4O4UA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
513
structure length
505
Chain Sequence
b'EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTYLNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDIKKMVAVACCSNLEYMKFGQLWQQTQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLDPGRHDNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TbpB
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
total genus 116
structure length 505
sequence length 513
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA02
4O49A 4U9CA 4O3ZA 3PQUA 2KC0A 2Y7SA 4AYNA 4AYDC 3PQSA 4Z3TA 4AYID 4AYMC 5T5FA 3V8UA 2W80C 2YPVA 2W81C 4QQ1A 4O4UA 2KDYA 3UAQA 5EE2A 4O3WA 3VE2A 3KVDD 3HOEA 4O4XA 3HOLA 4AYEC 2LFUA 1YS5A 4O3YA 4O3XB 3VE1A
chains in the Genus database with same CATH superfamily
4GETA 2RA6A 2QOMA 3WYPA 2RD7C 2IZFB 1EIIA 1ZHWA 3D96A 1MX8A 3T2XA 2IFBA 1LNMA 1MK5A 3FEKA 3NBXX 4IMNA 1I04A 2X46A 2LA7A 2OY8A 1X71A 4KR8A 4KC8A 4FGIB 4O4OA 2L67A 3O22A 1X8QA 3CBSA 5KICA 2RTNB 1JYDA 4QZUA 1ZHYA 1A18A 1BRQA 1S44A 2HNXA 1BSYA 1IZNB 4D5UA 2IZBA 4JGLA 1OEEA 3APWA 2Y0LA 5B5GA 4BX5B 4MIRA 1GT3A 2OVSA 4CV7A 1TXLA 1ZHZA 1YWAA 3B2HA 5H9AA 1TOWA 3PPTA 3TF6A 3BS0A 2I5VO 2RTCB 1DF3A 2W2BA 1NP1A 1ZNGA 2ERVA 1UZ2X 5AFUL 2FT9A 1LIBA 2JOZA 5C0NA 4GZVA 4I3CA 4YBUA 5B5EO 2R89A 4NLJA 3RBYA 5LKEA 2X8FA 3O2YA 1VWNB 1E00A 3VG7A 4GD9A 3JSQA 4FQBB 3P6EA 4B61A 1ERXA 4Z2PA 2PY1A 5IO5A 2FHLA 2C4IA 3VHMA 3MVFA 3VE1A 4D6AA 1PMPA 2CBRA 3RWXA 4I9SA 4Y59A 3EBWA 1GM6A 3UEXA 2WQ9A 2WUTA 1OPAA 4WFVA 1VWJB 4CDFA 2XE1A 2VFBA 8PRNA 1SWHA 2GTFX 2LBVA 4IBAA 5T5FA 4IAWA 4BX6A 4CPIA 4LSIA 2IZCB 3PF1A 3CQNA 3FR2A 2RN4A 4HFOA 2CZTA 1JV4A 3WJFA 3WBGA 3KFIA 2OVDA 3S26A 3SY7A 1GKAB 2RCTA 5FQ7E 2K23A 2MHDA 4AYID 4JHQA 3B2JA 3KZIO 1ZNHA 4FRXA 3SLTA 4I9RA 4COTA 5BYPA 2QM9A 1T1LA 1LCVA 4BX7B 4OEMA 1ORMA 1U17A 2R4PA 2OL8O 3O0EA 5B5FA 3WJGA 5EE2A 1SWGA 3P6FA 4GDAA 1QJPA 2X45A 4GCQA 2OFBA 1VWRB 1VWBB 4WFUA 5EDBA 3EMNX 1QY1A 3EW2A 3FW4A 3CKFA 1VWIB 3D97A 3FR5A 1OSMA 1LCWA 4KH8A 3F6ZB 5B2AO 2HYSA 4QGVA 3RDMA 5F1EA 1IFCA 4N74A 3LHNA 4U8UO 3T6LA 3WJDA 1VWAB 1I78A 1RBPA 1SY3A 2OFAA 1QY0A 2C1QA 3WXQA 4I6SA 4ZHDA 2GH7A 5KAFO 4C4VB 1KZXA 4N7CA 4KIIA 4A1HA 3AAAB 1AVDA 3Q6LA 1GX9A 4HPBA 5H9KA 4NNTA 1IIUA 1SWLA 4UU3A 1AQBA 2ALLX 2RQ0A 1LFOA 3K3LA 1CJ5A 4KT5A 3CBCA 3AAEA 3OJYC 4GNWA 1YS5A 1Z24A 4WBKA 3A0HO 1U0XA 3LK41 3KFHA 4EQAC 3D4RA 1PTSA 1ZNDA 4CPHB 4ZH9A 2WJQA 1LDQA 1I4UA 4U3QA 1T8VA 3T6FA 1SA8A 3AA1B 4Y0SA 3P6HA 2F1CX 1S5LO 4KRAA 1SWOA 2FKJA 1YIVA 3C77X 2YG2A 3PEDA 4ALOA 5HA1A 3ZW1A 1X8NA 4GHBA 2FR2A 2WEXA 1BSOA 4YGGA 1K24A 3PDFA 5B3MO 4Z2OA 1IKEA 1KZWA 1SWUA 4HPCA 5LJEA 5DL5A 2AKQA 4IB8A 4ZGFA 3TZGA 2JQYA 2Y3EA 4LZVA 1KXOA 4CPEA 4EEJA 1UREA 1E2TA 3HWGA 4HWMA 3POUA 4AZQA 2Y0HA 2AT0X 1KOIA 2OFMX 3EYCA 5B27A 5G39A 5FQ8E 3S60A 3VG2A 3PECA 2OVEA 5H9LA 3ZI8A 2RTHB 3AA7A 3AKMA 3NX2A 4TJZA 1HY2A 2Y3FA 3HW9A 4BOEA 2OY1O 2F01A 1KT6A 4CSBA 1GT4A 1QQSA 2YPVA 1YWCA 2J4UP 5DPQA 4TKBA 1LELA 5D8JA 5HA0A 3ZQ3A 1LIEA 2X34A 3VG6A 2Y2XA 4QGWA 1QJ9A 4RUNA 1QY2A 2HLVA 4ZCBA 5LKFA 1VWQB 2UYWA 3WJBA 2RTRB 2CZUA 1SWDA 5FVNA 1Y55X 3HWFA 1JQPA 1DV9A 1FENA 1S7DA 3ZUIA 3MM0A 1IW2A 3PRNA 2BT9A 4IL6O 1SY0A 1KQXA 3STNA 4ON1A 4N58A 4UB6O 6PRNA 4TKHA 3SZDA 2AXTO 1VWPB 3P24A 3IFBA 1W5RA 3S5XA 5CYBA 4NYRA 1DZKA 2AMMX 1HQPA 1JIWI 3BRYA 4B55A 2FGSA 2R8AA 2CAMA 3HTYA 1G90A 3WYQA 4GH7A 4RLCA 4YFQA 4Z3TA 2X32A 5F6BA 1HMRA 4ZHGA 4ZHFA 3PP6A 3MX7A 1IJ8A 2RTQB 1QJ8A 4AYEC 1PM1X 3KVNA 3VZWX 1S2PA 2KZ7A 2QO4A 2NNEA 3FMZA 1YP6A 1X8UA 1ZNKA 4NW4A 3T0SA 2FR3A 1ZRYA 2R88A 2X4MA 2JMBA 1GXAA 2F09A 1RSUB 1OBUA 4GRJA 1LICA 1D2UA 2IZGB 1Q9FA 5PRNA 3WI5A 4IB9A 2XTRA 3JS1A 4FMSA 4JFBA 3RE5A 3NSGA 2CM4A 2MJIA 1MVGA 3DA3A 2K62A 1VWKB 2OF9A 4YKMA 2IWWA 1SRJA 2Q39A 5BVSA 4FZNA 1ICMA 1EI5A 4OELA 1BEBA 3POXA 2OMFA 3TGBA 4OKAA 3TGAA 3FA8A 2WJRA 4PR7A 4L3RA 1PBYA 5EDCA 1DF8A 5KHPA 2N2LA 3JTYA 4JO6A 4U8UM 2O62A 3O19A 1JZUA 5H9NA 4AYMC 4G76A 4XMGA 2A2UA 1HQQA 5HZ6A 2FHNX 4RJXA 4N75A 3B2IA 2R4OA 5JD2A 2GJ5A 3BU9A 5LJGA 1H91A 1JYJA 3FYXA 1SWAA 1HN2A 1EW3A 1FELA 3QRCA 3C5OA 5FAZA 1O8VA 3SAOA 3QRAA 2AVIA 3AKNA 2YMSA 3P6GA 1YP7A 2X8TA 5LJKA 3GAQA 4EFGA 1KQWA 2JU3A 3FLLA 3FYFA 2LFOA 3PGRA 1SWEA 3B2KA 2IZLB 5H2FO 3SOTA 1AVGI 3IA8A 2OL6O 3VY8X 3T1DA 1G74A 1RSTB 3F8AA 1NBXA 2WQAE 5HCEC 3NR3A 1PRNA 5TISO 1SXWA 2A3FX 2AT6X 4C5PA 1G5WA 2HZQA 4AYDC 2A5BA 3FA6A 4AZRA 3BX8A 1VWMB 3T20A 4ZH6A 5KIDA 1SWTA 3PGUA 3VZUX 2AH7X 4FSPA 4KR4A 2RTFB 1GFPA 2A5CA 4IABA 5EEEA 4A1YA 2G8CO 3WJCA 4PJ0O 1SWCA 1SLEB 3UPGA 2X27X 1SLDB 1G7NA 3RDSA 1GGLA 5IYUA 1EXSA 2Y0KA 1LDOA 1OBPA 2RTGB 3D9WA 3PORA 4FRTA 5B66O 2RTOB 2FGQX 1YWDA 3VG5A 5FFHA 4BX6B 2R74A 2JU7A 2OVAA 5D4AA 2RTJA 3CWKA 5AQ6A 5JDPA 5FQ6E 4YKOA 4QAEA 5D45A 4ZFXA 4U46A 3HOLA 1NC9A 3E3CA 3FIDA 4YVBA 4FQEA 1FDQA 1GFMA 1XCAA 1HXZA 5D47A 1PHOA 2RTDB 5DG4A 1EPBA 4IB6A 1TW4A 3WZPA 3QQ2A 3DWNA 5GV0A 2XG6A 1CBSA 1ZHXA 2NNDA 1E06A 4GGTA 1VWOB 4C00A 4A60A 3HWEA 2IZIA 4ES7A 3N91A 2OY5O 5HZQA 1BSQA 4LKPA 2QO5A 1TVQA 4KC7A 2MF6A 4AKRA 1OSPO 4ARHA 1KL5A 1VWFB 1SWPA 2LB6A 1N9MA 3OE3A 1VYOA 1BXWA 4MVIA 3SZIA 4AZMA 2QOSC 3BRNA 3PH5A 3P02A 4ID2A 5H8TA 