FHTA 5IS2A 3BGOP 2K7KA 4FF4A 2JLFA 1F9EB 5DZ7A 3PYDA 1WHXA 4QBUA 3FFIB 1CS4A 3HZEA 1FKOB 2LVWA 2CDRB 1X4CA 4F0HA 2MQQA 1WEZA 1RAIB 1YSJA 2XTJP 2A2CA 4EUVA 4N8OA 2VB6A 3RBXA 1NK0A 3M7VA 3KNAA 3C19A 1T3OA 2CZVC 4ATNA 4G1PA 4B17A 2E9TA 3F73A 2HQFA 1RU2A 3KUGA 3N6LA 2RH3A 5DZ6A 2MGZB 2C2KB 5J2MB 1JLQA 4C11B 1UJ6A 2BZ2A 4QU7A 2FGCA 2H5EA 1S0OA 2GFFA 3VR1A 1ZETA 1X7VA 5F8NA 3ZO7A 4Y2IA 1SQGA 5L9NA 2X3GA 3CCZA 1EIYB 1X4AA 2KG1A 3EYZA 3DOLA 4DR5J 2IRUA 1HBMB 4EGLA 4DFMA 1VDHA 1ZM4A 3VF0B 2JVRA 1KWMA 1KR4A 3N9UC 4CLZA 3KLEB 4OI6A 2GAGC 4F3OA 4JI8F 1A7GE 4IO1A 2BXJA 3UN2A 2UUBJ 1SV5A 4YB1P 4IRDA 3BQ1A 4B9MA 1T9YA 4OHZA 5DQGA 1UVMA 4Y2CA 5LMNJ 1GK8A 4WZMA 3LGNA 1R0BG 3NOGA 2C28A 1I6JA 1VIOA 3R5BA 1F6TA 2DNHA 2IC3B 4CT8A 5FIIA 3OTEA 5LSLA 4LFBJ 2E5HA 1AXQA 1D09B 3PFEA 2HHHJ 1GTHA 1LFPA 1Y5IB 7FDRA 1YKWA 1QAYA 9RUBA 3US5A 4ECUA 2UUCF 2GC8A 5K8PA 1EAYC 4LF9F 3HD1A 1I94J 3GYGA 1P9YA 2NR0A 3H2UB 4DG1A 2GIRA 4LUBA 2ZH1A 3QRQA 5DJBA 3M4XA 1HBOA 3CEDA 1RUSA 4ED8A 2A6OA 5GAHU 1EJ7L 1MU2A 1JK9B 3OXGA 4NMLA 4K2XA 2KTQA 1RT7A 2HHWA 4DL0C 3A8IA 1RT2B 2HMIB 2GVZB 4PYAA 4DL3A 4JI0F 3PX6A 2XLKA 1BQXA 2ILZA 3TNVA 3OVBA 2QSWA 1DRZA 2R3VA 4HTJA 1HA1A 4USVA 4DX5A 1U26A 3BM7A 2RQ4A 2XY5A 4WE1A 3MM8A 4NWBA 2PGCA 2B7BB 4RW7A 4CI0B 1SUQB 5I42B 3LUYA 1HWKA 2HYIB 3Q89A 3KLIB 1PBUA 4PKDB 2HIYA 1X4BA 5A8WA 3JSMB 1VBXA 1Q79A 1RTIB 2P8IA 3ZZYA 1FCAA 4RNHA 2H5JB 3BBFA 3NGTA 5C2CA 3TZYA 2J0WA 5D4NA 4HACA 4MYTA 2B7CB 4UOCA 2HIQA 4FZVA 2CQHA 3C2PA 1WC4A 1O5JA 1HNZF 2LDYA 4NEZA 2VJVA 3DYAB 2VG6A 2PMHA 2R7TA 3MOJB 2H3EB 5I3UA 1R7IA 3LANA 3Q2SC 1YVFA 4B3MJ 4J9VA 3MMJA 4ANEA 2RU3A 5AXNA 4P2XA 2G0CA 4R8UB 2GMLA 4RNMA 1FJGF 4ZITA 6AT1B 1CJUB 2V69A 3AD7C 1SIWB 1RA6A 3AH6A 5DM6Q 4YHHJ 1U1RA 2WVFA 1MMNA 1ICEB 3ISNC 4ZVPB 4Q7AA 3QJJA 3I0SB 3WX8A 3IXQA 1BWEA 3AJDA 3NXZA 2GO8A 4NE9C 1VQPS 4IFYB 3JAMU 3DXSX 2OIHA 3MMAB 3LH2S 2GJIA 2EG2A 1P1TA 2CPEA 3H4DA 1HYSB 4BCAA 3UDVA 2KT3A 2MY8A 5CD4A 4X4TA 4DQRA 3T41A 3DI6A 3EZOA 2VFRA 2XZWA 3QZ7A 5IQQA 2WHOA 3EE3A 4B3OA 3UNYA 2ZOMA 2K1RA 4TLRA 2QFJA 4HKQA 5AXLA 3BQ2A 1ZZNA 4FNIA 2FJVA 3EPGA 1S59A 4HT5A 4N76A 3O5TB 2CPXA 1HMVB 4PQUA 2GZOA 1M1KT 1P6TA 3TQ1A 1VRTB 2Q43A 2Y1RI 2JC0A 1JLBB 1NLKL 1VHIA 1IQTA 5D4LA 3I32A 2WZ1A 1WHYA 2HWTA 4ZVRB 1XMQJ 3SCIE 5KFOA 1MMDA 4DUTA 4ZJQA 1KLMA 1RAEB 2CFXA 3TOQA 3K17A 2MKKA 5KG4A 1HARA 2HVZA 1N32F 2M4MA 2Z56B 1HWUA 2WSCC 4NYZA 3KK1A 2V2ZA 2JNJA 4O4GB 4U8YA 2W2MP 2CQIA 3IA0A 5G0RA 3MCNA 4K59A 1YITS 1F5CA 5CAAA 2PI4A 3CMQA 4V19J 2MLYA 3NCPA 4GRSA 2FY1A 2V2VA 1NDKA 4FPRA 2GJ2A 1G7CB 2Z58B 4QYZJ 4LF8F 4ED4A 2VKRA 4O4RA 2RILA 2QSFA 4RUBA 2B5JB 4C48A 4XPCA 2FVRA 1RT5B 1X9SA 1J5EF 3J80U 1FNMA 3NY0A 4DI6A 5DG7A 2DNMA 3B78A 2XEXA 3P8BB 4ZP7A 2YPZA 3LAMA 5F8MA 3RW7A 5KFWA 5H1SV 4M5LA 2V4QA 4YY3F 1N33J 1N36F 5EWEA 4C8YA 1NK7A 4QWBA 3V5RA 3M2RB 2AYGA 3QAEA 3KLHB 3JYTA 1NPPA 3Q8QB 3TQEA 2G1HA 3G8SA 2EG1A 3HSGA 2JOQA 1N5SA 4IFVA 1NDLA 1SC3B 3SQOP 2VUGA 3G82B 4TY9A 3KLFA 2W4DA 4ZDNA 2OUGA 4ZKAA 4LSNB 1MMLA 4CLLA 3JB9k 1VQ8S 3PO4A 2YWKA 5K8NA 4OYBA 2EFOA 3DLEA 2LEBA 3F0NA 3CVKA 1RWWB 2PSZA 3CJ8A 4ELUA 4N77A 1PGZA 4R25A 2ZOFA 4FF2A 2C1EB 5D78A 1EQ0A 5KTQA 3T1YF 4NYOA 2AX0A 1S76D 2Z0GA 3IG1B 1RWNB 3KJFB 2IDLA 4RW4A 3AJ2A 4RW6B 3AT1B 1GAOA 2DR5A 4F26A 3M8ZA 2NXNA 3MM9A 2CZ9A 1GQEA 2JEIA 4DFJA 2V4JA 4C8KA 2HNYA 1IKXA 2R4FA 4O3OA 3HMJG 2B51A 3PM9A 4DV3F 5J1EB 4QR2A 3D0GE 2C22A 5C7PA 3MUVP 1D1UA 1FWPA 2CPHA 3OUYB 1OSCA 2JDJA 5EWGA 3THPA 1NK9A 4KH1B 1F3FA 2GNKA 2YBVA 2HWHA 2CVIA 3DRSB 