4O4UA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
513
structure length
505
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTYLNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDIKKMVAVACCSNLEYMKFGQLWQQTQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLDPGRHDNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
molecule keywords TbpB
total genus 116
structure length 505
sequence length 513
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA02
4Z3TA 5T5FA 4O3WA 4AYDC 3PQSA 2YPVA 3V8UA 4O4UA 3HOLA 2KC0A 3UAQA 3KVDD 4AYMC 4AYEC 4U9CA 3PQUA 3VE1A 2W80C 5EE2A 2Y7SA 4O3YA 2KDYA 4O3ZA 4O3XB 4O49A 4O4XA 4QQ1A 3HOEA 2LFUA 4AYID 1YS5A 2W81C 4AYNA 3VE2A
chains in the Genus database with same CATH superfamily
2NNQA 1HN2A 3AA0A 3PRNA 1SREA 2WQAE 2M07A 1A18A 3FYXA 1SWOA 5EDCA 5JD2A 2AT3X 3FR5A 2FLJA 4EDEA 3SY7A 5G39A 1Y55X 3PDFA 1PBYA 2RTBB 3LHNA 1Y52X 3AKNA 2CBRA 4RLCA 4IB8A 2POAA 3WYPA 2A0AA 5LJGA 2VDFA 4LSHA 4A1HA 2OF8A 2RTLA 4CTDA 4XMFA 4O3XB 1WUBA 2FHNX 3S26A 3HWBA 2XKLA 3KVNA 1XKIA 2IZFB 4Y0PA 1SWKA 4GNWA 1OSPO 4OMWA 4Z6JA 4ARHA 1VWFB 1G74A 4YMYA 3WOVA 2K23A 3D9WA 4QQ1A 2FWVA 4DQ4A 4C4VB 2F09A 2Y0HA 1HXUA 2G8CO 1LIEA 4U8UM 3VG2A 3OJYC 3D95A 4CV7A 2A5BA 4CPHB 1DV9A 1JYDA 2AT5X 4NNTA 1DC9A 4FQEA 2GTLM 1E54A 1T68X 1VWEB 1EI5A 4QGXA 3HWEA 1JJJA 4EQAC 3FMZA 1HMTA 5CSEA 3FIQA 1SY2A 2A13A 5IXGA 2BT9A 1SXWA 1YIVA 2FTBA 3NPOA 5HCCC 1KFFA 2FRSA 5JR8A 2R4NA 5AJBA 3FEPA 3I17A 3D4RA 1SWRA 3APXA 3O2YA 1ADLA 1VWAB 4O3WA 5KIDA 1KQWA 2CM9A 2VFCA 4OKAA 1KT6A 4L3RA 1IZNB 1EW3A 5IYUA 4CPEA 2XE2A 1JJUA 4ORUA 2X55A 3F6ZB 3JS1A 4FOZA 2RTQB 2AF5A 1GKAA 1SWHA 4IMOA 3ZI8A 1ALBA 1CBIA 4HPBA 3UEXA 3A0HO 2QOMA 1IKJA 3RDUA 3S60A 2N2LA 3SLTA 4AYNA 2IZDB 4A1YA 3C78X 5IO6A 1X8PA 4TKHA 4I9RA 2K62A 3KVDD 1D2UA 1SWBA 1N0SA 3AAAA 3C5OA 1ZHTA 2RTRB 2W80C 1E5PA 3PGRA 1VWPB 2AH7X 5HTDA 1X89A 4AZLA 2PI3O 2OFBA 4WHIA 3RDSA 5ADXK 3B2HA 3VHMA 2A3FX 3HPEA 4GGTA 5HZ5A 1B4MA 1ZNKA 3P6EA 1SWGA 4BX7B 5F58A 5G26A 3SZHA 3WBGA 3WYQA 1EUOA 4IBAA 3STNA 2QCBA 5L8NA 2RTPB 4CDFA 3KFFA 2OF9A 4IB6A 2FT9A 4D64A 4GZVA 2L68A 1SRHA 4MVIA 3N91A 2MM3A 3ZW2A 2AMMX 5KHPA 3RE6A 2L5PA 3PF1A 1BLRA 3JQOA 5DL8A 3CKFA 1SWFA 3RBYA 1XCAA 5AJCA 4BQUA 3IA8A 3UAQA 1LIFA 4HPAA 3KFGA 1ZHXA 1KL5A 1STPA 3VY8X 1SY3A 3MG5A 4U46A 2OL7A 2LFUA 1BBPA 3KFHA 5LKEA 1GX8A 4MEEA 3RY2A 2X8FA 1EPAA 3FLLA 5AQ6A 3RDXA 2KXPA 5DPQA 1QY0A 4WFUA 4ZJ0A 1UYOX 3P02A 4PUXA 3VZWX 2OL8O 1LNMA 3P6CA 2ZLDA 1LDOA 3FEKA 1PEEA 4FBVA 3NQ9A 2A2UA 1YUPA 4BCSA 5LJBA 1VPRA 3U0DA 1SMPI 3LV4A 4RL9A 4BJ8A 1GFNA 3ZUIA 3AA7B 5C0NA 5L8IA 5B2AO 3SAOA 4CDDA 1G85A 1DZJA 1G5WA 1BSYA 4AW8A 3WI4A 2AKQA 4TLJA 1IFCA 3KQ0A 2LBAA 4O3YA 2OY7A 3VG5A 4YBPA 5H9KA 3JTYA 1EPBA 3WJFA 5GTHO 2LKKA 1IJ8A 1DF8A 2FR2A 2WSJA 3HWDA 1K24A 4RJWA 2QO6A 4ALOA 3RWXA 1Z24A 4XNKA 2KT4B 1E00A 2PORA 4ZHHA 1T8VA 1X71A 3VU1A 2X9KA 4GETA 5H9NA 2OY5O 1KL4A 3WI5A 3TGAA 1MOYA 1I4UA 3VGWA 4QNIA 5FVNA 1BXWA 1WBIA 4AUIA 3EBKA 4ZFXA 1S5LO 3P6HA 5B5FA 3PH6A 3OD9A 1PM1X 4O4XA 1EXSA 5H8TA 2Y3FA 3LK2B 1MVGA 4O9SA 1CRBA 2RCQA 1S2PA 2Y0KA 4YVBA 2MJIA 1UYNX 2Q2MA 2FGRA 2J4UP 4GUZA 4ORSA 3UEUA 2X34A 4COTA 1DF3A 4AZMA 1SWEA 1W4TA 3GAQA 4YFRA 4QYPA 4YKMA 2Q2PA 1JYJA 4D6AA 1GFPA 2HZRA 2MNHA 2R88A 2F1CX 2RCTA 1LCZA 2P8GA 3A2SX 3NX1A 4FZLA 5D4AA 1ZNDA 2RTOB 4FRTA 2K4TA 2OFMX 3RDOA 2JU7A 3HOEA 4ZH9A 1STSB 3PP6A 3KZAA 1BRPA 5IO7A 3F9DA 5IRAA 1OEEA 4NYQA 3MVFA 5KICA 1KZXA 3Q6LA 3S5XA 2NP1A 3BX7A 2Q4NA 1KL3A 1GXAA 4N7DA 4C5PA 1HXLA 3O22A 1RBPA 1KT7A 4I60A 2ALLX 2C1SA 3GP6A 1BWYA 2FKGA 1ERXA 5IRUA 3WZNA 1EIIA 3AA7A 4JFBA 3PQUA 4GF4A 4IAWA 2JGSA 2M06A 3VHIA 2WPUA 4A8ZA 4UB6O 3POUA 4GDAA 2LB6A 2Q39A 4E1SA 3FELA 4ODDA 4PJ2A 4ZHDA 2Y0LA 2ZAGA 2OVDA 4JGLA 3JCUO 1LICA 2OVSA 2OYBO 3SZVA 3EMNX 4AZOA 4BX6A 2R56A 4ID2A 1QJPA 1UZ2X 2DJFA 2Q9SA 3G7GA 2OVEA 2JMMA 3WJGA 3PH5A 5E79O 4I9SA 1Y9LA 1VWNB 1IW2A 4G76A 2JU3A 4KC8A 