2ZLDA 2XE3A 3JQOA 2DJGA 5HTDA 2QO6A 4FESA 2DM5A 1O1UA 3RSWA 4BBOA 5IO7A 4O3WA 4MEEA 4TQ2A 2HMBA 2ZSCA 4O3XB 2K4TA 1CBIA 5HTEA 2CBSA 1LF7A 2C1SA 3FEPA 4N7DA 1P4TA 2Y7SA 3WZQA 2J1NA 3RY2A 2AL0X 4ZJ0A 3ZUOA 1DFVA 1ACDA 4FUVA 2L68A 3BY0A 4YFRA 3AUMO 4YGHA 4I3BA 5LJDA 2A13A 4YBPA 3NQ3A 1JJXA 4YCHA 1DC9A 1QFVA 1FEMA 1XKIA 1SY2A 4O3ZA 5L8OA 3PGSA 2WWPA 4GK9A 3AAEB 1UYNX 2K0LA 1KT4A 3I0AA 2OFRX 3FIQA 3POQA 4FT6A 1EIOA 1SXXA 2GTLM 4O4UA 2KDYA 4XMCA 3SYSA 2FWVA 4AUIA 1CBRA 3CR6A 2Q4NA 3AA6A 4XMHA 4ORYA 4R0BA 5HZ8A 5F7GA 4IB7A 2WR6A 1WUBA 5AFUK 5HCDC 1OBQA 4RL9A 5AJCA 1N7YA 3Q34A 5FENA 4O3YA 4I60A 5CE4A 1I06A 3KFGA 3OD9A 3ZW1B 1UYOX 4U9CA 1RLBE 1EPAA 3BSZE 1R0UA 2JN3A 4YDAA 4NLIA 4Z27A 2KTSA 2BS6A 1SWBA 1TOUA 3DA4A 3WU2O 3LTWA 1HBQA 5D48A 1QABE 4LSHA 3C78X 2IWVA 2KC0A 3HPEA 4PJ2A 4E1TA 2WPUA 3D95A 3GP6A 3TZSA 4AW8A 2MO5A 4RJWA 1MUPA 5DL7A 3LK2A 3VU1A 1FTPA 1ICNA 1VWEB 1VWCB 1SY1A 3APVA 3U9PC 3FR4A 5CSEA 2RTAA 4ORRA 5KAIO 1SWJA 1VWGB 4ALBA 4GDZA 3DWOX 3ZWEA 1SRGA 3BX7A 3I17A 1Y53X 1LKEA 3WZOA 1SRIA 3AA7B 4QGXA 3LK42 3C76X 1KFFA 4Z6JA 1VWLB 2AT8X 2PRNA 2A8GA 3RDOA 1HXTA 2IZKA 2R4LA 2XE2A 2R56A 4PSQA 4BGFA 1HXUA 4GJVA 1SREA 2CM9A 3CKGA 1CRBA 1Y52X 1MM5A 4K19A 2A2GA 3UU2A 1QFTA 1DZJA 5BVQA 2FGRA 4EXZA 1N0SA 2FS7A 2W2FA 4YDBA 5BVTA 2ZAGA 1SWRA 2IZEB 1ML7A 5EZ2A 2G5LA 1AELA 2G79A 4XNLA 4CDEA 3HOEA 4D64A 2RTPB 3A0BO 1N9YA 5HWZA 4QRLA 5IXGA 1I9HA 4ORWA 2JGSA 4OS3A 5B10O 1LUQA 3MBTA 3EMMA 4AFKA 3AA0A 1GFQA 3LK3A 4CTDA 1ADLA 4ORSA 2NNQA 4XMFA 4YCEA 1I05A 2KXPA 4CK4A 5B29A 2IZAA 4ORUA 4DCBA 2MM3A 4NNSA 1Q9GA 2O4VA 1RXJA 3VHIA 2GTLO 1A3YA 4EKVA 2YNKA 1HMSA 2KZ7B 2P8GA 2ACOA 3RKGA 3STKA 4O9SA 3B2LA 2R4NA 2FS6A 3ZW0A 3WZNA 5IO6A 3QKGA 5HZ5A 2FKGA 4A8ZA 1JBHA 1JMXA 4BCSA 1KGLA 1BBPA 4RLBA 5JR8A 2BSZA 4LZUA 3WVMA 1D3SA 1O1VA 3ZW2A 1EUOA 4JNJA 3JCUO 5LJBA 5HAEA 1FJ1E 1A57A 4FZLA 5AEOA 2POAA 3ELXA 3OBLA 2RTIB 1GX3A 1X8OA 4CPFA 3SYBA 1VWDB 2KD2A 4FOZA 3CMPA 3FDCA 1B56A 1OPBA 1STSB 2X9KA 4K3CA 4MVEA 1KL3A 5G3AA 3K19A 2L9CA 3EC5A 5EPQA 2ACPX 3DSZA 4Z2VA 1U18A 1SWQA 4AYNA 1IZNA 1NQNA 3VG3A 2G7BA 3SZVA 1BH3A 4BX5A 1SLGB 1DZMA 2ZAIA 2QMIA 5K06A 3WOVA 3NADA 1JMZA 4LSFA 2XSTA 4C69X 2X56A 2Q9SA 3LV4A 2OL7A 5LJCA 4N59A 5ADXL 4AZOA 3STMX 4UU2A 3FELA 3A2SX 2QTKA 3EM0A 3H3IA 4CDDA 3FA7A 4Y0RA 1OPFA 1SLFB 3WI4A 1T68X 3SLOA 2RTBB 3PH6A 5L8IA 1ZNLA 4U8UN 4TKJA 1LPJA 1LIDA 4GCSA 4ODDA 2IZDB 1ZNEA 2AF5A 3SY9A 5LJHA 3RY1A 3EBKA 2RTKA 3BLGA 4FBVA 4O49A 4TNNA 4XNKA 3PK2A 1OEKA 2R73A 2M06A 1SXUA 3G7GA 1SRFA 2RTMA 1OEJA 1HBPA 3S5VA 2X55A 2ODJA 2W2AA 4ZHHA 4GKCA 1ZHTA 2MWHA 1HXXA 3KZAA 1WBIA 5HBSA 5F2BA 2L5PA 2Z4HA 4HPDA 4M7MA 3NJTA 3P6CA 2FLJA 4EDEA 1PBOA 4OS8A 2W81C 3VG4A 4GNYA 1A2DA 5L3YA 3P6DA 3U03A 4IRWA 1E02A 1GKAA 2E4JA 3U0DA 2OZQA 4D65A 4ZHCA 3HK1A 3RDUA 1G85A 1STPA 3KQ0A 4BX7A 4KCAA 4D6BA 2BS5A 1SWNA 2I5ZO 1SWSA 2N93A 2ASNX 5GTIO 3BS2A 1SRHA 2LBAA 4IAXA 3MG5A 4FBRA 1LIFA 3EW1A 2KT4B 1W4TA 2GE4A 4GE1A 1NQMA 2RTEB 3ZZVA 2X8SA 2IZJA 2Y32A 2BC3A 4QQ1A 2IZHB 4AYHA 1E5PA 1DZPA 3G7XA 1YWBA 4QZTA 4O4XA 2JU8A 1MX7A 3L4RA 4GGZA 2QCBA 1MOYA 4OMWA 2UZ2A 1HXLA 1KT5A 4NYQA 4AKRB 4GGRA 4MVKA 3FENA 1ERBA 2GC9A 2Q2PA 1P6PA 3GE2A 2VFCA 4GU8A 4DNEA 3ELZA 2ZFGA 2WSJA 3RDQA 1AVEA 3SZJA 4C4VA 2JMMA 1H6S1 1Y9TA 1VPRA 3AAAA 4JCHA 1SXYA 2F73A 1ALBA 4NV8A 2MNHA 2EU7X 5L8NA 4FZMA 1L6MA 2LFUA 4CDCA 1BT9A 1GT5A 4YGZA 1NP4A 4OS0A 3BDRA 5K68A 2XMXA 3NQ9A 4QYPA 1MDCA 4CPHA 2RCQA 4QYNA 4MISA 3AA1A 4DQ4A 3NQKA 1IKJA 1MM9A 4Y0QA 4QNIA 4ZGUA 4ZR2A 2WVPA 4GJSA 3CQRA 4Z28A 1QG5A 3V8UA 1LCZA 3AA6B 3T24A 3RZYA 1KT3A 1NGLA 5ADXK 3RDXA 1VWHB 4OMXA 1BWYA 4L1NA 4RUUA 2Q2MA 4GUZA 1Y9LA 4WHIA 4FSOA 4G75A 3RBHA 2XE5A 5E79O 2RTLA 7PRNA 4PUXA 2KW1A 1JJJA 2OF8A 4MVLA 5IRUA 3UEVA 4LKTA 3HWDA 5EEDA 4YFPA 1RXHA 2G78A 4LQZA 4XMDA 3WJEA 1N4JA 2KTDA 5K67A 4BJ8A 2W80C 3DTQA 3UAQA 2GTLN 3RE6A 3F9DA 1N43A 3SZHA 3VY9X 1AB0A 1GT1A 3LK2B 1QWDA 3T2WA 1VYGA 4TLJA 4DQ3A 3VPJE 2NP1A 5IRWA 3AEHA 2AT5X 4LSEA 1KT7A 1X8PA 3X00A 4AZPA 4I95A 1SWFA 1Y0GA 4YH0A 5G26A 3PQUA 3NX1A 3KFFA 5F6ZA 3PQSA 3UEWA 4BVMA 1GFNA 1EALA 1MM4A 1RAVA 4INNA 4AZLA 4XMEA 3FW5A 1VYFA 1E54A 1SMPI 1MPFA 4YMYA 2BHVA 4BUMX 2PI3O 2WEWA 4I3DA 2N2MA 2MHLA 1B0OA 4Y0PA 2HZRA 1THQA 1JJUA 1T16A 2OY7A 1IFBA 4IMOA 3HWBA 3KVDD 2M07A 1HMTA 1PEEA 1CBQA 5DL8A 4F4BA 4FBOA 4ML7B 5G38A 4AZNA 1B8EA 4ORXA 1MEPA 1EQDA 3APXA 2Z4IA 4E1SA 2DJFA 2XKLA 1YUPA 1T0VA 3BU1A 4BQUA 3VGWA 3NPOA 4NV7A 3BRZA 4GCPA 4O4SA 1SWKA 1BM5A 1BJ7A 2JW1A 3VZTX 4Y5DA 1RXKA 2OYBO 3AA0B 5F58A 3LK3B 2FRSA 2M4LA 4M6SA 2F1TA 4HPAA 5D5DA 3SLJA 3VE2A 1STRB 2FTBA 3FA9A 2KXPB 2ANSA 2BLGA 1NDJA 5IRAA 2F1VA 3VHHA 2AT3X 2VDFA 5GTHO 2LHFA 5DL6A 2PORA 2A0AA 4AKMA 3ZW0B 3UEUA 3NP1A 4K3BA 4GF4A 1GX8A 2LKKA 1W6FA 5HZ9A 1B4MA 1X89A 1K3BA 1GFOA 3DZMA 5AJBA 2HKDA 1KL4A 4UB8O 1BLRA 1FE3A 3APUA 1BRPA 4NP1A 5CHKA 5HCCC 2XTQA 3TGCA 5B11O
chains in the Genus database with same CATH topology