1D9FA 2F4FA 2VOOA 4Z7YA 2BKPA 1A6LA 1BUXA 1HNWF 5E33A 1U7LA 4WFYA 2OPPB 2GGPA 3CF5Q 3IAM9 5CYQB 2EW9A 2UXCJ 3OTOJ 2BM0A 2JWNA 2OFGX 4IH6A 1U1QA 2RQMA 4FKXA 4TYAA 2OJ3A 4DV4F 4DR4J 2Z2YB 3J81j 1U6ZA 1X9WA 4Q2LA 4FNHA 3NWRA 1U25A 2PMZD 1R8AA 3ILOA 4IOBA 4PXEA 4Y65A 2E5LJ 3G8QA 2K2PA 4AL6A 2E7VA 4QW9A 2RRNA 4ZCIA 3CMAS 4WU3A 4KGKA 1AZSA 3W3SA 2IJFA 2RHSB 3R7BB 4ECYA 3MEGB 2R7UA 1WTFA 1R27B 1VQ9S 4G3IA 1WNEA 2VG5B 2AJ0A 5KFTA 2NS1B 5EX0A 2IRXA 5LT5A 1RHKB 1L3VA 3RB0A 1Q53A 4K4ZA 4OX8A 2DTJA 4PXDA 2XLJA 1UA1A 4ZIWA 3NS6A 3UI3A 4F4AA 2WVDA 3UVJA 2I6WA 2G2ZA 4K7QA 3H5SA 2F8MA 4PZVA 3QFHA 3V6JA 3I5AA 1T05A 4I6WA 4CH0S 1UVLA 1BWVA 3W2WB 3H5XA 1JLAB 1HQ2A 4B9SA 4CLFA 4LFAF 5E5NA 3IRXB 5KG3A 4MYUA 3O44A 3KDNA 3D1OA 1SQFA 1RLDA 4X4NA 3LPYA 1BQMB 2ASDA 2VFSA 2MZQA 2UV8A 4YR2A 4A8QA 3DMJB 1I5OB 5B0EA 4QQBA 2HRTA 2GHWA 4PXBA 2CG8A 1WD6A 2E7WA 3GCXP 1YG0A 2HVIA 5E3AA 1RT6A 3ZFVA 4C4WA 3BKUA 4NLSA 5AXKA 4QPXA 5CABA 4EBCA 5F0WA 4FF1A 1RCOB 1S9EB 5D15A 4O0NA 2EVZA 3L3CA 5D0GA 3HJVA 3CJQA 2Q3PA 2YNGB 3FSXA 3DLGA 4DXLA 1FRJA 1KHWA 4C0OC 2ZOGA 2OTJS 1KVIA 1PILA 4GO5X 5J2PA 2Y9HA 3QLHB 2NREA 5AXMA 1EARA 4USMA 2XSJB 3D2WA 3LA0A 1N5QA 3Q8UA 1TKTA 2KI2A 1C4AA 1HD1A 2XI3A 2HHSA 2QT7A 3H2VE 2OHDA 1Z1ZA 3PR5B 2DGQA 2C3PA 3CC2S 2E5GA 4CLKA 2RKIA 3KJVA 3LPEA 4JI1F 3SQGA 4URGA 4NZ7A 4Z37A 1RWOB 4NLRA 4ZVSB 3AA9A 4DR3J 1R43A 5A6PA 4OHXA 2QL9B 2QL7B 5KG0A 1IN0A 2QG9B 3W62A 4DR7J 2AJ1A 1ROFA 4ZPTR 2W2NP 1E6VB 1HBUB 2BJEA 3J7ZT 2R8KA 2R7XA 4MKYA 2XMKA 3JTPA 2ZWPA 4D3HA 4CZCA 3BH7B 1UVJA 4I64A 3VHQA 1T03A 3MR5A 4J7CA 3BQ0A 2VG7A 2KO1A 3D0HE 5EGYA 4L74A 1U1MA 2G2OA 2MJUA 1G1XA 1RHJB 5C25A 2SXLA 2HVEA 2RB7A 4F3QA 4IG0B 1NZ8A 4ZVTB 5BJRA 4NLQA 1Q5VA 2FHJD 3LP2B 1PCAA 3D28A 5KFPA 2PFFB 3CJKB 2WB4A 4B3TF 1Y3JA 2OELA 3GJTB 1M0SA 4BBYA 3ONQA 1ZM3A 3MEEA 2BE9B 4JP8A 1S6PA 4ES1A 3Q8PB 1G2EA 3GP9A 4NLOA 1OSDA 1NBEB 1RWUA 5E3QA 3C15A 3GTYX 3QWUA 2VA2A 2JEJA 5K20B 3W5XA 2KT5A 4HEA9 3PW5A 1ZZFA 5KFRA 1GNKA 1KP6A 4DOZA 4GC7A 3UN5A 3T9ZA 2VPYB 3BN7A 1FO1A 2C3MA 5KFNA 4RU2A 1S1VA 2BJ1A 5M2PA 1S0MA 2M70A 2WAQD 5LSOA 2ZVIA 3GU0A 3FDSA 3TA0A 1RWVB 4ECVA 2V9KA 4DZ6A 2KRRA 3P4UB 3OFHA 3PRBA 1U2CA 1VK3A 1IKWA 3I56S 4C3KA 3BF4A 4URSA 2AF6A 3SEOA 1D8YA 4Q43A 1VBZA 3CJ0A 3QO9B 3THVA 1HNVA 4L3KA 1PYOB 1UFLA 3IS9A 4QIVA 4UUWA 1UWBA 2EFQA 1P8GA 2OMLA 4OZLA 1HD0A 2W9CB 2QEXS 2HFNA 3TZXA 3GILA 1VJQA 3MGJA 1ZA2B 3N28A 1HNXJ 1HQEA 3UW1A 1ULRA 3LP0A 1Y9OA 4ZPAA 2AJQA 4WIIA 2HHUA 1R3NA 1WC5A 2G1DA 4IOAQ 2RRAA 3ZC4A 3VGTA 4J9SA 1RTJA 1IBLF 2XWYA 5KFVA 2DITA 3C14B 1H38A 1CVJA 3DRRA 3BPDA 2D41A 3MECB 3K89A 1S0NA 1B4SA 2MQOA 2V67A 3V6KA 3OT9A 3IC1A 2COLA 2E1PA 3GYNA 3JS9A 3GJSB 3M2UB 4YDDB 2BA9A 1J2VA 1KQFB 2I0XA 3N5FA 3ZTPA 2NPIA 2W9BB 1UZHA 1FRKA 3NGDA 2XY6A 3HX9A 4DQSA 1YJRA 1Y00A 1KQKA 1LW0B 2XLIA 1WORA 2IBKA 3DGPB 1X5OA 1U2FA 2VA3A 3O8WA 3E2EA 1VOMA 4DV1F 5KG1A 1WC3A 2NSCA 2CQ3A 2QMXA 4ZCKA 2M9KA 4JI2F 2QX0A 1U8SA 3E51A 4OJ1A 3PIOQ 4I2QB 3PYGA 4JI4F 1VISA 3HSZA 4LF5J 2FYXA 4EI2A 2GIFA 1S9GB 1C0UB 3MM5A 5KOWA 5HP1B 1RJJA 3HKWA 2DH9A 4DPXA 2RUGA 4TXSA 2E5JA 1S1TB 3PV8A 2ZE2B 4JYAJ 3HDSA 5C24B 3GR1A 1NU4A 3CCQS 1Q82T 4C8OA 4RX6A 2RE1A 1V5IB 3TZZA 4G65A 3AY0A 3CNQP 1XBWA 2ASYA 3V81A 2K06A 1ZYQA 1JJ4A 1QAXA 4N47A 2ERRA 4JI3F 4UOGA 1WI8A 1BHNA 4WYWA 4B9VA 4RBVA 3LOUA 3KFWX 1DTTA 4NI2B 5A8RB 4YMEA 3QGPA 1NMEB 2FUG9 2V8PA 1U1PA 1PYSB 4IUFA 4J91A 1RHQB 5L39A 1TKXB 2D9PA 5F3ZA 1QUPA 5KT7A 3K5MA 3AXMA 3FCVA 2ZD1B 3DU5A 1YZ6A 4NA2A 2YWFA 2VOPA 4B3SF 2N4DA 4OZ3A 