4O4UA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
513
structure length
505
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTYLNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDIKKMVAVACCSNLEYMKFGQLWQQTQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLDPGRHDNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
molecule keywords TbpB
total genus 116
structure length 505
sequence length 513
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA02
2W80C 3KVDD 4QQ1A 4O4XA 3HOLA 4AYDC 5T5FA 1YS5A 3PQUA 3HOEA 2YPVA 2KDYA 3VE2A 4O3XB 4O3ZA 4O3YA 3V8UA 4Z3TA 2W81C 3PQSA 5EE2A 3VE1A 4AYNA 2KC0A 4U9CA 2Y7SA 3UAQA 4O3WA 2LFUA 4AYMC 4AYID 4AYEC 4O49A 4O4UA
chains in the Genus database with same CATH superfamily
1Q9GA 1JYDA 3UEXA 4FUVA 1I4UA 2AT3X 4RL9A 2QO5A 2LBAA 5L8OA 5G3AA 2OFAA 4HPBA 1SWSA 3V8UA 5F6BA 4IRWA 2L5PA 2MJIA 1E2TA 4LSHA 1VYOA 3B2LA 3F8AA 1RXHA 4I9SA 3WJGA 4BUMX 2C4IA 5FENA 4ZHCA 1TW4A 5H9KA 1YWAA 4O3XB 5CHKA 5DG4A 2N2MA 4QNIA 1NQNA 4KC8A 4K3BA 3EBKA 3C78X 4YBUA 4NV7A 1QJPA 2FGQX 3T0SA 4QGVA 2W2FA 4FSPA 3BDRA 1G7NA 3BX8A 3PORA 1D3SA 3FW4A 2AT5X 3FA7A 3SYBA 4Z2PA 4AYEC 5HTDA 2X56A 1QFTA 3ZW2A 2JW1A 3SLTA 3EW2A 3Q34A 4Y5DA 1B8EA 2QTKA 2Q39A 1SWAA 2FT9A 3SLJA 4ALOA 1FENA 4NYQA 1FDQA 2RTNB 2RD7C 5B2AO 7PRNA 4JCHA 1VWJB 2AF5A 2Y3FA 4ZH6A 1BT9A 1ZNGA 3BX7A 5C0NA 3AAEA 2RTIB 5HZ5A 1RSTB 1GFNA 4FSOA 1LCZA 3JQOA 5HCCC 3RY1A 4YGGA 4KCAA 1HMRA 1MK5A 4I95A 1D2UA 1OBPA 1SWUA 2BS6A 3EC5A 3BRZA 2GE4A 2ZAIA 3DWOX 3ZW1B 5FQ6E 2RTKA 2R4LA 3APUA 5B29A 3F9DA 1YWBA 2IWVA 4GF4A 3RSWA 3T20A 2X46A 2PI3O 3NX1A 5GTHO 3VHHA 4U46A 2HMBA 5FFHA 1O1UA 1LUQA 5D48A 1GKAB 3VG4A 2JGSA 1ERXA 4TQ2A 3D9WA 2Y7SA 4Y0QA 3KFGA 1BJ7A 2I5ZO 1LIDA 4Z2OA 1JQPA 4HPAA 1LDQA 2R74A 3HPEA 1GX8A 1LDOA 1ZHTA 5HTEA 3WXQA 2CBSA 1STRB 5L3YA 1S44A 4CSBA 1SWRA 4GKCA 2XE2A 3TZSA 3AKMA 4OS3A 1DC9A 2LFUA 3VG2A 4N7CA 5ADXK 4UU3A 4HFOA 1SWOA 5HWZA 4ZGUA 3KVDD 1QG5A 4RJWA 5DL7A 2PY1A 1S5LO 3OBLA 3PECA 4FRXA 1VWFB 2JU7A 4IB6A 1IJ8A 4QZUA 8PRNA 4AKRA 4LQZA 2LA7A 2IZBA 3AA7A 3UPGA 1E02A 3BLGA 5AQ6A 2R4PA 5B66O 2X27X 3SZHA 1I78A 1ACDA 5LJHA 3MBTA 1SRFA 4MVIA 4B61A 4KC7A 4BQUA 5D5DA 2A13A 1NP1A 3MX7A 5F2BA 2N93A 4O4OA 4ORXA 1PTSA 4CDFA 3MVFA 4I60A 4ORUA 2JMMA 4NW4A 1YS5A 1PBOA 4YFPA 4Y0RA 1HXZA 1CBQA 4GH7A 1SRGA 1KZWA 5B5EO 1P4TA 5JR8A 3D97A 5HCDC 4D5UA 4IB8A 2XMXA 3EBWA 1U0XA 4BX6B 1SREA 1NDJA 3QQ2A 1YIVA 2G7BA 1JZUA 4CDCA 3FMZA 1CJ5A 4O49A 5CYBA 4M7MA 5E79O 2RTMA 2ZAGA 4L3RA 2OF9A 1KT6A 4Y0SA 2R73A 1BBPA 3CBCA 3FA8A 3VGWA 2R89A 1ZNLA 1RXKA 1SWLA 1SWCA 2NNEA 1GFOA 3RDSA 1NP4A 5CE4A 5LJEA 4YFQA 2FTBA 1SY3A 2WEXA 3U03A 1ZNEA 2F09A 3I0AA 4D64A 2A2GA 1E06A 3DSZA 2AVIA 4AZPA 3TZGA 3POUA 4L1NA 1FE3A 1JV4A 2OY7A 1X71A 2QMIA 2KZ7B 2K4TA 4QGXA 2X8SA 1KFFA 5ADXL 1WBIA 1JMXA 3CR6A 4YKOA 1GXAA 4PUXA 1ZNKA 1X8UA 1O1VA 4DQ3A 4BOEA 4QAEA 3UEVA 2J1NA 2GC9A 4AYID 3VG5A 1VWCB 1LKEA 5B3MO 2JU3A 2FHNX 3P02A 2WEWA 4YGZA 1IKJA 4A8ZA 1T68X 2FHLA 2OFBA 3HWEA 3BY0A 1SWPA 3MG5A 1DZPA 5AFUL 2LHFA 3RY2A 3RDQA 1L6MA 3FR2A 3PGSA 3PQSA 3AA1A 1LELA 3AKNA 4TLJA 3RDOA 1A18A 4UB6O 4O4XA 3WYPA 3NQKA 2RTFB 1SLGB 2NNDA 3KVNA 5AJBA 4MVEA 2NP1A 2IZEB 2XE5A 1KL4A 4FESA 1UZ2X 3WU2O 1VWMB 4AYNA 1EIIA 1BH3A 4C4VB 1SY0A 1SXUA 1FJ1E 2Q2MA 1H6S1 4C5PA 4O4SA 4OELA 5L8IA 3ZQ3A 2W80C 4HPCA 3VHMA 3VZUX 2YPVA 1SWJA 3O0EA 3PDFA 1ADLA 3WZPA 2HZQA 5EDBA 2WQAE 2OL7A 1X89A 3HTYA 2L67A 4MVLA 1YP7A 4U3QA 1EPBA 2Y0KA 2L68A 2FR3A 5DL6A 2RCTA 3WZQA 3GP6A 1VWOB 2ALLX 3PH6A 1VWEB 1LFOA 2Q4NA 5H9LA 4YCEA 2Y32A 3AUMO 2OVDA 2RTCB 1DF3A 2MF6A 4N75A 4ID2A 2IZJA 2X4MA 3TGBA 3U9PC 1VWAB 2WR6A 4DNEA 1N7YA 2AMMX 3AEHA 1AELA 2OYBO 2Y0LA 4YGHA 3NR3A 3LK41 3POQA 1KT7A 1IFCA 2FGRA 2A5BA 2O62A 1MEPA 1MDCA 3UEUA 4K3CA 2F1VA 2MO5A 4PJ2A 4Z27A 1SWTA 1QJ8A 1GT1A 4ORYA 2A5CA 4INNA 4CV7A 3VZWX 1CBRA 3FW5A 1O8VA 3HWFA 3KQ0A 2VFBA 1HMTA 1X8QA 2R56A 4RUUA 3QRCA 3HWGA 5H8TA 3RZYA 3JCUO 4WHIA 1PEEA 1A3YA 4I3CA 4RLBA 3CWKA 4O4UA 2E4JA 3VU1A 3JTYA 4GK9A 5B5GA 4XMHA 4JHQA 4JNJA 1SRIA 3RBYA 5H9NA 2Q9SA 3P6CA 1VWLB 3VG3A 1SLFB 3P24A 4OMWA 4YVBA 1BM5A 1AB0A 1K3BA 5LJKA 2X8FA 3AA6A 3T6FA 4ZR2A 4U9CA 2A0AA 4ZHDA 4LSIA 2BT9A 3FEKA 2X34A 4Z6JA 1CRBA 1SWKA 2KDYA 4WBKA 3PK2A 1SXYA 4YFRA 3NBXX 4FZMA 3D4RA 2JMBA 1IW2A 3GE2A 2Y0HA 1OSMA 2P8GA 5F1EA 4GCSA 1MX7A 1VWHB 3VHIA 1OEEA 2IFBA 2DM5A 4OMXA 1HBPA 4ORWA 2A8GA 1Y9TA 2WJRA 1OBQA 1G74A 1FEMA 3FDCA 3CQRA 2FKGA 2W2AA 1STSB 4ODDA 3VY8X 2GH7A 3WBGA 1IIUA 3LHNA 4MIRA 2CBRA 4GRJA 5HZ8A 2AT6X 3STMX 4ZHHA 1S2PA 1JJJA 2O4VA 5FQ7E 3WJFA 3WZNA 2A3FX 2POAA 3TF6A 5HZ9A 1B4MA 1PHOA 4FBOA 4QGWA 1KXOA 2KXPB 4AYMC 3ZW0A 3I17A 2R8AA 5B11O 2OZQA 1MVGA 1SRHA 3CKFA 4G76A 3OJYC 5DPQA 1T16A 3WI4A 2R4NA 2KTSA 4BX5A 1GFPA 1GX9A 5HA1A 4FRTA 2OVEA 3KZAA 2JQYA 3E3CA 3RKGA 4Z28A 2ANSA 4GU8A 1MX8A 5IO6A 1GT5A 4D6BA 2YMSA 4QRLA 3FR4A 3WOVA 5DL8A 4PJ0O 2UYWA 2RN4A 3X00A 1YWCA 3QRAA 4OKAA 2X32A 2Y3EA 4LZUA 3Q6LA 3NQ3A 5HAEA 4N74A 5T5FA 3GAQA 1AVEA 3EMNX 1KGLA 2M4LA 4NLIA 5H2FO 4FOZA 3FLLA 3C77X 1RAVA 2WSJA 4GE1A 4C4VA 3NSGA 3O19A 3KFHA 4BX5B 3VPJE 2VFCA 1VWBB 4OS8A 1ICNA 4KIIA 4BBOA 2AT8X 4FZLA 4FQBB 1FTPA 4O3ZA 2FWVA 1ML7A 4BX7A 3G7GA 1ORMA 