4O4OA

Crystal structure of phycobiliprotein lyase cpct
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
197
structure length
197
Chain Sequence
b'THSTDIATLARWMAADFSNQAQAFENPPFYAHIRVCMRPLPWEVLSGVGFFVEQAYDYMLNDPYRLRVLKLMIVGDRIHIENYTVKQEENFYGASRDLNRLQTLTSESLEKLPGCNMIVEWTGNSFKGTVEPGKGCIVVRKGQKTYLDSEFEINEEKFISLDRGRDLETDAHIWGSVAGPFYFVRLHNFADEVKISA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phycocyanobilin lyase CpcT
publication title Structure and Mechanism of the Phycobiliprotein Lyase CpcT.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Lyase
total genus 47
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 4.-.-.-:
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06206 CpeT CpeT/CpcT family (DUF1001)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.590 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4oA00
4O4SA 4O4OA
chains in the Genus database with same CATH superfamily
2Q2PA 2IZAA 2W2FA 4A8ZA 1KL4A 4ID2A 5IXGA 1E2TA 1MK5A 3BX7A 3GE2A 1T8VA 4O3YA 3VG4A 4TKBA 3D96A 2E4JA 4D6BA 2KW1A 2LBAA 3RY1A 1B56A 1KT5A 2RTKA 5F6BA 4O9SA 3PQUA 3V8UA 1G85A 4XMFA 1A57A 1JV4A 2OVSA 3B2HA 4ORYA 4Z6JA 1HN2A 3MG5A 3WOVA 1YWBA 2OZQA 3TGBA 4O4SA 1FELA 3S5VA 1VWIB 5IO5A 3NX2A 2WEWA 4IBAA 4LZUA 5B5FA 1YP6A 4R0BA 4QNIA 2X34A 3AKNA 4M7MA 1CJ5A 3WXQA 3WJDA 3MM0A 4QAEA 3MBTA 5BVSA 1BEBA 3CR6A 5IO7A 1MEPA 3SLJA 2O62A 2HNXA 4OEMA 2X46A 2AT0X 5B29A 1JBHA 1Y9TA 3TGAA 4QGWA 2R73A 4OKAA 3B2LA 1E00A 3BU9A 4YVBA 1S44A 3Q6LA 1VPRA 4Z2OA 3WZNA 1JJJA 4IMOA 3FYFA 1Z24A 2RD7C 1SRHA 4HPCA 1IKEA 4DCBA 3GAQA 3P6DA 4QZTA 3VHHA 4EFGA 4ORWA 2BLGA 1LDQA 2AT3X 2RTRB 4BX5A 2OY7A 1RAVA 1ZNHA 2W2AA 1EUOA 4GD9A 4EKVA 2WEXA 2Q2MA 3LHNA 5IRUA 2LBVA 2X55A 3MVFA 3VHIA 3EW1A 4XMGA 3WJCA 3LTWA 1PBOA 1VYGA 4WBKA 2FHLA 1HMTA 3NQKA 3KVNA 4O4UA 3ZI8A 4I3CA 3NBXX 1BSQA 5FAZA 4WFVA 5HTDA 1NP1A 2IZJA 1MVGA 3RY2A 1QWDA 2FWVA 2A0AA 2DJFA 4OS3A 4CPIA 4A1YA 2Y3EA 4HWMA 2A2GA 5IRWA 1EPBA 3VE1A 1I4UA 1YP7A 2JGSA 4UU2A 4GE1A 2PI3O 1KFFA 4KC7A 2RTLA 2F01A 1DZPA 4GGTA 2A3FX 5L8IA 1LICA 5HCDC 1CBQA 1I9HA 1NP4A 1RBPA 2RQ0A 1FE3A 1VWFB 3UEUA 3PH5A 4AW8A 4HPBA 4PJ2A 2IZEB 1STSB 2Y3FA 1EALA 3ZW1A 1OBQA 2Z4IA 1U0XA 2ACOA 4WFUA 1Y52X 2FGSA 2FS6A 3CMPA 1SREA 1BM5A 3HWEA 4GU8A 3TGCA 5H8TA 1AVEA 1FJ1E 3HK1A 1YWDA 2ASNX 1O1UA 2IZKA 1KL3A 4OS0A 1VWEB 3F6ZB 2IZGB 4DNEA 1E5PA 4K19A 1W4TA 5KIDA 1B8EA 2OVEA 4GRJA 1NBXA 3RKGA 3P24A 1JQPA 1RXHA 5EPQA 4IB8A 3G7XA 2LKKA 4CDDA 3NPOA 2FKGA 4IAXA 2L9CA 1VWGB 1E02A 2P8GA 3KFFA 3U9PC 1PM1X 5L3YA 3ZWEA 2WPUA 1JJXA 1G5WA 4Y0PA 2NP1A 3PH6A 2FKJA 1EIIA 1P6PA 2C1SA 2X32A 5H9AA 2JU7A 1SWLA 1UZ2X 5B2AO 4EEJA 3T6FA 2POAA 1X71A 2GTFX 3KFIA 3O19A 4D6AA 2YG2A 2RTJA 1W5RA 2HKDA 1H91A 2IZHB 3RDOA 3RDUA 4ZCBA 3ZW0B 2UYWA 4KCAA 3ZW2A 2RTFB 1O8VA 3SLTA 1FEMA 2KTSA 4QRLA 2HZRA 3P6HA 1X89A 4BX6B 4CDFA 4BX7B 5LKFA 3HTYA 1N4JA 2MWHA 3E3CA 5L8NA 5EEEA 2JMBA 1EI5A 2A2UA 3RWXA 1SXYA 2Z4HA 4ORSA 1LPJA 4NW4A 2Q4NA 4KIIA 1VWRB 5F58A 3FW4A 4RUNA 4AZPA 4CPHA 3EYCA 2FTBA 5B10O 1VWLB 2ACPX 4GJVA 1SWCA 2WR6A 1HMSA 1I78A 1NGLA 4WHIA 3APWA 5DG4A 1X8UA 1OEKA 3OD9A 4NYRA 3FEPA 2OYBO 1KOIA 3FR2A 1ZRYA 1O1VA 2C1QA 4ZJ0A 3PDFA 1DF8A 2JU8A 1ZNGA 4ORRA 2OF9A 1ERXA 1RLBE 2AT8X 2KTDA 1TXLA 3KQ0A 4ORUA 1JYDA 2W2BA 4CPEA 1KXOA 3I0AA 1OPBA 3HWGA 3CBSA 1SWHA 5C0NA 2ZAGA 5HZ8A 3T2WA 3D97A 1IW2A 1SWSA 1GM6A 4ZR2A 3RE5A 1LCVA 1SWDA 1K24A 3Q34A 4L1NA 1KGLA 2DJGA 2IZFB 1KQWA 2I5VO 2JOZA 2L68A 4INNA 4BVMA 2G8CO 1TOUA 3BRNA 5EDBA 3VG5A 4CSBA 2RTPB 5EDCA 2FR3A 3P6CA 1DF3A 1JYJA 4MEEA 1BSYA 2A13A 3D9WA 3JQOA 5HAEA 1KT4A 2EU7X 2G78A 4QGXA 4BQUA 1DV9A 3F8AA 3FA8A 3NQ9A 4NNSA 2RTGB 3EMMA 2K23A 5BYPA 3VU1A 4CDEA 2CBRA 5LJEA 3B2KA 2Q9SA 1EW3A 4ZGUA 1X8QA 1NQMA 1OSPO 3CQNA 3KFGA 2RTQB 4GK9A 4AZOA 1ZNLA 1LDOA 1I06A 2GJ5A 2HYSA 1GT4A 1RSTB 3TZSA 4OS8A 2AVIA 3SZJA 4AZMA 5K67A 2AMMX 1CRBA 2N93A 5HCCC 5K06A 1QFTA 1SY0A 1SXXA 1SMPI 5HZ5A 3EBKA 2RTDB 3RDXA 1R0UA 4GUZA 3C76X 1OEJA 4Y5DA 1SWJA 1ALBA 4TNNA 4AYHA 4GGRA 4PSQA 2QMIA 2IZDB 4QQ1A 3CWKA 4BJ8A 1JIWI 4KT5A 3NX1A 4XMEA 1A18A 1CBIA 1L6MA 5HBSA 1D3SA 1LCWA 4U8UO 4YDAA 2FR2A 1QQSA 2WWPA 