4GETA 3NQ3A 1JJXA 3KZAA 4YCHA 1HXXA 1DC9A 2W81C 1QFVA 1FEMA 1XKIA 1QY2A 1SY2A 2RA6A 4O3ZA 5L8OA 5LJKA 5HBSA 2HLVA 2WWPA 2L5PA 2RD7C 4ZCBA 2Z4HA 5LKFA 4HPDA 4GK9A 4M7MA 1EIIA 1ZHWA 3D96A 3AAEB 2K0LA 1KT4A 3I0AA 3P6CA 2OFRX 3FIQA 3WJBA 3POQA 1MX8A 4FT6A 2FLJA 4EDEA 2CZUA 1PBOA 4OS8A 1EIOA 2IFBA 1SXXA 2GTLM 4GNYA 1A2DA 4O4UA 3P6DA 3VG4A 3U03A 2KDYA 4XMCA 5FVNA 1E02A 1GKAA 1LNMA 2E4JA 2FWVA 3FEKA 3U0DA 3SYSA 3NBXX 1CBRA 4AUIA 2OZQA 4IMNA 3HWFA 1I04A 4D65A 1DV9A 1FENA 3CR6A 2X46A 4ZHCA 2Q4NA 1S7DA 3HK1A 3ZUIA 4XMHA 4ORYA 4R0BA 3AA6A 5HZ8A 2LA7A 1IW2A 1X71A 3PRNA 4KR8A 2BT9A 4KC8A 1SY0A 5F7GA 1G85A 1KQXA 3STNA 4FGIB 4O4OA 4IB7A 4ON1A 2L67A 3O22A 3KQ0A 4N58A 1X8QA 6PRNA 2WR6A 4TKHA 3SZDA 5AFUK 4KCAA 3CBSA 4D6BA 3P24A 2BS5A 3IFBA 3S5XA 5HCDC 5KICA 1OBQA 4NYRA 5CYBA 1DZKA 1JYDA 2N93A 2ASNX 4QZUA 1ZHYA 5AJCA 2AMMX 4RL9A 1BRQA 1A18A 1HQPA 3BS2A 1JIWI 2LBAA 1S44A 2HNXA 1BSYA 5FENA 4O3YA 1IZNB 4D5UA 4IAXA 5CE4A 1I06A 3KFGA 4JGLA 3OD9A 1OEEA 4FBRA 3APWA 3ZW1B 2Y0LA 3HTYA 1G90A 4U9CA 1LIFA 1RLBE 1EPAA 3BSZE 2KT4B 4GH7A 4MIRA 2GE4A 1R0UA 2JN3A 1GT3A 2OVSA 4GE1A 4RLCA 4YDAA 4NLIA 4YFQA 3ZZVA 4CV7A 2KTSA 4Z3TA 1TXLA 1ZHZA 2X8SA 1YWAA 3B2HA 4RUNA 2BS6A 5F6BA 5H9AA 1TOWA 3PPTA 1HMRA 4ZHGA 3TF6A 1TOUA 4ZHFA 1DF3A 3DA4A 4QQ1A 2W2BA 4AYHA 3PP6A 3MX7A 1NP1A 1E5PA 1DZPA 1ZNGA 3G7XA 1YWBA 4QZTA 4O4XA 2ERVA 1QJ8A 1HBQA 1UZ2X 2JU8A 4AYEC 1PM1X 5AFUL 1MX7A 3L4RA 2FT9A 5D48A 3VZWX 1QABE 1S2PA 1LIBA 2JOZA 4OMWA 5C0NA 1KT5A 4GZVA 4I3CA 4NYQA 4YBUA 2KZ7A 4AKRB 2QO4A 4MVKA 4NLJA 3FENA 4LSHA 3C78X 3RBYA 1ERBA 2GC9A 5LKEA 2KC0A 2NNEA 2X8FA 2Q2PA 3O2YA 3FMZA 1P6PA 4PJ2A 4E1TA 1E00A 3GE2A 4GU8A 3VG7A 3D95A 3JSQA 3GP6A 1YP6A 1X8UA 4FQBB 3TZSA 4AW8A 2MO5A 3ELZA 2ZFGA 3P6EA 4RJWA 1MUPA 5DL7A 1ZNKA 3LK2A 4B61A 4NW4A 1ERXA 3VU1A 1FTPA 1ICNA 2PY1A 3T0SA 2FR3A 5IO5A 2WSJA 1ZRYA 1SY1A 3APVA 3U9PC 2JMBA 3FR4A 3MVFA 3VE1A 1GXAA 2F09A 4ORRA 4D6AA 1OBUA 2JMMA 4GRJA 1H6S1 1Y9TA 1VPRA 1PMPA 2CBRA 3RWXA 3AAAA 4JCHA 4ALBA 1SXYA 4GDZA 2F73A 1ALBA 1LICA 4I9SA 1D2UA 3ZWEA 3EBWA 2MNHA 1GM6A 1Q9FA 3UEXA 3BX7A 5PRNA 2EU7X 2WQ9A 3I17A 3WI5A 1LKEA 2WUTA 4IB9A 5L8NA 2XTRA 3JS1A 3AA7B 4FMSA 4JFBA 4QGXA 1OPAA 4FZMA 3LK42 3C76X 1L6MA 3NSGA 2CM4A 2MJIA 1MVGA 3DA3A 2AT8X 2K62A 4WFVA 4YKMA 2LFUA 2Q39A 2PRNA 5BVSA 4FZNA 1ICMA 1EI5A 1BT9A 1GT5A 4YGZA 1HXTA 2XE1A 1NP4A 1BEBA 3POXA 4OS0A 2OMFA 8PRNA 2XE2A 3TGBA 2R56A 4PSQA 2GTFX 3BDRA 2LBVA 4IBAA 3TGAA 1HXUA 2XMXA 3FA8A 3NQ9A 5T5FA 2CM9A 4IAWA 4QYPA 1CRBA 4LSIA 1MDCA 1MM5A 4K19A 2A2GA 2RCQA 4L3RA 3UU2A 3CQNA 3FR2A 2RN4A 5EDCA 4HFOA 4QYNA 5KHPA 1QFTA 1DZJA 2CZTA 5BVQA 2FGRA 2N2LA 3JTYA 4EXZA 4U8UM 4MISA 1JV4A 3WJFA 3AA1A 1N0SA 3WBGA 3KFIA 2FS7A 1IKJA 3NQKA 2OVDA 4DQ4A 2W2FA 3S26A 4Y0QA 4YDBA 5BVTA 3SY7A 4QNIA 1GKAB 4ZGUA 2RCTA 5FQ7E 2K23A 2ZAGA 2MHDA 2O62A 3O19A 4ZR2A 4AYID 1ML7A 5EZ2A 1JZUA 5H9NA 4AYMC 1AELA 3B2JA 3CQRA 4G76A 1QG5A 3V8UA 4XMGA 2A2UA 2G79A 3AA6B 4XNLA 1ZNHA 5HZ6A 4FRXA 3T24A 3RZYA 3HOEA 4I9RA 4RJXA 4COTA 5BYPA 4D64A 1KT3A 2QM9A 3B2IA 1NGLA 5ADXK 2GJ5A 3BU9A 5LJGA 5HWZA 1H91A 4OMXA 4QRLA 1BWYA 4ORWA 1JYJA 4L1NA 3FYXA 4RUUA 2Q2MA 1ORMA 1Y9LA 4OS3A 1HN2A 4WHIA 4FSOA 4G75A 3RBHA 1U17A 2XE5A 3O0EA 1EW3A 3MBTA 1FELA 3QRCA 3C5OA 3EMMA 7PRNA 5FAZA 4AFKA 1O8VA 3SAOA 3QRAA 3WJGA 5EE2A 3P6FA 3AKNA 2KW1A 4PUXA 1JJJA 3AA0A 1GFQA 2YMSA 3P6GA 1QJPA 1YP7A 2X45A 4MVLA 2X8TA 4GCQA 3UEVA 4LKTA 3LK3A 3GAQA 3HWDA 4WFUA 4EFGA 1ADLA 1KQWA 2JU3A 3FLLA 5EDBA 1QY1A 4ORSA 3EMNX 5EEDA 3FYFA 4YFPA 2LFOA 2NNQA 3FW4A 4XMFA 4YCEA 1I05A 3B2KA 2G78A 4LQZA 3D97A 4XMDA 2KXPA 3FR5A 3WJEA 4CK4A 5B29A 4ORUA 3SOTA 2MM3A 1OSMA 1AVGI 2KTDA 3IA8A 4NNSA 1Q9GA 2O4VA 4KH8A 2W80C 2GTLO 1G74A 3T1DA 3VY8X 3DTQA 1A3YA 3F6ZB 2HYSA 3UAQA 1HMSA 2YNKA 2KZ7B 3F8AA 4QGVA 2P8GA 2ACOA 3RKGA 3STKA 4O9SA 2WQAE 1IFCA 3B2LA 2GTLN 5F1EA 5HCEC 3NR3A 3F9DA 3LHNA 1PRNA 2FS6A 4U8UO 3ZW0A 3VY9X 3WJDA 1SXWA 5IO6A 2A3FX 2AT6X 1AB0A 1GT1A 1G5WA 3QKGA 5HZ5A 2HZQA 1RBPA 3LK2B 4AYDC 1QWDA 1SY3A 3FA6A 1QY0A 4A8ZA 4AZRA 1VYGA 3BX8A 4TLJA 3WXQA 1JBHA 4I6SA 4DQ3A 4ZHDA 3T20A 4ZH6A 3VPJE 5KIDA 1KZXA 4N7CA 1KGLA 1BBPA 2NP1A 4RLBA 3VZUX 2AH7X 4KIIA 3WVMA 2AT5X 4LZUA 5JR8A 1KT7A 1X8PA 4A1HA 3AAAB 4FSPA 4AZPA 4KR4A 1D3SA 4LSEA 1O1VA 4I95A 3ZW2A 3Q6LA 5H9KA 1GX9A 4HPBA 1GFPA 4IABA 5EEEA 1EUOA 4A1YA 4YH0A 3WJCA 4NNTA 5G26A 1IIUA 5LJBA 3PQUA 5HAEA 3NX1A 3UPGA 2X27X 3KFFA 1G7NA 5F6ZA 3PQSA 1AQBA 4UU3A 1GGLA 3UEWA 4BVMA 1A57A 5IYUA 2ALLX 2RQ0A 1EALA 1GFNA 1MM4A 1LFOA 4FZLA 1EXSA 2Y0KA 3K3LA 5AEOA 4INNA 2POAA 4AZLA 1CJ5A 3ELXA 4KT5A 3OBLA 3CBCA 1X8OA 1OBPA 4XMEA 3AAEA 3FW5A 3OJYC 1VYFA 1E54A 3SYBA 1SMPI 4GNWA 1YS5A 1Z24A 3PORA 4WBKA 4FRTA 1U0XA 1MPFA 2FGQX 3LK41 2KD2A 1YWDA 3KFHA 3VG5A 4FOZA 4EQAC 3D4RA 4YMYA 3CMPA 5FFHA 2BHVA 4BUMX 1ZNDA 2JU7A 2R74A 2WEWA 4ZH9A 2OVAA 5D4AA 3CWKA 4I3DA 5AQ6A 1B56A 5JDPA 1I4UA 1OPBA 5FQ6E 2N2MA 2MHLA 4U3QA 1B0OA 4Y0PA 4YKOA 4MVEA 4QAEA 2HZRA 1T8VA 5D45A 1THQA 3K19A 1SA8A 1IFBA 4IMOA 2L9CA 4ZFXA 4Y0SA 3AA1B 3HWBA 3P6HA 3KVDD 2M07A 3HOLA 3E3CA 5EPQA 2ACPX 1HMTA 1PEEA 3DSZA 1CBQA 5DL8A 4F4BA 4FBOA 4ML7B 4AZNA 1FDQA 4KRAA 1B8EA 4ORXA 1GFMA 1XCAA 1YIVA 3C77X 2YG2A 3PEDA 1EQDA 5D47A 1U18A 1PHOA 3APXA 4AYNA 5DG4A 1IZNA 3VG3A 1EPBA 2G7BA 4IB6A 1TW4A 2Z4IA 4ALOA 3SZVA 4E1SA 5HA1A 1BH3A 3ZW1A 2XKLA 1X8NA 4GHBA 1YUPA 2FR2A 2WEXA 1BSOA 4YGGA 1T0VA 3BU1A 5GV0A 1DZMA 2ZAIA 2XG6A 2QMIA 4BQUA 5K06A 1IKEA 1CBSA 3NPOA 1ZHXA 2NNDA 1E06A 1KZWA 4GCPA 