4O4OA 2K0LA 3SZJA 3RBHA 3ZUOA 1JJXA 1MX8A 4XMDA 2O4VA 2F1VA 4NLJA 1SWSA 1AELA 3HTYA 5PRNA 3NSGA 4JNJA 2RTGB 4JO6A 1YS5A 1K3BA 5AFUL 4Z3TA 1MPFA 1RXKA 2NNEA 1THQA 1SXUA 3PORA 3EYCA 3CBCA 2ZAIA 4U9CA 1FDQA 3APUA 3MM0A 1H6S1 2G79A 3ELXA 5HZ6A 4ORRA 3FENA 3JSQA 4AKMA 4FZNA 1QJ9A 1Y53X 2X56A 1NQNA 3ZW1B 3DA3A 1VWKB 1Q9FA 1BH3A 4OS0A 4CPHA 2MF6A 1NGLA 3CKGA 1BT9A 2RTKA 4DCBA 5D8JA 1HQPA 2F01A 1YWBA 3AAAB 1HXZA 4JCHA 1AB0A 4YGGA 3FW5A 4WFVA 4YGHA 4BOEA 4N74A 4K3CA 3POQA 3RY1A 1D3SA 1CBRA 4M7MA 2R8AA 4AKRA 4K19A 4AZRA 5EE2A 1AVGI 4BX5A 4YKOA 1TVQA 1G7NA 2G7BA 6PRNA 2HKDA 3ZQ3A 2FS7A 4R0BA 2XE5A 1S44A 1P6PA 3VG7A 1ZNGA 4NLIA 1SWCA 1ZRYA 1HXXA 3DZMA 2PY1A 1OEKA 2CZTA 2QOSC 4KR8A 2BS6A 4U3QA 3PECA 4GCSA 1S7DA 2RTFB 4GJSA 1CJ5A 1YWCA 3KZIO 1DZPA 1IZNA 1FENA 4PR7A 2IZIA 1SRGA 3BS2A 2RA6A 2OY8A 3OBLA 1N7YA 4TJZA 5HCDC 1JMZA 3NQKA 2AT8X 4KC7A 1A57A 4FBOA 3AA1B 1RAVA 3BSZE 2IZHB 1NDJA 3BY0A 2KD2A 3AA1A 4AYHA 4XMEA 5EEDA 3LK42 1GT5A 5B5EO 4YFQA 2ZFGA 4D65A 1SWAA 3DTQA 1VWLB 4NW4A 4O4SA 2RQ0A 5AEOA 3PPTA 2LBVA 4RJXA 1OBUA 4IMNA 5LJHA 1EIOA 1PTSA 3PQSA 2X45A 3CQRA 2GTLN 4C4VA 1HBPA 3NX2A 4FRXA 2IFBA 4QAEA 1CBSA 4F4BA 4DQ3A 3WJEA 4U8UN 4Z27A 1VWCB 3VG6A 2MO5A 1RXJA 1GT1A 1YP6A 1I06A 3T6FA 4FQBB 2HZQA 2WR6A 3K19A 5HZ8A 1FEMA 2KTSA 4YDBA 4NNSA 4AZQA 1VWHB 4YCEA 4N7CA 4LSIA 3FYFA 3SZDA 1MEPA 1FTPA 5BVQA 1MM9A 2RTEB 2WJQA 4HPDA 2PRNA 1LUQA 2R89A 1LDQA 1SXYA 4I3CA 1KZWA 3BU9A 4NP1A 5HCEC 1FJ1E 1SA8A 4KR4A 3TGCA 5CHKA 1SLGB 1GM6A 1QJ8A 4GE1A 1LIBA 3EW1A 1JIWI 2ASNX 4DNEA 4GCQA 2OZQA 2IZKA 2HYSA 1KGLA 1ERBA 3P24A 4Y0QA 3TZGA 1A3YA 1VWGB 4ZHFA 1L6MA 1QQSA 3SZIA 1EQDA 4KT5A 3HWGA 4LZVA 5B29A 2KC0A 5F6ZA 4QGWA 1I78A 1KOIA 1VWIB 3B2JA 2RTDB 3CQNA 2ACPX 4C69X 4D5UA 5B10O 1QY2A 1ICMA 4GJVA 2JN3A 1ZHWA 1JZUA 4FT6A 3LK3B 4OMXA 4AYDC 1LPJA 3VPJE 3QKGA 4GRJA 1DZMA 3DWOX 1PBOA 2IWVA 4I95A 2RD7C 3L4RA 1MDCA 2ODJA 1PRNA 4FBRA 3RE5A 1HXTA 5BVSA 1QFVA 2RTNB 4MVKA 2L9CA 3AA6B 3AA6A 5D48A 1ZHZA 2QTKA 4O3ZA 4KH8A 4YFPA 1EALA 5HBSA 2FKJA 3AEHA 5FAZA 3RDQA 4EXZA 1HQQA 2A5CA 1VWDB 1LCWA 3NADA 5G3AA 4GCPA 4OEMA 1T1LA 1I9HA 1STRB 3FIDA 2CAMA 2XE1A 4Z2OA 1RLBE 5TISO 4B61A 2LFOA 1FELA 2W81C 1SWJA 3NJTA 3BRZA 4M6SA 5EPQA 4ORWA 1BM5A 4AZPA 3STKA 2IZEB 4GDZA 1RXHA 3Q34A 4CPIA 4AYEC 2X8SA 4IABA 5B11O 2IZBA 5F1EA 2VFBA 1U17A 5L3YA 3POXA 4MIRA 1X8OA 4FSPA 5H9AA 4NV7A 3RSWA 1A2DA 4G75A 3CR6A 1KT3A 4AYMC 2UYWA 2ERVA 4IB9A 1VWQB 3WZPA 5HZQA 1E2TA 3SYSA 1GFOA 3F8AA 4C00A 1B56A 1LFOA 4BX5B 2R4LA 4RUNA 3T1DA 4CDEA 2WVPA 3AUMO 5DL6A 1X8NA 4HPCA 3EW2A 1KXOA 2FGSA 3VZTX 1SWLA 5BVTA 1FE3A 4PSQA 4IL6O 3DSZA 2R73A 5CYBA 3A0BO 1BSQA 4GNYA 2AL0X 3ELZA 1IKEA 4YCHA 2QO5A 4ES7A 1VYGA 1GFMA 3ZW0B 1NP4A 3FR2A 2Z4IA 3MBTA 4GK9A 4Y5DA 3T2WA 4TKJA 3WJDA 4CDCA 3VE2A 3CWKA 3AKMA 3ZZVA 3VY9X 4XMCA 2IZJA 1SLEB 1BRQA 4FGIB 1YP7A 5H9LA 2RTCB 2WJRA 1MM4A 1VWBB 3D96A 3STMX 2R74A 4QZTA 4WBKA 4Y0SA 4QZUA 4JHQA 1JV4A 3HOLA 4BX6B 1SWPA 5F2BA 1SRFA 4TNNA 1OEJA 2ZSCA 2OVAA 1MUPA 3AAEB 1O8VA 4NYRA 5BYPA 2JU8A 1I04A 1N4JA 4AZNA 2GTFX 2Y7SA 1W6FA 4O49A 3FA9A 3X00A 1HMRA 2OY1O 4EKVA 3WJCA 4BX7A 1GGLA 3BLGA 1I05A 3TZSA 1OBQA 2EU7X 2FR3A 5LJKA 4GH7A 4FSOA 3LK3A 3TF6A 3UEVA 3BU1A 2Z4HA 3ZWEA 4KIIA 2IWWA 1ZNHA 4CK4A 1VWRB 2MWHA 5DL7A 5HAEA 4GGZA 1OBPA 4FUVA 2WWPA 3CMPA 1UREA 2Y32A 3QRCA 3WXQA 1QWDA 1O1VA 5L8OA 3LTWA 2JMBA 2O62A 1KQXA 4UU3A 3P6DA 5FQ8E 2M4LA 1W5RA 3FA8A 2QM9A 3SYBA 1JQPA 4Z2PA 2BSZA 4O4UA 4RUUA 2CBSA 2AT0X 4XMHA 4ZGUA 2F1TA 4MVLA 3ZW1A 3WU2O 2BC3A 4ZHCA 4ZR2A 4AKRB 1GT3A 4XMGA 2OMFA 2XG6A 2Y2XA 2MHLA 1R0UA 1N43A 2LA7A 1TXLA 1ZNLA 4LQZA 2ACOA 4B55A 1SLFB 1OPAA 1HY2A 1GX3A 1TOUA 4MVEA 4YBUA 3DA4A 1TOWA 3U03A 1SWDA 5EDBA 3K3LA 1YWDA 2HMBA 1VYOA 3VG4A 3BRYA 3D97A 3PGSA 2YNKA 2IZLB 2N93A 5LJDA 3PK2A 1LCVA 2MHDA 3APVA 3E3CA 2WUTA 2AT6X 4LZUA 5FFHA 1PMPA 4AFKA 5ADXL 2KZ7A 3P6GA 3EMMA 2E4JA 3QRAA 5FQ7E 2W2BA 4N75A 5DG4A 4XNLA 3HWFA 5IO5A 4MISA 