1N9MA 3HOLA 4GNWA 3VG3A 5K68A 3WZPA 5LJKA 3WZOA 4GGZA 4Y0QA 1NQNA 3RDMA 4QYPA 1ML7A 3RBYA 1DC9A 2C4IA 4GDAA 3VPJE 2KT4B 2MJIA 1JJUA 4YDBA 4DQ3A 1OPAA 1FENA 1MOYA 2F73A 3IA8A 4YGGA 2QOMA 2F09A 1JMZA 1LFOA 2LA7A 2NNDA 5FQ6E 5B11O 3U0DA 1VWMB 4EDEA 5HTEA 1YWCA 1HBQA 1I04A 1QY1A 4MISA 3FR4A 1Y0GA 3RE6A 5F2BA 3KZAA 4TKHA 1ZNDA 1EIOA 3FELA 1SY1A 3RZYA 2YMSA 4M6SA 1KL5A 1YWAA 1FTPA 2MHDA 3S60A 1GT3A 2OFMX 3RDQA 1UYOX 4KH8A 3SAOA 5HZ9A 3BSZE 1AELA 2WQ9A 1SWPA 4LKPA 2CZUA 4UU3A 4BX6A 4HFOA 2HZQA 1I05A 2RTCB 1SLDB 3WYPA 2OY1O 1AQBA 4BX7A 3NP1A 5LJCA 2R56A 5H9LA 2NNQA 3FLLA 1VWOB 2G7BA 2IZLB 3O2YA 4ZHCA 4YMYA 1DFVA 4XMHA 3PPTA 4GDZA 5FQ7E 1QABE 4O4XA 1ADLA 4TJZA 2CBSA 5HZQA 2M4LA 4IB7A 1IIUA 3SZIA 2OL6O 2RTMA 5CE4A 1SWQA 2GH7A 4ZH6A 1SRIA 1T68X 2I5ZO 4YKOA 2VDFA 1HBPA 2Q39A 3ELXA 2JU3A 4GNYA 1TW4A 2X8FA 3EBWA 4NV7A 1VWQB 4MVKA 1GT5A 1Y55X 4I3DA 4U8UN 2WUTA 1LIFA 2WQAE 4O49A 1AVGI 5LJDA 1OBUA 1SWOA 2GTLO 2DM5A 1JMXA 4YGHA 4FBRA 1SY2A 1BWYA 3IFBA 4A60A 2X4MA 5HA0A 1VWKB 4QZUA 3X00A 3RDSA 5FFHA 3PEDA 4Z27A 1SXWA 1RXJA 3FIQA 4I9RA 1VWHB 1CBSA 3BX8A 4NLIA 4YCHA 1LELA 5IRAA 4YH0A 2AT5X 3BY0A 4HPDA 1VWPB 1BJ7A 1YIVA 4A1HA 1GXAA 1VWAB 3EC5A 3TF6A 1PMPA 1BRQA 1S7DA 2FLJA 2XSTA 1AB0A 4GKCA 4NNTA 4ALOA 3FENA 1B4MA 5HZ6A 1GX8A 2RTHB 3U03A 4ZGFA 1CBRA 1HQQA 2ZSCA 1MM9A 4JGLA 2NNEA 3SOTA 1SY3A 2AF5A 1LF7A 1PBYA 5CHKA 4COTA 3HWDA 2IZBA 3C78X 3FA7A 3P02A 3MX7A 4BBOA 5KICA 2Y32A 3ZZVA 2HLVA 3HPEA 4GJSA 1GX3A 3AKMA 1SXUA 2RCQA 2JW1A 2RTNB 3KFHA 4AZRA 1BRPA 2BS6A 2X45A 1U18A 5H9KA 3S5XA 4I60A 5B27A 4YFRA 3JS1A 3ZUIA 1RSUB 4IMNA 3PP6A 5FQ8E 1TVQA 4JHQA 2QOSC 3WJGA 5JR8A 3CKGA 2OFAA 2CM9A 1MX7A 3WJBA 4DQ4A 2UZ2A 1N9YA 1TOWA 2MO5A 2OL7A 4OELA 1DZMA 3OE3A 4EQAC 4ZHGA 1SWUA 1EQDA 1PTSA 3D95A 4GH7A 1BSOA 2GTLN 3CKFA 1LIDA 2FRSA 5CSEA 1D2UA 1LIBA 4TKJA 5HCEC 4LZVA 3P6EA 3T1DA 2ANSA 1KT3A 1KQXA 4U46A 1LUQA 2OL8O 5F6ZA 3UEWA 4CPFA 2RTAA 1NDJA 3L4RA 4HPAA 1GGLA 1GKAB 1HXLA 1SWGA 1MDCA 1IJ8A 3F9DA 1JZUA 4FBOA 2OF8A 1N43A 4ARHA 5BVTA 3T6LA 2IFBA 4BOEA 1SRGA 4IAWA 5LJBA 4CV7A 2BS5A 4QYNA 2AL0X 1QFVA 1WBIA 4O3XB 4U3QA 5LJHA 5AJCA 4B55A 4MVIA 1SLEB 2GC9A 3QKGA 3P6GA 4O4OA 4CPHB 5AEOA 4ES7A 1PEEA 3C77X 1ZNEA 4YGZA 4TQ2A 1X8OA 3PQSA 3WYQA 3FA6A 4ALBA 2RTOB 1S2PA 4N7DA 4U9CA 2OFRX 2AH7X 5HWZA 5D8JA 3D4RA 3NQ3A 3WVMA 1ACDA 2CAMA 2QCBA 3EW2A 2LFOA 3N91A 1VWDB 1VWCB 4RUUA 4I3BA 1SLFB 3STKA 4CDCA 3FMZA 1E06A 1VWJB 4YBUA 1A3YA 2MF6A 1G7NA 4YFPA 4JNJA 3ELZA 4Z2PA 1KT6A 4LQZA 3P6FA 2VFBA 1EXSA 2RTIB 3APUA 2G79A 1OBPA 1FDQA 3BS2A 4IB9A 3FDCA 1Y9LA 2G5LA 2KD2A 1SRFA 1K3BA 3WZQA 3UAQA 1XKIA 4GZVA 1AVDA 1GT1A 1ERBA 1X8PA 5F7GA 3OBLA 3S26A 3JSQA 1VWBB 5D4AA 3UEVA 1SWBA 3BU1A 2BC3A 4ZHDA 2L5PA 1LKEA 4FGIB 1Y53X 3FR5A 3ZW0A 4O3WA 1VYOA 2CM4A 2MM3A 2R74A 3BLGA 1KZXA 4YFQA 4Z2VA 4MVEA 4U8UM 2HMBA 3FA9A 3OJYC 3APXA 1NC9A 1RXKA 2IZIA 3DTQA 3H3IA 3SLOA 4AZNA 2IZCB 2FT9A 2QO6A 1IFCA 3HOEA 4ORXA 2OY5O 4QGVA 2OFBA 5JD2A 3B2JA 1STPA 4OMXA 3PECA 3VG2A 3PK2A 1ZNKA 1BBPA 1EPAA 2A5CA 4ZHHA 1HQPA 4NLJA 4NYQA 1IKJA 2BHVA 1W6FA 2AKQA 2LB6A 4JO6A 4XMCA 5D45A 5D48A 2RCTA 1A2DA 5D47A 3WBGA 4BX5B 4YBPA 3APVA 1SWKA 2OVDA 3EM0A 1DZKA 3AUMO 3ZUOA 1HXZA 1OEEA 4XMDA 4ML7B 1GX9A 4OMWA 3CQRA 5FENA 1SWRA 2L67A 1DZJA 5IO6A 4AZQA 2OVAA 5HA1A 1LIEA 1VWNB 4Y59A 5DPQA 1KT7A 2BT9A 2RTEB 2PY1A 1N0SA 1SWEA 4CK4A 4ZFXA 3RSWA 5AJBA 3VE2A 1LNMA 1U17A 2OY8A 2A5BA 3QQ2A 5L8OA 2BSZA 2AT6X 1WUBA 1UREA 4IABA 4MIRA 2K62A 2XKLA 3O22A 4O3ZA 1N7YA 3I17A 4Y0SA 4BGFA 3K3LA 2VFCA 2ALLX 4MVLA 1IFBA 5B5GA 5AQ6A 1YUPA 1XCAA 4Z28A 4I6SA 1SWAA 2RN4A 4N7CA 4YCEA 1QY2A 3VG7A 2QM9A 1SWTA 4IRWA 4ZHFA 1KZWA 5EZ2A 3STNA 3ZW1B 3FW5A 4ZH9A 1ICNA 4ON1A 3B2IA 4FBVA 4YKMA 2GTLM 4BCSA 1MX8A 1VYFA 4IB6A 2X8SA 1X8NA 2CZTA 3AEHA 5CYBA 1T0VA 2X8TA 3NR3A 5LKEA 1GKAA 4NP1A 3HWFA 1SLGB 3VGWA 2A8GA 1BLRA 1ICMA 4LKTA 4I95A 4EXZA 2X56A 3NADA 2ZAIA 1SWNA 3VG6A 3FIDA 2FS7A 4C5PA 4GETA 1HMRA 2RTBB 3SZHA 3CBCA 3LV4A 4L3RA 2FHNX 3STMX 3WJEA 1SWFA 5H9NA 1UYNX 3BDRA 4KC8A 1HY2A 1QY0A 1SRJA 5EEDA 3ZQ3A 2WSJA 2QO4A 4ODDA 1STRB 5LJGA 3T2XA 4FQBB 1G74A 1QG5A 1MUPA 3FEKA 1B0OA 2QO5A 2RA6A 5B3MO 3WJFA 4Y0RA 5KHPA 4NV8A 4TLJA 3DSZA 5F1EA 5BVQA 1LCZA 3UEXA 3VHMA 1SA8A 4I9SA 2JN3A