4KR0B 4ED5A 2LCWA 3HHLD 3CE8A 3DOKB 4WP8A 1FFWB 2AZ1A 3ENQA 5D0EA 1U1OA 4E2FB 1JLEB 4M95A 1RE1B 2C2ZB 1FESA 4USHA 4DR2F 3CD5A 2VD3A 4DX7A 1YRUA 3H40A 2R8IA 3CCRS 3R27A 1TKDA 4X64F 1SVDA 1S77D 2KYZA 3ZZZA 3FFIA 1FKOA 2P5VA 2ZJQQ 3UDLA 1V3RA 3RG6A 4OYIA 3VGUA 1CQNA 1QY7A 3CCSS 1KNZA 1ITPA 4RNFA 3V6DB 2GAHC 3VALA 2HQCA 5IC4B 2MGZA 5K9FA 5J2MA 1N0UA 2P6TA 2PEHA 4C11A 2PC6A 4AFFA 4HVZA 3GE9A 3CMES 1M1HA 4CNZA 1G3OA 3GFHA 3R5GA 2UXDF 3GIJA 3B4MA 2N3LA 1UL3A 3VQSA 2UVVA 1CEZA 4C6AA 1BY9A 3HXMA 5HMWA 3EXCX 2BE2B 4CO3A 4RW9B 2IRYA 2ACYA 4DR5F 4ILMA 3NP5A 2H9ZA 1HBMA 3BDEA 2HFUA 2D74B 4QIGA 2ACMA 1GH8A 4ZP6A 2CPYA 4WTOB 3SMZA 4F25A 3KLEA 3J7AN 2RMLA 1XC9A 1N48A 2OH2A 1TAUA 2PO4A 2UUBF 1DQAA 2DH8A 3DKDA 1LXJA 2W1BA 2W7OA 2Q66A 3M1VB 2HGLA 4D3GA 2J7UA 5CYMB 1TL3B 1WJ9A 3U1NA 3AD9C 2DGWA 1N5TA 4H54A 3F56A 2OLWA 4GMKA 2DY1A 4KQZA 1BLUA 2PA8D 1FJ7A 5H9EK 3NNCA 1RYSA 2V50A 3G6XA 4WWSA 3ZNJ1 1XERA 3DN9A 1REGX 2KYXA 2FJXA 2C3OA 1Z4UA 4JV0A 3OL9A 1X9MA 4A8YA 2VDHA 1KONA 5B0DA 1G4CA 1U1KA 4OZJA 4WU2A 3ET6B 4KT0C 1RAHB 1RYRA 2APOA 4PG4A 3M8RA 4QYZK 1KC8T 3I9V9 2VBWA 1RT2A 4USKA 5AJ3F 3BEGB 2HMIA 2GVZA 4JV5J 1TELA 4DR6F 2VPWB 4E0DA 1VQOS 1IXKA 2QC3A 3SYZA 2J0SD 4G1QB 4OYXA 5CD4H 4YDXA 3MUTP 5EN1A 1S4EA 3O1LA 2GQCA 3TX8A 2XO6A 4H4MB 3A8JA 1NAQA 5E3RA 4X65J 3OJUA 2MKYA 4DSKA 4Q8EA 1SUQA 4M1KA 3WC2A 1S6UA 5I42A 2RDIA 4X4PA 1MG7A 5EHHA 4TQSA 2VQFF 4FYYB 1IBMF 3KLIA 3GG1A 3D6TB 1YTYA 3JSMA 2W8LA 3HT0A 1RTIA 4BWMA 4JI7F 1X5PA 1Z2LA 2NLWA 1TUWA 2MKCA 2XMTA 2BJDA 1B0PA 5GMKa 3GMGA 1WOSA 3EGWB 2X51A 3AFGA 3W1YC 4DLEA 2AGPA 5EWFA 1H98A 3I96A 2QFIA 2W2QP 3MPVA 4YB6A 3DYAA 1LWFB 4NLWA 1JXEA 3FKBA 4NOHA 5KG6A 3CC4S 4MTPA 1YJTA 2YWHA 2L41A 3EICA 5ETMA 1S99A 4Y0FA 3NL0A 2DNNA 2W4CA 2V0NA 4K0KF 1S4FA 2F4VJ 1A9NB 3TEHB 2HBQB 1S7IA 3BSAA 5BYQA 1FERA 4MH8A 2J9DA 3CJTA 1WG4A 4R8UA 3O3LA 4DF8A 2DR7A 2EBEA 3NNHA 1LKZA 1CJUA 5BYRA 1N5VA 3BSNA 4YHHF 4LRDA 3CDEA 3I4PA 4UZCA 1IKYB 4ECZA 4DV0J 2Z4PA 4K4YA 3I0SA 4X66J 2J9CA 1QDUB 1EP4B 3TARA 4ZJOA 2Y8WA 2RT3A 2AYMA 2E7XA 2B9XA 2CPDA 4IFYA 2IA6A 4MFBB 3HVTB 2FIUA 3MMAA 4ZLPA 4ID5B 2W01A 3D5MA 1DAXA 2POKA 1JWWA 2CQ1A 3OR2B 4NLGA 4ZOSA 1HYSA 1X4HA 3PKMA 5DDQC 1ZH5A 1FKPB 1VBYA 1P1LA 2R7VA 4O3RA 4QJVA 2ZITA 2BEFA 3QGGA 1MWYA 4KGVB 1O8BA 5KFGA 3JSRA 4P7TA 3H25A 1YLXA 3BGFA 2ROEA 5FD1A 3M8QB 2UU9J 1PC4A 1FFSB 3NEKA 4XPEA 4M94A 2OD4A 2U1AA 4XIUA 2BRKA 3FEZA 3U27A 2A1BA 1NK6A 1HMVA 4OZ5A 3PY8A 2NXJA 2HLTA 5KT5A 2CA9A 4DV2F 4P75A 1URRA 2RUSA 1VRTA 2M7SA 5FJ4A 2IM3A 1GFWB 4QIEA 3I82A 4RUHA 1JLBA 1OQ3A 1Q86T 5IM0B 5A2QY 2QO3A 4H4OB 9ATCB 3R6LB 2YH0A 4QIFA 2OD6A 2Y0SD 1S1UB 1VRUB 1U0HB 5E3CA 2ZBIA 5HROB 2EFNA 3K8WA 3I0RA 1SL1A 3T9NA 4O4GA 2HAIA 2J76E 2XMJA 4ECSA 4C7QA 1EX8A 3KLVA 2W2OP 1YX2A 4ID8A 5KFJA 4CLWA 4A8WA 1N4LA 1HI0P 3P6YC 2PN6A 2W8KA 1WG1A 2MLZA 4KB7A 2VICA 3CJRA 2DHHA 3FC9A 1NJXA 1AYEA 1NHKL 4NLPA 1YQHA 5AE3A 3QIPA 5HN0A 2B5JA 1XK8A 4XAKA 1RT5A 1WSRA 4M5NA 2VHGA 4B3RJ 5L46A 3LGHA 1XQIA 1DTQB 4FYVB 4PRFA 1AFIA 2WW4A 3MAHA 4QYRA 3BSCA 3UCZP 2QV6A 2R7WA 1FT8A 1K8AT 2CNKB 2X7IA 5C42B 1TZ0A 4P2SA 3IR7B 1LOUA 1FD8A 2H5IB 3M2RA 3KLHA 4EZ6A 3AJ1A 2HPUA 3C66A 1EETB 2K3KA 4URQU 1KD1T 3QBCA 2HFVA 1RCXB 3KHHA 5E2QA 2OFHX 3G82A 1S57A 3U02A 4DUYJ 2OP5A 2Z57B 1TV6B 4RKUC 3T1HF 4LSNA 2OAUA 1TAQA 4DV7F 3SIPB 3CDWA 2ZKUA 4LT6A 4NRTA 1RADB 4ANDA 4OMFG 1Y4ZB 1H2VZ 2ZJPQ 4F2RA 3IR5B 1IJFB 1GXTA 5F8LA 3HI9A 1T9XA 3GSIA 3OFFA 3IG1A 3K59A 2JFDA 3R1LA 4KGMA 1QSLA 4RW6A 4WZQA 1IUJA 3QWPA 4MT1A 1Q95G 2KB2A 