3IFBA 3FA7A 4EEJA 3C77X 1ORMA 4E1TA 4FMSA 1KT4A 4U8UO 2R4PA 1B0OA 4ZGFA 4K3BA 5EZ2A 2X8TA 3EBWA 1QY1A 4GHBA 2YG2A 2GTLO 1GT4A 2RTIB 5AFUK 4ORXA 4D6BA 5B3MO 3PGUA 4Z28A 4UB8O 4CSBA 4QRLA 2RN4A 3SY9A 4HWMA 2G5LA 4UU2A 1SY1A 5HA1A 3EM0A 1QG5A 1BSOA 1SXXA 3NQ3A 4QYNA 1HBQA 2JOZA 3ZW0A 3TGBA 1LELA 2CM4A 1OPFA 4ORYA 1MM5A 3DWNA 5HA0A 2RTJA 5GV0A 3WZQA 1Y0GA 1NC9A 2C4IA 3AA0B 3VG3A 4YDAA 1AVEA 3HK1A 4BGFA 4INNA 4N59A 2WQ9A 3O19A 2DJGA 1U18A 2RTHB 1QABE 1O1UA 1AVDA 2HNXA 4LKPA 5HTEA 3UU2A 4LSEA 1AQBA 2X32A 2FS6A 1G90A 3EC5A 4AYID 3LK41 3BDRA 2BHVA 1MK5A 4I3BA 4IRWA 1SLDB 3KFIA 4HFOA 4Y0RA 2OFRX 1NBXA 2XSTA 4LSFA 1E06A 3AAEA 1GFQA 3BX8A 2FHLA 4GU8A 8PRNA 2L67A 1X8QA 2A8GA 2N2MA 3O0EA 2ANSA 5D47A 4YGZA 4KCAA 1SWUA 5KAIO 2J1NA 3CBSA 1HMSA 4ZHGA 1IFBA 5F6BA 4I3DA 2OL6O 3FA6A 2RTAA 4OS8A 3LK2A 1SWTA 3RKGA 2UZ2A 5F7GA 1U0XA 3UPGA 1H91A 4OS3A 4I6SA 2KW1A 5GTIO 2W2AA 1ZHYA 2GH7A 2X27X 2WEWA 3T20A 5K68A 1RSTB 1P4TA 1CBQA 5FQ6E 4FESA 1BEBA 1IIUA 4N58A 1TW4A 2AXTO 5G38A 7PRNA 2I5ZO 4Z2VA 5HZ9A 3NP1A 5K06A 2GC9A 3I0AA 3MX7A 2X46A 3H3IA 3WJBA 2NNDA 1QFTA 4ML7B 1VWJB 2CZUA 4A60A 3FR4A 2GE4A 2JW1A 5K67A 2BLGA 1GKAB 3HW9A 2YPVA 3PEDA 3WVMA 4RLBA 4PJ0O 3BS0A 1NQMA 2KTDA 2WEXA 1ML7A 1OSMA 3NBXX 3P6FA 1SY0A 3U9PC 2R4OA 2QMIA 2IZAA 4FZMA 5EEEA 4TQ2A 2F73A 4YH0A 3RDMA 4QGVA 5HWZA 3V8UA 1PHOA 2XTQA 5D45A 3T0SA 2RTMA 4Y59A 2G78A 3S5VA 2C1QA 4L1NA 2X4MA 1T16A 3B2KA 2XMXA 5D5DA 4ZCBA 3BRNA 3T6LA 3APWA 2KDYA 1B8EA 3OE3A 3B2LA 5B5GA 1VYFA 2IZCB 2W2FA 3B2IA 5B66O 1N9YA 4LKTA 1DZKA 1ICNA 2HLVA 2KXPB 1N9MA 4ZH6A 5FENA 2IZGB 3QQ2A 4BVMA 2JQYA 1LIDA 3RZYA 2XE3A 1BJ7A 4EFGA 1KT5A 2GJ5A 3T2XA 4IB7A 1T0VA 4NV8A 2OFAA 1E02A 3FW4A 2QO4A 1X8UA 3VE1A 1SWNA 1RSUB 5LKFA 2FGQX 2YMSA 3GE2A 3C76X 5T5FA 4GKCA 2BS5A 5B27A 5CE4A 2KZ7B 2Y3EA 3WZOA 5LJCA 1SRJA 1NP1A 5KAFO 3VHHA 1GX9A 2A2GA 1SWQA 1Y9TA 4GGRA 1SRIA 4BUMX 1ACDA 1OPBA 2DM5A 1JBHA 3UEWA 3SLJA 3T24A 5H2FO 1ZNEA 4OELA 3FDCA 1VWMB 1LKEA 3SOTA 2XTRA 2LHFA 5IRWA 5JDPA 2AVIA 3VZUX 1YWAA 3SLOA 5LJEA 4ON1A 4CPFA 1LF7A 4TKBA 4BBOA 2I5VO 4GD9A 4IAXA 1Q9GA 1MX7A 4KRAA 1VWOB 1JMXA 5DL5A 3G7XA 3NR3A 4ALBA 1DFVA
chains in the Genus database with same CATH topology
2RCQA 1S2PA 2NNQA 1HN2A 2Y0KA 3AA0A 2PRNA 3PRNA 2WQAE 3U03A 2M07A 1A18A 1SXYA 3FYXA 4I3CA 2MJIA 1KZWA 2Q2MA 3BU9A 5EDCA 2FGRA 2J4UP 4NP1A 5EDBA 5HCEC 3K3LA 1YWDA 4ORSA 3UEUA 2HMBA 4COTA 1SA8A 1DF3A 4KR4A 3TGCA 2AT3X 4AZMA 1GM6A 3VG4A 1QJ8A 3GAQA 4GE1A 4YFRA 3D97A 4QYPA 2YNKA 1LIBA 2FLJA 3FR5A 2N93A 1JIWI 4YKMA 2ASNX 2Q2PA 5LJDA 4GCQA 4EDEA 2OZQA 1JYJA 2MHDA 3SY7A 3APVA 2HYSA 1KGLA 3E3CA 4D6AA 2WUTA 1ERBA 1GFPA 2AT6X 4LZUA 2HZRA 5FFHA 2MNHA 3P24A 4Y0QA 3TZGA 1A3YA 4ZHFA 1L6MA 1QQSA 3LHNA 1PMPA 4AFKA 1EQDA 2RCTA 3AKNA 4KT5A 5ADXL 2KZ7A 2CBRA 3HWGA 4LZVA 4RLCA 4IB8A 2POAA 3P6GA 5B29A 5F6ZA 4QGWA 2KC0A 2A0AA 5LJGA 2P8GA 3EMMA 2E4JA 3A2SX 3NX1A 4LSHA 4A1HA 4FZLA 3QRAA 5FQ7E 2W2BA 5D4AA 5DG4A 4XNLA 3HWFA 5IO5A 4MISA 3IFBA 1ZNDA 3FA7A 4XMFA 4EEJA 1KOIA 3C77X 1ORMA 4FRTA 2K4TA 4E1TA 3B2JA 2OFMX 3CQNA 4O3XB 2ACPX 4C69X 2JU7A 3HOEA 3S26A 3HWBA 4FMSA 4D5UA 2XKLA 4ZH9A 1QY2A 1XKIA 1ICMA 1KT4A 4U8UO 2JN3A 1ZHWA 1JZUA 3PP6A 1B0OA 1BRPA 3KZAA 4ZGFA 4FT6A 3LK3B 4OMXA 4AYDC 1LPJA 5IO7A 3VPJE 3F9DA 5EZ2A 1OEEA 3QKGA 4NYQA 4Y0PA 3MVFA 4GNWA 4GRJA 5KICA 2X8TA 1DZMA 3EBWA 1QY1A 1KZXA 4GHBA 2YG2A 2GTLO 3Q6LA 1GT4A 4OMWA 3S5XA 2NP1A 4ARHA 5AFUK 4ORXA 1G74A 3BX7A 4D6BA 2Q4NA 1PBOA 4YMYA 3WOVA 2K23A 4CSBA 4QRLA 1GXAA 4N7DA 4QQ1A 3O22A 4I95A 2RN4A 3SY9A 1RBPA 2RD7C 4HWMA 3L4RA 2FWVA 1KT7A 4UU2A 5HA1A 1SY1A 1MDCA 4DQ4A 2ALLX 3EM0A 2F09A 1QG5A 2ODJA 2Y0HA 1HXUA 1BSOA 1SXXA 3NQ3A 1LIEA 1BWYA 1PRNA 4QYNA 4U8UM 4FBRA 3GP6A 1HBQA 2JOZA 1ERXA 1HXTA 5BVSA 3ZW0A 3TGBA 3VG2A 3OJYC 1EIIA 2CM4A 3AA7A 1QFVA 1OPFA 3D95A 4JFBA 3PQUA 4ORYA 4CV7A 1MM5A 5HA0A 4MVKA 4GF4A 1DV9A 2L9CA 4IAWA 3AA6B 1JYDA 2AT5X 4NNTA 5D48A 1ZHZA 2M06A 2QTKA 