chains in the Genus database with same CATH topology
2Q2PA 2W2FA 4A8ZA 4ID2A 3BX7A 4O3YA 3GE2A 1T8VA 3VG4A 4TKBA 3D96A 2E4JA 4D6BA 2KW1A 2LBAA 1B56A 1KT5A 5F6BA 4O9SA 3PQUA 3V8UA 1G85A 4XMFA 1A57A 1JV4A 2OVSA 3B2HA 4ORYA 1HN2A 3WOVA 1YWBA 2OZQA 3TGBA 4O4SA 1FELA 3S5VA 5IO5A 3NX2A 2WEWA 4IBAA 4LZUA 1YP6A 4R0BA 4QNIA 3AKNA 4M7MA 1CJ5A 3WXQA 3WJDA 4QAEA 5IO7A 3MBTA 5BVSA 1BEBA 3CR6A 2O62A 2HNXA 1JBHA 2X46A 2AT0X 5B29A 1Y9TA 3TGAA 4QGWA 2R73A 3B2LA 1E00A 3BU9A 1S44A 3Q6LA 1VPRA 1JJJA 4IMOA 3FYFA 1Z24A 2RD7C 4HPCA 1IKEA 3GAQA 3P6DA 4QZTA 4EFGA 4ORWA 2BLGA 2AT3X 1ZNHA 2W2AA 1EUOA 2WEXA 2Q2MA 3LHNA 2LBVA 3MVFA 4XMGA 3WJCA 1PBOA 1VYGA 4WBKA 1HMTA 3NQKA 4O4UA 3ZI8A 4I3CA 3NBXX 1BSQA 5FAZA 4WFVA 5HTDA 1NP1A 1MVGA 1QWDA 2FWVA 2A0AA 4OS3A 4A1YA 4HWMA 2A2GA 1EPBA 3VE1A 1I4UA 1YP7A 4UU2A 4GE1A 4KC7A 5L8IA 1DZPA 5HCDC 2A3FX 1LICA 1CBQA 1NP4A 1RBPA 3UEUA 2RQ0A 1FE3A 4AW8A 3PH5A 4HPBA 4PJ2A 1EALA 3ZW1A 1OBQA 2Z4IA 1U0XA 2ACOA 4WFUA 2FS6A 3CMPA 1BM5A 3HWEA 4GU8A 3TGCA 5H8TA 3HK1A 1YWDA 2ASNX 1O1UA 4OS0A 3F6ZB 1E5PA 4K19A 5KIDA 1B8EA 2OVEA 4GRJA 3RKGA 3P24A 4IB8A 3G7XA 2LKKA 3NPOA 4IAXA 2L9CA 1E02A 2P8GA 3KFFA 3U9PC 1PM1X 1G5WA 3ZWEA 1JJXA 4Y0PA 2NP1A 3PH6A 1EIIA 1P6PA 5H9AA 4EEJA 2JU7A 1UZ2X 2POAA 1X71A 2GTFX 3KFIA 3O19A 4D6AA 2YG2A 1H91A 4ZCBA 3ZW0B 4KCAA 3ZW2A 1O8VA 1FEMA 2KTSA 4QRLA 2HZRA 3P6HA 1X89A 5LKFA 3HTYA 2MWHA 3E3CA 5L8NA 5EEEA 2JMBA 1EI5A 2A2UA 3RWXA 1SXYA 2Z4HA 4ORSA 1LPJA 4NW4A 2Q4NA 4KIIA 5F58A 3FW4A 4RUNA 4AZPA 3EYCA 2FTBA 3VPJE 2ACPX 4WHIA 2WR6A 1HMSA 1NGLA 3APWA 5DG4A 1X8UA 1OEKA 3OD9A 4NYRA 3FEPA 1KOIA 3FR2A 1ZRYA 1O1VA 4ZJ0A 2JU8A 4ORRA 1ZNGA 1ERXA 1RLBE 2AT8X 2KTDA 1TXLA 3KQ0A 4ORUA 1JYDA 2W2BA 5C0NA 1KXOA 3I0AA 1OPBA 3HWGA 3CBSA 2ZAGA 5HZ8A 3D97A 1IW2A 4ZR2A 1GM6A 4L1NA 1KGLA 2JOZA 1KQWA 2L68A 4INNA 4BVMA 3VG5A 1TOUA 3BRNA 5EDBA 4CSBA 5EDCA 2FR3A 3P6CA 1DF3A 1JYJA 1BSYA 2A13A 3JQOA 5HAEA 1KT4A 2EU7X 2G78A 4QGXA 1DV9A 3F8AA 3FA8A 3NQ9A 4NNSA 3EMMA 2K23A 5BYPA 3VU1A 2CBRA 5LJEA 3B2KA 2Q9SA 1EW3A 4ZGUA 1X8QA 3CQNA 3KFGA 4GK9A 4AZOA 1ZNLA 1I06A 2GJ5A 2HYSA 1GT4A 3TZSA 4OS8A 4AZMA 2AMMX 1CRBA 2N93A 5HCCC 5K06A 1QFTA 1SY0A 1SXXA 1SMPI 5HZ5A 3EBKA 1R0UA 3C76X 1OEJA 1ALBA 4TNNA 4AYHA 4PSQA 2QMIA 4QQ1A 3CWKA 1JIWI 4KT5A 3NX1A 4XMEA 1A18A 1CBIA 1L6MA 5HBSA 1D3SA 4U8UO 4YDAA 2FR2A 1QQSA 2WWPA 3HOLA 4GNWA 3VG3A 5LJKA 4Y0QA 4QYPA 1ML7A 3RBYA 1DC9A 2KT4B 2MJIA 4YDBA 4DQ3A 1OPAA 1FENA 3IA8A 2F73A 4YGGA 2F09A 1LFOA 2LA7A 2NNDA 5FQ6E 3U0DA 4EDEA 5HTEA 1YWCA 1HBQA 1I04A 1QY1A 4MISA 3FR4A 3KZAA 4TKHA 1ZNDA 1EIOA 3FELA 1SY1A 3RZYA 2YMSA 4M6SA 1YWAA 1FTPA 2MHDA 3S60A 1GT3A 2OFMX 4KH8A 3SAOA 5HZ9A 3BSZE 1AELA 2WQ9A 4LKPA 2CZUA 4UU3A 4HFOA 2HZQA 1I05A 1AQBA 5LJCA 3NP1A 2R56A 5H9LA 2NNQA 3FLLA 3O2YA 2G7BA 4ZHCA 4YMYA 1DFVA 4XMHA 3PPTA 4GDZA 5FQ7E 1QABE 4O4XA 1ADLA 4TJZA 2CBSA 5HZQA 2M4LA 4IB7A 1IIUA 5CE4A 4ZH6A 1T68X 4YKOA 1HBPA 2Q39A 3ELXA 2JU3A 4GNYA 1TW4A 2X8FA 3EBWA 4MVKA 1GT5A 4U8UN 4I3DA 2WUTA 1LIFA 2WQAE 4O49A 1AVGI 5LJDA 1OBUA 2GTLO 2DM5A 4YGHA 4FBRA 1SY2A 1BWYA 3IFBA 4A60A 5HA0A 4QZUA 3PEDA 1SXWA 3FIQA 4I9RA 1CBSA 3BX8A 4NLIA 4YCHA 4YH0A 2AT5X 3BY0A 4HPDA 1BJ7A 1YIVA 4A1HA 1GXAA 3TF6A 1PMPA 1BRQA 1S7DA 2FLJA 2XSTA 1AB0A 4GKCA 4NNTA 4ALOA 3FENA 1B4MA 5HZ6A 1GX8A 3U03A 4ZGFA 1CBRA 4JGLA 2NNEA 3SOTA 1SY3A 4COTA 1LF7A 3HWDA 3C78X 3FA7A 3P02A 3MX7A 5KICA 3ZZVA 2HLVA 3KFHA 3AKMA 1SXUA 2RCQA 2JW1A 4AZRA 1BRPA 2BS6A 2X45A 1U18A 5H9KA 3S5XA 5B27A 4YFRA 3JS1A 3ZUIA 4IMNA 5FQ8E 3PP6A 5LJHA 1TVQA 3WJGA 2QOSC 5JR8A 2CM9A 1MX7A 3WJBA 4DQ4A 1TOWA 2MO5A 1DZMA 3OE3A 4EQAC 4ZHGA 1EQDA 3D95A 4GH7A 1BSOA 2GTLN 1LIDA 2FRSA 1D2UA 1LIBA 4TKJA 5HCEC 4LZVA 3P6EA 3T1DA 2ANSA 1KT3A 1KQXA 5F6ZA 3UEWA 3L4RA 4HPAA 1GGLA 1GKAB 1MDCA 3F9DA 1JZUA 4FBOA 4ARHA 5BVTA 2IFBA 4BOEA 4IAWA 5LJBA 4CV7A 2BS5A 4QYNA 2AL0X 1QFVA 4O3XB 4U3QA 5AJCA 4MVIA 2GC9A 3QKGA 5AEOA 3P6GA 4O4OA 4ES7A 1PEEA 3C77X 1ZNEA 4YGZA 4TQ2A 1X8OA 3PQSA 3FA6A 4ALBA 1S2PA 4N7DA 4U9CA 2OFRX 2AH7X 5HWZA 5D8JA 3D4RA 3NQ3A 3WVMA 1ACDA 5EPQA 4RUUA 3STKA 2LFOA 3N91A 4BQUA 