4O4SA 3WOVA 4HPCA 5LJEA 5DL5A 3NADA 4LSFA 2XSTA 4A60A 3HWEA 1BM5A 1BJ7A 4ES7A 3N91A 2AKQA 2JW1A 2Q9SA 4IB8A 4ZGFA 3VZTX 4C69X 3TZGA 5HZQA 1BSQA 3LV4A 4LKPA 4LZVA 3AA0B 1KXOA 2QO5A 5F58A 5LJCA 1TVQA 4KC7A 4N59A 5ADXL 4AKRA 3LK3B 4ARHA 2FRSA 2M4LA 4EEJA 1UREA 4AZOA 4M6SA 3STMX 4UU2A 2F1TA 3FELA 3HWGA 4HPAA 3A2SX 3VE2A 4HWMA 5D5DA 2QTKA 2LB6A 3EM0A 3POUA 2FTBA 3H3IA 3FA9A 2ANSA 3FA7A 2BLGA 3OE3A 1BXWA 2KXPB 4AZQA 4Y0RA 1OPFA 4MVIA 4AZMA 2QOSC 3BRNA 3PH5A 2Y0HA 2AT0X 2F1VA 3WI4A 1T68X 3P02A 4ID2A 5H8TA 2ZLDA 1KOIA 2AT3X 3PH6A 2XE3A 3JQOA 5L8IA 2LHFA 1ZNLA 5DL6A 2PORA 4U8UN 4TKJA 5HTDA 1LPJA 1LIDA 2A0AA 2OFMX 2QO6A 3EYCA 4ODDA 4FESA 2DM5A 4GCSA 4AKMA 1ZNEA 3ZW0B 1O1UA 5B27A 3RSWA 5FQ8E 3UEUA 3S60A 5IO7A 4O3WA 3SY9A 3NP1A 3VG2A 5LJHA 3PECA 2OVEA 4TQ2A 2HMBA 1GX8A 5H9LA 4O3XB 4GF4A 3ZI8A 3EBKA 2K4TA 3AA7A 1CBIA 5HTEA 3BLGA 2CBSA 2LKKA 4FBVA 4O49A 1LF7A 4TNNA 3AKMA 3NX2A 5HZ9A 1B4MA 4XNKA 1X89A 4TJZA 3FEPA 4N7DA 1P4TA 2Y7SA 2J1NA 4BOEA 3HW9A 1GFOA 1OEKA 2R73A 5AJBA 2AL0X 4ZJ0A 1KT6A 3ZUOA 4CSBA 1GT4A 2M06A 1QQSA 2YPVA 1SXUA 1DFVA 1ACDA 1YWCA 4FUVA 1BLRA 3G7GA 2J4UP 1FE3A 5DPQA 3APUA 4TKBA 2L68A 3BY0A 1OEJA 1HBPA 3S5VA 2ODJA 2W2AA 4YFRA 4ZHHA 5D8JA 4YGHA 1BRPA 5HA0A 4GKCA 4I3BA 4NP1A 5LJDA 3ZQ3A 1LIEA 5HCCC 2XTQA 3VG6A 2A13A 3TGCA 1ZHTA 4QGWA 4YBPA 2Y2XA 1QJ9A 2MWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O49 A;  4U9C A;  4O3Z A;  3PQU A;  2KC0 A;  2Y7S A;  4AYN A;  4AYD C;  3PQS A;  4Z3T A;  4AYI D;  4AYM C;  5T5F A;  3V8U A;  2W80 C;  2YPV A;  2W81 C;  4QQ1 A;  4O4U A;  2KDY A;  3UAQ A;  5EE2 A;  4O3W A;  3VE2 A;  3KVD D;  3HOE A;  4O4X A;  3HOL A;  4AYE C;  2LFU A;  1YS5 A;  4O3Y A;  4O3X B;  3VE1 A; 
#chains in the Genus database with same CATH topology
 4GET A;  2RA6 A;  2QOM A;  3WYP A;  2RD7 C;  2IZF B;  1EII A;  1ZHW A;  3D96 A;  1MX8 A;  3T2X A;  2IFB A;  1LNM A;  1MK5 A;  3FEK A;  3NBX X;  4IMN A;  1I04 A;  2X46 A;  2LA7 A;  2OY8 A;  1X71 A;  4KR8 A;  4KC8 A;  4FGI B;  4O4O A;  2L67 A;  3O22 A;  1X8Q A;  3CBS A;  5KIC A;  2RTN B;  1JYD A;  4QZU A;  1ZHY A;  1A18 A;  1BRQ A;  1S44 A;  2HNX A;  1BSY A;  1IZN B;  4D5U A;  2IZB A;  4JGL A;  1OEE A;  3APW A;  2Y0L A;  5B5G A;  4BX5 B;  4MIR A;  1GT3 A;  2OVS A;  4CV7 A;  1TXL A;  1ZHZ A;  1YWA A;  3B2H A;  5H9A A;  1TOW A;  3PPT A;  3TF6 A;  3BS0 A;  2I5V O;  2RTC B;  1DF3 A;  2W2B A;  1NP1 A;  1ZNG A;  2ERV A;  1UZ2 X;  5AFU L;  2FT9 A;  1LIB A;  2JOZ A;  5C0N A;  4GZV A;  4I3C A;  4YBU A;  5B5E O;  2R89 A;  4NLJ A;  3RBY A;  5LKE A;  2X8F A;  3O2Y A;  1VWN B;  1E00 A;  3VG7 A;  4GD9 A;  3JSQ A;  4FQB B;  3P6E A;  4B61 A;  1ERX A;  4Z2P A;  2PY1 A;  5IO5 A;  2FHL A;  2C4I A;  3VHM A;  3MVF A;  3VE1 A;  4D6A A;  1PMP A;  2CBR A;  3RWX A;  4I9S A;  4Y59 A;  3EBW A;  1GM6 A;  3UEX A;  2WQ9 A;  2WUT A;  1OPA A;  4WFV A;  1VWJ B;  4CDF A;  2XE1 A;  2VFB A;  8PRN A;  1SWH A;  2GTF X;  2LBV A;  4IBA A;  5T5F A;  4IAW A;  4BX6 A;  4CPI A;  4LSI A;  2IZC B;  3PF1 A;  3CQN A;  3FR2 A;  2RN4 A;  4HFO A;  2CZT A;  1JV4 A;  3WJF A;  3WBG A;  3KFI A;  2OVD A;  3S26 A;  3SY7 A;  1GKA B;  2RCT A;  5FQ7 E;  2K23 A;  2MHD A;  4AYI D;  4JHQ A;  3B2J A;  3KZI O;  1ZNH A;  4FRX A;  3SLT A;  4I9R A;  4COT A;  5BYP A;  2QM9 A;  1T1L A;  1LCV A;  4BX7 B;  4OEM A;  1ORM A;  1U17 A;  2R4P A;  2OL8 O;  3O0E A;  5B5F A;  3WJG A;  5EE2 A;  1SWG A;  3P6F A;  4GDA A;  1QJP A;  2X45 A;  4GCQ A;  2OFB A;  1VWR B;  1VWB B;  4WFU A;  5EDB A;  3EMN X;  1QY1 A;  3EW2 A;  3FW4 A;  3CKF A;  1VWI B;  3D97 A;  3FR5 A;  1OSM A;  1LCW A;  4KH8 A;  3F6Z B;  5B2A O;  2HYS A;  4QGV A;  3RDM A;  5F1E A;  1IFC A;  4N74 A;  3LHN A;  4U8U O;  3T6L A;  3WJD A;  1VWA B;  1I78 A;  1RBP A;  1SY3 A;  2OFA A;  1QY0 A;  2C1Q A;  3WXQ A;  4I6S A;  4ZHD A;  2GH7 A;  5KAF O;  4C4V B;  1KZX A;  4N7C A;  4KII A;  4A1H A;  3AAA B;  1AVD A;  3Q6L A;  1GX9 A;  4HPB A;  5H9K A;  4NNT A;  1IIU A;  1SWL A;  4UU3 A;  1AQB A;  2ALL X;  2RQ0 A;  1LFO A;  3K3L A;  1CJ5 A;  4KT5 A;  3CBC A;  3AAE A;  3OJY C;  4GNW A;  1YS5 A;  1Z24 A;  4WBK A;  3A0H O;  1U0X A;  3LK4 1;  3KFH A;  4EQA C;  3D4R A;  1PTS A;  1ZND A;  4CPH B;  4ZH9 A;  2WJQ A;  1LDQ A;  1I4U A;  4U3Q A;  1T8V A;  3T6F A;  1SA8 A;  3AA1 B;  4Y0S A;  3P6H A;  2F1C X;  1S5L O;  4KRA A;  1SWO A;  2FKJ A;  1YIV A;  3C77 X;  2YG2 A;  3PED A;  4ALO A;  5HA1 A;  3ZW1 A;  1X8N A;  4GHB A;  2FR2 A;  2WEX A;  1BSO A;  4YGG A;  1K24 A;  3PDF A;  5B3M O;  4Z2O A;  1IKE A;  1KZW A;  1SWU A;  4HPC A;  5LJE A;  5DL5 A;  2AKQ A;  4IB8 A;  4ZGF A;  3TZG A;  2JQY A;  2Y3E A;  4LZV A;  1KXO A;  4CPE A;  4EEJ A;  1URE A;  1E2T A;  3HWG A;  4HWM A;  3POU A;  4AZQ A;  2Y0H A;  2AT0 X;  1KOI A;  2OFM X;  3EYC A;  5B27 A;  5G39 A;  5FQ8 E;  3S60 A;  3VG2 A;  3PEC A;  2OVE A;  5H9L A;  3ZI8 A;  2RTH B;  3AA7 A;  3AKM A;  3NX2 A;  4TJZ A;  1HY2 A;  2Y3F A;  3HW9 A;  4BOE A;  2OY1 O;  2F01 A;  1KT6 A;  4CSB A;  1GT4 A;  1QQS A;  2YPV A;  1YWC A;  2J4U P;  5DPQ A;  4TKB A;  1LEL A;  5D8J A;  5HA0 A;  3ZQ3 A;  1LIE A;  2X34 A;  3VG6 A;  2Y2X A;  4QGW A;  1QJ9 A;  4RUN A;  1QY2 A;  2HLV A;  4ZCB A;  