3WVMA 1E00A 4ES7A 2C1SA 3UU2A 3FYFA 4AW8A 1W6FA 1ZHZA 2JU8A 5G39A 1BLRA 2OL8O 2GTLO 4YMYA 2RTJA 3JSQA 3BRYA 4OS0A 1NBXA 1T1LA 5EE2A 1UREA 4G75A 1N9MA 3B2HA 4NNSA 2K0LA 4AZOA 1EXSA 2RQ0A 5AFUK 4UU2A 1N43A 3CQNA 1LCWA 1T0VA 1UYNX 1G5WA 2CZUA 2KZ7A 1I9HA 3CBSA 3A0HO 2Z4HA 2AL0X 3WYQA 1KQXA 2X8TA 5D4AA 3S5XA 4TNNA 3P6FA 3ELXA 4GUZA 1QY1A 3PGUA 2FLJA 2OY1O 3WJEA 1MM4A 2WWPA 5HBSA 3BS0A 1QY2A 2G8CO 3SZJA 4B55A 4GHBA 3FIQA 1GM6A 3STNA 4K19A 4O9SA 2LBVA 2ZSCA 1OSPO 1IZNB 1KL3A 2GTFX 5CSEA 4CDEA 4XMGA 1SXXA 3B2KA 1I05A 3TGCA 3AAAA 1PMPA 2X55A 4RLCA 4FT6A 1ZNDA 4IB9A 2XG6A 3L4RA 2CZTA 5KAIO 3SZDA 1OPAA 1YP6A 4O3YA 2M07A 5B27A 3T2WA 1SLEB 4TKJA 2KTDA 3P6HA 5DL5A 1P6PA 3T2XA 3UAQA 2QCBA 5FQ8E 4FQEA 5L8NA 3EMMA 4GETA 3P6EA 2G5LA 3STKA 2F1CX 1ZHYA 3PF1A 2IZDB 4HWMA 3PEDA 1HQQA 1JJUA 3S5VA 4FBRA 3RE6A 2RTDB 5D45A 2CM9A 4FGIB 3ZW0B 2ERVA 3H3IA 4ALBA 5D8JA 3FENA 1THQA 5BVTA 4QZTA 2EU7X 5IRWA 2AT0X 1BRPA 1HMSA 3SLOA 3SY9A 2XKLA 5PRNA 1ERBA 1TOWA 2W2BA 4IAXA 1RBPA 3RDMA 1A57A 2DJGA 4ZCBA 3ZUIA 1BWYA 3KZIO 3NADA 3C5OA 2A2UA 4AZNA 3HOLA 2AH7X 1GFMA 2KT4B 5B10O 4Y59A 4YH0A 2OFMX 2XE3A 4N58A 1Y52X 2UZ2A 3VG6A 4IABA 1SWHA 3AA7B 1HXXA 5HA0A 3RDUA 1DFVA 5AJCA 1EPAA 1RLBE 2OF8A 1NC9A 2ASNX 2OL6O 1Z24A 1EUOA 1HXTA 1EW3A 1GFQA 1X8PA 2JOZA 3NP1A 2IZFB 2IZHB 4AKMA 5KHPA 2M06A 2GJ5A 1VWQB 3JS1A 3AAAB 4EQAC 2IZKA 4AZQA 1U17A 4ZHFA 4EEJA 4GGZA 4YCHA 1HXUA 3IA8A 3KFIA 4QYNA 3OE3A 1W5RA 4F4BA 3BU9A 4GCPA 3SYSA 1W4TA 1OBUA 1K24A 4LKTA 4AZMA 3O22A 4QYPA 1GKAA 1ZHXA 2RA6A 1VWNB 3RWXA 3RBHA 4ORRA 5G26A 4N7DA 3UEWA 3LK42 4JFBA 5LJBA 4BGFA 2KXPA 2CM4A 1GT3A 5EZ2A 3PQUA 4BVMA 3S60A 1HY2A 4GNWA 3FYXA 4ZGFA 5HZ6A 1VYFA 2JN3A 4DCBA 2FKJA 1SWQA 1VWDB 3B2IA 1KQWA 3G7XA 2YNKA 1EI5A 3NPOA 1HQPA 4YDBA 2G79A 2WQ9A 1DZMA 3APWA 4EDEA 1LIEA 1QQSA 1JBHA 2F73A 1ZNHA 4ZJ0A 1VWPB 3T24A 3FR5A 1ICMA 2OY8A 1NQMA 2BSZA 2K23A 2XTQA 1IZNA 4CPFA 2FGSA 2WVPA 4WFUA 4A60A 4Z2VA 5IRUA 4LSEA 1JYJA 1E54A 3VZTX 4JGLA 2FR2A 1KT4A 2RTEB 5LKEA 2OVAA 2Z4IA 1JMZA 4O3WA 2BS5A 3FELA 1LICA 2OFRX 4GJSA 1Q9FA 1XKIA 3LK3B 1VPRA 2I5VO 2RTHB 1HN2A 3TGAA 5H9AA 4NP1A 1UYOX 1HBQA 1EALA 4U8UM 2MHDA 4IMNA 5F58A 1Y53X 4WFVA 5KIDA 3OD9A 4GGRA 5FAZA 1BSYA 3RDXA 4HPDA 1BEBA 1MM9A 4XMDA 2LFOA 4A1HA 5K06A 1SXWA 4YBPA 4FMSA 1SA8A 5IYUA 2BLGA 5EPQA 4TKBA 1OPBA 4CTDA 3VG7A 1KOIA 1B0OA 1SRJA 5KAFO 2YG2A 4AUIA 2X9KA 3FA6A 2ACPX 1U18A 2NNQA 4MISA 3NX2A 4C00A 1GGLA 5LJCA 3EYCA 2BC3A 4KRAA 3LK2B 1G85A 4TKHA 3LV4A 5D47A 3VE2A 4AKRB 2R4OA 2ACOA 2ODJA 3CMPA 1FELA 5B5FA 1MUPA 3KFFA 3SZVA 1E5PA 4IMOA 1A2DA 4E1SA 3BU1A 3FA9A 5LJDA 1BSQA 2QO6A 1AVGI 2WPUA 1SLDB 1JIWI 3D95A 3SAOA 5IXGA 3PH5A 3P6GA 3MM0A 4CPHA 3N91A 3SZIA 1QJ9A 3NQ9A 4AZLA 1SWFA 3PRNA 3P6DA 4FZNA 4R0BA 1SWEA 5EEDA 2RTOB 4GDAA 1IFBA 3F6ZB 2VDFA 4MEEA 4XMCA 3WJCA 5IO7A 1VYGA 2QO4A 1KZXA 1ZHWA 2WUTA 6PRNA 5BVSA 2L9CA 4EFGA 2LKKA 4ZH9A 1OPFA 4QQ1A 3WI5A 2J4UP 4E1TA 3ZW1A 2ZLDA 4BX7B 1N9YA 2K62A 2FS7A 2IZLB 2QM9A 4I6SA 4CPEA 3FEPA 3DA4A 1XCAA 2FRSA 2ZFGA 2WJQA 1KT3A 4ON1A 3HK1A 5K68A 4COTA 1X8OA 2OY5O 4ML7B 1N0SA 1S7DA 2HYSA 2RTGB 2PRNA 1N4JA 1PM1X 1PBYA 4A1YA 2F1TA 1IKEA 1RSUB 3DTQA 3EM0A 1OEJA 3VY9X 3RE5A 2C1QA 2R88A 3ZUOA 4D6AA 2Q2PA 1VWIB 2IZCB 2MHLA 2RTAA 4KH8A 1KT5A 1EQDA 4UB8O 4XMFA 4KT5A 3BSZE 1QABE 5BVQA 3HOEA 4YDAA 5HZQA 2AKQA 2LB6A 3K3LA 4NV8A 1Y55X 4AFKA 2G78A 1VWGB 1SWGA 4Y0PA 4PR7A 1DZKA 2IZAA 1BRQA 4BX6A 1VWRB 4GJVA 1SY1A 1BSOA 1MPFA 4CDDA 4XNKA 1SWBA 4ZHGA 4KR8A 1CBIA 4NNTA 1MM5A 2DJFA 2OVSA 1I06A 1KL5A 1WUBA 4YKMA 2HZRA 5HCEC 5GTIO 1QY0A 5K67A 3BRNA 4IL6O 4PSQA 1ZRYA 1PRNA 3ZWEA 4FBVA 3ZI8A 3SOTA 5G38A 4IBAA 3AA1B 4IB7A 1GX3A 3B2JA 1DF8A 3NJTA 3SY7A 1I04A 3DWNA 1G90A 3EW1A 1LIBA 1EIOA 3LK2A 1JJXA 4AZRA 4CK4A 1B56A 4GDZA 3K19A 4GZVA 2RTQB 5KICA 5TISO 4KR4A 4I9RA 5JD2A 1MOYA 3APVA 3T6LA 5IRAA 4TJZA 2OMFA 4I3BA 1BXWA 2RTRB 2X45A 2GTLN 5BYPA 3A2SX 5JDPA 2CAMA 4M6SA 3VE1A 4GCQA 2IZGB 4U8UN 1T8VA 3PP6A 2IZIA 4ZFXA 3BS2A 1AVDA 1LF7A 1NGLA 1Y0GA 3ZZVA 4GD9A 1GT4A 3POXA 4RUNA 5FVNA 1CBSA 3WJDA 3ELZA 2HNXA 4LKPA 5AEOA 1QWDA 1RXJA 2XTRA 4ARHA 2RTLA 1LIFA 1YUPA 4GNYA 3PGRA 4OEMA 3LTWA 4BJ8A 1TVQA 2KC0A 3HWDA 4LSFA 2MM3A 1ALBA 2QOSC 5GV0A 3DZMA 3CKGA 4JO6A 2XSTA 1H91A 5EDCA 4NYRA 2RCQA 3A0BO 1R0UA 3HWBA 3S26A 3AA0B 2HLVA 1SWDA 5F6ZA 2N2LA 3FIDA 3APXA 3AA6B 2BHVA 5LJGA 2MWHA 2KD2A 3IFBA 1DV9A 1LNMA 4I3DA 4Z3TA 2KW1A 5IO5A 4IAWA 4N59A 4RJXA 3WJBA 1Y9LA 2FS6A 4GGTA 3PPTA 1SMPI 4BCSA 1X8NA 1TXLA 4EKVA 3D96A 1LCVA 1SWNA 4MVKA 4XMEA 1AQBA 2F01A 4EXZA 3LK3A 1QFVA 4CPIA 4CPHB 1HXLA 1STPA 4AYDC 3AA0A 4D65A 2QOMA 2AXTO 2HKDA 1TOUA 4ORSA 2W81C 4NLJA 2Y2XA 4XNLA 3AAEB 5F7GA 1VWKB 4C69X 2IWWA 1LPJA 3O2YA 3DA3A 2GTLM 5LKFA 2PORA 5EEEA 3WZOA 2RTBB 1SY2A 1DZJA 4AYHA 4DQ4A 3C76X 3T1DA 4LZVA 2XE1A 1YWDA 3HW9A 3U0DA 2MNHA 3QKGA 2RTPB 4U8UO 1OEKA
chains in the Genus database with same CATH topology