1DC9A 3AA6A 5GV0A 4O3ZA 4A8ZA 2GTLM 1E54A 3POUA 4KH8A 4YFPA 1EALA 1T68X 5HBSA 1EI5A 2LB6A 4QGXA 2Q39A 3HWEA 1JJJA 4E1SA 3FELA 4EQAC 3AA0B 3VG3A 4ODDA 3FMZA 4YDAA 5FAZA 1HMTA 4EXZA 4PJ2A 3HK1A 4ZHDA 3NADA 4INNA 3FIQA 4N59A 1SY2A 2Y0LA 2A13A 2ZAGA 4GCPA 2WQ9A 3O19A 2OVDA 4JGLA 2BT9A 1SXWA 1U18A 1LICA 2OVSA 1YIVA 2FTBA 3NPOA 1QABE 1O1UA 2HNXA 5HTEA 4LKPA 5HCCC 3UU2A 2FRSA 5JR8A 2XE1A 4LSEA 1RLBE 5AJBA 1AQBA 3SZVA 2FS6A 1G90A 4B61A 3EMNX 4AYID 3FEPA 4AZOA 3I17A 2LFOA 3D4RA 1FELA 2W81C 3LK41 3APXA 3O2YA 1ADLA 3BDRA 2BHVA 2R56A 4ID2A 4M6SA 5EPQA 1QJPA 4O3WA 4I3BA 1UZ2X 4ORWA 5KIDA 1KQWA 1BM5A 4AZPA 2Q9SA 3G7GA 2CM9A 3STKA 2OVEA 2JMMA 4GDZA 3KFIA 4HFOA 4Y0RA 1KT6A 2OFRX 3WJGA 4AYEC 2X8SA 2XSTA 3PH5A 4LSFA 4IABA 4I9SA 4L3RA 1E06A 1Y9LA 3AAEA 1GFQA 1IW2A 3BX8A 4GU8A 5F1EA 4G76A 8PRNA 2L67A 1X8QA 2JU3A 4KC8A 2N2MA 1U17A 1IZNB 3O0EA 3POXA 4MIRA 4O4OA 2K0LA 1EW3A 1X8OA 5IYUA 3RBHA 3ZUOA 2ANSA 1JJXA 2XE2A 4ORUA 4FSPA 3F6ZB 3JS1A 4YGZA 5D47A 1MX8A 5H9AA 4XMDA 4KCAA 2O4VA 4FOZA 2F1VA 1GKAA 3RSWA 2J1NA 4NLJA 1A2DA 3CBSA 4G75A 1AELA 3ZI8A 4IMOA 3CR6A 1HMSA 3HTYA 4ZHGA 5PRNA 1KT3A 4AYMC 3NSGA 1ALBA 1IFBA 1CBIA 5F6BA 4I3DA 3FA6A 4HPBA 3UEXA 2ERVA 4OS8A 3LK2A 1IKJA 4IB9A 3RKGA 3S60A 5F7GA 1U0XA 3UPGA 1H91A 2N2LA 4OS3A 5HZQA 1YS5A 4I6SA 3SYSA 4AYNA 2KW1A 2W2AA 5AFUL 1GFOA 1ZHYA 1MPFA 4Z3TA 3F8AA 2NNEA 1B56A 1LFOA 4A1YA 3C78X 5IO6A 2X27X 2WEWA 1SXUA 1THQA 1X8PA 4TKHA 4I9RA 4RUNA 3T1DA 2K62A 3EYCA 3PORA 3T20A 3KVDD 1P4TA 5DL6A 1CBQA 3CBCA 2ZAIA 1D2UA 1X8NA 4U9CA 1FDQA 3APUA 4HPCA 1H6S1 2G79A 1N0SA 5FQ6E 3AAAA 1ZHTA 1KXOA 2W80C 1E5PA 3ELXA 5HZ6A 1BEBA 3C5OA 4FESA 3VZTX 1IIUA 4ORRA 1FE3A 1TW4A 3FENA 4PSQA 5BVTA 3JSQA 4N58A 2AH7X 5HTDA 1X89A 4AKMA 4AZLA 4FZNA 7PRNA 5HZ9A 1QJ9A 4WHIA 3DSZA 3ZW1B 3NP1A 3DA3A 2R73A 5K06A 5CYBA 5ADXK 1BSQA 3B2HA 4GNYA 2A3FX 2GC9A 1Q9FA 3I0AA 1BH3A 2AL0X 3MX7A 3ELZA 5HZ5A 1B4MA 1ZNKA 1IKEA 2X46A 3H3IA 4OS0A 4YCHA 3WJBA 2QO5A 3P6EA 1NGLA 2NNDA 4ES7A 5F58A 1VYGA 1QFTA 5G26A 1BT9A 3WBGA 1GFMA 3ZW0B 1NP4A 4ML7B 5D8JA 3FR2A 1EUOA 2CZUA 2Z4IA 3MBTA 4GK9A 4IBAA 1HQPA 3STNA 4TKJA 5L8NA 3WJDA 1YWBA 4A60A 3AAAB 3FR4A 2GE4A 3VE2A 3CWKA 2JW1A 3AKMA 2BLGA 3ZZVA 1GKAB 3KFFA 3VY9X 4XMCA 4JCHA 4IB6A 1AB0A 3HW9A 2YPVA 2FT9A 4YGGA 3PEDA 3WVMA 4D64A 3FW5A 4WFVA 4RLBA 4GZVA 2KTDA 2WEXA 2L68A 4YGHA 1BRQA 4FGIB 1YP7A 1ML7A 4BOEA 1OSMA 3POQA 4MVIA 5H9LA 3NBXX 3P6FA 1SY0A 1MM4A 3U9PC 3N91A 1D3SA 2MM3A 4RJWA 1CBRA 2QMIA 3ZW2A 2AMMX 3D96A 4M7MA 3STMX 5KHPA 2R74A 4AKRA 2L5PA 4QZTA 1BLRA 4WBKA 3JQOA 4K19A 4AZRA 4Y0SA 4FZMA 5EEEA 5DL8A 5EE2A 4QZUA 2F73A 1AVGI 4TQ2A 4YH0A 4QGVA 3RBYA 5HWZA 1XCAA 4YKOA 1TVQA 1JV4A 1G7NA 3V8UA 5AJCA 1PHOA 2XTQA 5D45A 2G7BA 3HOLA 3T0SA 6PRNA 4BQUA 3ZQ3A 2G78A 2FS7A 3IA8A 3S5VA 3UAQA 4R0BA 2XE5A 1LIFA 1S44A 4L1NA 4HPAA 3KFGA 1P6PA 1ZHXA 4TNNA 3VG7A 1ZNGA 1OEJA 4NLIA 3VY8X 1SY3A 3B2KA 2XMXA 1ZRYA 5D5DA 2OVAA 1HXXA 4ZCBA 3BRNA 1BBPA 2LFUA 1MUPA 3AAEB 3APWA 1O8VA 2KDYA 3KFHA 2PY1A 5LKEA 1OEKA 1GX8A 1B8EA 3OE3A 2CZTA 2QOSC 4NYRA 2BS6A 3B2LA 4KR8A 1VYFA 4U3QA 2W2FA 3B2IA 3PECA 4GCSA 1S7DA 4LKTA 1DZKA 5BYPA 2JU8A 1ICNA 2X8FA 1YWCA 1CJ5A 1I04A 1EPAA 2HLVA 3FLLA 1DZPA 5AQ6A 1IZNA 2KXPA 2KXPB 5DPQA 1FENA 1QY0A 4WFUA 4AZNA 4ZJ0A 4ZH6A 3P02A 2GTFX 2Y7SA 5FENA 4O49A 3FA9A 4PUXA 4BVMA 3BS2A 2RA6A 3VZWX 1LIDA 3OBLA 3RZYA 1LNMA 3P6CA 4TJZA 2XE3A 1BJ7A 4EFGA 5HCDC 2ZLDA 3NQKA 1HMRA 3FEKA 2AT8X 3WJCA 1PEEA 4FBVA 1KT5A 2GJ5A 4KC7A 1A57A 3NQ9A 1T0VA 4FBOA 1GGLA 3BLGA 2A2UA 1YUPA 4IB7A 5LJBA 3AA1B 1VPRA 1E02A 3FW4A 3BSZE 2QO4A 3U0DA 1X8UA 3VE1A 1SMPI 1I05A 3TZSA 1OBQA 2EU7X 3LV4A 2FR3A 5LJKA 4GH7A 4RL9A 5LKFA 2FGQX 2YMSA 4FSOA 3LK3A 3TF6A 3UEVA 3BU1A 3BY0A 2Z4HA 3ZWEA 4KIIA 2KD2A 3AA1A 1ZNHA 3GE2A 1GFNA 4AYHA 4XMEA 3ZUIA 3C76X 4CK4A 3AA7B 5T5FA 2MWHA 4GKCA 5EEDA 5DL7A 5HAEA 2BS5A 5C0NA 3LK42 1GT5A 5B27A 5L8IA 5CE4A 2KZ7B 3SAOA 1OBPA 4FUVA 4YFQA 1G85A 2WWPA 3CMPA 