4DBQA 3GZ7A 3TAQA 1RWPB 3UO0A 1UFWA 2RS2A 1GX6A 4RBUA 4X2BA 2XG8A 2LKZA 3CPWR 3M30B 5F9LA 2A3JA 4OJ3A 3UN3A 3R2CJ 3GYXB 4F2SA 3QNWB 3DHXA 4EBEA 4XK8C 4ZPCA 2B9EA 2Y8YA 2A18A 3DRSA 1F5BA 4L75A 3RBDA 1FRIA 2B9YA 3ENAA 1OWXA 5LJ3Y 2E5IA 4HL9A 3PEHA 2OPPA 3PJWA 3OTOF 5CYQA 1NM2A 1XJWB 3RRGA 3BKFA 2ZBPA 4CO5A 3QJLA 1UWAA 3BO2A 3MTJA 3JSBA 2CPJA 2BJ9A 3FQKA 5K14A 4USJC 1CG2A 1NPKA 4N5SA 3K5PA 3DXBA 4ZPWR 5M2RA 2OTLS 1Q5YA 5AE2A 4DFKA 3HPOA 3QFWA 3CD6S 3FEXB 1LWCB 1N34J 4LF1A 4X4QA 3MEGA 1ZAVA 1G6BA 2VPZB 2VG5A 4TY8B 2R8HA 2F9DA 2PE8A 3NS5A 4TVAB 3D3BJ 5F8IA 3MCMA 2VJUA 2AMCB 3ULHA 2EKYA 2F7VA 1ZPVA 2PI5A 1Q8BA 3DLKB 2VQEJ 2XYGB 4O3QA 5GAGU 2GIQA 1JLAA 3PFOA 5L8RC 3HO1A 2VONA 1JJ2R 4NLVA 3IRXA 1TFYA 1JJCB 1OY6A 4LJMA 4WXWA 4XTTA 4QR0A 3BDPA 4GVBB 4LF4J 5H9FJ 1JXVA 3RB3A 2CWXA 2GA7A 3TUZC 4JI5F 3KG0A 5EDWA 1BQMA 1TK5A 3CCLS 1T9TA 3DMJA 2DEIA 1ZTWA 5ETQA 1VQYA 3R7NB 4N7TA 2GX8A 4YS2A 1FX2A 3FCWA 5DS7A 3OL8A 2HFZA 4A8FA 1F2GA 1IBKF 2HK2A 1CJKB 4OHVA 2ZHOA 5MAOA 3LO3A 4TKTA 4ANCA 1S9EA 4F50A 3CC7S 1KN6A 1O6XA 5JXSA 2MKHA 4FBUA 2UVWA 2IIHA 2YNGA 2IY5B 1VRQC 2BRLA 3SCJE 4C9DA 1ZPWX 4IOCQ 4FPIA 2DGOA 3C6UB 3QLHA 5DLGA 2XSJA 3OXFA 2HAFA 3DOMB 3DCAA 1Q81T 4F3MA 5BYSA 2XY7A 1NO8A 4MIWA 5D4OA 2RF2B 4QPTA 3NOCA 4WPAA 2KZMA 4IR1A 1V3SA 4QIWD 4JI8J 3CCWA 1VYAA 4OYOA 2VODA 3OR1B 2E1CA 1RT3B 3A4TA 4ED6A 4OL8A 2LQ9A 2KXFA 2AQ4A 1FDBA 1PJ6A 3D6MB 4DR3F 3SV3A 2F9JA 4Q45A 1OIAA 2N7YA 5AT1B 4DR7F 1ZAWA 4H4KA 3Q23A 1QTMA 4NL5A 3J7Z5 2IVFB 2DB1A 2LFVA 1E6VA 1HBUA 4CNYA 3QSIA 2AU0A 2XYHB 3T6BA 2V8GA 2UUCJ 4ZPDA 3U1MA 1VC0A 1HPZB 2XO7A 4LF9J 4C0BA 1BE4A 2JEGA 4U6PA 3CO9A 1HBOB 2V6AA 5IT9Y 1S1XA 4MJKA 3N0VA 3BR8A 1MU2B 2MSSA 1VQKS 2V34A 3N6NA 4ECXA 2KFNA 4NLDA 4DQPA 4IG0A 2YH1A 2DNQA 4B9TA 3LP2A 2XI2A 3BR9A 2JJ4D 4JI0J 2DHSA 2WVCA 3CJKA 3VGVA 2PIIA 3L7UA 3EZUA 5DGAA 4E8UA 3NWGA 1MROB 1FEHA 3PIPQ 2YWWA 4AQYF 3OJSA 1JIHA 4JBCA 2JEFA 1CLFA 1K47A 4DPYA 3Q8SB 1TQLA 3WX4A 1IR1A 4DQIA 3CO0P 3A8KA 3K2YA 3D7SB 1QSYA 2XZDB 4DCJB 4ZN3A 5HVHA 2KVQE 2Y1IA 2J0QD 4WK1A 5C5JA 5A8WB 3MHYA 5F0UA 2CG4A 4IH5A 3TWZA 1KTVA 2MXYA 3S1TA 5CQGA 1AUDA 1X0FA 1Y5LB 3T19A 2MSTA 2YKQA 1KS2A 4HACB 5IWAF 5L38A 4CO4A 4YR0A 1SL2A 4C97A 3DRXA 2QYGA 4R5PB 3QO9A 1HNZJ 3VGSA 2VU5A 1KKHA 3OLBA 3NKYA 2J8SA 2RQKA 3AQOA 3J81U 1FE0A 5I3UB 3EGZA 1URNA 1WACA 3QIDA 2W9CA 1DHMA 2OPQB 4A8MP 3BGUA 1FJGJ 3BB5A 4UT4A 2ALZA 1PKUA 4TN2A 2CYYA 1N0VC 1S72S 4DR1J 2H65B 1ZBTA 2N4CA 3TYTA 2QE5A 2DK2A 1YHQS 3EGVA 1RTDB 3C14A 3DHWC 3PDNA 2DGVA 3SV4A 3H59A 2ZVSA 1EQMA 5IC6B 5KG7A 3MCSA 3DDIA 4LR8A 3MECA 4NZ6A 2ZBCA 4J9UE 3ISND 1YJWS 5J2NB 4K4UA 2IM2A 3PJXA 3CWJA 2WSFC 3M2UA 3VAJA 1KSPA 3GIRA 2NPFA 1T3NA 2ILYA 5I4MA 1BC6A 4N56A 1RP5A 4NZ0A 2W9BA 1XR6A 4B3OB 2CQDA 2J6UA 4KFBB 2CAJA 1LW0A 1RHUB 3DGPA 1FTCA 3E01B 2ZH9A 4HTIA 2WONA 2WCXA 1YBTA 4CLTA 1KLNA 4I2QA 4ZN1A 1N8RT 4Q8FA 2XS7A 2QA4G 4DU7A 2XWXA 1UAWA 1S9GA 1C0UA 1F2HA 3VAFA 2X1BA 2V2KA 5HP1A 1IR0A 1H73A 4DX8H 4YP3A 1S1TA 3GCWP 2MKIA 2ZE2A 3IN5A 1RQ0A 5GADU 2F3JA 2L9NA 1NSPA 5C24A 3HM9A 1CSJA 5DRKA 5HJXA 3PYEA 2P9GA 2NQPA 1N32J 5HLFB 4PCQA 2R8GA 3CD0A 1SI9A 3W9IA 1D9AA 8ATCB 5HQ8A 5E0OA 2L9WA 4UQGA 4OI2A 2JLEA 2UXBF 3BBBA 4X62F 1UVKA 4ED7A 3NGKA 3AOCA 3LWLA 5IV4A 4Z2XA 4FBTA 1S48A 2FJWA 4NI2A 2IA0A 1AA1B 4TU7A 3M6XA 1FVQA 3NLCA 4B9UA 1MNEA 2Z2LA 2P2CB 3KNGA 5A8RA 3VWSA 1DFDA 5DGBA 3ZTQA 2C2OB 1Q8LA 5KT4A 1WG5A 4ZCLA 3D66A 4LF8J 1TKXA 4CO1A 1QVFR 2QLFB 1JLCB 2VBYA 4CYUB 3IBFB 3OXLA 1SJRA 2R2RA 4LSZB 4GC6A 2QTWA 1J5EJ 