4I3BA 3FMZA 1E06A 4YBUA 1A3YA 1G7NA 4YFPA 3ELZA 1KT6A 4LQZA 3P6FA 1EXSA 3APUA 2G79A 1OBPA 1FDQA 3BS2A 4IB9A 1Y9LA 2KD2A 3UAQA 1XKIA 4GZVA 1GT1A 5F7GA 1ERBA 1X8PA 3OBLA 3S26A 3JSQA 5D4AA 3UEVA 3BU1A 4ZHDA 2L5PA 1LKEA 4FGIB 3FR5A 3ZW0A 4O3WA 2CM4A 2MM3A 2R74A 3BLGA 1KZXA 4YFQA 4MVEA 4U8UM 2HMBA 3FA9A 3OJYC 3APXA 3DTQA 3H3IA 4AZNA 2FT9A 2QO6A 1IFCA 3HOEA 4ORXA 4QGVA 3B2JA 4OMXA 3PECA 3VG2A 1ZNKA 1BBPA 1EPAA 4ZHHA 1HQPA 4NLJA 4NYQA 1IKJA 2BHVA 2AKQA 2LB6A 4XMCA 5D45A 5D47A 5FFHA 5D48A 2RCTA 1A2DA 3WBGA 4YBPA 3APVA 2OVDA 3EM0A 1DZKA 3ZUOA 1OEEA 4XMDA 4ML7B 1GX9A 4OMWA 3CQRA 5FENA 2L67A 1DZJA 5IO6A 4AZQA 2OVAA 5HA1A 1LIEA 5DPQA 1KT7A 2BT9A 2PY1A 1N0SA 4CK4A 4ZFXA 3RSWA 5AJBA 3VE2A 1LNMA 1U17A 5L8OA 2AT6X 1UREA 4IABA 4MIRA 2K62A 2XKLA 3O22A 4O3ZA 3I17A 4Y0SA 3K3LA 2ALLX 4MVLA 1IFBA 5AQ6A 1YUPA 1XCAA 4I6SA 4N7CA 2RN4A 4YCEA 1QY2A 3VG7A 2QM9A 4ZHFA 1KZWA 5EZ2A 3STNA 3ZW1B 3FW5A 4ZH9A 1ICNA 4ON1A 3B2IA 4FBVA 4YKMA 2GTLM 1MX8A 1VYFA 4IB6A 2X8SA 1X8NA 2CZTA 5CYBA 5LKEA 1T0VA 2X8TA 3NR3A 1GKAA 4NP1A 3HWFA 1BLRA 1ICMA 4LKTA 4I95A 4EXZA 3NADA 2ZAIA 3VG6A 2FS7A 4GETA 1HMRA 3WJEA 3CBCA 3LV4A 4L3RA 3STMX 5H9NA 3BDRA 4KC8A 1QY0A 5EEDA 3ZQ3A 2WSJA 2QO4A 4ODDA 5LJGA 4FQBB 1G74A 1QG5A 1MUPA 3FEKA 1B0OA 2QO5A 2RA6A 3WJFA 5KHPA 4Y0RA 4TLJA 3DSZA 5F1EA 5BVQA 3UEXA 1SA8A 4I9SA 2JN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O4S A;  4O4O A; 
#chains in the Genus database with same CATH topology
 2Q2P A;  2IZA A;  2W2F A;  4A8Z A;  1KL4 A;  4ID2 A;  5IXG A;  1E2T A;  1MK5 A;  3BX7 A;  3GE2 A;  1T8V A;  4O3Y A;  3VG4 A;  4TKB A;  3D96 A;  2E4J A;  4D6B A;  2KW1 A;  2LBA A;  3RY1 A;  1B56 A;  1KT5 A;  2RTK A;  5F6B A;  4O9S A;  3PQU A;  3V8U A;  1G85 A;  4XMF A;  1A57 A;  1JV4 A;  2OVS A;  3B2H A;  4ORY A;  4Z6J A;  1HN2 A;  3MG5 A;  3WOV A;  1YWB A;  2OZQ A;  3TGB A;  4O4S A;  1FEL A;  3S5V A;  1VWI B;  5IO5 A;  3NX2 A;  2WEW A;  4IBA A;  4LZU A;  5B5F A;  1YP6 A;  4R0B A;  4QNI A;  2X34 A;  3AKN A;  4M7M A;  1CJ5 A;  3WXQ A;  3WJD A;  3MM0 A;  4QAE A;  3MBT A;  5BVS A;  1BEB A;  3CR6 A;  5IO7 A;  1MEP A;  3SLJ A;  2O62 A;  2HNX A;  4OEM A;  2X46 A;  2AT0 X;  5B29 A;  1JBH A;  1Y9T A;  3TGA A;  4QGW A;  2R73 A;  4OKA A;  3B2L A;  1E00 A;  3BU9 A;  4YVB A;  1S44 A;  3Q6L A;  1VPR A;  4Z2O A;  3WZN A;  1JJJ A;  4IMO A;  3FYF A;  1Z24 A;  2RD7 C;  1SRH A;  4HPC A;  1IKE A;  4DCB A;  3GAQ A;  3P6D A;  4QZT A;  3VHH A;  4EFG A;  4ORW A;  2BLG A;  1LDQ A;  2AT3 X;  2RTR B;  4BX5 A;  2OY7 A;  1RAV A;  1ZNH A;  2W2A A;  1EUO A;  4GD9 A;  4EKV A;  2WEX A;  2Q2M A;  3LHN A;  5IRU A;  2LBV A;  2X55 A;  3MVF A;  3VHI A;  3EW1 A;  4XMG A;  3WJC A;  3LTW A;  1PBO A;  1VYG A;  4WBK A;  2FHL A;  1HMT A;  3NQK A;  3KVN A;  4O4U A;  3ZI8 A;  4I3C A;  3NBX X;  1BSQ A;  5FAZ A;  4WFV A;  5HTD A;  1NP1 A;  2IZJ A;  1MVG A;  3RY2 A;  1QWD A;  2FWV A;  2A0A A;  2DJF A;  4OS3 A;  4CPI A;  4A1Y A;  2Y3E A;  4HWM A;  2A2G A;  5IRW A;  1EPB A;  3VE1 A;  1I4U A;  1YP7 A;  2JGS A;  4UU2 A;  4GE1 A;  2PI3 O;  1KFF A;  4KC7 A;  2RTL A;  2F01 A;  1DZP A;  4GGT A;  2A3F X;  5L8I A;  1LIC A;  5HCD C;  1CBQ A;  1I9H A;  1NP4 A;  1RBP A;  2RQ0 A;  1FE3 A;  1VWF B;  3UEU A;  3PH5 A;  4AW8 A;  4HPB A;  4PJ2 A;  2IZE B;  1STS B;  2Y3F A;  1EAL A;  3ZW1 A;  1OBQ A;  2Z4I A;  1U0X A;  2ACO A;  4WFU A;  1Y52 X;  2FGS A;  2FS6 A;  3CMP A;  1SRE A;  1BM5 A;  3HWE A;  4GU8 A;  3TGC A;  5H8T A;  1AVE A;  1FJ1 E;  3HK1 A;  1YWD A;  2ASN X;  1O1U A;  2IZK A;  1KL3 A;  4OS0 A;  1VWE B;  3F6Z B;  2IZG B;  4DNE A;  1E5P A;  4K19 A;  1W4T A;  5KID A;  1B8E A;  2OVE A;  4GRJ A;  1NBX A;  3RKG A;  3P24 A;  1JQP A;  1RXH A;  5EPQ A;  4IB8 A;  3G7X A;  2LKK A;  4CDD A;  3NPO A;  2FKG A;  4IAX A;  2L9C A;  1VWG B;  1E02 A;  2P8G A;  3KFF A;  3U9P C;  1PM1 X;  5L3Y A;  3ZWE A;  2WPU A;  1JJX A;  1G5W A;  4Y0P A;  2NP1 A;  3PH6 A;  2FKJ A;  1EII A;  1P6P A;  2C1S A;  2X32 A;  5H9A A;  2JU7 A;  1SWL A;  1UZ2 X;  5B2A O;  4EEJ A;  3T6F A;  2POA A;  1X71 A;  2GTF X;  3KFI A;  3O19 A;  4D6A A;  2YG2 A;  2RTJ A;  1W5R A;  2HKD A;  1H91 A;  