1UREA 5LJCA 1DZJA 1G5WA 1BSYA 4AW8A 2ZFGA 4D65A 1NP1A 3WI4A 2AKQA 3QRCA 4TLJA 3DTQA 3WXQA 1QWDA 1IFCA 1O1VA 3KQ0A 2LBAA 1GX9A 4NW4A 2A2GA 1Y9TA 4O3YA 4O4SA 2JMBA 5L8OA 2O62A 2RQ0A 1KQXA 3VG5A 5AEOA 4YBPA 4UU3A 3PPTA 3P6DA 5FQ8E 2LBVA 1OBUA 4RJXA 1ACDA 5H9KA 4BUMX 2M4LA 4IMNA 3JTYA 5LJHA 3FA8A 2QM9A 1EIOA 1EPBA 3WJFA 3SYBA 1OPBA 2LKKA 3PQSA 2X45A 2DM5A 3CQRA 2WSJA 2FR2A 2GTLN 3HWDA 1HBPA 3NX2A 4O4UA 2QO6A 4RUUA 4ALOA 4FRXA 3RWXA 1JBHA 2CBSA 2AT0X 2IFBA 1Z24A 4XMHA 4QAEA 4ZGUA 2F1TA 4XNKA 4MVLA 2KT4B 3ZW1A 3UEWA 1CBSA 4F4BA 4DQ3A 3T24A 1ZNEA 4U8UN 3WJEA 4ZHCA 4ZR2A 3VG6A 4AKRB 2MO5A 1GT3A 1E00A 1GT1A 1YP6A 2PORA 1LKEA 4ZHHA 4XMGA 1I06A 1T8VA 2OMFA 1X71A 3VU1A 2XG6A 4GETA 3SOTA 4FQBB 2HZQA 2WR6A 5H9NA 3WI5A 2XTRA 3K19A 3TGAA 1I4UA 5FVNA 4QNIA 5HZ8A 1BXWA 2LHFA 5JDPA 2Y2XA 2MHLA 1FEMA 4AUIA 3EBKA 1R0UA 4ZFXA 2KTSA 2LA7A 4YDBA 4NNSA 4AZQA 3P6HA 3VZUX 4YCEA 1TXLA 1YWAA 1ZNLA 4N7CA 5LJEA 4ON1A 4LQZA 4LSIA 1LF7A 2ACOA 3FYFA 4TKBA 3SZDA 3PH6A 3OD9A 1PM1X 1OPAA 4IAXA 1Q9GA 1MX7A 4KRAA 1TOUA 4O4XA 5DL5A 1FTPA 3G7XA 1EXSA 4MVEA 4YBUA 5H8TA 5BVQA 3DA4A 1TOWA 3LK2B 1MVGA 3NR3A 4ALBA 1DFVA 4O9SA 4HPDA 1CRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z3T A;  5T5F A;  4O3W A;  4AYD C;  3PQS A;  2YPV A;  3V8U A;  4O4U A;  3HOL A;  2KC0 A;  3UAQ A;  3KVD D;  4AYM C;  4AYE C;  4U9C A;  3PQU A;  3VE1 A;  2W80 C;  5EE2 A;  2Y7S A;  4O3Y A;  2KDY A;  4O3Z A;  4O3X B;  4O49 A;  4O4X A;  4QQ1 A;  3HOE A;  2LFU A;  4AYI D;  1YS5 A;  2W81 C;  4AYN A;  3VE2 A; 
#chains in the Genus database with same CATH topology
 2NNQ A;  1HN2 A;  3AA0 A;  3PRN A;  1SRE A;  2WQA E;  2M07 A;  1A18 A;  3FYX A;  1SWO A;  5EDC A;  5JD2 A;  2AT3 X;  3FR5 A;  2FLJ A;  4EDE A;  3SY7 A;  5G39 A;  1Y55 X;  3PDF A;  1PBY A;  2RTB B;  3LHN A;  1Y52 X;  3AKN A;  2CBR A;  4RLC A;  4IB8 A;  2POA A;  3WYP A;  2A0A A;  5LJG A;  2VDF A;  4LSH A;  4A1H A;  2OF8 A;  2RTL A;  4CTD A;  4XMF A;  4O3X B;  1WUB A;  2FHN X;  3S26 A;  3HWB A;  2XKL A;  3KVN A;  1XKI A;  2IZF B;  4Y0P A;  1SWK A;  4GNW A;  1OSP O;  4OMW A;  4Z6J A;  4ARH A;  1VWF B;  1G74 A;  4YMY A;  3WOV A;  2K23 A;  3D9W A;  4QQ1 A;  2FWV A;  4DQ4 A;  4C4V B;  2F09 A;  2Y0H A;  1HXU A;  2G8C O;  1LIE A;  4U8U M;  3VG2 A;  3OJY C;  3D95 A;  4CV7 A;  2A5B A;  4CPH B;  1DV9 A;  1JYD A;  2AT5 X;  4NNT A;  1DC9 A;  4FQE A;  2GTL M;  1E54 A;  1T68 X;  1VWE B;  1EI5 A;  4QGX A;  3HWE A;  1JJJ A;  4EQA C;  3FMZ A;  1HMT A;  5CSE A;  3FIQ A;  1SY2 A;  2A13 A;  5IXG A;  2BT9 A;  1SXW A;  1YIV A;  2FTB A;  3NPO A;  5HCC C;  1KFF A;  2FRS A;  5JR8 A;  2R4N A;  5AJB A;  3FEP A;  3I17 A;  3D4R A;  1SWR A;  3APX A;  3O2Y A;  1ADL A;  1VWA B;  4O3W A;  5KID A;  1KQW A;  2CM9 A;  2VFC A;  4OKA A;  1KT6 A;  4L3R A;  1IZN B;  1EW3 A;  5IYU A;  4CPE A;  2XE2 A;  1JJU A;  4ORU A;  2X55 A;  3F6Z B;  3JS1 A;  4FOZ A;  2RTQ B;  2AF5 A;  1GKA A;  1SWH A;  4IMO A;  3ZI8 A;  1ALB A;  1CBI A;  4HPB A;  3UEX A;  3A0H O;  2QOM A;  1IKJ A;  3RDU A;  3S60 A;  2N2L A;  3SLT A;  4AYN A;  2IZD B;  4A1Y A;  3C78 X;  5IO6 A;  1X8P A;  4TKH A;  4I9R A;  2K62 A;  3KVD D;  1D2U A;  1SWB A;  1N0S A;  3AAA A;  3C5O A;  1ZHT A;  2RTR B;  2W80 C;  1E5P A;  3PGR A;  1VWP B;  2AH7 X;  5HTD A;  1X89 A;  4AZL A;  2PI3 O;  2OFB A;  4WHI A;  3RDS A;  5ADX K;  3B2H A;  3VHM A;  2A3F X;  3HPE A;  4GGT A;  5HZ5 A;  1B4M A;  1ZNK A;  3P6E A;  1SWG A;  4BX7 B;  5F58 A;  5G26 A;  3SZH A;  3WBG A;  3WYQ A;  1EUO A;  4IBA A;  3STN A;  2QCB A;  5L8N A;  2RTP B;  4CDF A;  3KFF A;  2OF9 A;  4IB6 A;  2FT9 A;  4D64 A;  4GZV A;  2L68 A;  1SRH A;  4MVI A;  3N91 A;  2MM3 A;  3ZW2 A;  2AMM X;  5KHP A;  3RE6 A;  2L5P A;  3PF1 A;  1BLR A;  3JQO A;  5DL8 A;  3CKF A;  1SWF A;  3RBY A;  1XCA A;  5AJC A;  4BQU A;  3IA8 A;  3UAQ A;  1LIF A;  4HPA A;  3KFG A;  1ZHX A;  1KL5 A;  1STP A;  3VY8 X;  1SY3 A;  3MG5 A;  4U46 