2X8TA 3PRNA 1A18A 5D4AA 1Q9GA 3P6DA 4FZNA 3S5XA 1JYDA 3UEXA 4FUVA 1I4UA 4O4XA 2AT3X 4TNNA 3NQKA 4RL9A 2QO5A 2NNDA 4R0BA 5EEDA 5AJBA 2LBAA 5L8OA 1IFBA 3P6FA 4MVEA 2NP1A 3ELXA 1QY1A 4HPBA 2XE5A 2FLJA 3F6ZB 3V8UA 5F6BA 1UZ2X 4FESA 3WJEA 2L5PA 4XMCA 1MM4A 3WJCA 5IO7A 2MJIA 4LSHA 4AYNA 1VYGA 1EIIA 2QO4A 1KZXA 2WWPA 1ZHWA 3B2LA 1BH3A 1SY0A 3F8AA 1SXUA 2Q2MA 5HBSA 2WUTA 1H6S1 1QY2A 5BVSA 6PRNA 2L9CA 4I9SA 3WJGA 4EFGA 4BUMX 2LKKA 4O4SA 5L8IA 3ZQ3A 2W80C 4HPCA 4ZH9A 4QQ1A 5FENA 4ZHCA 1OPFA 3WI5A 4GHBA 2J4UP 1TW4A 3FIQA 3VZUX 2YPVA 5H9KA 1YWAA 1GM6A 3O0EA 3ZW1A 4E1TA 4N59A 3STNA 4K19A 4O9SA 4O3XB 2ZLDA 1ADLA 2LBVA 1IZNB 5DG4A 2GTFX 2HZQA 5EDBA 4XMGA 4QNIA 2N2MA 2WQAE 4KC8A 2K62A 3EBKA 1SXXA 1X89A 3B2KA 3HTYA 1I05A 2FS7A 2L67A 3C78X 4MVLA 1YP7A 3TGCA 4YBUA 4U3QA 1EPBA 1PMPA 2Y0KA 3AAAA 4RLCA 2L68A 2FR3A 2QM9A 1QJPA 4I6SA 2FGQX 2RCTA 4FT6A 5DL6A 3T0SA 1ZNDA 4QGVA 2W2FA 4IB9A 3FEPA 2XG6A 3DA4A 4FSPA 3L4RA 1XCAA 3GP6A 3BDRA 2CZTA 1G7NA 3BX8A 2ALLX 3PORA 3SZDA 2FRSA 1OPAA 3PH6A 1YP6A 1LFOA 1D3SA 2Q4NA 4O3YA 2M07A 5B27A 2ZFGA 1KT3A 4TKJA 5H9LA 2KTDA 3FW4A 2AT5X 3FA7A 4ON1A 3P6HA 5DL5A 4YCEA 3SYBA 3HK1A 1P6PA 3UAQA 2OVDA 4AYEC 5HTDA 3T20A 5FQ8E 5L8NA 3EMMA 1DF3A 4GETA 4COTA 1QFTA 3P6EA 1X8OA 4ML7B 1N0SA 1S7DA 3STKA 2HYSA 4ID2A 3ZW2A 2JW1A 2PRNA 1PM1X 3TGBA 1ZHYA 3U9PC 4A1YA 1B8EA 2QTKA 4HWMA 2Q39A 2WR6A 2F1TA 1IKEA 3PEDA 2FT9A 3DTQA 3EM0A 2AMMX 4ALOA 1AELA 1FENA 1OEJA 4NYQA 2Y0LA 1FDQA 3VY9X 3S5VA 4FBRA 4YGHA 3NR3A 5D45A 2CM9A 2RD7C 4FGIB 3ZW0B 2ERVA 3LK41 7PRNA 3H3IA 4ALBA 3ZUOA 4D6AA 2Q2PA 3POQA 5D8JA 3FENA 1KT7A 2MHLA 1THQA 1IFCA 5BVTA 4JCHA 4KH8A 1KT5A 4QZTA 2EU7X 4ZH6A 2FGRA 2O62A 1BT9A 1EQDA 1ZNGA 3BX7A 4KT5A 4XMFA 5C0NA 3AAEA 2AT0X 3BSZE 5HZ5A 1GFNA 1MDCA 3UEUA 1BRPA 1QABE 5BVQA 4FSOA 1HMSA 2F1VA 2MO5A 3HOEA 4YDAA 3SY9A 2XKLA 3JQOA 5HZQA 5HCCC 4PJ2A 2AKQA 2LB6A 3K3LA 1QJ8A 5PRNA 1GT1A 4YGGA 1ERBA 1TOWA 4ORYA 2W2BA 4IAXA 4KCAA 1HMRA 1RBPA 4INNA 4AFKA 4I95A 1A57A 1D2UA 1OBPA 2BS6A 2G78A 4ZCBA 3ZUIA 4CV7A 4Y0PA 1BWYA 3NADA 3C5OA 3VZWX 2A2UA 2GE4A 1DZKA 1BRQA 1CBRA 2ZAIA 3FW5A 5FQ6E 3ZW1B 4AZNA 1O8VA 3HOLA 3HWFA 1SY1A 3APUA 2AH7X 5B29A 3F9DA 1GFMA 1QJ9A 2KT4B 1BSOA 3KQ0A 1YWBA 4YH0A 4GF4A 3RSWA 2OFMX 2XE3A 1MPFA 4N58A 1HMTA 4RJXA 1X8QA 2R56A 2X46A 3NX1A 4ZHGA 4XNKA 4RUUA 3QRCA 2HMBA 5FFHA 1CBIA 1O1UA 4KR8A 5D48A 1GKAB 3VG6A 4NNTA 4IABA 3VG4A 1MM5A 3AA7B 1ERXA 1HXXA 2OVSA 3HWGA 1I06A 5H8TA 5HA0A 3RZYA 4TQ2A 2Y7SA 1DFVA 4WHIA 4Y0QA 1PEEA 3KFGA 5AJCA 1A3YA 1BJ7A 1EPAA 1LIDA 1RLBE 4I3CA 4RLBA 3CWKA 4O4UA 4YKMA 2E4JA 2HZRA 3VU1A 3JTYA 5HCEC 2ASNX 4GK9A 1Z24A 1EUOA 1QY0A 4HPAA 4XMHA 1EW3A 1GFQA 1HXTA 3RBYA 2R74A 5H9NA 1X8PA 2JOZA 2Q9SA 3BRNA 1GX8A 3NP1A 3P6CA 4PSQA 1ZHTA 3VG3A 5HTEA 1ZRYA 3P24A 3ZWEA 1PRNA 4OMWA 4FBVA 3ZI8A 3SOTA 3WXQA 4IBAA 1BM5A 2CBSA 4AKMA 1AB0A 3AA1B 5KHPA 5LJKA 4IB7A 2M06A 2X8FA 1S44A 4CSBA 3AA6A 2GJ5A 4GKCA 3B2JA 4ZR2A 2XE2A 4U9CA 2A0AA 3JS1A 4ZHDA 3TZSA 3AKMA 4LSIA 4OS3A 1DC9A 2LFUA 3VG2A 4N7CA 3AAAB 5ADXK 4UU3A 3SY7A 4EQAC 2BT9A 4HFOA 1I04A 5HWZA 4ZGUA 3KVDD 4AZQA 3FEKA 1QG5A 4RJWA 5DL7A 1G90A 3LK2A 1LIBA 1EIOA 4AZLA 1U17A 4ZHFA 1JJXA 1CRBA 4EEJA 4AZRA 2PY1A 2KDYA 4YCHA 1HXUA 4CK4A 4WBKA 1B56A 1SXYA 4YFRA 3NBXX 3OBLA 3IA8A 4GDZA 3KFIA 3K19A 4GZVA 4QYNA 4FZMA 3D4RA 2JMBA 3OE3A 1IW2A 3PECA 4FRXA 3GE2A 2Y0HA 1OSMA 5KICA 4KR4A 4F4BA 4I9RA 2JU7A 2P8GA 5F1EA 3BU9A 4IB6A 4GCPA 4GCSA 3APVA 4QZUA 1MX7A 3SYSA 8PRNA 1OBUA 4AKRA 4LQZA 4TJZA 4LKTA 2OMFA 4AZMA 4I3BA 1OEEA 2IFBA 3O22A 2LA7A 4QYPA 3AA7A 3UPGA 1GKAA 1BXWA 2DM5A 4OMXA 1ZHXA 1E02A 1HBPA 3BLGA 2RA6A 4ORWA 5AQ6A 3RWXA 2X45A 2GTLN 5BYPA 4ORRA 3RBHA 2X27X 1Y9TA 1OBQA 5G26A 4N7DA 3A2SX 1ACDA 5LJHA 1G74A 3UEWA 1FEMA 5JDPA 3MBTA 3LK42 4JFBA 4M6SA 3VE1A 4GCQA 3CQRA 5LJBA 2W2AA 4U8UN 4ODDA 4MVIA 4B61A 3VY8X 2KXPA 2CM4A 1T8VA 1GT3A 3PP6A 5EZ2A 3PQUA 4KC7A 3WBGA 4ZFXA 4BQUA 1IIUA 3LHNA 4BVMA 3BS2A 3S60A 4MIRA 5D5DA 4GNWA 2A13A 1LF7A 2CBRA 1NP1A 4GRJA 5HZ8A 2AT6X 1NGLA 3STMX 1VYFA 4ZGFA 4ZHHA 5HZ6A 2JN3A 3MX7A 1S2PA 1JJJA 3ZZVA 2O4VA 3B2IA 1GT4A 2N93A 1KQWA 3POXA 5FQ7E 3WJFA 3G7XA 4RUNA 4O4OA 2YNKA 1EI5A 2A3FX 2POAA 4ORXA 3TF6A 5HZ9A 1B4MA 3NPOA 1HQPA 4FBOA 4QGWA 2G79A 4YDBA 1PHOA 5FVNA 1KXOA 2WQ9A 3MVFA 1CBSA 2KXPB 1DZMA 3ZW0A 4AYMC 3WJDA 3APWA 4EDEA 3ELZA 3I17A 1LIEA 2HNXA 4LKPA 2OZQA 1QQSA 5AEOA 1QWDA 1JBHA 4ORUA 2JMMA 1MVGA 4NW4A 2XTRA 1YS5A 4G76A 4ARHA 3OJYC 1LIFA 1YUPA 1PBOA 5DPQA 2F73A 1ZNHA 4GNYA 4YFPA 4ZJ0A 4Y0RA 3WI4A 1CBQA 4GH7A 2KTSA 3T24A 1TVQA 3FR5A 1KZWA 2KC0A 1ICMA 3HWDA 4LSFA 1P4TA 5JR8A 1GFPA 3D97A 1GX9A 2MM3A 1ALBA 5HA1A 5HCDC 2OVEA 4FRTA 2QOSC 3KZAA 4IB8A 3E3CA 2K23A 3RKGA 2XMXA 4D5UA 5GV0A 1IZNA 2ANSA 2XTQA 4GU8A 1MX8A 4WFUA 5IO6A 3EBWA 1U0XA 4A60A 2XSTA 1GT5A 1H91A 5EDCA 4NYRA 4LSEA 4D6BA 1JYJA 2RCQA 1YIVA 1R0UA 2YMSA 2G7BA 4QRLA 1E54A 3FR4A 3WOVA 5DL8A 3VZTX 4JGLA 1JZUA 2FR2A 1KT4A 5LKEA 2RN4A 1YWCA 3FMZA 3HWBA 3S26A 2OVAA 1CJ5A 2Z4IA 3AA0B 3QRAA 4O3WA 2HLVA 2BS5A 3FELA 1LICA 2OFRX 4O49A 1Q9FA 1XKIA 5CYBA 4M7MA 5F6ZA 4LZUA 2N2LA 3LK3B 1VPRA 3NQ3A 3Q6LA 3APXA 3AA6B 5HAEA 2ZAGA 5T5FA 4L3RA 2BHVA 1KT6A 1HN2A 4Y0SA 3TGAA 3GAQA 5H9AA 5LJGA 2MWHA 4NP1A 2R73A 3EMNX 1BBPA 2KD2A 1KGLA 2M4LA 1HBQA 3IFBA 1EALA 3CBCA 4NLIA 3FA8A 4U8UM 2MHDA 4FOZA 3FLLA 1DV9A 1ZNLA 4IMNA 3C77X 2WSJA 4GE1A 5F58A 3NSGA 3O19A 1LNMA 3KFHA 4WFVA 4I3DA 3OD9A 5KIDA 4Z3TA 2KW1A 3VPJE 2NNEA 1GFOA 5FAZA 1BSYA 4OS8A 5IO5A 1ICNA 4HPDA 4IAWA 4KIIA 1NP4A 1BEBA 5CE4A 4XMDA 5LJEA 