5LKF A;  1VWQ B;  2UYW A;  3WJB A;  2RTR B;  2CZU A;  1SWD A;  5FVN A;  1Y55 X;  3HWF A;  1JQP A;  1DV9 A;  1FEN A;  1S7D A;  3ZUI A;  3MM0 A;  1IW2 A;  3PRN A;  2BT9 A;  4IL6 O;  1SY0 A;  1KQX A;  3STN A;  4ON1 A;  4N58 A;  4UB6 O;  6PRN A;  4TKH A;  3SZD A;  2AXT O;  1VWP B;  3P24 A;  3IFB A;  1W5R A;  3S5X A;  5CYB A;  4NYR A;  1DZK A;  2AMM X;  1HQP A;  1JIW I;  3BRY A;  4B55 A;  2FGS A;  2R8A A;  2CAM A;  3HTY A;  1G90 A;  3WYQ A;  4GH7 A;  4RLC A;  4YFQ A;  4Z3T A;  2X32 A;  5F6B A;  1HMR A;  4ZHG A;  4ZHF A;  3PP6 A;  3MX7 A;  1IJ8 A;  2RTQ B;  1QJ8 A;  4AYE C;  1PM1 X;  3KVN A;  3VZW X;  1S2P A;  2KZ7 A;  2QO4 A;  2NNE A;  3FMZ A;  1YP6 A;  1X8U A;  1ZNK A;  4NW4 A;  3T0S A;  2FR3 A;  1ZRY A;  2R88 A;  2X4M A;  2JMB A;  1GXA A;  2F09 A;  1RSU B;  1OBU A;  4GRJ A;  1LIC A;  1D2U A;  2IZG B;  1Q9F A;  5PRN A;  3WI5 A;  4IB9 A;  2XTR A;  3JS1 A;  4FMS A;  4JFB A;  3RE5 A;  3NSG A;  2CM4 A;  2MJI A;  1MVG A;  3DA3 A;  2K62 A;  1VWK B;  2OF9 A;  4YKM A;  2IWW A;  1SRJ A;  2Q39 A;  5BVS A;  4FZN A;  1ICM A;  1EI5 A;  4OEL A;  1BEB A;  3POX A;  2OMF A;  3TGB A;  4OKA A;  3TGA A;  3FA8 A;  2WJR A;  4PR7 A;  4L3R A;  1PBY A;  5EDC A;  1DF8 A;  5KHP A;  2N2L A;  3JTY A;  4JO6 A;  4U8U M;  2O62 A;  3O19 A;  1JZU A;  5H9N A;  4AYM C;  4G76 A;  4XMG A;  2A2U A;  1HQQ A;  5HZ6 A;  2FHN X;  4RJX A;  4N75 A;  3B2I A;  2R4O A;  5JD2 A;  2GJ5 A;  3BU9 A;  5LJG A;  1H91 A;  1JYJ A;  3FYX A;  1SWA A;  1HN2 A;  1EW3 A;  1FEL A;  3QRC A;  3C5O A;  5FAZ A;  1O8V A;  3SAO A;  3QRA A;  2AVI A;  3AKN A;  2YMS A;  3P6G A;  1YP7 A;  2X8T A;  5LJK A;  3GAQ A;  4EFG A;  1KQW A;  2JU3 A;  3FLL A;  3FYF A;  2LFO A;  3PGR A;  1SWE A;  3B2K A;  2IZL B;  5H2F O;  3SOT A;  1AVG I;  3IA8 A;  2OL6 O;  3VY8 X;  3T1D A;  1G74 A;  1RST B;  3F8A A;  1NBX A;  2WQA E;  5HCE C;  3NR3 A;  1PRN A;  5TIS O;  1SXW A;  2A3F X;  2AT6 X;  4C5P A;  1G5W A;  2HZQ A;  4AYD C;  2A5B A;  3FA6 A;  4AZR A;  3BX8 A;  1VWM B;  3T20 A;  4ZH6 A;  5KID A;  1SWT A;  3PGU A;  3VZU X;  2AH7 X;  4FSP A;  4KR4 A;  2RTF B;  1GFP A;  2A5C A;  4IAB A;  5EEE A;  4A1Y A;  2G8C O;  3WJC A;  4PJ0 O;  1SWC A;  1SLE B;  3UPG A;  2X27 X;  1SLD B;  1G7N A;  3RDS A;  1GGL A;  5IYU A;  1EXS A;  2Y0K A;  1LDO A;  1OBP A;  2RTG B;  3D9W A;  3POR A;  4FRT A;  5B66 O;  2RTO B;  2FGQ X;  1YWD A;  3VG5 A;  5FFH A;  4BX6 B;  2R74 A;  2JU7 A;  2OVA A;  5D4A A;  2RTJ A;  3CWK A;  5AQ6 A;  5JDP A;  5FQ6 E;  4YKO A;  4QAE A;  5D45 A;  4ZFX A;  4U46 A;  3HOL A;  1NC9 A;  3E3C A;  3FID A;  4YVB A;  4FQE A;  1FDQ A;  1GFM A;  1XCA A;  1HXZ A;  5D47 A;  1PHO A;  2RTD B;  5DG4 A;  1EPB A;  4IB6 A;  1TW4 A;  3WZP A;  3QQ2 A;  3DWN A;  5GV0 A;  2XG6 A;  1CBS A;  1ZHX A;  2NND A;  1E06 A;  4GGT A;  1VWO B;  4C00 A;  4A60 A;  3HWE A;  2IZI A;  4ES7 A;  3N91 A;  2OY5 O;  5HZQ A;  1BSQ A;  4LKP A;  2QO5 A;  1TVQ A;  4KC7 A;  2MF6 A;  4AKR A;  1OSP O;  4ARH A;  1KL5 A;  1VWF B;  1SWP A;  2LB6 A;  1N9M A;  3OE3 A;  1VYO A;  1BXW A;  4MVI A;  3SZI A;  4AZM A;  2QOS C;  3BRN A;  3PH5 A;  3P02 A;  4ID2 A;  5H8T A;  2ZLD A;  2XE3 A;  3JQO A;  2DJG A;  5HTD A;  2QO6 A;  4FES A;  2DM5 A;  1O1U A;  3RSW A;  4BBO A;  5IO7 A;  4O3W A;  4MEE A;  4TQ2 A;  2HMB A;  2ZSC A;  4O3X B;  2K4T A;  1CBI A;  5HTE A;  2CBS A;  1LF7 A;  2C1S A;  3FEP A;  4N7D A;  1P4T A;  2Y7S A;  3WZQ A;  2J1N A;  3RY2 A;  2AL0 X;  4ZJ0 A;  3ZUO A;  1DFV A;  1ACD A;  4FUV A;  2L68 A;  3BY0 A;  4YFR A;  3AUM O;  4YGH A;  4I3B A;  5LJD A;  2A13 A;  4YBP A;  3NQ3 A;  1JJX A;  4YCH A;  1DC9 A;  1QFV A;  1FEM A;  1XKI A;  1SY2 A;  4O3Z A;  5L8O A;  3PGS A;  2WWP A;  4GK9 A;  3AAE B;  1UYN X;  2K0L A;  1KT4 A;  3I0A A;  2OFR X;  3FIQ A;  3POQ A;  4FT6 A;  1EIO A;  1SXX A;  2GTL M;  4O4U A;  2KDY A;  4XMC A;  3SYS A;  2FWV A;  4AUI A;  1CBR A;  3CR6 A;  2Q4N A;  3AA6 A;  4XMH A;  4ORY A;  4R0B A;  5HZ8 A;  5F7G A;  4IB7 A;  2WR6 A;  1WUB A;  5AFU K;  5HCD C;  1OBQ A;  4RL9 A;  5AJC A;  1N7Y A;  3Q34 A;  5FEN A;  4O3Y A;  4I60 A;  5CE4 A;  1I06 A;  3KFG A;  3OD9 A;  3ZW1 B;  1UYO X;  4U9C A;  1RLB E;  1EPA A;  3BSZ E;  1R0U A;  2JN3 A;  4YDA A;  4NLI A;  4Z27 A;  2KTS A;  2BS6 A;  1SWB A;  1TOU A;  3DA4 A;  3WU2 O;  3LTW A;  1HBQ A;  5D48 A;  1QAB E;  4LSH A;  3C78 X;  2IWV A;  2KC0 A;  3HPE A;  4PJ2 A;  4E1T A;  2WPU A;  3D95 A;  3GP6 A;  3TZS A;  4AW8 A;  2MO5 A;  4RJW A;  1MUP A;  5DL7 A;  3LK2 A;  3VU1 A;  1FTP A;  1ICN A;  1VWE B;  1VWC B;  1SY1 A;  3APV A;  3U9P C;  3FR4 A;  5CSE A;  2RTA A;  4ORR A;  5KAI O;  1SWJ A;  1VWG B;  4ALB A;  4GDZ A;  3DWO X;  3ZWE A;  1SRG A;  3BX7 A;  3I17 A;  1Y53 X;  1LKE A;  3WZO A;  1SRI A;  3AA7 B;  4QGX A;  3LK4 2;  3C76 X;  1KFF A;  4Z6J A;  1VWL B;  2AT8 X;  2PRN A;  2A8G A;  3RDO A;  1HXT A;  2IZK A;  2R4L A;  2XE2 A;  2R56 A;  4PSQ A;  4BGF A;  1HXU A;  4GJV A;  1SRE A;  2CM9 A;  3CKG A;  1CRB A;  1Y52 X;  1MM5 A;  4K19 A;  2A2G A;  3UU2 A;  1QFT A;  1DZJ A;  5BVQ A;  2FGR A;  4EXZ A;  1N0S A;  2FS7 A;  2W2F A;  4YDB A;  5BVT A;  2ZAG A;  1SWR A;  2IZE B;  1ML7 A;  5EZ2 A;  2G5L A;  1AEL A;  2G79 A;  4XNL A;  4CDE A;  3HOE