2ZD1A 4WJBA 1W26A 3SSQA 3K0JA 2CDQA 3R3TA 4CO2A 3CD7A 2KL8A 2LDIA 4EYHB 1U48A 2Z8QA 4RJVA 5AE1A 1ELOA 4YY3J 1N36J 4LIRA 4YEAA 4J9PA 3DOKA 2IDEA 4TU8A 4LR7A 1WEXA 4EU0A 1JLEA 2DCUB 2YWEA 4KRWA 4Q44A 3PYFA 4NLUA 4ECTA 3BZQA 2DEJA 2ZZNA 4NEYA 4DLGA 3C6TB 3UCGA 3PW7A 1S79A 2HGNA 4PWWA 2NUUG 4OX6A 4NPOA 3W9JA 4LRCA 2YQ1A 1FX4A 4V19X 2DNYA 2JFKA 3MCOA 2Q79A 1H3DA 5CCLA 4U8VA 2I9SA 3V6DA 2BW7A 4WXOA 3M6WA 3PACA 2KJWA 1NK8A 4USIA 4X4SA 2LXFA 3T1YJ 3GWCA 2BKOA 2W7PA 4DSIA 3SSRA 4DF4A 5L1IA 1XIQA 1X4GA 1M5VC 4RW9A 1XMOF 4DHVA 3QJPA 2MTLA 1YBUA 2R9LA 2XQCA 2UUAF 4YN3B 4KHMA 2VPXB 2XHCA 5J1NA 4AD6A 2NSBA 2O67A 3DLHA 3Q24A 4ILRA 1WC0A 3EWGA 1FI4A 3ZTRA 1LV5A 2MZSA 3L95X 3JQMA 1B7FA 2YQ0A 1SKWA 3DLBA 2ZC3A 1JNZB 2OEJA 4KJIA 3MMCB 4M8LA 3M1VA 4EBDA 2P9EA 1RWXB 3IM8A 2HNDB 4FS1A 3VV2B 4LVOP 5CYMA 1TL3A 1HNWJ 3R2DJ 2QLBB 1NSQA 4FKYA 5HL7Q 1FXLA 2K8GA 4F4WA 4UOHA 1KOOA 4GKJF 5HATA 2W2PP 1VJWA 1FRMA 2XULA 4S0MA 4MAKA 1U45A 1RA7A 4OYMA 3B54A 5LXYA 3W61A 4KHRA 5HO4A 4IO9Q 1WC6A 2B4UA 3W65A 3PKYA 4OX9F 1UA0A 2KHDA 3QT8A 1CPZA 2KFZA 4KC5A 1AZSB 3KG1A 3IP0A 3TRGA 1H6KX 2YPYA 1S1WB 2HHVA 1VQNS 3M8WA 1WOPA 2IM0A 4JV5F 4WCEQ 4W90B 1YRTA 2AEMA 3BKTA 2QLXA 4L3NA 3B6BA 2LQJA 5KFKA 4G1QA 5T7LA 1NKBA 4DSEA 2I2YA 3TVYA 3QYYA 3PR4A 4H4MA 3OL7A 1VQ5S 2A0FB 1RXOB 4X4RA 2DGSA 4F4ZA 3I5BA 1GMUA 5LMUF 4ELVA 4DZDA 3OW2R 2E1AA 4ZCMA 4LFAJ 2GV1A 3EX7B 3MTKA 3GPAA 4HI2A 1FTRA 1KFSA 3NNAA 5A76A 3ITHB 1U6BA 1CC7A 3OSNA 1EHWA 2BBEA 5H9EJ 4LVNP 3QRRA 1T95A 2G13A 3GFYA 4Y3CA 4ED0A 3TJ8A 4LF6F 4C8LA 5C2GA 1S9FA 3G8TA 4J9OA 3TAMB 2KRBA 4P2FA 1F9HA 1S10A 5BR8F 1E6YB 4NRUA 4PXCA 1FEEA 4PG7A 1LWFA 2LA4A 2AKWB 3ETMA 4MK8A 3MEDB 1JKHB 1DLOB 3EGNA 2OPRB 2RRBA 3RTVA 3W2VB 1IM6A 4PG5A 4ED2A 4NXNF 3R6GB 3Q22A 3DLGB 1SH2A 4ZK7M 3BPSP 1B70B 3QT7A 2HS3A 3C8YA 4UOFA 1BQNA 3HK2A 1FVSA 3D67A 3OL6A 1IKYA 2WRMA 2ROPA 5B0GA 4ZS6A 3D9BA 4GO7X 5E7OB 2W9AA 4NXMF 2BANB 3VAIA 2YXLA 1EP4A 2QMWA 1RHMB 4O3NA 4OHYA 5KT3A 3IWNC 3J80Y 3GR0A 3FCHA 4MFBA 3HVTA 4OLPA 3BYPA 5A6WA 1KFDA 4ID5A 4QW8A 4JI1J 3SQGB 4P72A 3OR2A 1HHSA 3R5JB 1FKPA 2IAJB 5FLXY 2QN6B 4Q0BB 4LQ3A 4XDCA 4BC9A 5M2UA 3CJSA 3Q8YA 3QATA 3KHGA 1YIJS 2B3TB 4P6QA 3C16A 3VQTA 3NBPB 1HI8A 1HWIA 1SC4B 3CT9A 3RB4A 2M8DB 1XMBA 1SJFA 3LTOA 2FQQB 3FSYA 1DURA 4MIBA 1FNXH 1N6QB 2OEMA 3UNGC 3D54A 2X3DA 2R7SA 2FJBB 2AWZA 5DO2A 3WBZA 3ENVA 5A8KB 2RD5C 3I87A 3TEGA 1HI1A 2YVSA 3RRHA 2DIVA 3SDEB 1AB8A 5IM0A 4H4OA 3FJ2A 3HCXA 4A8KA 5E3PA 2KZZA 3H98A 3RR7A 3GFXA 5D8HB 2QA2A 3G87A 1S1UA 3PHEA 3I9ZA 3UD5A 1VRUA 1UJ5A 1U0HA 4B3TJ 2I1RA 2XMMA 1SC1B 5HROA 3DGVA 3MEEB 1FDNA 1VQ7S 2Q6BA 3QT5A 1RT1B 2CJXB 5KFMA 3H5YA 1XNRF 4HDHA 4NA3A 2R7QA 2BE7D 2LECA 1NH7A 1WDTA 4HT7A 1JX4A 4K4WA 3WZ0A 4OLOA 3FNNA 1GMWA 4G1IA 4AYBD 4O44B 1PC5A 2FC9A 3W9HA 5KFQA 1B3TA 2NYHA 4CWBA 1HNIB 4FXVA 4PUOB 4DS4A 5H9FK 3H8YA 4TYBA 1Q7LB 5KG2A 1RB0A 2J7WA 4LREA 1NNDA 1NPRA 4DSJA 1DTQA 2HZVA 5GAGI 3FBBA 2LXUA 5JUMA 4ZHRB 5D3GB 1RAOA 3IS9B 7FD1A 3SCKE 3N5BA 5LL6d 4WBFA 2BKNA 1FK9B 3MXHP 4HI1A 4C3MA 3M8PB 1TL1B 5C42A 5D6GA 3BREA 2UV8G 3HHKA 2N3OA 2MQMA 1EETA 2RS8A 1VLYA 2L48A 3P5TL 2UVUA 1O0PA 3OD2A 2ZDOA 3VZIA 1GXLA 1MN9A 3FZ2A 5DLFA 2AIRB 2CZ4A 1SL0A 3N6MA 1UETA 3I4HX 1IBLJ 1SQEA 1VQMS 2MZTA 2ZH8A 5IT9U 4OV6A 2VDIA 3DRRB 3PX0A 3G6VA 4IDKB 3K57A 5HAOA 2LQ5A 4DPOA 3QAUA 2C42A 5LSRA 1LEOA 4J9QA 1M5OC 2D3ZA 3LQVA 3ZZTA 2OGUA 1PJ5A 3W8PA 2YX4A 1Q8KA 4PG8A 1S49A 5ETVA 1AFJA 2DCLA 3OBIA 4KPYA 1QTNB 2CJBA 3WC0A 3KTQA 3OFGA 2H1YA 3WDOA 2ZM6F 1P9QC 4QU6A 3DRPB 