A;  2OL7 A;  2LFU A;  1BBP A;  3KFH A;  5LKE A;  1GX8 A;  4MEE A;  3RY2 A;  2X8F A;  1EPA A;  3FLL A;  5AQ6 A;  3RDX A;  2KXP A;  5DPQ A;  1QY0 A;  4WFU A;  4ZJ0 A;  1UYO X;  3P02 A;  4PUX A;  3VZW X;  2OL8 O;  1LNM A;  3P6C A;  2ZLD A;  1LDO A;  3FEK A;  1PEE A;  4FBV A;  3NQ9 A;  2A2U A;  1YUP A;  4BCS A;  5LJB A;  1VPR A;  3U0D A;  1SMP I;  3LV4 A;  4RL9 A;  4BJ8 A;  1GFN A;  3ZUI A;  3AA7 B;  5C0N A;  5L8I A;  5B2A O;  3SAO A;  4CDD A;  1G85 A;  1DZJ A;  1G5W A;  1BSY A;  4AW8 A;  3WI4 A;  2AKQ A;  4TLJ A;  1IFC A;  3KQ0 A;  2LBA A;  4O3Y A;  2OY7 A;  3VG5 A;  4YBP A;  5H9K A;  3JTY A;  1EPB A;  3WJF A;  5GTH O;  2LKK A;  1IJ8 A;  1DF8 A;  2FR2 A;  2WSJ A;  3HWD A;  1K24 A;  4RJW A;  2QO6 A;  4ALO A;  3RWX A;  1Z24 A;  4XNK A;  2KT4 B;  1E00 A;  2POR A;  4ZHH A;  1T8V A;  1X71 A;  3VU1 A;  2X9K A;  4GET A;  5H9N A;  2OY5 O;  1KL4 A;  3WI5 A;  3TGA A;  1MOY A;  1I4U A;  3VGW A;  4QNI A;  5FVN A;  1BXW A;  1WBI A;  4AUI A;  3EBK A;  4ZFX A;  1S5L O;  3P6H A;  5B5F A;  3PH6 A;  3OD9 A;  1PM1 X;  4O4X A;  1EXS A;  5H8T A;  2Y3F A;  3LK2 B;  1MVG A;  4O9S A;  1CRB A;  2RCQ A;  1S2P A;  2Y0K A;  4YVB A;  2MJI A;  1UYN X;  2Q2M A;  2FGR A;  2J4U P;  4GUZ A;  4ORS A;  3UEU A;  2X34 A;  4COT A;  1DF3 A;  4AZM A;  1SWE A;  1W4T A;  3GAQ A;  4YFR A;  4QYP A;  4YKM A;  2Q2P A;  1JYJ A;  4D6A A;  1GFP A;  2HZR A;  2MNH A;  2R88 A;  2F1C X;  2RCT A;  1LCZ A;  2P8G A;  3A2S X;  3NX1 A;  4FZL A;  5D4A A;  1ZND A;  2RTO B;  4FRT A;  2K4T A;  2OFM X;  3RDO A;  2JU7 A;  3HOE A;  4ZH9 A;  1STS B;  3PP6 A;  3KZA A;  1BRP A;  5IO7 A;  3F9D A;  5IRA A;  1OEE A;  4NYQ A;  3MVF A;  5KIC A;  1KZX A;  3Q6L A;  3S5X A;  2NP1 A;  3BX7 A;  2Q4N A;  1KL3 A;  1GXA A;  4N7D A;  4C5P A;  1HXL A;  3O22 A;  1RBP A;  1KT7 A;  4I60 A;  2ALL X;  2C1S A;  3GP6 A;  1BWY A;  2FKG A;  1ERX A;  5IRU A;  3WZN A;  1EII A;  3AA7 A;  4JFB A;  3PQU A;  4GF4 A;  4IAW A;  2JGS A;  2M06 A;  3VHI A;  2WPU A;  4A8Z A;  4UB6 O;  3POU A;  4GDA A;  2LB6 A;  2Q39 A;  4E1S A;  3FEL A;  4ODD A;  4PJ2 A;  4ZHD A;  2Y0L A;  2ZAG A;  2OVD A;  4JGL A;  3JCU O;  1LIC A;  2OVS A;  2OYB O;  3SZV A;  3EMN X;  4AZO A;  4BX6 A;  2R56 A;  4ID2 A;  1QJP A;  1UZ2 X;  2DJF A;  2Q9S A;  3G7G A;  2OVE A;  2JMM A;  3WJG A;  3PH5 A;  5E79 O;  4I9S A;  1Y9L A;  1VWN B;  1IW2 A;  4G76 A;  2JU3 A;  4KC8 A;  4O4O A;  2K0L A;  3SZJ A;  3RBH A;  3ZUO A;  1JJX A;  1MX8 A;  4XMD A;  2O4V A;  2F1V A;  4NLJ A;  1SWS A;  1AEL A;  3HTY A;  5PRN A;  3NSG A;  4JNJ A;  2RTG B;  4JO6 A;  1YS5 A;  1K3B A;  5AFU L;  4Z3T A;  1MPF A;  1RXK A;  2NNE A;  1THQ A;  1SXU A;  3POR A;  3EYC A;  3CBC A;  2ZAI A;  4U9C A;  1FDQ A;  3APU A;  3MM0 A;  1H6S 1;  2G79 A;  3ELX A;  5HZ6 A;  4ORR A;  3FEN A;  3JSQ A;  4AKM A;  4FZN A;  1QJ9 A;  1Y53 X;  2X56 A;  1NQN A;  3ZW1 B;  3DA3 A;  1VWK B;  1Q9F A;  1BH3 A;  4OS0 A;  4CPH A;  2MF6 A;  1NGL A;  3CKG A;  1BT9 A;  2RTK A;  4DCB A;  5D8J A;  1HQP A;  2F01 A;  1YWB A;  3AAA B;  1HXZ A;  4JCH A;  1AB0 A;  4YGG A;  3FW5 A;  4WFV A;  4YGH A;  4BOE A;  4N74 A;  4K3C A;  3POQ A;  3RY1 A;  1D3S A;  1CBR A;  4M7M A;  2R8A A;  4AKR A;  4K19 A;  4AZR A;  5EE2 A;  1AVG I;  4BX5 A;  4YKO A;  1TVQ A;  1G7N A;  2G7B A;  6PRN A;  2HKD A;  3ZQ3 A;  2FS7 A;  4R0B A;  2XE5 A;  1S44 A;  1P6P A;  3VG7 A;  1ZNG A;  4NLI A;  1SWC A;  1ZRY A;  1HXX A;  3DZM A;  2PY1 A;  1OEK A;  2CZT A;  2QOS C;  4KR8 A;  2BS6 A;  4U3Q A;  3PEC A;  4GCS A;  1S7D A;  2RTF B;  4GJS A;  1CJ5 A;  1YWC A;  3KZI O;  1DZP A;  1IZN A;  1FEN A;  4PR7 A;  2IZI A;  1SRG A;  3BS2 A;  2RA6 A;  2OY8 A;  3OBL A;  1N7Y A;  4TJZ A;  5HCD C;  1JMZ A;  3NQK A;  2AT8 X;  4KC7 A;  1A57 A;  4FBO A;  3AA1 B;  1RAV A;  3BSZ E;  2IZH B;  1NDJ A;  3BY0 A;  2KD2 A;  3AA1 A;  4AYH A;  4XME A;  5EED A;  3LK4 2;  1GT5 A;  5B5E O;  4YFQ A;  2ZFG A;  4D65 A;  1SWA A;  