A;  4D64 A;  2RTP B;  3A0B O;  1N9Y A;  5HWZ A;  4QRL A;  5IXG A;  1I9H A;  4ORW A;  2JGS A;  4OS3 A;  5B10 O;  1LUQ A;  3MBT A;  3EMM A;  4AFK A;  3AA0 A;  1GFQ A;  3LK3 A;  4CTD A;  1ADL A;  4ORS A;  2NNQ A;  4XMF A;  4YCE A;  1I05 A;  2KXP A;  4CK4 A;  5B29 A;  2IZA A;  4ORU A;  4DCB A;  2MM3 A;  4NNS A;  1Q9G A;  2O4V A;  1RXJ A;  3VHI A;  2GTL O;  1A3Y A;  4EKV A;  2YNK A;  1HMS A;  2KZ7 B;  2P8G A;  2ACO A;  3RKG A;  3STK A;  4O9S A;  3B2L A;  2R4N A;  2FS6 A;  3ZW0 A;  3WZN A;  5IO6 A;  3QKG A;  5HZ5 A;  2FKG A;  4A8Z A;  1JBH A;  1JMX A;  4BCS A;  1KGL A;  1BBP A;  4RLB A;  5JR8 A;  2BSZ A;  4LZU A;  3WVM A;  1D3S A;  1O1V A;  3ZW2 A;  1EUO A;  4JNJ A;  3JCU O;  5LJB A;  5HAE A;  1FJ1 E;  1A57 A;  4FZL A;  5AEO A;  2POA A;  3ELX A;  3OBL A;  2RTI B;  1GX3 A;  1X8O A;  4CPF A;  3SYB A;  1VWD B;  2KD2 A;  4FOZ A;  3CMP A;  3FDC A;  1B56 A;  1OPB A;  1STS B;  2X9K A;  4K3C A;  4MVE A;  1KL3 A;  5G3A A;  3K19 A;  2L9C A;  3EC5 A;  5EPQ A;  2ACP X;  3DSZ A;  4Z2V A;  1U18 A;  1SWQ A;  4AYN A;  1IZN A;  1NQN A;  3VG3 A;  2G7B A;  3SZV A;  1BH3 A;  4BX5 A;  1SLG B;  1DZM A;  2ZAI A;  2QMI A;  5K06 A;  3WOV A;  3NAD A;  1JMZ A;  4LSF A;  2XST A;  4C69 X;  2X56 A;  2Q9S A;  3LV4 A;  2OL7 A;  5LJC A;  4N59 A;  5ADX L;  4AZO A;  3STM X;  4UU2 A;  3FEL A;  3A2S X;  2QTK A;  3EM0 A;  3H3I A;  4CDD A;  3FA7 A;  4Y0R A;  1OPF A;  1SLF B;  3WI4 A;  1T68 X;  3SLO A;  2RTB B;  3PH6 A;  5L8I A;  1ZNL A;  4U8U N;  4TKJ A;  1LPJ A;  1LID A;  4GCS A;  4ODD A;  2IZD B;  1ZNE A;  2AF5 A;  3SY9 A;  5LJH A;  3RY1 A;  3EBK A;  2RTK A;  3BLG A;  4FBV A;  4O49 A;  4TNN A;  4XNK A;  3PK2 A;  1OEK A;  2R73 A;  2M06 A;  1SXU A;  3G7G A;  1SRF A;  2RTM A;  1OEJ A;  1HBP A;  3S5V A;  2X55 A;  2ODJ A;  2W2A A;  4ZHH A;  4GKC A;  1ZHT A;  2MWH A;  1HXX A;  3KZA A;  1WBI A;  5HBS A;  5F2B A;  2L5P A;  2Z4H A;  4HPD A;  4M7M A;  3NJT A;  3P6C A;  2FLJ A;  4EDE A;  1PBO A;  4OS8 A;  2W81 C;  3VG4 A;  4GNY A;  1A2D A;  5L3Y A;  3P6D A;  3U03 A;  4IRW A;  1E02 A;  1GKA A;  2E4J A;  3U0D A;  2OZQ A;  4D65 A;  4ZHC A;  3HK1 A;  3RDU A;  1G85 A;  1STP A;  3KQ0 A;  4BX7 A;  4KCA A;  4D6B A;  2BS5 A;  1SWN A;  2I5Z O;  1SWS A;  2N93 A;  2ASN X;  5GTI O;  3BS2 A;  1SRH A;  2LBA A;  4IAX A;  3MG5 A;  4FBR A;  1LIF A;  3EW1 A;  2KT4 B;  1W4T A;  2GE4 A;  4GE1 A;  1NQM A;  2RTE B;  3ZZV A;  2X8S A;  2IZJ A;  2Y32 A;  2BC3 A;  4QQ1 A;  2IZH B;  4AYH A;  1E5P A;  1DZP A;  3G7X A;  1YWB A;  4QZT A;  4O4X A;  2JU8 A;  1MX7 A;  3L4R A;  4GGZ A;  2QCB A;  1MOY A;  4OMW A;  2UZ2 A;  1HXL A;  1KT5 A;  4NYQ A;  4AKR B;  4GGR A;  4MVK A;  3FEN A;  1ERB A;  2GC9 A;  2Q2P A;  1P6P A;  3GE2 A;  2VFC A;  4GU8 A;  4DNE A;  3ELZ A;  2ZFG A;  2WSJ A;  3RDQ A;  1AVE A;  3SZJ A;  4C4V A;  2JMM A;  1H6S 1;  1Y9T A;  1VPR A;  3AAA A;  4JCH A;  1SXY A;  2F73 A;  1ALB A;  4NV8 A;  2MNH A;  2EU7 X;  5L8N A;  4FZM A;  1L6M A;  2LFU A;  4CDC A;  1BT9 A;  1GT5 A;  4YGZ A;  1NP4 A;  4OS0 A;  3BDR A;  5K68 A;  2XMX A;  3NQ9 A;  4QYP A;  1MDC A;  4CPH A;  2RCQ A;  4QYN A;  4MIS A;  3AA1 A;  4DQ4 A;  3NQK A;  1IKJ A;  1MM9 A;  4Y0Q A;  4QNI A;  4ZGU A;  4ZR2 A;  2WVP A;  4GJS A;  3CQR A;  4Z28 A;  1QG5 A;  3V8U A;  1LCZ A;  3AA6 B;  3T24 A;  3RZY A;  1KT3 A;  1NGL A;  5ADX K;  3RDX A;  1VWH B;  4OMX A;  1BWY A;  4L1N A;  4RUU A;  2Q2M A;  4GUZ A;  1Y9L A;  4WHI A;  4FSO A;  4G75 A;  3RBH A;  2XE5 A;  5E79 O;  2RTL A;  7PRN A;  4PUX A;  2KW1 A;  1JJJ A;  2OF8 A;  4MVL A;  5IRU A;  3UEV A;  4LKT A;  3HWD A;  5EED A;  4YFP A;  1RXH A;  2G78 A;  4LQZ A;  4XMD A;  3WJE A;  1N4J A;  2KTD A;  5K67 A;  4BJ8 A;  2W80 C;  3DTQ A;  3UAQ A;  2GTL N;  3RE6 A;  3F9D A;  1N43 A;  3SZH A;  3VY9 X;  1AB0 A;  1GT1 A;  3LK2 B;  1QWD A;  3T2W A;  1VYG A;  4TLJ A;  4DQ3 A;  3VPJ E;  2NP1 A;  5IRW A;  3AEH A;  2AT5 X;  4LSE A;  1KT7 A;  1X8P A;  3X00 A;  4AZP A;  4I95 A;  1SWF A;  1Y0G A;  4YH0 A;  5G26 A;  3PQU A;  3NX1 A;  3KFF A;  5F6Z A;  3PQS A;  3UEW A;  4BVM A;  1GFN A;  1EAL A;  1MM4 A;  1RAV A;  4INN A;  4AZL A;  4XME A;  3FW5 A;  1VYF A;  1E54 A;  1SMP I;  1MPF A;  4YMY A;  2BHV A;  4BUM X;  2PI3 O;  2WEW A;  4I3D A;  2N2M A;  2MHL A;  1B0O A;  4Y0P A;  2HZR A;  1THQ A;  1JJU A;  1T16 A;  2OY7 A;  1IFB A;  4IMO A;  3HWB A;  3KVD D;  2M07 A;  1HMT A;  1PEE A;  1CBQ A;  5DL8 A;  4F4B A;  4FBO A;  4ML7 B;  5G38 A;  4AZN A;  1B8E A;  4ORX A;  1MEP A;  1EQD A;  3APX A;  2Z4I A;  4E1S A;  2DJF A;  2XKL A;  1YUP A;  1T0V A;  3BU1 A;  4BQU A;  3VGW A;  3NPO A;  4NV7 A;  3BRZ A;  4GCP A;  4O4S A;  1SWK A;  1BM5 A;  1BJ7 A;  2JW1 A;  3VZT X;  4Y5D A;  1RXK A;  2OYB O;  3AA0 B;  5F58 A;  3LK3 B;  2FRS A;  2M4L A;  4M6S A;  2F1T A;  4HPA A;  5D5D A;  3SLJ A;  3VE2 A;  1STR B;  2FTB A;  3FA9 A;  2KXP B;  2ANS A;  2BLG A;  1NDJ A;  5IRA A;  2F1V A;  3VHH A;  2AT3 X;  2VDF A;  5GTH O;  2LHF A;  5DL6 A;  2POR A;  2A0A A;  4AKM A;  3ZW0 B;  3UEU A;  3NP1 A;  4K3B A;  4GF4 A;  1GX8 A;  2LKK A;  1W6F A;  5HZ9 A;  1B4M A;  1X89 A;  1K3B A;  1GFO A;  3DZM A;  5AJB A;  2HKD A;  1KL4 A;  4UB8 O;  1BLR A;  1FE3 A;  3APU A;  1BRP A;  4NP1 A;  5CHK A;  5HCC C;  2XTQ A;  3TGC A;  5B11 O; 