4OYAA 2YQ3A 1HL6A 4I2PB 3PCOB 1FFGB 3KK2B 3K5OA 5KFLA 2DGUA 3RBEA 5DETA 4AL5A 2V8HA 4ZP8A 2XGPA 4WTYA 4RO0A 5L1KA 4J9KA 5KFIA 2BV3A 4CRJA 4CH7A 5J1PA 3IWLA 4JI4J 1LFWA 5DG8A 4U9RA 1NSAA 4YB7A 3DDKA 2KT2A 2MHEA 1YBAA 4ICLB 4X4VA 5HBMB 5IV3A 3CUNA 4LF7J 5LM7E 3OPKA 3MMBB 2PFDA 1I51B 3CCUS 3GFZA 2ZEJA 2KN4A 1NJWA 1M1GA 2E1RA 2U2FA 2HNZB 1S5ZA 1IBCB 4CIOA 1LXNA 4DQQA 5F8HA 1AUSL 5HQLA 3GV5B 3D0IE 3S01A 1MSWD 1F0XA 3POTB 4J9LA 2I5JB 3H7HB 2NUHA 3CCTA 2YKNB 4JI3J 4A46A 5GMDA 3GQCA 3H2LA 2HS4A 2YKMB 2EC2A 3MWBA 5K5MA 1WKKA 5KAKA 4DUZF 3HFKA 4IG3B 2CRLA 4NASA 2EK1A 4LFCF 4F0KA 1LWCA 3HVWA 2KH9A 1LWEB 2R2TA 1CULB 4OYPA 1OY9A 4P73A 2HZAA 3HFVA 1UVNA 4EEYA 4ES3A 3G2XA 4E98A 1UP1A 4TY8A 2YWGA 2YKOA 2ZKTA 1B7YB 3KK3B 2LQ8A 4B3SJ 1JQGA 2CQ0A 6FD1A 3HULA 1BGXT 4OV1A 3DLKA 2BVZA 1K1QA 3OQ2A 3KJQB 2EXUA 3CW2C 1C2PA 5I3PA 3D68A 5B0BA 2GJFA 1HHTP 2V63A 2WOMB 2FHKA 1NZAA 2ZBRA 4TNOA 4KKOB 4DR2J 4OI0A 4GVBA 1BMQB 2CPZA 3FMBA 4X64J 4KHPJ 1FA0A 4ZIVA 2JH3A 1NK4A 3KHLA 3K8VA 3HVRA 4GKKF 3M05A 2IBOA 4I68A 3MDFA 3PEJA 1RWMB 4WFNQ 4DDFA 2CNLB 3EXYA 3IO1A 3V4IB 5GMEA 3JXOA 1YJVA 1WOOA 3BGRB 5G4DA 2CJKA 1CJKA 1FDAA 2UXDJ 1HR0F 1FRXA 3ZTSA 1M5HA 2M5YA 1SIZA 3M32B 3C6UA 4XDDA 2HZCA 1TMJA 3DOMA 2B6AA 1I1GA 1Q1KA 1VQSA 2F65A 2LU1A 4K4XA 2C3UA 3DM2B 2RF2A 5FDLB 1Y7PA 1KRPA 1V9OA 1OYEA 1QLNA 4PR6A 2CNOB 1TL7B 4A8XA 1C1CB 4J9MA 4X84A 2BYCA 3OR1A 3RW6A 3VCDA 1RT3A 4DU8A 2D69A 1Y3KA 2FDNA 4JV1A 4P10A 4ILLA 3B8HA 1UPMB 2WVBA 4DMZA 3ILJA 2FZKB 2XHWA 5DM7Q 1JB0C 2W4PA 2C2RA 2E9ZA 4DV5F 2J6TA 3R7SB 4DPWA 3FK4A 3TVZA 4QWEA 3CJ5A 4UY8T 1TKZB 4GVLA 4B02A 4KTQA 4LSLB 3AOBA 1K73T 1VBKA 4ZVQB 5T41A 1TL5A 1C1BA 1HPZA 3BN4A 4F02A 3GJQB 1JLGB 4P74A 2XNQA 4C0HA 5IFMA 5GADI 8RUCA 1HKAA 5KFZA 3HHLB 2QGFB 2UUWA 3OTCA 2BQ3A 5AJ3J 3ILIA 1V5VA 2HEKA 3C46A 2QYCA 4DR6J 1XN9A 4OJGA 2BX6A 1MLAA 3G6ES 3GV7B 2FJDB 1MROA 3RB6A 4JI6F 5DG9A 2KG0A 5L9XA 4YR3A 1RLCL 2MZRA 3AAWB 3LWMA 1GX5A 2CWKA 4CTAB 3HP6A 4ES2A 1TK8A 2VQFJ 4PWDB 1IBMJ 1KQGB 3A3OB 4AXJA 3TO8A 4B9NA 2GHVC 4JI7J 2DY9A 2ZNZA 4ZLLA 3NGUA 1IQZA 4WFAQ 3WQPA 3ZZUA 2L3MA 3HJFA 1VC5A 2IMOA 5IQ6A 4X4OA 4DV6J 3NMRA 4R5PA 3H20A 2FTRA 5CYJA 3A1YG 4CQ1A 2WTFA 3HHEA 7AT1B 3W8GA 2B9WA 4U96A 2V94A 3HSJA 4K0KJ 2DHGA 3ZZ0A 2OKQA 4UZBA 2X1FA 2OPQA 4DN0A 3A12A 2C2MB 3OHBA 3BSOA 3H5UA 1IKVB 4ZLJA 1KTQA 1RTHB 4ZVFA 1YGYA 4DJBA 4I6YA 3T5HA 5CH7B 4DR1F 2XZTB 3IR6B 3BJYA 1HQUB 4ECWA 2I8EA 4OZ0A 2J6SA 1RTDA 3P5BP 1XNQF 2V4RA 3IAS9 2KXHA 5HK4A 1DZ5A 4QCLA 2OPSB 3ENWA 2KM8C 4LBPA 4HLBA 2V8DA 1SPBP 5J2NA 3H90A 3TUJC 2RQCA 2VC1A 4KH0B 2MPUA 5JJBA 3H4BA 1WF0A 4P9SA 2IPOB 4DFPA 2FJAB 2HRUA 3IFEA 5ITHA 4PG6A 1Y0HA 1KEKA 4OI1A 2ZH2A 2A2DA 1CBKA 3OTDA 3TZWA 5J2QB 4IQMA 4KFBA 3AODA 4ZA1A 3E01A 3QSYB 3S7RA 2D7SA 4DCPB 1XEZA 1P27B 2M88A 2O3DA 2DRAA 2DRBA 2CJQA 2BM1A 4AXIA 2EBGA 2CQBA 4M5HA 4DWIA 1HWLA 3NMAA 2D3O1 1PO6A 3V4MA 4DV2J 2JC1A 4Y2MA 2F1FA 2IHR1 2QA1A 4Q5VA 4NCAA 4PYDA 1Q8IA 1U6FA 5F8JA 2JZ5A 5B0FA 1MWZA 4OJHA 4HHUA 2AT1B 4PWUA 2DNKA 1V6HA 5HMZA 3I0RB 4FVMA 1KQSR 5HLFA 2DO0A 3FGVA 2CPIA 2AHOB 4BS2A 1F3VA 2UVRA 4USUA 4U7CA 1ACMB 2FHMA 1K44A 1NKCA 1HW9A 3PRVA 3UR3C 2AGQA 2BJ8A 4OX7A 1GTEA 1CQMA 4OZ1A 1VCTA 3GJRB 4USTA 4ZMMA 3MEKA 5KFDA 1OO0B 5LMNF 3L4BC 1IVZA 4OZ2A 4QZVB 3FQLA 4KGXB 4Z7CA 4YFUA 3EM1A 4CLSA 3QIPB 2BABA 2IC3A 1DJ0A 2A6MA 1K0VA 4LFBF 1D8ZA 1JLCA 2KDOA 2LQBA 2ZUGA 2E66A 2HHHF 4CYUA 3L7OA 3HF5A 1U49A 4HHJA 2DJWA 4PABA 4CDIA 4C2MA 5A0YB 3JQJA 4KPCA 2DH7A 2Z30B 1MW7A 3TR5A 1I94F 4YQWA 1FD2A 1WF1A 2D1CA 