3WJBA 1Y9LA 4YFQA 2FTBA 2FS6A 2WEXA 1SY3A 2LFOA 4A1HA 5K06A 2AT8X 3PPTA 1SMPI 1SXWA 1ZNEA 2F09A 1X8NA 4YBPA 1SA8A 3U03A 3I0AA 4FMSA 2BLGA 4D64A 5IYUA 4FZLA 1TXLA 4FQBB 1FTPA 5EPQA 4O3ZA 4TKBA 1OPBA 2FWVA 1ML7A 3D96A 3VG7A 1KOIA 1B0OA 3G7GA 2A2GA 1ORMA 4MVKA 3WVMA 2YG2A 4XMEA 1E06A 1E00A 3DSZA 4ES7A 4AZPA 3UU2A 4AUIA 1AQBA 3FYFA 4AW8A 3FA6A 2ACPX 3TZGA 1U18A 3POUA 2NNQA 4L1NA 1FE3A 4MISA 1JV4A 3NX2A 1ZHZA 1GGLA 2JU8A 4EXZA 3LK3A 5LJCA 1X71A 2QMIA 1QFVA 3EYCA 4KRAA 3LK2B 1BLRA 1G85A 4TKHA 4AYDC 2GTLO 2KZ7B 3LV4A 4YMYA 3AA0A 4D65A 3JSQA 2K4TA 5D47A 4QGXA 2X8SA 4OS0A 3VE2A 4AKRB 5ADXL 2ACOA 1TOUA 3CR6A 4YKOA 3CMPA 4ORSA 2ODJA 1FELA 1GXAA 2W81C 4NLJA 2Y2XA 4PUXA 1ZNKA 1X8UA 4XNLA 3AAEB 5F7GA 5EE2A 1O1VA 1UREA 4DQ3A 1MUPA 4BOEA 4G75A 4C69X 3KFFA 4QAEA 3UEVA 2J1NA 1LPJA 3B2HA 2GC9A 3O2YA 4NNSA 2K0LA 3DA3A 2GTLM 5LKFA 4AZOA 2PORA 5EEEA 4AYID 1EXSA 3VG5A 2RQ0A 5AFUK 1SY2A 3SZVA 1LKEA 2JU3A 1E5PA 3CQNA 4UU2A 3P02A 2WEWA 1A2DA 4IMOA 4E1SA 4YGZA 1DZJA 3BU1A 1T0VA 1IKJA 3FA9A 5LJDA 4A8ZA 1G5WA 1BSQA 1T68X 2QO6A 1AVGI 4AYHA 4DQ4A 2CZUA 1JIWI 3D95A 3HWEA 3BY0A 3SAOA 3C76X 3T1DA 3PH5A 2KZ7A 4LZVA 3P6GA 1DZPA 3CBSA 5AFUL 2LHFA 2XE1A 1YWDA 3HW9A 1L6MA 3FR2A 3U0DA 3FYXA 2Z4HA 3N91A 3PQSA 2MNHA 2AL0X 3AA1A 3QKGA 4U8UO 1KQXA 3AKNA 4TLJA 1OEKA 3NQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W80 C;  3KVD D;  4QQ1 A;  4O4X A;  3HOL A;  4AYD C;  5T5F A;  1YS5 A;  3PQU A;  3HOE A;  2YPV A;  2KDY A;  3VE2 A;  4O3X B;  4O3Z A;  4O3Y A;  3V8U A;  4Z3T A;  2W81 C;  3PQS A;  5EE2 A;  3VE1 A;  4AYN A;  2KC0 A;  4U9C A;  2Y7S A;  3UAQ A;  4O3W A;  2LFU A;  4AYM C;  4AYI D;  4AYE C;  4O49 A;  4O4U A; 
#chains in the Genus database with same CATH topology
 1Q9G A;  1JYD A;  3UEX A;  4FUV A;  1I4U A;  2AT3 X;  4RL9 A;  2QO5 A;  2LBA A;  5L8O A;  5G3A A;  2OFA A;  4HPB A;  1SWS A;  3V8U A;  5F6B A;  4IRW A;  2L5P A;  2MJI A;  1E2T A;  4LSH A;  1VYO A;  3B2L A;  3F8A A;  1RXH A;  4I9S A;  3WJG A;  4BUM X;  2C4I A;  5FEN A;  4ZHC A;  1TW4 A;  5H9K A;  1YWA A;  4O3X B;  5CHK A;  5DG4 A;  2N2M A;  4QNI A;  1NQN A;  4KC8 A;  4K3B A;  3EBK A;  3C78 X;  4YBU A;  4NV7 A;  1QJP A;  2FGQ X;  3T0S A;  4QGV A;  2W2F A;  4FSP A;  3BDR A;  1G7N A;  3BX8 A;  3POR A;  1D3S A;  3FW4 A;  2AT5 X;  3FA7 A;  3SYB A;  4Z2P A;  4AYE C;  5HTD A;  2X56 A;  1QFT A;  3ZW2 A;  2JW1 A;  3SLT A;  3EW2 A;  3Q34 A;  4Y5D A;  1B8E A;  2QTK A;  2Q39 A;  1SWA A;  2FT9 A;  3SLJ A;  4ALO A;  1FEN A;  4NYQ A;  1FDQ A;  2RTN B;  2RD7 C;  5B2A O;  7PRN A;  4JCH A;  1VWJ B;  2AF5 A;  2Y3F A;  4ZH6 A;  1BT9 A;  1ZNG A;  3BX7 A;  5C0N A;  3AAE A;  2RTI B;  5HZ5 A;  1RST B;  1GFN A;  4FSO A;  1LCZ A;  3JQO A;  5HCC C;  3RY1 A;  4YGG A;  4KCA A;  1HMR A;  1MK5 A;  4I95 A;  1D2U A;  1OBP A;  1SWU A;  2BS6 A;  3EC5 A;  3BRZ A;  2GE4 A;  2ZAI A;  3DWO X;  3ZW1 B;  5FQ6 E;  2RTK A;  2R4L A;  3APU A;  5B29 A;  3F9D A;  1YWB A;  2IWV A;  4GF4 A;  3RSW A;  3T20 A;  2X46 A;  2PI3 O;  3NX1 A;  5GTH O;  3VHH A;  4U46 A;  2HMB A;  5FFH A;  1O1U A;  1LUQ A;  5D48 A;  1GKA B;  3VG4 A;  2JGS A;  1ERX A;  4TQ2 A;  3D9W A;  2Y7S A;  4Y0Q A;  3KFG A;  1BJ7 A;  2I5Z O;  1LID A;  4Z2O A;  1JQP A;  4HPA A;  1LDQ A;  2R74 A;  3HPE A;  1GX8 A;  1LDO A;  1ZHT A;  5HTE A;  3WXQ A;  2CBS A;  1STR B;  5L3Y A;  1S44 A;  4CSB A;  1SWR A;  4GKC A;  2XE2 A;  3TZS A;  3AKM A;  4OS3 A;  1DC9 A;  2LFU A;  3VG2 A;  4N7C A;  5ADX K;  4UU3 A;  4HFO A;  1SWO A;  5HWZ A;  4ZGU A;  3KVD D;  1QG5 A;  4RJW A;  5DL7 A;  2PY1 A;  1S5L O;  3OBL A;  3PEC A;  4FRX A;  1VWF B;  2JU7 A;  4IB6 A;  1IJ8 A;  4QZU A;  8PRN A;  4AKR A;  4LQZ A;  2LA7 A;  2IZB A;  3AA7 A;  3UPG A;  1E02 A;  3BLG A;  5AQ6 A;  2R4P A;  5B66 O;  2X27 X;  3SZH A;  1I78 A;  1ACD A;  5LJH A;  3MBT A;  1SRF A;  4MVI A;  4B61 A;  4KC7 A;  4BQU A;  5D5D A;  2A13 A;  1NP1 A;  3MX7 A;  5F2B A;  2N93 A;  4O4O A;  4ORX A;  1PTS A;  4CDF A;  3MVF A;  4I60 A;  4ORU A;  2JMM A;  4NW4 A;  1YS5 A;  1PBO A;  4YFP A;  4Y0R A;  1HXZ A;  1CBQ A;  4GH7 A;  1SRG A;  1KZW A;  5B5E O;  1P4T A;  5JR8 A;  3D97 A;  5HCD C;  4D5U A;  4IB8 A;  2XMX A;  3EBW A;  1U0X A;  4BX6 B;  1SRE A;  1NDJ A;  3QQ2 A;  1YIV A;  2G7B A;  1JZU A;  4CDC A;  3FMZ A;  1CJ5 A;  4O49 A;  5CYB A;  4M7M A;  5E79 O;  2RTM A;  2ZAG A;  4L3R A;  2OF9 A;  1KT6 A;  4Y0S A;  2R73 A;  1BBP A;  3CBC A;  3FA8 A;  3VGW A;  2R89 A;  1ZNL A;  1RXK A;  1SWL A;  1SWC A;  2NNE A;  1GFO A;  3RDS A;  1NP4 A;  5CE4 A;  5LJE A;  4YFQ A;  2FTB A;  1SY3 A;  2WEX A;  3U03 A;  1ZNE A;  2F09 A;  3I0A A;  4D64 A;  2A2G A;  1E06 A;  3DSZ A;  2AVI A;  4AZP A;  3TZG A;  3POU A;  4L1N A;  1FE3 A;  1JV4 A;  2OY7 A;  1X71 A;  2QMI A;  2KZ7 B;  2K4T A;  4QGX A;  2X8S A;  1KFF A;  5ADX L;  1WBI A;  1JMX A;  3CR6 A;  4YKO A;  1GXA A;  4PUX A;  1ZNK A;  1X8U A;  1O1V A;  4DQ3 A;  4BOE A;  4QAE A;  3UEV A;  2J1N A;  2GC9 A;  4AYI D;  3VG5 A;  1VWC B;  1LKE A;  5B3M O;  2JU3 A;  2FHN X;  3P02 A;  2WEW A;  4YGZ A;  1IKJ A;  4A8Z A;  1T68 X;  2FHL A;  2OFB A;  3HWE A;  3BY0 A;  1SWP A;  3MG5 A;  1DZP A;  5AFU L;  2LHF A;  3RY2 A;  3RDQ A;  1L6M A;  