3DTQ A;  1VWL B;  4NW4 A;  4O4S A;  2RQ0 A;  5AEO A;  3PPT A;  2LBV A;  4RJX A;  1OBU A;  4IMN A;  5LJH A;  1EIO A;  1PTS A;  3PQS A;  2X45 A;  3CQR A;  2GTL N;  4C4V A;  1HBP A;  3NX2 A;  4FRX A;  2IFB A;  4QAE A;  1CBS A;  4F4B A;  4DQ3 A;  3WJE A;  4U8U N;  4Z27 A;  1VWC B;  3VG6 A;  2MO5 A;  1RXJ A;  1GT1 A;  1YP6 A;  1I06 A;  3T6F A;  4FQB B;  2HZQ A;  2WR6 A;  3K19 A;  5HZ8 A;  1FEM A;  2KTS A;  4YDB A;  4NNS A;  4AZQ A;  1VWH B;  4YCE A;  4N7C A;  4LSI A;  3FYF A;  3SZD A;  1MEP A;  1FTP A;  5BVQ A;  1MM9 A;  2RTE B;  2WJQ A;  4HPD A;  2PRN A;  1LUQ A;  2R89 A;  1LDQ A;  1SXY A;  4I3C A;  1KZW A;  3BU9 A;  4NP1 A;  5HCE C;  1FJ1 E;  1SA8 A;  4KR4 A;  3TGC A;  5CHK A;  1SLG B;  1GM6 A;  1QJ8 A;  4GE1 A;  1LIB A;  3EW1 A;  1JIW I;  2ASN X;  4DNE A;  4GCQ A;  2OZQ A;  2IZK A;  2HYS A;  1KGL A;  1ERB A;  3P24 A;  4Y0Q A;  3TZG A;  1A3Y A;  1VWG B;  4ZHF A;  1L6M A;  1QQS A;  3SZI A;  1EQD A;  4KT5 A;  3HWG A;  4LZV A;  5B29 A;  2KC0 A;  5F6Z A;  4QGW A;  1I78 A;  1KOI A;  1VWI B;  3B2J A;  2RTD B;  3CQN A;  2ACP X;  4C69 X;  4D5U A;  5B10 O;  1QY2 A;  1ICM A;  4GJV A;  2JN3 A;  1ZHW A;  1JZU A;  4FT6 A;  3LK3 B;  4OMX A;  4AYD C;  1LPJ A;  3VPJ E;  3QKG A;  4GRJ A;  1DZM A;  3DWO X;  1PBO A;  2IWV A;  4I95 A;  2RD7 C;  3L4R A;  1MDC A;  2ODJ A;  1PRN A;  4FBR A;  3RE5 A;  1HXT A;  5BVS A;  1QFV A;  2RTN B;  4MVK A;  2L9C A;  3AA6 B;  3AA6 A;  5D48 A;  1ZHZ A;  2QTK A;  4O3Z A;  4KH8 A;  4YFP A;  1EAL A;  5HBS A;  2FKJ A;  3AEH A;  5FAZ A;  3RDQ A;  4EXZ A;  1HQQ A;  2A5C A;  1VWD B;  1LCW A;  3NAD A;  5G3A A;  4GCP A;  4OEM A;  1T1L A;  1I9H A;  1STR B;  3FID A;  2CAM A;  2XE1 A;  4Z2O A;  1RLB E;  5TIS O;  4B61 A;  2LFO A;  1FEL A;  2W81 C;  1SWJ A;  3NJT A;  3BRZ A;  4M6S A;  5EPQ A;  4ORW A;  1BM5 A;  4AZP A;  3STK A;  2IZE B;  4GDZ A;  1RXH A;  3Q34 A;  4CPI A;  4AYE C;  2X8S A;  4IAB A;  5B11 O;  2IZB A;  5F1E A;  2VFB A;  1U17 A;  5L3Y A;  3POX A;  4MIR A;  1X8O A;  4FSP A;  5H9A A;  4NV7 A;  3RSW A;  1A2D A;  4G75 A;  3CR6 A;  1KT3 A;  4AYM C;  2UYW A;  2ERV A;  4IB9 A;  1VWQ B;  3WZP A;  5HZQ A;  1E2T A;  3SYS A;  1GFO A;  3F8A A;  4C00 A;  1B56 A;  1LFO A;  4BX5 B;  2R4L A;  4RUN A;  3T1D A;  4CDE A;  2WVP A;  3AUM O;  5DL6 A;  1X8N A;  4HPC A;  3EW2 A;  1KXO A;  2FGS A;  3VZT X;  1SWL A;  5BVT A;  1FE3 A;  4PSQ A;  4IL6 O;  3DSZ A;  2R73 A;  5CYB A;  3A0B O;  1BSQ A;  4GNY A;  2AL0 X;  3ELZ A;  1IKE A;  4YCH A;  2QO5 A;  4ES7 A;  1VYG A;  1GFM A;  3ZW0 B;  1NP4 A;  3FR2 A;  2Z4I A;  3MBT A;  4GK9 A;  4Y5D A;  3T2W A;  4TKJ A;  3WJD A;  4CDC A;  3VE2 A;  3CWK A;  3AKM A;  3ZZV A;  3VY9 X;  4XMC A;  2IZJ A;  1SLE B;  1BRQ A;  4FGI B;  1YP7 A;  5H9L A;  2RTC B;  2WJR A;  1MM4 A;  1VWB B;  3D96 A;  3STM X;  2R74 A;  4QZT A;  4WBK A;  4Y0S A;  4QZU A;  4JHQ A;  1JV4 A;  3HOL A;  4BX6 B;  1SWP A;  5F2B A;  1SRF A;  4TNN A;  1OEJ A;  2ZSC A;  2OVA A;  1MUP A;  3AAE B;  1O8V A;  4NYR A;  5BYP A;  2JU8 A;  1I04 A;  1N4J A;  4AZN A;  2GTF X;  2Y7S A;  1W6F A;  4O49 A;  3FA9 A;  3X00 A;  1HMR A;  2OY1 O;  4EKV A;  3WJC A;  4BX7 A;  1GGL A;  3BLG A;  1I05 A;  3TZS A;  1OBQ A;  2EU7 X;  2FR3 A;  5LJK A;  4GH7 A;  4FSO A;  3LK3 A;  3TF6 A;  3UEV A;  3BU1 A;  2Z4H A;  3ZWE A;  4KII A;  2IWW A;  1ZNH A;  4CK4 A;  1VWR B;  2MWH A;  5DL7 A;  5HAE A;  4GGZ A;  1OBP A;  4FUV A;  2WWP A;  3CMP A;  1URE A;  2Y32 A;  3QRC A;  3WXQ A;  1QWD A;  1O1V A;  5L8O A;  3LTW A;  2JMB A;  2O62 A;  1KQX A;  4UU3 A;  3P6D A;  5FQ8 E;  2M4L A;  1W5R A;  3FA8 A;  2QM9 A;  3SYB A;  1JQP A;  4Z2P A;  2BSZ A;  4O4U A;  4RUU A;  2CBS A;  2AT0 X;  4XMH A;  4ZGU A;  2F1T A;  4MVL A;  3ZW1 A;  3WU2 O;  2BC3 A;  4ZHC A;  4ZR2 A;  4AKR B;  1GT3 A;  4XMG A;  2OMF A;  2XG6 A;  2Y2X A;  2MHL A;  1R0U A;  1N43 A;  2LA7 A;  1TXL A;  1ZNL A;  4LQZ A;  2ACO A;  4B55 A;  1SLF B;  1OPA A;  