1PAUB 2MQ8A 3SXLA 5FLXU 3MR3A 2ASJA 3EPIA 2HG4A 1VLOA 3TANA 3RAXA 2DIUA 3W63A 1NHUA 5MLCV 1X4DA 3C6TA 1KOHA 4EMDA 4RZRA 3PW0A 3TW0A 1KVKA 5BXIA 4NMXA 1FF2A 2MKSA 2AJ2A 3T1HJ 4X4UA 2MEWA 4DV7J 3FMWA 2GVDB 1GXUA 3N4WA 4Y6IA 2YY3A 1KVJA 5CZVA 4LF2A 5D0HA 3SZ2A 1T7PA 4KAIA 2DPIA 2FLOA 5DQHA 1M5PC 2CUYA 2D3UA 2IYGA 2FHOB 1S6QB 4MK9A 1W25A 1TK0A 3RBZA 1WC1A 1YI2S 5F41A 1TUGB 3N79A 3M2VB 3QT6A 3V2UC 3AOAA 2PT0A 3CULA 3MPWA 3P49B 1LNQA 1VFJA 1FWLA 2O01C 5HVFA 3JSYA 2ZFHA 3PVXA 4DPTA 4LIWA 2XNRA 1V3ZA 3VTIA 2HFSA 1U1LA 1SH0A 3SI8A 4YOEA 3P96A 4B3MF 2HWIA 4RBTA 3DNCA 4U7UD 1W2BR 2N82B 2ATLA 3IRWP 4B9LA 3SFUA 4Q2MA 4EO6A 2JSXA 3MMCA 2QMUB 2YKPA 2HNDA 4O3PA 4IKAA 1T9VA 4LBHA 5ETOA 3MAAB 3FBFA 1VHFA 1WDDA 2VBZA 3TA2A 1HHQA 2PD1A 4KE5A 2DGXA 3EUNA 1NB7A 3CB4A 2Q1LA 5E41A 3LP1B 3KWMA 1QE1B 3I5CA 4EFAC 2BQUA 3BO3A 3ILLA 2G9OA 2PEBA 2UP1A 5K14B 1JLFB 1PIEA 1L3UA 1X5TA 5IXUA 3FBCA 4FYXB 1LW2B 3AXKA 1NKEA 3CJ2A 3G6YA 2WSEC 3RU0A 2HK3A 2WBMA 1Q0NA 2RVJA 3UWTA 3A3PB 2CXEA 2B56A 1S1WA 4K5RA 4FYWB 2CJYB 4CLYA 3ELHA 2DT9A 1R6VA 2YNIB 2VBXA 1NHVA 1WHVA 1CJTB 2NXEA 4BWJA 4ELTA 1NB2A 1OYDA 3GB0A 1U47A 1RT4B 5L1LA 2LP4A 5ETKA 2XB2D 1SKRA 3I31A 4AE5A 1T94A 3WIVA 4CLUA 4LRBA 2IVYA 1XMQF 3DLJA 4CO0A 2DNGA 1S6OA 5K8OA 3ITHA 5LXRA 2R8JA 1QD1A 2ROGA 3CDBA 1D0EA 5KFYA 4JI5J 1CJVB 2IM1A 4DL7A 4P7VA 3S8SA 3OFEA 1NK5A 3G9CA 2CQPA 3AHPA 3R1HA 1RDRA 2YNHB 3RR8A 3TAMA 5GAEU 1E6YA 3PTWA 1SJQA 3UE2A 3MEDA 1JKHA 3W64A 1IBKJ 1DLOA 3TVKA 2OPRA 3W2VA 2FLLA 4W92B 5F8GA 1YJNS 1SXLA 4QWAA 4U95A 1OJ4A 2H54B 2ADCA 2B43A 1YZ7A 2IJRA 2CQGA 2FLPA 1YJ9S 1R0AB 3EDRB 1XWLA 2BANA 1J5OB 3Q0AA 2K3IA 1N33F 3MM7B 3HLUA 3PNIA 2ALYB 1N5YB 2LLZA 4WFBQ 5IT0A 3UDEA 2LXIA 1TL4A 2HQGA 3TAPA 3CDUA 3WIUA 4FYDA 3T5KA 2C3YA 4RW8B 2BJ3A 2ZH3A 2FB0A 2IAJA 4Q0BA 1AROP 3MM6B 3L09A 4I7FB 1R8CA 2GCFA 2EEYA 4F0MA 2PA3A 4M5GA 4KO0B 2O5DA 3PXGa 3NBPA 3AB2B 2RIJA 4OIXA 3O6QA 4ZVHA 2B4OA 2XGQA 3PG9A 1Y11A 2HQ3A 4NCGB 5KT6A 4M5DB 3K5LA 3U1LA 1N6QA 4FVCA 2XC9A 2CQCA 5F3TA 3NAHA 2DKOB 5D77A 5A8KA 5ADZA 4N8NA 4RPFA 1S1XB 3CCES 4OI3A 4KV8B 4DL2A 3SDEA 1H74A 4O3SA 3K5NA 4QWCA 1WWHA 1BD6A 3Q8VA 1L3SA 2CJ9A 1RKIA 2HRYA 3F44A 2Q6CA 3K58A 2MB0B 4M5IA 3KYLA 1HWJA 5J1EA 4KY3A 1RT1A 4AQYJ 3T1AA 2EC0A 1HBNB 4WKRA 2VASA 5JMNA 1REVB 3OUYA 3TUIC 1T9WA 3DU6A 3ETOA 3RGIA 1YDLA 3QZ8A 4USWA 3MPDA 2V68A 2BMBA 2XYPB 3U7JA 4O44A 2HHPA 3MF5A 4BDPA 1O51A 2ZNYA 1UKUA 5KFBA 2DGTA 2J8AA 2UXCF 2D3OR 1OPIA 3F41A 1C0TB 2AEFA 3EJMA 4F8RA 1HNIA 3KLGB 4PUOA 3DRYA 2RAQA 2HBZB 1DQ9A 2YNFB 5IWAJ 1U2RA 2QIFA 4DR4F 4OZNA 2CQ2A 5IZHA 2JLGA 1X4FA 4DPUA 3QGHA 1S97A 2E5LF 4A8OA 1UTAA 4ZHRA 5D3GA 3H42A 3EDQB 1TVRB 2WVEA 4DX6A 2VL1A 4CLPA 4G6VB 1FK9A 3M8PA 1FNOA 3V6HA 3M9OB 1TL1A 1NRKA 5B0AA 1WF2A 4NLXA 4DN9A 3EVMA 2OEKA 4DSLA 5ETSA 1FRLA 1UJ4A 1H2UX 4ED3A 1F1BB 1M90T 5B09A 1VS3A 1FDDA 1ZOTA 2F8EX 4PQAA 4M63A 1RI7A 3BH6B 4ETZA 4EWTA 4NLYA 1OY8A 1UZDA 2MZJA 3L9ZA 1R89A 4UW2A 2IVMA 4IDKA 3HHDA 2GHPA 3W2WA 3THTA 2AD9A 3I55S 1SBRA 5T14A 4W4MA 2GO9A 2GS8A 5ETTA 4LRAA 2NXCA 4RUAA 4A4JA 4RWWA 2M0GB 1RABB 1GMVA 5KFCA 1CS4B 4K5SA 4NYPA 2ZZMA 4M5KA 3MPUB 3DRPA 3P45B 3KHRA 2DYAA 1X4EA 2WONB 4I2PA 3KK2A 3FVYA 2MDAA 4W98A 1WTBA 2E29A 1UMJA 4PAAA 1Y5NB 2FHJA 2DVIA 1R8HA 1VIXA 4WK3A 4DEZA 2AYEA 4UQTA 1JLQB 3IM9A 2DD8S 3CTRA 2V8VA 1VGYA 3M8YA 4ICLA 4BC7A 5HBMA 4J90A 4LF7F 2YX7A 4ZVGA 4V1Ak 2HW3A 1RGVA 2ZWOA 3MMBA 3R5CA 1K9MT 4WFXA 3DOLB 3NAIA 2W25A 1B64A 3IMQJ 2HNZA 3E8OA 1WI6A 2ZC4A 3QPIA 4ZPBA 2BOPA 2BW2A 3C3LA 2DNZA 3POTA 