2IZH B;  3RDO A;  3RDU A;  4ZCB A;  3ZW0 B;  2UYW A;  4KCA A;  3ZW2 A;  2RTF B;  1O8V A;  3SLT A;  1FEM A;  2KTS A;  4QRL A;  2HZR A;  3P6H A;  1X89 A;  4BX6 B;  4CDF A;  4BX7 B;  5LKF A;  3HTY A;  1N4J A;  2MWH A;  3E3C A;  5L8N A;  5EEE A;  2JMB A;  1EI5 A;  2A2U A;  3RWX A;  1SXY A;  2Z4H A;  4ORS A;  1LPJ A;  4NW4 A;  2Q4N A;  4KII A;  1VWR B;  5F58 A;  3FW4 A;  4RUN A;  4AZP A;  4CPH A;  3EYC A;  2FTB A;  5B10 O;  1VWL B;  2ACP X;  4GJV A;  1SWC A;  2WR6 A;  1HMS A;  1I78 A;  1NGL A;  4WHI A;  3APW A;  5DG4 A;  1X8U A;  1OEK A;  3OD9 A;  4NYR A;  3FEP A;  2OYB O;  1KOI A;  3FR2 A;  1ZRY A;  1O1V A;  2C1Q A;  4ZJ0 A;  3PDF A;  1DF8 A;  2JU8 A;  1ZNG A;  4ORR A;  2OF9 A;  1ERX A;  1RLB E;  2AT8 X;  2KTD A;  1TXL A;  3KQ0 A;  4ORU A;  1JYD A;  2W2B A;  4CPE A;  1KXO A;  3I0A A;  1OPB A;  3HWG A;  3CBS A;  1SWH A;  5C0N A;  2ZAG A;  5HZ8 A;  3T2W A;  3D97 A;  1IW2 A;  1SWS A;  1GM6 A;  4ZR2 A;  3RE5 A;  1LCV A;  1SWD A;  1K24 A;  3Q34 A;  4L1N A;  1KGL A;  2DJG A;  2IZF B;  1KQW A;  2I5V O;  2JOZ A;  2L68 A;  4INN A;  4BVM A;  2G8C O;  1TOU A;  3BRN A;  5EDB A;  3VG5 A;  4CSB A;  2RTP B;  5EDC A;  2FR3 A;  3P6C A;  1DF3 A;  1JYJ A;  4MEE A;  1BSY A;  2A13 A;  3D9W A;  3JQO A;  5HAE A;  1KT4 A;  2EU7 X;  2G78 A;  4QGX A;  4BQU A;  1DV9 A;  3F8A A;  3FA8 A;  3NQ9 A;  4NNS A;  2RTG B;  3EMM A;  2K23 A;  5BYP A;  3VU1 A;  4CDE A;  2CBR A;  5LJE A;  3B2K A;  2Q9S A;  1EW3 A;  4ZGU A;  1X8Q A;  1NQM A;  1OSP O;  3CQN A;  3KFG A;  2RTQ B;  4GK9 A;  4AZO A;  1ZNL A;  1LDO A;  1I06 A;  2GJ5 A;  2HYS A;  1GT4 A;  1RST B;  3TZS A;  4OS8 A;  2AVI A;  3SZJ A;  4AZM A;  5K67 A;  2AMM X;  1CRB A;  2N93 A;  5HCC C;  5K06 A;  1QFT A;  1SY0 A;  1SXX A;  1SMP I;  5HZ5 A;  3EBK A;  2RTD B;  3RDX A;  1R0U A;  4GUZ A;  3C76 X;  1OEJ A;  4Y5D A;  1SWJ A;  1ALB A;  4TNN A;  4AYH A;  4GGR A;  4PSQ A;  2QMI A;  2IZD B;  4QQ1 A;  3CWK A;  4BJ8 A;  1JIW I;  4KT5 A;  3NX1 A;  4XME A;  1A18 A;  1CBI A;  1L6M A;  5HBS A;  1D3S A;  1LCW A;  4U8U O;  4YDA A;  2FR2 A;  1QQS A;  2WWP A;  1N9M A;  3HOL A;  4GNW A;  3VG3 A;  5K68 A;  3WZP A;  5LJK A;  3WZO A;  4GGZ A;  4Y0Q A;  1NQN A;  3RDM A;  4QYP A;  1ML7 A;  3RBY A;  1DC9 A;  2C4I A;  4GDA A;  3VPJ E;  2KT4 B;  2MJI A;  1JJU A;  4YDB A;  4DQ3 A;  1OPA A;  1FEN A;  1MOY A;  2F73 A;  3IA8 A;  4YGG A;  2QOM A;  2F09 A;  1JMZ A;  1LFO A;  2LA7 A;  2NND A;  5FQ6 E;  5B11 O;  3U0D A;  1VWM B;  4EDE A;  5HTE A;  1YWC A;  1HBQ A;  1I04 A;  1QY1 A;  4MIS A;  3FR4 A;  1Y0G A;  3RE6 A;  5F2B A;  3KZA A;  4TKH A;  1ZND A;  1EIO A;  3FEL A;  1SY1 A;  3RZY A;  2YMS A;  4M6S A;  1KL5 A;  1YWA A;  1FTP A;  2MHD A;  3S60 A;  1GT3 A;  2OFM X;  3RDQ A;  1UYO X;  4KH8 A;  3SAO A;  5HZ9 A;  3BSZ E;  1AEL A;  2WQ9 A;  1SWP A;  4LKP A;  2CZU A;  4UU3 A;  4BX6 A;  4HFO A;  2HZQ A;  1I05 A;  2RTC B;  1SLD B;  3WYP A;  2OY1 O;  1AQB A;  4BX7 A;  3NP1 A;  5LJC A;  2R56 A;  5H9L A;  2NNQ A;  3FLL A;  1VWO B;  2G7B A;  2IZL B;  3O2Y A;  4ZHC A;  4YMY A;  1DFV A;  4XMH A;  3PPT A;  4GDZ A;  5FQ7 E;  1QAB E;  4O4X A;  1ADL A;  4TJZ A;  2CBS A;  5HZQ A;  2M4L A;  4IB7 A;  1IIU A;  3SZI A;  2OL6 O;  2RTM A;  5CE4 A;  1SWQ A;  2GH7 A;  4ZH6 A;  1SRI A;  1T68 X;  2I5Z O;  4YKO A;  2VDF A;  1HBP A;  2Q39 A;  3ELX A;  2JU3 A;  4GNY A;  1TW4 A;  2X8F A;  3EBW A;  4NV7 A;  1VWQ B;  4MVK A;  1GT5 A;  1Y55 X;  4I3D A;  4U8U N;  2WUT A;  1LIF A;  2WQA E;  4O49 A;  1AVG I;  5LJD A;  1OBU A;  1SWO A;  2GTL O;  2DM5 A;  1JMX A;  4YGH A;  4FBR A;  1SY2 A;  1BWY A;  3IFB A;  4A60 A;  2X4M A;  5HA0 A;  1VWK B;  4QZU A;  3X00 A;  3RDS A;  5FFH A;  3PED A;  4Z27 A;  1SXW A;  1RXJ A;  3FIQ A;  4I9R A;  1VWH B;  1CBS A;  3BX8 A;  4NLI A;  4YCH A;  1LEL A;  5IRA A;  4YH0 A;  2AT5 X;  3BY0 A;  4HPD A;  1VWP B;  1BJ7 A;  1YIV A;  4A1H A;  1GXA A;  1VWA B;  3EC5 A;  3TF6 A;  1PMP A;  1BRQ A;  1S7D A;  2FLJ A;  2XST A;  1AB0 A;  4GKC A;  4NNT A;  4ALO A;  3FEN A;  1B4M A;  5HZ6 A;  1GX8 A;  2RTH B;  3U03 A;  4ZGF A;  1CBR A;  1HQQ A;  2ZSC A;  1MM9 A;  4JGL A;  2NNE A;  3SOT A;  1SY3 A;  2AF5 