3FR2 A;  3PGS A;  3PQS A;  3AA1 A;  1LEL A;  3AKN A;  4TLJ A;  3RDO A;  1A18 A;  4UB6 O;  4O4X A;  3WYP A;  3NQK A;  2RTF B;  1SLG B;  2NND A;  3KVN A;  5AJB A;  4MVE A;  2NP1 A;  2IZE B;  2XE5 A;  1KL4 A;  4FES A;  1UZ2 X;  3WU2 O;  1VWM B;  4AYN A;  1EII A;  1BH3 A;  4C4V B;  1SY0 A;  1SXU A;  1FJ1 E;  2Q2M A;  1H6S 1;  4C5P A;  4O4S A;  4OEL A;  5L8I A;  3ZQ3 A;  2W80 C;  4HPC A;  3VHM A;  3VZU X;  2YPV A;  1SWJ A;  3O0E A;  3PDF A;  1ADL A;  3WZP A;  2HZQ A;  5EDB A;  2WQA E;  2OL7 A;  1X89 A;  3HTY A;  2L67 A;  4MVL A;  1YP7 A;  4U3Q A;  1EPB A;  2Y0K A;  2L68 A;  2FR3 A;  5DL6 A;  2RCT A;  3WZQ A;  3GP6 A;  1VWO B;  2ALL X;  3PH6 A;  1VWE B;  1LFO A;  2Q4N A;  5H9L A;  4YCE A;  2Y32 A;  3AUM O;  2OVD A;  2RTC B;  1DF3 A;  2MF6 A;  4N75 A;  4ID2 A;  2IZJ A;  2X4M A;  3TGB A;  3U9P C;  1VWA B;  2WR6 A;  4DNE A;  1N7Y A;  2AMM X;  3AEH A;  1AEL A;  2OYB O;  2Y0L A;  4YGH A;  3NR3 A;  3LK4 1;  3POQ A;  1KT7 A;  1IFC A;  2FGR A;  2A5B A;  2O62 A;  1MEP A;  1MDC A;  3UEU A;  4K3C A;  2F1V A;  2MO5 A;  4PJ2 A;  4Z27 A;  1SWT A;  1QJ8 A;  1GT1 A;  4ORY A;  2A5C A;  4INN A;  4CV7 A;  3VZW X;  1CBR A;  3FW5 A;  1O8V A;  3HWF A;  3KQ0 A;  2VFB A;  1HMT A;  1X8Q A;  2R56 A;  4RUU A;  3QRC A;  3HWG A;  5H8T A;  3RZY A;  3JCU O;  4WHI A;  1PEE A;  1A3Y A;  4I3C A;  4RLB A;  3CWK A;  4O4U A;  2E4J A;  3VU1 A;  3JTY A;  4GK9 A;  5B5G A;  4XMH A;  4JHQ A;  4JNJ A;  1SRI A;  3RBY A;  5H9N A;  2Q9S A;  3P6C A;  1VWL B;  3VG3 A;  1SLF B;  3P24 A;  4OMW A;  4YVB A;  1BM5 A;  1AB0 A;  1K3B A;  5LJK A;  2X8F A;  3AA6 A;  3T6F A;  4ZR2 A;  4U9C A;  2A0A A;  4ZHD A;  4LSI A;  2BT9 A;  3FEK A;  2X34 A;  4Z6J A;  1CRB A;  1SWK A;  2KDY A;  4WBK A;  3PK2 A;  1SXY A;  4YFR A;  3NBX X;  4FZM A;  3D4R A;  2JMB A;  1IW2 A;  3GE2 A;  2Y0H A;  1OSM A;  2P8G A;  5F1E A;  4GCS A;  1MX7 A;  1VWH B;  3VHI A;  1OEE A;  2IFB A;  2DM5 A;  4OMX A;  1HBP A;  4ORW A;  2A8G A;  1Y9T A;  2WJR A;  1OBQ A;  1G74 A;  1FEM A;  3FDC A;  3CQR A;  2FKG A;  2W2A A;  1STS B;  4ODD A;  3VY8 X;  2GH7 A;  3WBG A;  1IIU A;  3LHN A;  4MIR A;  2CBR A;  4GRJ A;  5HZ8 A;  2AT6 X;  3STM X;  4ZHH A;  1S2P A;  1JJJ A;  2O4V A;  5FQ7 E;  3WJF A;  3WZN A;  2A3F X;  2POA A;  3TF6 A;  5HZ9 A;  1B4M A;  1PHO A;  4FBO A;  4QGW A;  1KXO A;  2KXP B;  4AYM C;  3ZW0 A;  3I17 A;  2R8A A;  5B11 O;  2OZQ A;  1MVG A;  1SRH A;  3CKF A;  4G76 A;  3OJY C;  5DPQ A;  1T16 A;  3WI4 A;  2R4N A;  2KTS A;  4BX5 A;  1GFP A;  1GX9 A;  5HA1 A;  4FRT A;  2OVE A;  3KZA A;  2JQY A;  3E3C A;  3RKG A;  4Z28 A;  2ANS A;  4GU8 A;  1MX8 A;  5IO6 A;  1GT5 A;  4D6B A;  2YMS A;  4QRL A;  3FR4 A;  3WOV A;  5DL8 A;  4PJ0 O;  2UYW A;  2RN4 A;  3X00 A;  1YWC A;  3QRA A;  4OKA A;  2X32 A;  2Y3E A;  4LZU A;  3Q6L A;  3NQ3 A;  5HAE A;  4N74 A;  5T5F A;  3GAQ A;  1AVE A;  3EMN X;  1KGL A;  2M4L A;  4NLI A;  5H2F O;  4FOZ A;  3FLL A;  3C77 X;  1RAV A;  2WSJ A;  4GE1 A;  4C4V A;  3NSG A;  3O19 A;  3KFH A;  4BX5 B;  3VPJ E;  2VFC A;  1VWB B;  4OS8 A;  1ICN A;  4KII A;  4BBO A;  2AT8 X;  4FZL A;  4FQB B;  1FTP A;  4O3Z A;  2FWV A;  1ML7 A;  4BX7 A;  3G7G A;  1ORM A;  3WVM A;  1E00 A;  4ES7 A;  2C1S A;  3UU2 A;  3FYF A;  4AW8 A;  1W6F A;  1ZHZ A;  2JU8 A;  5G39 A;  1BLR A;  2OL8 O;  2GTL O;  4YMY A;  2RTJ A;  3JSQ A;  3BRY A;  4OS0 A;  1NBX A;  1T1L A;  5EE2 A;  1URE A;  4G75 A;  1N9M A;  3B2H A;  4NNS A;  2K0L A;  4AZO A;  1EXS A;  2RQ0 A;  5AFU K;  4UU2 A;  1N43 A;  3CQN A;  1LCW A;  1T0V A;  1UYN X;  1G5W A;  2CZU A;  2KZ7 A;  1I9H A;  3CBS A;  3A0H O;  2Z4H A;  2AL0 X;  3WYQ A;  1KQX A;  2X8T A;  5D4A A;  3S5X A;  4TNN A;  3P6F A;  3ELX A;  4GUZ A;  1QY1 A;  3PGU A;  2FLJ A;  2OY1 O;  3WJE A;  1MM4 A;  2WWP A;  5HBS A;  3BS0 A;  1QY2 A;  2G8C O;  3SZJ A;  4B55 A;  4GHB A;  3FIQ A;  1GM6 A;  3STN A;  4K19 A;  4O9S A;  2LBV A;  2ZSC A;  1OSP O;  1IZN B;  1KL3 A;  2GTF X;  5CSE A;  4CDE A;  4XMG A;  1SXX A;  3B2K A;  1I05 A;  3TGC A;  3AAA A;  1PMP A;  2X55 A;  4RLC A;  4FT6 A;  1ZND A;  4IB9 A;  2XG6 A;  3L4R A;  2CZT A;  5KAI O;  3SZD A;  1OPA A;  1YP6 A;  4O3Y A;  2M07 A;  5B27 A;  3T2W A;  1SLE B;  4TKJ A;  2KTD A;  3P6H A;  5DL5 A;  1P6P A;  3T2X A;  3UAQ A;  2QCB A;  5FQ8 E;  4FQE A;  5L8N A;  3EMM A;  4GET A;  3P6E A;  2G5L A;  3STK A;  2F1C X;  1ZHY A;  3PF1 A;  2IZD B;  4HWM A;  3PED A;  1HQQ A;  1JJU A;  3S5V A;  4FBR A;  3RE6 A;  2RTD B;  5D45 A;  2CM9 A;  4FGI B;  3ZW0 B;  2ERV A;  3H3I A;  4ALB A;  5D8J A;  3FEN A;  1THQ A;  5BVT A;  4QZT A;  2EU7 X;  5IRW A;  2AT0 X;  1BRP A;  1HMS A;  3SLO A;  3SY9 A;  2XKL A;  5PRN A;  1ERB A;  1TOW A;  2W2B A;  4IAX A;  1RBP A;  3RDM A;  1A57 A;  2DJG A;  4ZCB A;  3ZUI A;  1BWY A;  3KZI O;  3NAD A;  3C5O A;  2A2U A;  4AZN A;  3HOL A;  2AH7 X;  1GFM A;  2KT4 B;  5B10 O;  4Y59 A;  4YH0 A;  2OFM X;  2XE3 A;  4N58 A;  1Y52 X;  2UZ2 A;  3VG6 A;  4IAB A;  1SWH A;  3AA7 B;  1HXX A;  5HA0 A;  3RDU A;  1DFV A;  5AJC A;  1EPA A;  1RLB E;  2OF8 A;  1NC9 A;  2ASN X;  2OL6 O;  1Z24 A;  1EUO A;  1HXT A;  1EW3 A;  1GFQ A;  1X8P A;  2JOZ A;  3NP1 A;  2IZF B;  2IZH B;  4AKM A;  5KHP A;  2M06 