2I5JA 3UPFA 3FRZA 5KFXA 4WKYA 2YKNA 2XCPA 2EKNA 2UXBJ 1SV5B 4IRCA 5GAHI 4X62J 3N01A 4ZPVR 3FSIA 1VI7A 1NJZA 4Y34A 1WUUA 2YKMA 4AT1B 1Q16B 4IG3A 4ED1A 2EFPA 1KHVA 4WF9Q 1LWEA 1CULA 3ZZRA 1UEKA 4K4SA 1K0TA 3J7YU 2EK6A 4ENOA 1IM4A 2ZHBA 3M9NB 1R6YA 4MKAA 1SC6A 1TU0B 2NZ4A 5HANA 2OO4A 1H7XA 3HZGA 1QAIA 5DDPC 2HQIA 3KK3A 3IBWA 4UUXA 4DG1B 4TQRA 1F5AA 2YTCA 4I6AA 4R0JA 4JUZA 5KOXA 2DRDA 2B8PA 1OQ6A 2N7CA 3DC2A 2I38A 5DQIA 1RT7B 2GQ2A 3KMSA 1FE4A 2WOMA 1FXDA 4HHHA 2GQQA 1KBRA 4KKOA 1DY3A 2AV5A 4EO8A 3HVAA 4KHPF 2HLUA 3NG8A 3VAGA 4AUKA 2E1MC 4WE1B 3MM8B 2KM8B 3CXCR 1WEYA 4RW7B 3V4IA 5SZTA 3VAKA 5JVHQ 1A0OB 3BS9A 3BGRA 3TI0A 2RU9A 3ADAC 1Z2ZA 5IT4A 4CP5A 2XS2A 3B4DA 4NA1A 2K7JA 4J37A 2V5HG 1HIYA 3Q86A 3M32A 4CH1A 1DQ8A 2H4WB 1QJHA 2E9RX 3CCMS 3D1HA 1XMOJ 4ECRA 3GSDA 1TP7A 3HHNB 1TTHB 5HMYA 1JJHA 2UUAJ 2XBPA 4ER8A 2W24A 2VG6B 1X31C 4F04B 3DM2A 5FDLA 4A47A 1PAEX 4U7UK 2BACA 2QLWA 1TL7A 4FN5A 2YKAA 2CADA 3HKZD 3CJ3A 4ETXA 1C1CA 1N88A 1UCNA 3A13A 4ALZA 2XS5A 1GT8A 3J81Y 1HNXF 2FVSA 4CM0A 1IWAA 3EMTA 3PW4A 3BBCA 4QOTA 4L73A 2VIHA 2IYIA 3B82A 1LWXA 1ZS6A 4UY85 1U0SA 4KYZA 3W5YA 1AW0A 1MN7A 4K4VA 4GKJJ 1TKZA 4Y28C 4LSLA 4TLQA 3SCLE 1SH3A 2DR6A 3ZXWA 2ZH5A 1VQ4S 3MUMP 2OI2A 3TA1A 2FVQA 1UW9A 2RNEA 5KFAA 1WELA 5F9NA 3RAQA 3RYLA 1RBAA 1U24A 1JLGA 3R5DA 3KKFA 5CCMA 4A8SA 2F40A 4OX9J 3ZZPA 4KIAA 3DI6B 1KDNA 4UF4A 3AB4B 2KKHA 3AD8C 3OVSA 3HHLA 2HVDA 2K1RB 1DBDA 2J0XA 1W7WA 3BYRA 5THWA 3RUBL 2MZ1A 3PW2A 1RACB 4XO0A 5T7LB 2H48B 2VV5A 1RKJA 3G96A 4PQUB 4DCOB 5JVGQ 2ASLA 5L1JA 2BJ7A 4AL7A 3OVAA 4DSFA 1YWXA 4LF5F 1NDCA
chains in the Genus database with same CATH topology
5M2RA 4CTAA 3KMQA 2W4DA 4ZDNA 4XDDA 2L9DA 2OTLS 4ZKAA 2O66A 4LSNB 1MMLA 2HZCA 3JB9k 1VQ8S 5AE2A 3DOMA 2B6AA 3PO4A 4DFKA 4JV2A 2O1PA 3HPOA 2YWKA 5K8NA 2DNLA 3CD6S 1I1GA 4PWDA 3FEXB 1Q1KA 3ZZOA 3A8EA 1LWCB 2KVIA 2EFOA 4Y2KA 3DLEA 1VQSA 2LEBA 2LU1A 4X4QA 2CQ4A 2C3UA 3DM2B 2RF2A 5FDLB 1Y7PA 4K4XA 1KRPA 2NYIA 4JYAF 1V9OA 3MEGA 1ZAVA 3RRKA 1G6BA 1KLMB 3CVKA 2VPZB 1QLNA 4PR6A 2VG5A 5KT2A 2PSZA 4TY8B 2R8HA 4YB5A 5D4PA 3KK1B 2F9DA 4A8XA 4ELUA 2PE8A 5SUHA 3ISZA 3NS5A 1N56A 1C1CB 4KSEB 4J9MA 4N77A 4PPDA 4X84A 1PGZA 4R25A 2BYCA 2ZOFA 3OR1A 4FF2A 3KOAA 3RW6A 3VCDA 1XTZA 5F8IA 4DV6F 5D78A 1RT3A 1APSA 2LMIA 5KTQA 1QSSA 3T1YF 4NYOA 1Y3KA 3MPYA 2FDNA 3ULHA 2AX0A 4JV1A 4ILLA 2EKYA 2F7VA 1ZPVA 3B8HA 2PI5A 4L72B 1S76D 2Z0GA 3IG1B 1Q8BA 4DMZA 5G0RB 2RJZA 2XHWA 5DM7Q 4RW4A 1JB0C 3AJ2A 2LYVA 4RW6B 2W4PA 3DLKB 2C2RA 1LK5A 2E9ZA 1GAOA 1JXLA 2DR5A 3UD3P 1OPZA 4F26A 4WFZA 4DV5F 3MM9A 4O3QA 4ERDA 2J6TA 1CC8A 1GQEA 5GAGU 2JEIA 4DFJA 2V4JA 2GIQA 3TVZA 4C8KA 2HNYA 5CXTA 1IKXA 4QWEA 1JLAA 4N41A 3CJ5A 2R4FA 3CCVS 4UY8T 1TKZB 3PFOA 4O3OA 5L8RC 3UFCX 3HMJG 2B51A 3HO1A 4B02A 3PM9A 4DV3F 4KTQA 4LSLB 1JJ2R 2VONA 3FEYB 4NLVA 3IRXA 5J1EB 1TFYA 4QR2A 3IGNA 1K73T 3D0GE 4LJMA 4WXWA 4C8MA 2AX1A 2C22A 4QR0A 3MUVP 3MFHA 1D1UA 2WW8A 3BDPA 4ITSA 5T41A 5H9FJ 2CPHA 1TL5A 3OUYB 1OSCA 2JDJA 5EWGA 3THPA 1RK8A 3RB3A 1C1BA 1HPZA 1IKVA 3HHLC 2GA7A 3BN4A 3TUZC 4JI5F 1RTHA 3KG0A 1NK9A 4F02A 1BQNB 3MR2A 4LQ9A 5EDWA 2GNKA 1BQMA 1TK5A 3CCLS 3M6UA 1JLGB 4I0WA 2HWHA 2WBRA 2XNQA 3DMJA 2CVIA 1ZTWA 1HQUA 1VQYA 5B0CA 4C0HA 3DRSB 2VZ9A 5IFMA 1D9FA 5GADI 2GX8A 2VOOA 2KJVA 4F4YA 5KFZA 1A6LA 3HHLB 5DS7A 5B7WA 1HNWF 2EI5A 5E33A 2X1GA 1U7LA 2UUWA 4WFYA 2OPPB 2GGPA 2HFZA 3OL8A 3CF5Q 3IAM9 2OPSA 5CYQB 2EW9A 3OTCA 2BQ3A 4A8FA 3C46A 1F2GA 1IBKF 2BM0A 2QYCA 1XN9A 3CIZA 4OJGA 1B0TA 4OHVA 2ZHOA 2JWNA 5MAOA 1U4BA 2OFGX