A;  1LF7 A;  1PBY A;  5CHK A;  4COT A;  3HWD A;  2IZB A;  3C78 X;  3FA7 A;  3P02 A;  3MX7 A;  4BBO A;  5KIC A;  2Y32 A;  3ZZV A;  2HLV A;  3HPE A;  4GJS A;  1GX3 A;  3AKM A;  1SXU A;  2RCQ A;  2JW1 A;  2RTN B;  3KFH A;  4AZR A;  1BRP A;  2BS6 A;  2X45 A;  1U18 A;  5H9K A;  3S5X A;  4I60 A;  5B27 A;  4YFR A;  3JS1 A;  3ZUI A;  1RSU B;  4IMN A;  3PP6 A;  5FQ8 E;  1TVQ A;  4JHQ A;  2QOS C;  3WJG A;  5JR8 A;  3CKG A;  2OFA A;  2CM9 A;  1MX7 A;  3WJB A;  4DQ4 A;  2UZ2 A;  1N9Y A;  1TOW A;  2MO5 A;  2OL7 A;  4OEL A;  1DZM A;  3OE3 A;  4EQA C;  4ZHG A;  1SWU A;  1EQD A;  1PTS A;  3D95 A;  4GH7 A;  1BSO A;  2GTL N;  3CKF A;  1LID A;  2FRS A;  5CSE A;  1D2U A;  1LIB A;  4TKJ A;  5HCE C;  4LZV A;  3P6E A;  3T1D A;  2ANS A;  1KT3 A;  1KQX A;  4U46 A;  1LUQ A;  2OL8 O;  5F6Z A;  3UEW A;  4CPF A;  2RTA A;  1NDJ A;  3L4R A;  4HPA A;  1GGL A;  1GKA B;  1HXL A;  1SWG A;  1MDC A;  1IJ8 A;  3F9D A;  1JZU A;  4FBO A;  2OF8 A;  1N43 A;  4ARH A;  5BVT A;  3T6L A;  2IFB A;  4BOE A;  1SRG A;  4IAW A;  5LJB A;  4CV7 A;  2BS5 A;  4QYN A;  2AL0 X;  1QFV A;  1WBI A;  4O3X B;  4U3Q A;  5LJH A;  5AJC A;  4B55 A;  4MVI A;  1SLE B;  2GC9 A;  3QKG A;  3P6G A;  4O4O A;  4CPH B;  5AEO A;  4ES7 A;  1PEE A;  3C77 X;  1ZNE A;  4YGZ A;  4TQ2 A;  1X8O A;  3PQS A;  3WYQ A;  3FA6 A;  4ALB A;  2RTO B;  1S2P A;  4N7D A;  4U9C A;  2OFR X;  2AH7 X;  5HWZ A;  5D8J A;  3D4R A;  3NQ3 A;  3WVM A;  1ACD A;  2CAM A;  2QCB A;  3EW2 A;  2LFO A;  3N91 A;  1VWD B;  1VWC B;  4RUU A;  4I3B A;  1SLF B;  3STK A;  4CDC A;  3FMZ A;  1E06 A;  1VWJ B;  4YBU A;  1A3Y A;  2MF6 A;  1G7N A;  4YFP A;  4JNJ A;  3ELZ A;  4Z2P A;  1KT6 A;  4LQZ A;  3P6F A;  2VFB A;  1EXS A;  2RTI B;  3APU A;  2G79 A;  1OBP A;  1FDQ A;  3BS2 A;  4IB9 A;  3FDC A;  1Y9L A;  2G5L A;  2KD2 A;  1SRF A;  1K3B A;  3WZQ A;  3UAQ A;  1XKI A;  4GZV A;  1AVD A;  1GT1 A;  1ERB A;  1X8P A;  5F7G A;  3OBL A;  3S26 A;  3JSQ A;  1VWB B;  5D4A A;  3UEV A;  1SWB A;  3BU1 A;  2BC3 A;  4ZHD A;  2L5P A;  1LKE A;  4FGI B;  1Y53 X;  3FR5 A;  3ZW0 A;  4O3W A;  1VYO A;  2CM4 A;  2MM3 A;  2R74 A;  3BLG A;  1KZX A;  4YFQ A;  4Z2V A;  4MVE A;  4U8U M;  2HMB A;  3FA9 A;  3OJY C;  3APX A;  1NC9 A;  1RXK A;  2IZI A;  3DTQ A;  3H3I A;  3SLO A;  4AZN A;  2IZC B;  2FT9 A;  2QO6 A;  1IFC A;  3HOE A;  4ORX A;  2OY5 O;  4QGV A;  2OFB A;  5JD2 A;  3B2J A;  1STP A;  4OMX A;  3PEC A;  3VG2 A;  3PK2 A;  1ZNK A;  1BBP A;  1EPA A;  2A5C A;  4ZHH A;  1HQP A;  4NLJ A;  4NYQ A;  1IKJ A;  2BHV A;  1W6F A;  2AKQ A;  2LB6 A;  4JO6 A;  4XMC A;  5D45 A;  5D48 A;  2RCT A;  1A2D A;  5D47 A;  3WBG A;  4BX5 B;  4YBP A;  3APV A;  1SWK A;  2OVD A;  3EM0 A;  1DZK A;  3AUM O;  3ZUO A;  1HXZ A;  1OEE A;  4XMD A;  4ML7 B;  1GX9 A;  4OMW A;  3CQR A;  5FEN A;  1SWR A;  2L67 A;  1DZJ A;  5IO6 A;  4AZQ A;  2OVA A;  5HA1 A;  1LIE A;  1VWN B;  4Y59 A;  5DPQ A;  1KT7 A;  2BT9 A;  2RTE B;  2PY1 A;  1N0S A;  1SWE A;  4CK4 A;  4ZFX A;  3RSW A;  5AJB A;  3VE2 A;  1LNM A;  1U17 A;  2OY8 A;  2A5B A;  3QQ2 A;  5L8O A;  2BSZ A;  2AT6 X;  1WUB A;  1URE A;  4IAB A;  4MIR A;  2K62 A;  2XKL A;  3O22 A;  4O3Z A;  1N7Y A;  3I17 A;  4Y0S A;  4BGF A;  3K3L A;  2VFC A;  2ALL X;  4MVL A;  1IFB A;  5B5G A;  5AQ6 A;  1YUP A;  1XCA A;  4Z28 A;  4I6S A;  1SWA A;  2RN4 A;  4N7C A;  4YCE A;  1QY2 A;  3VG7 A;  2QM9 A;  1SWT A;  4IRW A;  4ZHF A;  1KZW A;  5EZ2 A;  3STN A;  3ZW1 B;  3FW5 A;  4ZH9 A;  1ICN A;  4ON1 A;  3B2I A;  4FBV A;  4YKM A;  2GTL M;  4BCS A;  1MX8 A;  1VYF A;  4IB6 A;  2X8S A;  1X8N A;  2CZT A;  3AEH A;  5CYB A;  1T0V A;  2X8T A;  3NR3 A;  5LKE A;  1GKA A;  4NP1 A;  3HWF A;  1SLG B;  3VGW A;  2A8G A;  1BLR A;  1ICM A;  4LKT A;  4I95 A;  4EXZ A;  2X56 A;  3NAD A;  2ZAI A;  1SWN A;  3VG6 A;  3FID A;  2FS7 A;  4C5P A;  4GET A;  1HMR A;  2RTB B;  3SZH A;  3CBC A;  3LV4 A;  4L3R A;  2FHN X;  3STM X;  3WJE A;  1SWF A;  5H9N A;  1UYN X;  3BDR A;  4KC8 A;  1HY2 A;  1QY0 A;  1SRJ A;  5EED A;  3ZQ3 A;  2WSJ A;  2QO4 A;  4ODD A;  1STR B;  5LJG A;  3T2X A;  4FQB B;  1G74 A;  1QG5 A;  1MUP A;  3FEK A;  1B0O A;  2QO5 A;  2RA6 A;  5B3M O;  3WJF A;  4Y0R A;  5KHP A;  4NV8 A;  4TLJ A;  3DSZ A;  5F1E A;  5BVQ A;  1LCZ A;  3UEX A;  3VHM A;  1SA8 A;  4I9S A;  2JN3 A; 