A;  2GJ5 A;  1VWQ B;  3JS1 A;  3AAA B;  4EQA C;  2IZK A;  4AZQ A;  1U17 A;  4ZHF A;  4EEJ A;  4GGZ A;  4YCH A;  1HXU A;  3IA8 A;  3KFI A;  4QYN A;  3OE3 A;  1W5R A;  4F4B A;  3BU9 A;  4GCP A;  3SYS A;  1W4T A;  1OBU A;  1K24 A;  4LKT A;  4AZM A;  3O22 A;  4QYP A;  1GKA A;  1ZHX A;  2RA6 A;  1VWN B;  3RWX A;  3RBH A;  4ORR A;  5G26 A;  4N7D A;  3UEW A;  3LK4 2;  4JFB A;  5LJB A;  4BGF A;  2KXP A;  2CM4 A;  1GT3 A;  5EZ2 A;  3PQU A;  4BVM A;  3S60 A;  1HY2 A;  4GNW A;  3FYX A;  4ZGF A;  5HZ6 A;  1VYF A;  2JN3 A;  4DCB A;  2FKJ A;  1SWQ A;  1VWD B;  3B2I A;  1KQW A;  3G7X A;  2YNK A;  1EI5 A;  3NPO A;  1HQP A;  4YDB A;  2G79 A;  2WQ9 A;  1DZM A;  3APW A;  4EDE A;  1LIE A;  1QQS A;  1JBH A;  2F73 A;  1ZNH A;  4ZJ0 A;  1VWP B;  3T24 A;  3FR5 A;  1ICM A;  2OY8 A;  1NQM A;  2BSZ A;  2K23 A;  2XTQ A;  1IZN A;  4CPF A;  2FGS A;  2WVP A;  4WFU A;  4A60 A;  4Z2V A;  5IRU A;  4LSE A;  1JYJ A;  1E54 A;  3VZT X;  4JGL A;  2FR2 A;  1KT4 A;  2RTE B;  5LKE A;  2OVA A;  2Z4I A;  1JMZ A;  4O3W A;  2BS5 A;  3FEL A;  1LIC A;  2OFR X;  4GJS A;  1Q9F A;  1XKI A;  3LK3 B;  1VPR A;  2I5V O;  2RTH B;  1HN2 A;  3TGA A;  5H9A A;  4NP1 A;  1UYO X;  1HBQ A;  1EAL A;  4U8U M;  2MHD A;  4IMN A;  5F58 A;  1Y53 X;  4WFV A;  5KID A;  3OD9 A;  4GGR A;  5FAZ A;  1BSY A;  3RDX A;  4HPD A;  1BEB A;  1MM9 A;  4XMD A;  2LFO A;  4A1H A;  5K06 A;  1SXW A;  4YBP A;  4FMS A;  1SA8 A;  5IYU A;  2BLG A;  5EPQ A;  4TKB A;  1OPB A;  4CTD A;  3VG7 A;  1KOI A;  1B0O A;  1SRJ A;  5KAF O;  2YG2 A;  4AUI A;  2X9K A;  3FA6 A;  2ACP X;  1U18 A;  2NNQ A;  4MIS A;  3NX2 A;  4C00 A;  1GGL A;  5LJC A;  3EYC A;  2BC3 A;  4KRA A;  3LK2 B;  1G85 A;  4TKH A;  3LV4 A;  5D47 A;  3VE2 A;  4AKR B;  2R4O A;  2ACO A;  2ODJ A;  3CMP A;  1FEL A;  5B5F A;  1MUP A;  3KFF A;  3SZV A;  1E5P A;  4IMO A;  1A2D A;  4E1S A;  3BU1 A;  3FA9 A;  5LJD A;  1BSQ A;  2QO6 A;  1AVG I;  2WPU A;  1SLD B;  1JIW I;  3D95 A;  3SAO A;  5IXG A;  3PH5 A;  3P6G A;  3MM0 A;  4CPH A;  3N91 A;  3SZI A;  1QJ9 A;  3NQ9 A;  4AZL A;  1SWF A;  3PRN A;  3P6D A;  4FZN A;  4R0B A;  1SWE A;  5EED A;  2RTO B;  4GDA A;  1IFB A;  3F6Z B;  2VDF A;  4MEE A;  4XMC A;  3WJC A;  5IO7 A;  1VYG A;  2QO4 A;  1KZX A;  1ZHW A;  2WUT A;  6PRN A;  5BVS A;  2L9C A;  4EFG A;  2LKK A;  4ZH9 A;  1OPF A;  4QQ1 A;  3WI5 A;  2J4U P;  4E1T A;  3ZW1 A;  2ZLD A;  4BX7 B;  1N9Y A;  2K62 A;  2FS7 A;  2IZL B;  2QM9 A;  4I6S A;  4CPE A;  3FEP A;  3DA4 A;  1XCA A;  2FRS A;  2ZFG A;  2WJQ A;  1KT3 A;  4ON1 A;  3HK1 A;  5K68 A;  4COT A;  1X8O A;  2OY5 O;  4ML7 B;  1N0S A;  1S7D A;  2HYS A;  2RTG B;  2PRN A;  1N4J A;  1PM1 X;  1PBY A;  4A1Y A;  2F1T A;  1IKE A;  1RSU B;  3DTQ A;  3EM0 A;  1OEJ A;  3VY9 X;  3RE5 A;  2C1Q A;  2R88 A;  3ZUO A;  4D6A A;  2Q2P A;  1VWI B;  2IZC B;  2MHL A;  2RTA A;  4KH8 A;  1KT5 A;  1EQD A;  4UB8 O;  4XMF A;  4KT5 A;  3BSZ E;  1QAB E;  5BVQ A;  3HOE A;  4YDA A;  5HZQ A;  2AKQ A;  2LB6 A;  3K3L A;  4NV8 A;  1Y55 X;  4AFK A;  2G78 A;  1VWG B;  1SWG A;  4Y0P A;  4PR7 A;  1DZK A;  2IZA A;  1BRQ A;  4BX6 A;  1VWR B;  4GJV A;  1SY1 A;  1BSO A;  1MPF A;  4CDD A;  4XNK A;  1SWB A;  4ZHG A;  4KR8 A;  1CBI A;  4NNT A;  1MM5 A;  2DJF A;  2OVS A;  1I06 A;  1KL5 A;  1WUB A;  4YKM A;  2HZR A;  5HCE C;  5GTI O;  1QY0 A;  5K67 A;  3BRN A;  4IL6 O;  4PSQ A;  1ZRY A;  1PRN A;  3ZWE A;  4FBV A;  3ZI8 A;  3SOT A;  5G38 A;  4IBA A;  3AA1 B;  4IB7 A;  1GX3 A;  3B2J A;  1DF8 A;  3NJT A;  3SY7 A;  1I04 A;  3DWN A;  1G90 A;  3EW1 A;  1LIB A;  1EIO A;  3LK2 A;  1JJX A;  4AZR A;  4CK4 A;  1B56 A;  4GDZ A;  3K19 A;  4GZV A;  2RTQ B;  5KIC A;  5TIS O;  4KR4 A;  4I9R A;  5JD2 A;  1MOY A;  3APV A;  3T6L A;  5IRA A;  4TJZ A;  2OMF A;  4I3B A;  1BXW A;  2RTR B;  2X45 A;  2GTL N;  5BYP A;  3A2S X;  5JDP A;  2CAM A;  4M6S A;  3VE1 A;  4GCQ A;  2IZG B;  4U8U N;  1T8V A;  3PP6 A;  2IZI A;  4ZFX A;  3BS2 A;  1AVD A;  1LF7 A;  1NGL A;  1Y0G A;  3ZZV A;  4GD9 A;  1GT4 A;  3POX A;  4RUN A;  5FVN A;  1CBS A;  3WJD A;  3ELZ A;  2HNX A;  4LKP A;  5AEO A;  1QWD A;  1RXJ A;  2XTR A;  4ARH A;  2RTL A;  1LIF A;  1YUP A;  4GNY A;  3PGR A;  4OEM A;  3LTW A;  4BJ8 A;  1TVQ A;  2KC0 A;  3HWD A;  4LSF A;  2MM3 A;  1ALB A;  2QOS C;  5GV0 A;  3DZM A;  3CKG A;  4JO6 A;  2XST A;  1H91 A;  5EDC A;  4NYR A;  2RCQ A;  3A0B O;  1R0U A;  3HWB A;  3S26 A;  3AA0 B;  2HLV A;  1SWD A;  5F6Z A;  2N2L A;  3FID A;  3APX A;  3AA6 B;  2BHV A;  5LJG A;  2MWH A;  2KD2 A;  3IFB A;  1DV9 A;  1LNM A;  4I3D A;  4Z3T A;  2KW1 A;  5IO5 A;  4IAW A;  4N59 A;  4RJX A;  3WJB A;  1Y9L A;  2FS6 A;  4GGT A;  3PPT A;  1SMP I;  4BCS A;  1X8N A;  1TXL A;  4EKV A;  3D96 A;  1LCV A;  1SWN A;  4MVK A;  4XME A;  1AQB A;  2F01 A;  4EXZ A;  3LK3 A;  1QFV A;  4CPI A;  4CPH B;  1HXL A;  1STP A;  4AYD C;  3AA0 A;  4D65 A;  2QOM A;  2AXT O;  2HKD A;  1TOU A;  4ORS A;  2W81 C;  4NLJ A;  2Y2X A;  4XNL A;  3AAE B;  5F7G A;  1VWK B;  4C69 X;  2IWW A;  1LPJ A;  3O2Y A;  3DA3 A;  2GTL M;  5LKF A;  2POR A;  5EEE A;  3WZO A;  2RTB B;  1SY2 A;  1DZJ A;  4AYH A;  4DQ4 A;  3C76 X;  3T1D A;  4LZV A;  2XE1 A;  1YWD A;  3HW9 A;  3U0D A;  2MNH A;  3QKG A;  2RTP B;  4U8U O;  1OEK A; 