#chains in the Genus database with same CATH homology
 4GET A;  3NQ3 A;  1JJX A;  3KZA A;  4YCH A;  1HXX A;  1DC9 A;  2W81 C;  1QFV A;  1FEM A;  1XKI A;  1QY2 A;  1SY2 A;  2RA6 A;  4O3Z A;  5L8O A;  5LJK A;  5HBS A;  2HLV A;  2WWP A;  2L5P A;  2RD7 C;  4ZCB A;  2Z4H A;  5LKF A;  4HPD A;  4GK9 A;  4M7M A;  1EII A;  1ZHW A;  3D96 A;  3AAE B;  2K0L A;  1KT4 A;  3I0A A;  3P6C A;  2OFR X;  3FIQ A;  3WJB A;  3POQ A;  1MX8 A;  4FT6 A;  2FLJ A;  4EDE A;  2CZU A;  1PBO A;  4OS8 A;  1EIO A;  2IFB A;  1SXX A;  2GTL M;  4GNY A;  1A2D A;  4O4U A;  3P6D A;  3VG4 A;  3U03 A;  2KDY A;  4XMC A;  5FVN A;  1E02 A;  1GKA A;  1LNM A;  2E4J A;  2FWV A;  3FEK A;  3U0D A;  3SYS A;  3NBX X;  1CBR A;  4AUI A;  2OZQ A;  4IMN A;  3HWF A;  1I04 A;  4D65 A;  1DV9 A;  1FEN A;  3CR6 A;  2X46 A;  4ZHC A;  2Q4N A;  1S7D A;  3HK1 A;  3ZUI A;  4XMH A;  4ORY A;  4R0B A;  3AA6 A;  5HZ8 A;  2LA7 A;  1IW2 A;  1X71 A;  3PRN A;  4KR8 A;  2BT9 A;  4KC8 A;  1SY0 A;  5F7G A;  1G85 A;  1KQX A;  3STN A;  4FGI B;  4O4O A;  4IB7 A;  4ON1 A;  2L67 A;  3O22 A;  3KQ0 A;  4N58 A;  1X8Q A;  6PRN A;  2WR6 A;  4TKH A;  3SZD A;  5AFU K;  4KCA A;  3CBS A;  4D6B A;  3P24 A;  2BS5 A;  3IFB A;  3S5X A;  5HCD C;  5KIC A;  1OBQ A;  4NYR A;  5CYB A;  1DZK A;  1JYD A;  2N93 A;  2ASN X;  4QZU A;  1ZHY A;  5AJC A;  2AMM X;  4RL9 A;  1BRQ A;  1A18 A;  1HQP A;  3BS2 A;  1JIW I;  2LBA A;  1S44 A;  2HNX A;  1BSY A;  5FEN A;  4O3Y A;  1IZN B;  4D5U A;  4IAX A;  5CE4 A;  1I06 A;  3KFG A;  4JGL A;  3OD9 A;  1OEE A;  4FBR A;  3APW A;  3ZW1 B;  2Y0L A;  3HTY A;  1G90 A;  4U9C A;  1LIF A;  1RLB E;  1EPA A;  3BSZ E;  2KT4 B;  4GH7 A;  4MIR A;  2GE4 A;  1R0U A;  2JN3 A;  1GT3 A;  2OVS A;  4GE1 A;  4RLC A;  4YDA A;  4NLI A;  4YFQ A;  3ZZV A;  4CV7 A;  2KTS A;  4Z3T A;  1TXL A;  1ZHZ A;  2X8S A;  1YWA A;  3B2H A;  4RUN A;  2BS6 A;  5F6B A;  5H9A A;  1TOW A;  3PPT A;  1HMR A;  4ZHG A;  3TF6 A;  1TOU A;  4ZHF A;  1DF3 A;  3DA4 A;  4QQ1 A;  2W2B A;  4AYH A;  3PP6 A;  3MX7 A;  1NP1 A;  1E5P A;  1DZP A;  1ZNG A;  3G7X A;  1YWB A;  4QZT A;  4O4X A;  2ERV A;  1QJ8 A;  1HBQ A;  1UZ2 X;  2JU8 A;  4AYE C;  1PM1 X;  5AFU L;  1MX7 A;  3L4R A;  2FT9 A;  5D48 A;  3VZW X;  1QAB E;  1S2P A;  1LIB A;  2JOZ A;  4OMW A;  5C0N A;  1KT5 A;  4GZV A;  4I3C A;  4NYQ A;  4YBU A;  2KZ7 A;  4AKR B;  2QO4 A;  4MVK A;  4NLJ A;  3FEN A;  4LSH A;  3C78 X;  3RBY A;  1ERB A;  2GC9 A;  5LKE A;  2KC0 A;  2NNE A;  2X8F A;  2Q2P A;  3O2Y A;  3FMZ A;  1P6P A;  4PJ2 A;  4E1T A;  1E00 A;  3GE2 A;  4GU8 A;  3VG7 A;  3D95 A;  3JSQ A;  3GP6 A;  1YP6 A;  1X8U A;  4FQB B;  3TZS A;  4AW8 A;  2MO5 A;  3ELZ A;  2ZFG A;  3P6E A;  4RJW A;  1MUP A;  5DL7 A;  1ZNK A;  3LK2 A;  4B61 A;  4NW4 A;  1ERX A;  3VU1 A;  1FTP A;  1ICN A;  2PY1 A;  3T0S A;  2FR3 A;  5IO5 A;  2WSJ A;  1ZRY A;  1SY1 A;  3APV A;  3U9P C;  2JMB A;  3FR4 A;  3MVF A;  3VE1 A;  1GXA A;  2F09 A;  4ORR A;  4D6A A;  1OBU A;  2JMM A;  4GRJ A;  1H6S 1;  1Y9T A;  1VPR A;  1PMP A;  2CBR A;  3RWX A;  3AAA A;  4JCH A;  4ALB A;  1SXY A;  4GDZ A;  2F73 A;  1ALB A;  1LIC A;  4I9S A;  1D2U A;  3ZWE A;  3EBW A;  2MNH A;  1GM6 A;  1Q9F A;  3UEX A;  3BX7 A;  5PRN A;  2EU7 X;  2WQ9 A;  3I17 A;  3WI5 A;  1LKE A;  2WUT A;  4IB9 A;  5L8N A;  2XTR A;  3JS1 A;  3AA7 B;  4FMS A;  4JFB A;  4QGX A;  1OPA A;  4FZM A;  3LK4 2;  3C76 X;  1L6M A;  3NSG A;  2CM4 A;  2MJI A;  1MVG A;  3DA3 A;  2AT8 X;  2K62 A;  4WFV A;  4YKM A;  2LFU A;  2Q39 A;  2PRN A;  5BVS A;  4FZN A;  1ICM A;  1EI5 A;  1BT9 A;  1GT5 A;  4YGZ A;  1HXT A;  2XE1 A;  1NP4 A;  1BEB A;  3POX A;  4OS0 A;  2OMF A;  8PRN A;  2XE2 A;  3TGB A;  2R56 A;  4PSQ A;  2GTF X;  3BDR A;  2LBV A;  4IBA A;  3TGA A;  1HXU A;  2XMX A;  3FA8 A;  3NQ9 A;  5T5F A;  2CM9 A;  4IAW A;  4QYP A;  1CRB A;  4LSI A;  1MDC A;  1MM5 A;  4K19 A;  2A2G A;  2RCQ A;  4L3R A;  3UU2 A;  3CQN A;  3FR2 A;  2RN4 A;  5EDC A;  4HFO A;  4QYN A;  5KHP A;  1QFT A;  1DZJ A;  2CZT A;  5BVQ A;  2FGR A;  2N2L A;  3JTY A;  4EXZ A;  4U8U M;  4MIS A;  1JV4 A;  3WJF A;  3AA1 A;  1N0S A;  3WBG A;  3KFI A;  2FS7 A;  1IKJ A;  3NQK A;  2OVD A;  4DQ4 A;  2W2F A;  3S26 A;  4Y0Q A;  4YDB A;  5BVT A;  3SY7 A;  4QNI A;  1GKA B;  4ZGU A;  2RCT A;  5FQ7 E;  2K23 A;  2ZAG A;  2MHD A;  2O62 A;  3O19 A;  4ZR2 A;  4AYI D;  1ML7 A;  5EZ2 A;  1JZU A;  5H9N A;  4AYM C;  1AEL A;  3B2J A;  3CQR A;  4G76 A;  1QG5 A;  3V8U A;  4XMG A;  2A2U A;  2G79 A;  3AA6 B;  4XNL A;  1ZNH A;  5HZ6 A;  4FRX A;  3T24 A;  3RZY A;  3HOE A;  4I9R A;  4RJX A;  4COT A;  5BYP A;  4D64 A;  1KT3 A;  2QM9 A;  3B2I A;  1NGL A;  5ADX K;  2GJ5 A;  3BU9 A;  5LJG A;  5HWZ A;  1H91 A;  4OMX A;  4QRL A;  1BWY A;  4ORW A;  1JYJ A;  4L1N A;  3FYX A;  4RUU A;  2Q2M A;  1ORM A;  1Y9L A;  4OS3 A;  1HN2 A;  4WHI A;  4FSO A;  4G75 A;  3RBH A;  1U17 A;  2XE5 A;  3O0E A;  1EW3 A;  3MBT A;  1FEL A;  3QRC A;  3C5O A;  3EMM A;  7PRN A;  5FAZ A;  4AFK A;  1O8V A;  3SAO A;  3QRA A;  3WJG A;  5EE2 A;  3P6F A;  3AKN A;  2KW1 A;  4PUX A;  1JJJ A;  3AA0 A;  1GFQ A;  2YMS A;  3P6G A;  1QJP A;  1YP7 A;  2X45 A;  4MVL