#chains in the Genus database with same CATH homology
 2Q2P A;  2W2F A;  4A8Z A;  4ID2 A;  3BX7 A;  4O3Y A;  3GE2 A;  1T8V A;  3VG4 A;  4TKB A;  3D96 A;  2E4J A;  4D6B A;  2KW1 A;  2LBA A;  1B56 A;  1KT5 A;  5F6B A;  4O9S A;  3PQU A;  3V8U A;  1G85 A;  4XMF A;  1A57 A;  1JV4 A;  2OVS A;  3B2H A;  4ORY A;  1HN2 A;  3WOV A;  1YWB A;  2OZQ A;  3TGB A;  4O4S A;  1FEL A;  3S5V A;  5IO5 A;  3NX2 A;  2WEW A;  4IBA A;  4LZU A;  1YP6 A;  4R0B A;  4QNI A;  3AKN A;  4M7M A;  1CJ5 A;  3WXQ A;  3WJD A;  4QAE A;  5IO7 A;  3MBT A;  5BVS A;  1BEB A;  3CR6 A;  2O62 A;  2HNX A;  1JBH A;  2X46 A;  2AT0 X;  5B29 A;  1Y9T A;  3TGA A;  4QGW A;  2R73 A;  3B2L A;  1E00 A;  3BU9 A;  1S44 A;  3Q6L A;  1VPR A;  1JJJ A;  4IMO A;  3FYF A;  1Z24 A;  2RD7 C;  4HPC A;  1IKE A;  3GAQ A;  3P6D A;  4QZT A;  4EFG A;  4ORW A;  2BLG A;  2AT3 X;  1ZNH A;  2W2A A;  1EUO A;  2WEX A;  2Q2M A;  3LHN A;  2LBV A;  3MVF A;  4XMG A;  3WJC A;  1PBO A;  1VYG A;  4WBK A;  1HMT A;  3NQK A;  4O4U A;  3ZI8 A;  4I3C A;  3NBX X;  1BSQ A;  5FAZ A;  4WFV A;  5HTD A;  1NP1 A;  1MVG A;  1QWD A;  2FWV A;  2A0A A;  4OS3 A;  4A1Y A;  4HWM A;  2A2G A;  1EPB A;  3VE1 A;  1I4U A;  1YP7 A;  4UU2 A;  4GE1 A;  4KC7 A;  5L8I A;  1DZP A;  5HCD C;  2A3F X;  1LIC A;  1CBQ A;  1NP4 A;  1RBP A;  3UEU A;  2RQ0 A;  1FE3 A;  4AW8 A;  3PH5 A;  4HPB A;  4PJ2 A;  1EAL A;  3ZW1 A;  1OBQ A;  2Z4I A;  1U0X A;  2ACO A;  4WFU A;  2FS6 A;  3CMP A;  1BM5 A;  3HWE A;  4GU8 A;  3TGC A;  5H8T A;  3HK1 A;  1YWD A;  2ASN X;  1O1U A;  4OS0 A;  3F6Z B;  1E5P A;  4K19 A;  5KID A;  1B8E A;  2OVE A;  4GRJ A;  3RKG A;  3P24 A;  4IB8 A;  3G7X A;  2LKK A;  3NPO A;  4IAX A;  2L9C A;  1E02 A;  2P8G A;  3KFF A;  3U9P C;  1PM1 X;  1G5W A;  3ZWE A;  1JJX A;  4Y0P A;  2NP1 A;  3PH6 A;  1EII A;  1P6P A;  5H9A A;  4EEJ A;  2JU7 A;  1UZ2 X;  2POA A;  1X71 A;  2GTF X;  3KFI A;  3O19 A;  4D6A A;  2YG2 A;  1H91 A;  4ZCB A;  3ZW0 B;  4KCA A;  3ZW2 A;  1O8V A;  1FEM A;  2KTS A;  4QRL A;  2HZR A;  3P6H A;  1X89 A;  5LKF A;  3HTY A;  2MWH A;  3E3C A;  5L8N A;  5EEE A;  2JMB A;  1EI5 A;  2A2U A;  3RWX A;  1SXY A;  2Z4H A;  4ORS A;  1LPJ A;  4NW4 A;  2Q4N A;  4KII A;  5F58 A;  3FW4 A;  4RUN A;  4AZP A;  3EYC A;  2FTB A;  3VPJ E;  2ACP X;  4WHI A;  2WR6 A;  1HMS A;  1NGL A;  3APW A;  5DG4 A;  1X8U A;  1OEK A;  3OD9 A;  4NYR A;  3FEP A;  1KOI A;  3FR2 A;  1ZRY A;  1O1V A;  4ZJ0 A;  2JU8 A;  4ORR A;  1ZNG A;  1ERX A;  1RLB E;  2AT8 X;  2KTD A;  1TXL A;  3KQ0 A;  4ORU A;  1JYD A;  2W2B A;  5C0N A;  1KXO A;  3I0A A;  1OPB A;  3HWG A;  3CBS A;  2ZAG A;  5HZ8 A;  3D97 A;  1IW2 A;  4ZR2 A;  1GM6 A;  4L1N A;  1KGL A;  2JOZ A;  1KQW A;  2L68 A;  4INN A;  4BVM A;  3VG5 A;  1TOU A;  3BRN A;  5EDB A;  4CSB A;  5EDC A;  2FR3 A;  3P6C A;  1DF3 A;  1JYJ A;  1BSY A;  2A13 A;  3JQO A;  5HAE A;  1KT4 A;  2EU7 X;  2G78 A;  4QGX A;  1DV9 A;  3F8A A;  3FA8 A;  3NQ9 A;  4NNS A;  3EMM A;  2K23 A;  5BYP A;  3VU1 A;  2CBR A;  5LJE A;  3B2K A;  2Q9S A;  1EW3 A;  4ZGU A;  1X8Q A;  3CQN A;  3KFG A;  4GK9 A;  4AZO A;  1ZNL A;  1I06 A;  2GJ5 A;  2HYS A;  1GT4 A;  3TZS A;  4OS8 A;  4AZM A;  2AMM X;  1CRB A;  2N93 A;  5HCC C;  5K06 A;  1QFT A;  1SY0 A;  1SXX A;  1SMP I;  5HZ5 A;  3EBK A;  1R0U A;  3C76 X;  1OEJ A;  1ALB A;  4TNN A;  4AYH A;  4PSQ A;  2QMI A;  4QQ1 A;  3CWK A;  1JIW I;  4KT5 A;  3NX1 A;  4XME A;  1A18 A;  1CBI A;  1L6M A;  5HBS A;  1D3S A;  4U8U O;  4YDA A;  2FR2 A;  1QQS A;  2WWP A;  3HOL A;  4GNW A;  3VG3 A;  5LJK A;  4Y0Q A;  4QYP A;  1ML7 A;  3RBY A;  1DC9 A;  2KT4 B;  2MJI A;  4YDB A;  4DQ3 A;  1OPA A;  1FEN A;  3IA8 A;  2F73 A;  4YGG A;  2F09 A;  1LFO A;  2LA7 A;  2NND A;  5FQ6 E;  3U0D A;  4EDE A;  5HTE A;  1YWC A;  1HBQ A;  1I04 A;  1QY1 A;  4MIS A;  3FR4 A;  3KZA A;  4TKH A;  1ZND A;  1EIO A;  3FEL A;  1SY1 A;  3RZY A;  2YMS A;  4M6S A;  1YWA A;  1FTP A;  2MHD A;  3S60 A;  1GT3 A;  2OFM X;  4KH8 A;  3SAO A;  5HZ9 A;  3BSZ E;  1AEL A;  2WQ9 A;  4LKP A;  