#chains in the Genus database with same CATH homology
 2X8T A;  3PRN A;  1A18 A;  5D4A A;  1Q9G A;  3P6D A;  4FZN A;  3S5X A;  1JYD A;  3UEX A;  4FUV A;  1I4U A;  4O4X A;  2AT3 X;  4TNN A;  3NQK A;  4RL9 A;  2QO5 A;  2NND A;  4R0B A;  5EED A;  5AJB A;  2LBA A;  5L8O A;  1IFB A;  3P6F A;  4MVE A;  2NP1 A;  3ELX A;  1QY1 A;  4HPB A;  2XE5 A;  2FLJ A;  3F6Z B;  3V8U A;  5F6B A;  1UZ2 X;  4FES A;  3WJE A;  2L5P A;  4XMC A;  1MM4 A;  3WJC A;  5IO7 A;  2MJI A;  4LSH A;  4AYN A;  1VYG A;  1EII A;  2QO4 A;  1KZX A;  2WWP A;  1ZHW A;  3B2L A;  1BH3 A;  1SY0 A;  3F8A A;  1SXU A;  2Q2M A;  5HBS A;  2WUT A;  1H6S 1;  1QY2 A;  5BVS A;  6PRN A;  2L9C A;  4I9S A;  3WJG A;  4EFG A;  4BUM X;  2LKK A;  4O4S A;  5L8I A;  3ZQ3 A;  2W80 C;  4HPC A;  4ZH9 A;  4QQ1 A;  5FEN A;  4ZHC A;  1OPF A;  3WI5 A;  4GHB A;  2J4U P;  1TW4 A;  3FIQ A;  3VZU X;  2YPV A;  5H9K A;  1YWA A;  1GM6 A;  3O0E A;  3ZW1 A;  4E1T A;  4N59 A;  3STN A;  4K19 A;  4O9S A;  4O3X B;  2ZLD A;  1ADL A;  2LBV A;  1IZN B;  5DG4 A;  2GTF X;  2HZQ A;  5EDB A;  4XMG A;  4QNI A;  2N2M A;  2WQA E;  4KC8 A;  2K62 A;  3EBK A;  1SXX A;  1X89 A;  3B2K A;  3HTY A;  1I05 A;  2FS7 A;  2L67 A;  3C78 X;  4MVL A;  1YP7 A;  3TGC A;  4YBU A;  4U3Q A;  1EPB A;  1PMP A;  2Y0K A;  3AAA A;  4RLC A;  2L68 A;  2FR3 A;  2QM9 A;  1QJP A;  4I6S A;  2FGQ X;  2RCT A;  4FT6 A;  5DL6 A;  3T0S A;  1ZND A;  4QGV A;  2W2F A;  4IB9 A;  3FEP A;  2XG6 A;  3DA4 A;  4FSP A;  3L4R A;  1XCA A;  3GP6 A;  3BDR A;  2CZT A;  1G7N A;  3BX8 A;  2ALL X;  3POR A;  3SZD A;  2FRS A;  1OPA A;  3PH6 A;  1YP6 A;  1LFO A;  1D3S A;  2Q4N A;  4O3Y A;  2M07 A;  5B27 A;  2ZFG A;  1KT3 A;  4TKJ A;  5H9L A;  2KTD A;  3FW4 A;  2AT5 X;  3FA7 A;  4ON1 A;  3P6H A;  5DL5 A;  4YCE A;  3SYB A;  3HK1 A;  1P6P A;  3UAQ A;  2OVD A;  4AYE C;  5HTD A;  3T20 A;  5FQ8 E;  5L8N A;  3EMM A;  1DF3 A;  4GET A;  4COT A;  1QFT A;  3P6E A;  1X8O A;  4ML7 B;  1N0S A;  1S7D A;  3STK A;  2HYS A;  4ID2 A;  3ZW2 A;  2JW1 A;  2PRN A;  1PM1 X;  3TGB A;  1ZHY A;  3U9P C;  4A1Y A;  1B8E A;  2QTK A;  4HWM A;  2Q39 A;  2WR6 A;  2F1T A;  1IKE A;  3PED A;  2FT9 A;  3DTQ A;  3EM0 A;  2AMM X;  4ALO A;  1AEL A;  1FEN A;  1OEJ A;  4NYQ A;  2Y0L A;  1FDQ A;  3VY9 X;  3S5V A;  4FBR A;  4YGH A;  3NR3 A;  5D45 A;  2CM9 A;  2RD7 C;  4FGI B;  3ZW0 B;  2ERV A;  3LK4 1;  7PRN A;  3H3I A;  4ALB A;  3ZUO A;  4D6A A;  2Q2P A;  3POQ A;  5D8J A;  3FEN A;  1KT7 A;  2MHL A;  1THQ A;  1IFC A;  5BVT A;  4JCH A;  4KH8 A;  1KT5 A;  4QZT A;  2EU7 X;  4ZH6 A;  2FGR A;  2O62 A;  1BT9 A;  1EQD A;  1ZNG A;  3BX7 A;  4KT5 A;  4XMF A;  5C0N A;  3AAE A;  2AT0 X;  3BSZ E;  5HZ5 A;  1GFN A;  1MDC A;  3UEU A;  1BRP A;  1QAB E;  5BVQ A;  4FSO A;  1HMS A;  2F1V A;  2MO5 A;  3HOE A;  4YDA A;  3SY9 A;  2XKL A;  3JQO A;  5HZQ A;  5HCC C;  4PJ2 A;  2AKQ A;  2LB6 A;  3K3L A;  1QJ8 A;  5PRN A;  1GT1 A;  4YGG A;  1ERB A;  1TOW A;  4ORY A;  2W2B A;  4IAX A;  4KCA A;  1HMR A;  1RBP A;  4INN A;  4AFK A;  4I95 A;  1A57 A;  1D2U A;  1OBP A;  2BS6 A;  2G78 A;  4ZCB A;  3ZUI A;  4CV7 A;  4Y0P A;  1BWY A;  3NAD A;  3C5O A;  3VZW X;  2A2U A;  2GE4 A;  1DZK A;  1BRQ A;  1CBR A;  2ZAI A;  3FW5 A;  5FQ6 E;  3ZW1 B;  4AZN A;  1O8V A;  3HOL A;  3HWF A;  1SY1 A;  3APU A;  2AH7 X;  5B29 A;  3F9D A;  1GFM A;  1QJ9 A;  2KT4 B;  1BSO A;  3KQ0 A;  1YWB A;  4YH0 A;  4GF4 A;  3RSW A;  2OFM X;  2XE3 A;  1MPF A;  4N58 A;  1HMT A;  4RJX A;  1X8Q A;  2R56 A;  2X46 A;  3NX1 A;  4ZHG A;  4XNK A;  4RUU A;  3QRC A;  2HMB A;  5FFH A;  1CBI A;  1O1U A;  4KR8 A;  5D48 A;  1GKA B;  3VG6 A;  4NNT A;  4IAB A;  3VG4 A;  1MM5 A;  3AA7 B;  1ERX A;  1HXX A;  2OVS A;  3HWG A;  1I06 A;  5H8T A;  5HA0 A;  3RZY A;  4TQ2 A;  2Y7S A;  1DFV A;  4WHI A;  4Y0Q A;  1PEE A;  3KFG A;  5AJC A;  1A3Y A;  1BJ7 A;  1EPA A;  1LID A;  1RLB E;  4I3C A;  4RLB A;  3CWK A;  4O4U A;  4YKM A;  2E4J A;  2HZR A;  3VU1 A;  3JTY A;  5HCE C;  2ASN X;  4GK9 A;  1Z24 A;  1EUO A;  1QY0 A;  4HPA A;  4XMH A;  1EW3 A;  1GFQ A;  1HXT A;  3RBY A;  2R74 A;  5H9N A;  1X8P A;  2JOZ A;  2Q9S A;  3BRN A;  1GX8 A;  3NP1 A;  3P6C A;  4PSQ A;  1ZHT A;  3VG3 A;  5HTE A;  1ZRY A;  3P24 A;  3ZWE A;  1PRN A;  4OMW A;  4FBV A;  3ZI8 A;  3SOT A;  3WXQ A;  4IBA A;  1BM5 A;  2CBS A;  4AKM A;  1AB0 A;  3AA1 B;  5KHP A;  5LJK A;  4IB7 A;  2M06 A;  2X8F A;  1S44 A;  4CSB A;  3AA6 A;  2GJ5 A;  4GKC A;  3B2J A;  4ZR2 A;  2XE2 A;  4U9C A;  2A0A A;  3JS1 A;  4ZHD A;  3TZS A;  3AKM A;  4LSI A;  4OS3 A;  1DC9 A;  2LFU A;  3VG2 A;  4N7C A;  3AAA B;  5ADX K;  4UU3 A;  3SY7 A;  4EQA C;  2BT9 A;  4HFO A;  1I04 A;  5HWZ A;  4ZGU A;  3KVD D;  4AZQ A;  3FEK A;  1QG5 A;  4RJW A;  5DL7 A;  1G90 A;  3LK2 A;  1LIB A;  1EIO A;  4AZL A;  1U17 A;  4ZHF A;  1JJX A;  1CRB A;  4EEJ A;  4AZR A;  2PY1 A;  2KDY A;  4YCH A;  1HXU A;  4CK4 A;  4WBK A;  1B56 A;  1SXY A;  4YFR A;  3NBX X;  3OBL A;  3IA8 A;  4GDZ A;  3KFI A;  3K19 A;  4GZV A;  4QYN A;  4FZM A;  3D4R A;  2JMB A;  3OE3 A;  1IW2 A;  3PEC A;  4FRX A;  3GE2 A;  2Y0H A;  1OSM A;  5KIC A;  4KR4 A;  4F4B A;  4I9R A;  2JU7 A;  