A;  2X8T A;  4GCQ A;  3UEV A;  4LKT A;  3LK3 A;  3GAQ A;  3HWD A;  4WFU A;  4EFG A;  1ADL A;  1KQW A;  2JU3 A;  3FLL A;  5EDB A;  1QY1 A;  4ORS A;  3EMN X;  5EED A;  3FYF A;  4YFP A;  2LFO A;  2NNQ A;  3FW4 A;  4XMF A;  4YCE A;  1I05 A;  3B2K A;  2G78 A;  4LQZ A;  3D97 A;  4XMD A;  2KXP A;  3FR5 A;  3WJE A;  4CK4 A;  5B29 A;  4ORU A;  3SOT A;  2MM3 A;  1OSM A;  1AVG I;  2KTD A;  3IA8 A;  4NNS A;  1Q9G A;  2O4V A;  4KH8 A;  2W80 C;  2GTL O;  1G74 A;  3T1D A;  3VY8 X;  3DTQ A;  1A3Y A;  3F6Z B;  2HYS A;  3UAQ A;  1HMS A;  2YNK A;  2KZ7 B;  3F8A A;  4QGV A;  2P8G A;  2ACO A;  3RKG A;  3STK A;  4O9S A;  2WQA E;  1IFC A;  3B2L A;  2GTL N;  5F1E A;  5HCE C;  3NR3 A;  3F9D A;  3LHN A;  1PRN A;  2FS6 A;  4U8U O;  3ZW0 A;  3VY9 X;  3WJD A;  1SXW A;  5IO6 A;  2A3F X;  2AT6 X;  1AB0 A;  1GT1 A;  1G5W A;  3QKG A;  5HZ5 A;  2HZQ A;  1RBP A;  3LK2 B;  4AYD C;  1QWD A;  1SY3 A;  3FA6 A;  1QY0 A;  4A8Z A;  4AZR A;  1VYG A;  3BX8 A;  4TLJ A;  3WXQ A;  1JBH A;  4I6S A;  4DQ3 A;  4ZHD A;  3T20 A;  4ZH6 A;  3VPJ E;  5KID A;  1KZX A;  4N7C A;  1KGL A;  1BBP A;  2NP1 A;  4RLB A;  3VZU X;  2AH7 X;  4KII A;  3WVM A;  2AT5 X;  4LZU A;  5JR8 A;  1KT7 A;  1X8P A;  4A1H A;  3AAA B;  4FSP A;  4AZP A;  4KR4 A;  1D3S A;  4LSE A;  1O1V A;  4I95 A;  3ZW2 A;  3Q6L A;  5H9K A;  1GX9 A;  4HPB A;  1GFP A;  4IAB A;  5EEE A;  1EUO A;  4A1Y A;  4YH0 A;  3WJC A;  4NNT A;  5G26 A;  1IIU A;  5LJB A;  3PQU A;  5HAE A;  3NX1 A;  3UPG A;  2X27 X;  3KFF A;  1G7N A;  5F6Z A;  3PQS A;  1AQB A;  4UU3 A;  1GGL A;  3UEW A;  4BVM A;  1A57 A;  5IYU A;  2ALL X;  2RQ0 A;  1EAL A;  1GFN A;  1MM4 A;  1LFO A;  4FZL A;  1EXS A;  2Y0K A;  3K3L A;  5AEO A;  4INN A;  2POA A;  4AZL A;  1CJ5 A;  3ELX A;  4KT5 A;  3OBL A;  3CBC A;  1X8O A;  1OBP A;  4XME A;  3AAE A;  3FW5 A;  3OJY C;  1VYF A;  1E54 A;  3SYB A;  1SMP I;  4GNW A;  1YS5 A;  1Z24 A;  3POR A;  4WBK A;  4FRT A;  1U0X A;  1MPF A;  2FGQ X;  3LK4 1;  2KD2 A;  1YWD A;  3KFH A;  3VG5 A;  4FOZ A;  4EQA C;  3D4R A;  4YMY A;  3CMP A;  5FFH A;  2BHV A;  4BUM X;  1ZND A;  2JU7 A;  2R74 A;  2WEW A;  4ZH9 A;  2OVA A;  5D4A A;  3CWK A;  4I3D A;  5AQ6 A;  1B56 A;  5JDP A;  1I4U A;  1OPB A;  5FQ6 E;  2N2M A;  2MHL A;  4U3Q A;  1B0O A;  4Y0P A;  4YKO A;  4MVE A;  4QAE A;  2HZR A;  1T8V A;  5D45 A;  1THQ A;  3K19 A;  1SA8 A;  1IFB A;  4IMO A;  2L9C A;  4ZFX A;  4Y0S A;  3AA1 B;  3HWB A;  3P6H A;  3KVD D;  2M07 A;  3HOL A;  3E3C A;  5EPQ A;  2ACP X;  1HMT A;  1PEE A;  3DSZ A;  1CBQ A;  5DL8 A;  4F4B A;  4FBO A;  4ML7 B;  4AZN A;  1FDQ A;  4KRA A;  1B8E A;  4ORX A;  1GFM A;  1XCA A;  1YIV A;  3C77 X;  2YG2 A;  3PED A;  1EQD A;  5D47 A;  1U18 A;  1PHO A;  3APX A;  4AYN A;  5DG4 A;  1IZN A;  3VG3 A;  1EPB A;  2G7B A;  4IB6 A;  1TW4 A;  2Z4I A;  4ALO A;  3SZV A;  4E1S A;  5HA1 A;  1BH3 A;  3ZW1 A;  2XKL A;  1X8N A;  4GHB A;  1YUP A;  2FR2 A;  2WEX A;  1BSO A;  4YGG A;  1T0V A;  3BU1 A;  5GV0 A;  1DZM A;  2ZAI A;  2XG6 A;  2QMI A;  4BQU A;  5K06 A;  1IKE A;  1CBS A;  3NPO A;  1ZHX A;  2NND A;  1E06 A;  1KZW A;  4GCP A;  4O4S A;  3WOV A;  4HPC A;  5LJE A;  5DL5 A;  3NAD A;  4LSF A;  2XST A;  4A60 A;  3HWE A;  1BM5 A;  1BJ7 A;  4ES7 A;  3N91 A;  2AKQ A;  2JW1 A;  2Q9S A;  4IB8 A;  4ZGF A;  3VZT X;  4C69 X;  3TZG A;  5HZQ A;  1BSQ A;  3LV4 A;  4LKP A;  4LZV A;  3AA0 B;  1KXO A;  2QO5 A;  5F58 A;  5LJC A;  1TVQ A;  4KC7 A;  4N59 A;  5ADX L;  4AKR A;  3LK3 B;  4ARH A;  2FRS A;  2M4L A;  4EEJ A;  1URE A;  4AZO A;  4M6S A;  3STM X;  4UU2 A;  2F1T A;  3FEL A;  3HWG A;  4HPA A;  3A2S X;  3VE2 A;  4HWM A;  5D5D A;  2QTK A;  2LB6 A;  3EM0 A;  3POU A;  2FTB A;  3H3I A;  3FA9 A;  2ANS A;  3FA7 A;  2BLG A;  3OE3 A;  1BXW A;  2KXP B;  4AZQ A;  4Y0R A;  1OPF A;  4MVI A;  4AZM A;  2QOS C;  3BRN A;  3PH5 A;  2Y0H A;  2AT0 X;  2F1V A;  3WI4 A;  1T68 X;  3P02 A;  4ID2 A;  5H8T A;  2ZLD A;  1KOI A;  2AT3 X;  3PH6 A;  2XE3 A;  3JQO A;  5L8I A;  2LHF A;  1ZNL A;  5DL6 A;  2POR A;  4U8U N;  4TKJ A;  5HTD A;  1LPJ A;  1LID A;  2A0A A;  2OFM X;  2QO6 A;  3EYC A;  4ODD A;  4FES A;  2DM5 A;  4GCS A;  4AKM A;  1ZNE A;  3ZW0 B;  1O1U A;  5B27 A;  3RSW A;  5FQ8 E;  3UEU A;  3S60 A;  5IO7 A;  4O3W A;  3SY9 A;  3NP1 A;  3VG2 A;  5LJH A;  3PEC A;  2OVE A;  4TQ2 A;  2HMB A;  1GX8 A;  5H9L A;  4O3X B;  4GF4 A;  3ZI8 A;  3EBK A;  2K4T A;  3AA7 A;  1CBI A;  5HTE A;  3BLG A;  2CBS A;  2LKK A;  4FBV A;  4O49 A;  1LF7 A;  4TNN A;  3AKM A;  3NX2 A;  5HZ9 A;  1B4M A;  4XNK A;  1X89 A;  4TJZ A;  3FEP A;  4N7D A;  1P4T A;  2Y7S A;  2J1N A;  4BOE A;  3HW9 A;  1GFO A;  1OEK A;  2R73 A;  5AJB A;  2AL0 X;  4ZJ0 A;  1KT6 A;  3ZUO A;  4CSB A;  1GT4 A;  2M06 A;  1QQS A;  2YPV A;  1SXU A;  1DFV A;  1ACD A;  1YWC A;  4FUV A;  1BLR A;  3G7G A;  2J4U P;  1FE3 A;  5DPQ A;  3APU A;  4TKB A;  2L68 A;  3BY0 A;  1OEJ A;  1HBP A;  3S5V A;  2ODJ A;  2W2A A;  4YFR A;  4ZHH A;  5D8J A;  4YGH A;  1BRP A;  5HA0 A;  4GKC A;  4I3B A;  4NP1 A;  5LJD A;  3ZQ3 A;  1LIE A;  5HCC C;  2XTQ A;  3VG6 A;  2A13 A;  3TGC A;  1ZHT A;  4QGW A;  4YBP A;  2Y2X A;  1QJ9 A;  2MWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...