2CZU A;  4UU3 A;  4HFO A;  2HZQ A;  1I05 A;  1AQB A;  5LJC A;  3NP1 A;  2R56 A;  5H9L A;  2NNQ A;  3FLL A;  3O2Y A;  2G7B A;  4ZHC A;  4YMY A;  1DFV A;  4XMH A;  3PPT A;  4GDZ A;  5FQ7 E;  1QAB E;  4O4X A;  1ADL A;  4TJZ A;  2CBS A;  5HZQ A;  2M4L A;  4IB7 A;  1IIU A;  5CE4 A;  4ZH6 A;  1T68 X;  4YKO A;  1HBP A;  2Q39 A;  3ELX A;  2JU3 A;  4GNY A;  1TW4 A;  2X8F A;  3EBW A;  4MVK A;  1GT5 A;  4U8U N;  4I3D A;  2WUT A;  1LIF A;  2WQA E;  4O49 A;  1AVG I;  5LJD A;  1OBU A;  2GTL O;  2DM5 A;  4YGH A;  4FBR A;  1SY2 A;  1BWY A;  3IFB A;  4A60 A;  5HA0 A;  4QZU A;  3PED A;  1SXW A;  3FIQ A;  4I9R A;  1CBS A;  3BX8 A;  4NLI A;  4YCH A;  4YH0 A;  2AT5 X;  3BY0 A;  4HPD A;  1BJ7 A;  1YIV A;  4A1H A;  1GXA A;  3TF6 A;  1PMP A;  1BRQ A;  1S7D A;  2FLJ A;  2XST A;  1AB0 A;  4GKC A;  4NNT A;  4ALO A;  3FEN A;  1B4M A;  5HZ6 A;  1GX8 A;  3U03 A;  4ZGF A;  1CBR A;  4JGL A;  2NNE A;  3SOT A;  1SY3 A;  4COT A;  1LF7 A;  3HWD A;  3C78 X;  3FA7 A;  3P02 A;  3MX7 A;  5KIC A;  3ZZV A;  2HLV A;  3KFH A;  3AKM A;  1SXU A;  2RCQ A;  2JW1 A;  4AZR A;  1BRP A;  2BS6 A;  2X45 A;  1U18 A;  5H9K A;  3S5X A;  5B27 A;  4YFR A;  3JS1 A;  3ZUI A;  4IMN A;  5FQ8 E;  3PP6 A;  5LJH A;  1TVQ A;  3WJG A;  2QOS C;  5JR8 A;  2CM9 A;  1MX7 A;  3WJB A;  4DQ4 A;  1TOW A;  2MO5 A;  1DZM A;  3OE3 A;  4EQA C;  4ZHG A;  1EQD A;  3D95 A;  4GH7 A;  1BSO A;  2GTL N;  1LID A;  2FRS A;  1D2U A;  1LIB A;  4TKJ A;  5HCE C;  4LZV A;  3P6E A;  3T1D A;  2ANS A;  1KT3 A;  1KQX A;  5F6Z A;  3UEW A;  3L4R A;  4HPA A;  1GGL A;  1GKA B;  1MDC A;  3F9D A;  1JZU A;  4FBO A;  4ARH A;  5BVT A;  2IFB A;  4BOE A;  4IAW A;  5LJB A;  4CV7 A;  2BS5 A;  4QYN A;  2AL0 X;  1QFV A;  4O3X B;  4U3Q A;  5AJC A;  4MVI A;  2GC9 A;  3QKG A;  5AEO A;  3P6G A;  4O4O A;  4ES7 A;  1PEE A;  3C77 X;  1ZNE A;  4YGZ A;  4TQ2 A;  1X8O A;  3PQS A;  3FA6 A;  4ALB A;  1S2P A;  4N7D A;  4U9C A;  2OFR X;  2AH7 X;  5HWZ A;  5D8J A;  3D4R A;  3NQ3 A;  3WVM A;  1ACD A;  5EPQ A;  4RUU A;  3STK A;  2LFO A;  3N91 A;  4BQU A;  4I3B A;  3FMZ A;  1E06 A;  4YBU A;  1A3Y A;  1G7N A;  4YFP A;  3ELZ A;  1KT6 A;  4LQZ A;  3P6F A;  1EXS A;  3APU A;  2G79 A;  1OBP A;  1FDQ A;  3BS2 A;  4IB9 A;  1Y9L A;  2KD2 A;  3UAQ A;  1XKI A;  4GZV A;  1GT1 A;  5F7G A;  1ERB A;  1X8P A;  3OBL A;  3S26 A;  3JSQ A;  5D4A A;  3UEV A;  3BU1 A;  4ZHD A;  2L5P A;  1LKE A;  4FGI B;  3FR5 A;  3ZW0 A;  4O3W A;  2CM4 A;  2MM3 A;  2R74 A;  3BLG A;  1KZX A;  4YFQ A;  4MVE A;  4U8U M;  2HMB A;  3FA9 A;  3OJY C;  3APX A;  3DTQ A;  3H3I A;  4AZN A;  2FT9 A;  2QO6 A;  1IFC A;  3HOE A;  4ORX A;  4QGV A;  3B2J A;  4OMX A;  3PEC A;  3VG2 A;  1ZNK A;  1BBP A;  1EPA A;  4ZHH A;  1HQP A;  4NLJ A;  4NYQ A;  1IKJ A;  2BHV A;  2AKQ A;  2LB6 A;  4XMC A;  5D45 A;  5D47 A;  5FFH A;  5D48 A;  2RCT A;  1A2D A;  3WBG A;  4YBP A;  3APV A;  2OVD A;  3EM0 A;  1DZK A;  3ZUO A;  1OEE A;  4XMD A;  4ML7 B;  1GX9 A;  4OMW A;  3CQR A;  5FEN A;  2L67 A;  1DZJ A;  5IO6 A;  4AZQ A;  2OVA A;  5HA1 A;  1LIE A;  5DPQ A;  1KT7 A;  2BT9 A;  2PY1 A;  1N0S A;  4CK4 A;  4ZFX A;  3RSW A;  5AJB A;  3VE2 A;  1LNM A;  1U17 A;  5L8O A;  2AT6 X;  1URE A;  4IAB A;  4MIR A;  2K62 A;  2XKL A;  3O22 A;  4O3Z A;  3I17 A;  4Y0S A;  3K3L A;  2ALL X;  4MVL A;  1IFB A;  5AQ6 A;  1YUP A;  1XCA A;  4I6S A;  4N7C A;  2RN4 A;  4YCE A;  1QY2 A;  3VG7 A;  2QM9 A;  4ZHF A;  1KZW A;  5EZ2 A;  3STN A;  3ZW1 B;  3FW5 A;  4ZH9 A;  1ICN A;  4ON1 A;  3B2I A;  4FBV A;  4YKM A;  2GTL M;  1MX8 A;  1VYF A;  4IB6 A;  2X8S A;  1X8N A;  2CZT A;  5CYB A;  5LKE A;  1T0V A;  2X8T A;  3NR3 A;  1GKA A;  4NP1 A;  3HWF A;  1BLR A;  1ICM A;  4LKT A;  4I95 A;  4EXZ A;  3NAD A;  2ZAI A;  3VG6 A;  2FS7 A;  4GET A;  1HMR A;  3WJE A;  3CBC A;  3LV4 A;  4L3R A;  3STM X;  5H9N A;  3BDR A;  4KC8 A;  1QY0 A;  5EED A;  3ZQ3 A;  2WSJ A;  2QO4 A;  4ODD A;  5LJG A;  4FQB B;  1G74 A;  1QG5 A;  1MUP A;  3FEK A;  1B0O A;  2QO5 A;  2RA6 A;  3WJF A;  5KHP A;  4Y0R A;  4TLJ A;  3DSZ A;  5F1E A;  5BVQ A;  3UEX A;  1SA8 A;  4I9S A;  2JN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...