2P8G A;  5F1E A;  3BU9 A;  4IB6 A;  4GCP A;  4GCS A;  3APV A;  4QZU A;  1MX7 A;  3SYS A;  8PRN A;  1OBU A;  4AKR A;  4LQZ A;  4TJZ A;  4LKT A;  2OMF A;  4AZM A;  4I3B A;  1OEE A;  2IFB A;  3O22 A;  2LA7 A;  4QYP A;  3AA7 A;  3UPG A;  1GKA A;  1BXW A;  2DM5 A;  4OMX A;  1ZHX A;  1E02 A;  1HBP A;  3BLG A;  2RA6 A;  4ORW A;  5AQ6 A;  3RWX A;  2X45 A;  2GTL N;  5BYP A;  4ORR A;  3RBH A;  2X27 X;  1Y9T A;  1OBQ A;  5G26 A;  4N7D A;  3A2S X;  1ACD A;  5LJH A;  1G74 A;  3UEW A;  1FEM A;  5JDP A;  3MBT A;  3LK4 2;  4JFB A;  4M6S A;  3VE1 A;  4GCQ A;  3CQR A;  5LJB A;  2W2A A;  4U8U N;  4ODD A;  4MVI A;  4B61 A;  3VY8 X;  2KXP A;  2CM4 A;  1T8V A;  1GT3 A;  3PP6 A;  5EZ2 A;  3PQU A;  4KC7 A;  3WBG A;  4ZFX A;  4BQU A;  1IIU A;  3LHN A;  4BVM A;  3BS2 A;  3S60 A;  4MIR A;  5D5D A;  4GNW A;  2A13 A;  1LF7 A;  2CBR A;  1NP1 A;  4GRJ A;  5HZ8 A;  2AT6 X;  1NGL A;  3STM X;  1VYF A;  4ZGF A;  4ZHH A;  5HZ6 A;  2JN3 A;  3MX7 A;  1S2P A;  1JJJ A;  3ZZV A;  2O4V A;  3B2I A;  1GT4 A;  2N93 A;  1KQW A;  3POX A;  5FQ7 E;  3WJF A;  3G7X A;  4RUN A;  4O4O A;  2YNK A;  1EI5 A;  2A3F X;  2POA A;  4ORX A;  3TF6 A;  5HZ9 A;  1B4M A;  3NPO A;  1HQP A;  4FBO A;  4QGW A;  2G79 A;  4YDB A;  1PHO A;  5FVN A;  1KXO A;  2WQ9 A;  3MVF A;  1CBS A;  2KXP B;  1DZM A;  3ZW0 A;  4AYM C;  3WJD A;  3APW A;  4EDE A;  3ELZ A;  3I17 A;  1LIE A;  2HNX A;  4LKP A;  2OZQ A;  1QQS A;  5AEO A;  1QWD A;  1JBH A;  4ORU A;  2JMM A;  1MVG A;  4NW4 A;  2XTR A;  1YS5 A;  4G76 A;  4ARH A;  3OJY C;  1LIF A;  1YUP A;  1PBO A;  5DPQ A;  2F73 A;  1ZNH A;  4GNY A;  4YFP A;  4ZJ0 A;  4Y0R A;  3WI4 A;  1CBQ A;  4GH7 A;  2KTS A;  3T24 A;  1TVQ A;  3FR5 A;  1KZW A;  2KC0 A;  1ICM A;  3HWD A;  4LSF A;  1P4T A;  5JR8 A;  1GFP A;  3D97 A;  1GX9 A;  2MM3 A;  1ALB A;  5HA1 A;  5HCD C;  2OVE A;  4FRT A;  2QOS C;  3KZA A;  4IB8 A;  3E3C A;  2K23 A;  3RKG A;  2XMX A;  4D5U A;  5GV0 A;  1IZN A;  2ANS A;  2XTQ A;  4GU8 A;  1MX8 A;  4WFU A;  5IO6 A;  3EBW A;  1U0X A;  4A60 A;  2XST A;  1GT5 A;  1H91 A;  5EDC A;  4NYR A;  4LSE A;  4D6B A;  1JYJ A;  2RCQ A;  1YIV A;  1R0U A;  2YMS A;  2G7B A;  4QRL A;  1E54 A;  3FR4 A;  3WOV A;  5DL8 A;  3VZT X;  4JGL A;  1JZU A;  2FR2 A;  1KT4 A;  5LKE A;  2RN4 A;  1YWC A;  3FMZ A;  3HWB A;  3S26 A;  2OVA A;  1CJ5 A;  2Z4I A;  3AA0 B;  3QRA A;  4O3W A;  2HLV A;  2BS5 A;  3FEL A;  1LIC A;  2OFR X;  4O49 A;  1Q9F A;  1XKI A;  5CYB A;  4M7M A;  5F6Z A;  4LZU A;  2N2L A;  3LK3 B;  1VPR A;  3NQ3 A;  3Q6L A;  3APX A;  3AA6 B;  5HAE A;  2ZAG A;  5T5F A;  4L3R A;  2BHV A;  1KT6 A;  1HN2 A;  4Y0S A;  3TGA A;  3GAQ A;  5H9A A;  5LJG A;  2MWH A;  4NP1 A;  2R73 A;  3EMN X;  1BBP A;  2KD2 A;  1KGL A;  2M4L A;  1HBQ A;  3IFB A;  1EAL A;  3CBC A;  4NLI A;  3FA8 A;  4U8U M;  2MHD A;  4FOZ A;  3FLL A;  1DV9 A;  1ZNL A;  4IMN A;  3C77 X;  2WSJ A;  4GE1 A;  5F58 A;  3NSG A;  3O19 A;  1LNM A;  3KFH A;  4WFV A;  4I3D A;  3OD9 A;  5KID A;  4Z3T A;  2KW1 A;  3VPJ E;  2NNE A;  1GFO A;  5FAZ A;  1BSY A;  4OS8 A;  5IO5 A;  1ICN A;  4HPD A;  4IAW A;  4KII A;  1NP4 A;  1BEB A;  5CE4 A;  4XMD A;  5LJE A;  3WJB A;  1Y9L A;  4YFQ A;  2FTB A;  2FS6 A;  2WEX A;  1SY3 A;  2LFO A;  4A1H A;  5K06 A;  2AT8 X;  3PPT A;  1SMP I;  1SXW A;  1ZNE A;  2F09 A;  1X8N A;  4YBP A;  1SA8 A;  3U03 A;  3I0A A;  4FMS A;  2BLG A;  4D64 A;  5IYU A;  4FZL A;  1TXL A;  4FQB B;  1FTP A;  5EPQ A;  4O3Z A;  4TKB A;  1OPB A;  2FWV A;  1ML7 A;  3D96 A;  3VG7 A;  1KOI A;  1B0O A;  3G7G A;  2A2G A;  1ORM A;  4MVK A;  3WVM A;  2YG2 A;  4XME A;  1E06 A;  1E00 A;  3DSZ A;  4ES7 A;  4AZP A;  3UU2 A;  4AUI A;  1AQB A;  3FYF A;  4AW8 A;  3FA6 A;  2ACP X;  3TZG A;  1U18 A;  3POU A;  2NNQ A;  4L1N A;  1FE3 A;  4MIS A;  1JV4 A;  3NX2 A;  1ZHZ A;  1GGL A;  2JU8 A;  4EXZ A;  3LK3 A;  5LJC A;  1X71 A;  2QMI A;  1QFV A;  3EYC A;  4KRA A;  3LK2 B;  1BLR A;  1G85 A;  4TKH A;  4AYD C;  2GTL O;  2KZ7 B;  3LV4 A;  4YMY A;  3AA0 A;  4D65 A;  3JSQ A;  2K4T A;  5D47 A;  4QGX A;  2X8S A;  4OS0 A;  3VE2 A;  4AKR B;  5ADX L;  2ACO A;  1TOU A;  3CR6 A;  4YKO A;  3CMP A;  4ORS A;  2ODJ A;  1FEL A;  1GXA A;  2W81 C;  4NLJ A;  2Y2X A;  4PUX A;  1ZNK A;  1X8U A;  4XNL A;  3AAE B;  5F7G A;  5EE2 A;  1O1V A;  1URE A;  4DQ3 A;  1MUP A;  4BOE A;  4G75 A;  4C69 X;  3KFF A;  4QAE A;  3UEV A;  2J1N A;  1LPJ A;  3B2H A;  2GC9 A;  3O2Y A;  4NNS A;  2K0L A;  3DA3 A;  2GTL M;  5LKF A;  4AZO A;  2POR A;  5EEE A;  4AYI D;  1EXS A;  3VG5 A;  2RQ0 A;  5AFU K;  1SY2 A;  3SZV A;  1LKE A;  2JU3 A;  1E5P A;  3CQN A;  4UU2 A;  3P02 A;  2WEW A;  1A2D A;  4IMO A;  4E1S A;  4YGZ A;  1DZJ A;  3BU1 A;  1T0V A;  1IKJ A;  3FA9 A;  5LJD A;  4A8Z A;  1G5W A;  1BSQ A;  1T68 X;  2QO6 A;  1AVG I;  4AYH A;  4DQ4 A;  2CZU A;  1JIW I;  3D95 A;  3HWE A;  3BY0 A;  3SAO A;  3C76 X;  3T1D A;  3PH5 A;  2KZ7 A;  4LZV A;  3P6G A;  1DZP A;  3CBS A;  5AFU L;  2LHF A;  2XE1 A;  1YWD A;  3HW9 A;  1L6M A;  3FR2 A;  3U0D A;  3FYX A;  2Z4H A;  3N91 A;  3PQS A;  2MNH A;  2AL0 X;  3AA1 A;  3QKG A;  4U8U O;  1KQX A;  3AKN A;  4TLJ A;  1OEK A;  3NQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...