1HY2 A;  1GX3 A;  1TOU A;  4MVE A;  4YBU A;  3DA4 A;  1TOW A;  3U03 A;  1SWD A;  5EDB A;  3K3L A;  1YWD A;  2HMB A;  1VYO A;  3VG4 A;  3BRY A;  3D97 A;  3PGS A;  2YNK A;  2IZL B;  2N93 A;  5LJD A;  3PK2 A;  1LCV A;  2MHD A;  3APV A;  3E3C A;  2WUT A;  2AT6 X;  4LZU A;  5FFH A;  1PMP A;  4AFK A;  5ADX L;  2KZ7 A;  3P6G A;  3EMM A;  2E4J A;  3QRA A;  5FQ7 E;  2W2B A;  4N75 A;  5DG4 A;  4XNL A;  3HWF A;  5IO5 A;  4MIS A;  3IFB A;  3FA7 A;  4EEJ A;  3C77 X;  1ORM A;  4E1T A;  4FMS A;  1KT4 A;  4U8U O;  2R4P A;  1B0O A;  4ZGF A;  4K3B A;  5EZ2 A;  2X8T A;  3EBW A;  1QY1 A;  4GHB A;  2YG2 A;  2GTL O;  1GT4 A;  2RTI B;  5AFU K;  4ORX A;  4D6B A;  5B3M O;  3PGU A;  4Z28 A;  4UB8 O;  4CSB A;  4QRL A;  2RN4 A;  3SY9 A;  4HWM A;  2G5L A;  4UU2 A;  1SY1 A;  5HA1 A;  3EM0 A;  1QG5 A;  1BSO A;  1SXX A;  3NQ3 A;  4QYN A;  1HBQ A;  2JOZ A;  3ZW0 A;  3TGB A;  1LEL A;  2CM4 A;  1OPF A;  4ORY A;  1MM5 A;  3DWN A;  5HA0 A;  2RTJ A;  5GV0 A;  3WZQ A;  1Y0G A;  1NC9 A;  2C4I A;  3AA0 B;  3VG3 A;  4YDA A;  1AVE A;  3HK1 A;  4BGF A;  4INN A;  4N59 A;  2WQ9 A;  3O19 A;  2DJG A;  1U18 A;  2RTH B;  1QAB E;  1O1U A;  1AVD A;  2HNX A;  4LKP A;  5HTE A;  3UU2 A;  4LSE A;  1AQB A;  2X32 A;  2FS6 A;  1G90 A;  3EC5 A;  4AYI D;  3LK4 1;  3BDR A;  2BHV A;  1MK5 A;  4I3B A;  4IRW A;  1SLD B;  3KFI A;  4HFO A;  4Y0R A;  2OFR X;  1NBX A;  2XST A;  4LSF A;  1E06 A;  3AAE A;  1GFQ A;  3BX8 A;  2FHL A;  4GU8 A;  8PRN A;  2L67 A;  1X8Q A;  2A8G A;  2N2M A;  3O0E A;  2ANS A;  5D47 A;  4YGZ A;  4KCA A;  1SWU A;  5KAI O;  2J1N A;  3CBS A;  1HMS A;  4ZHG A;  1IFB A;  5F6B A;  4I3D A;  2OL6 O;  3FA6 A;  2RTA A;  4OS8 A;  3LK2 A;  1SWT A;  3RKG A;  2UZ2 A;  5F7G A;  1U0X A;  3UPG A;  1H91 A;  4OS3 A;  4I6S A;  2KW1 A;  5GTI O;  2W2A A;  1ZHY A;  2GH7 A;  2X27 X;  2WEW A;  3T20 A;  5K68 A;  1RST B;  1P4T A;  1CBQ A;  5FQ6 E;  4FES A;  1BEB A;  1IIU A;  4N58 A;  1TW4 A;  2AXT O;  5G38 A;  7PRN A;  2I5Z O;  4Z2V A;  5HZ9 A;  3NP1 A;  5K06 A;  2GC9 A;  3I0A A;  3MX7 A;  2X46 A;  3H3I A;  3WJB A;  2NND A;  1QFT A;  4ML7 B;  1VWJ B;  2CZU A;  4A60 A;  3FR4 A;  2GE4 A;  2JW1 A;  5K67 A;  2BLG A;  1GKA B;  3HW9 A;  2YPV A;  3PED A;  3WVM A;  4RLB A;  4PJ0 O;  3BS0 A;  1NQM A;  2KTD A;  2WEX A;  1ML7 A;  1OSM A;  3NBX X;  3P6F A;  1SY0 A;  3U9P C;  2R4O A;  2QMI A;  2IZA A;  4FZM A;  5EEE A;  4TQ2 A;  2F73 A;  4YH0 A;  3RDM A;  4QGV A;  5HWZ A;  3V8U A;  1PHO A;  2XTQ A;  5D45 A;  3T0S A;  2RTM A;  4Y59 A;  2G78 A;  3S5V A;  2C1Q A;  4L1N A;  2X4M A;  1T16 A;  3B2K A;  2XMX A;  5D5D A;  4ZCB A;  3BRN A;  3T6L A;  3APW A;  2KDY A;  1B8E A;  3OE3 A;  3B2L A;  5B5G A;  1VYF A;  2IZC B;  2W2F A;  3B2I A;  5B66 O;  1N9Y A;  4LKT A;  1DZK A;  1ICN A;  2HLV A;  2KXP B;  1N9M A;  4ZH6 A;  5FEN A;  2IZG B;  3QQ2 A;  4BVM A;  2JQY A;  1LID A;  3RZY A;  2XE3 A;  1BJ7 A;  4EFG A;  1KT5 A;  2GJ5 A;  3T2X A;  4IB7 A;  1T0V A;  4NV8 A;  2OFA A;  1E02 A;  3FW4 A;  2QO4 A;  1X8U A;  3VE1 A;  1SWN A;  1RSU B;  5LKF A;  2FGQ X;  2YMS A;  3GE2 A;  3C76 X;  5T5F A;  4GKC A;  2BS5 A;  5B27 A;  5CE4 A;  2KZ7 B;  2Y3E A;  3WZO A;  5LJC A;  1SRJ A;  1NP1 A;  5KAF O;  3VHH A;  1GX9 A;  2A2G A;  1SWQ A;  1Y9T A;  4GGR A;  1SRI A;  4BUM X;  1ACD A;  1OPB A;  2DM5 A;  1JBH A;  3UEW A;  3SLJ A;  3T24 A;  5H2F O;  1ZNE A;  4OEL A;  3FDC A;  1VWM B;  1LKE A;  3SOT A;  2XTR A;  2LHF A;  5IRW A;  5JDP A;  2AVI A;  3VZU X;  1YWA A;  3SLO A;  5LJE A;  4ON1 A;  4CPF A;  1LF7 A;  4TKB A;  4BBO A;  2I5V O;  4GD9 A;  4IAX A;  1Q9G A;  1MX7 A;  4KRA A;  1VWO B;  1JMX A;  5DL5 A;  3G7X A;  3NR3 A;  4ALB A;  1DFV A; 
#chains in the Genus database with same CATH homology
 2RCQ A;  1S2P A;  2NNQ A;  1HN2 A;  2Y0K A;  3AA0 A;  2PRN A;  3PRN A;  2WQA E;  3U03 A;  2M07 A;  1A18 A;  1SXY A;  3FYX A;  4I3C A;  2MJI A;  1KZW A;  2Q2M A;  3BU9 A;  5EDC A;  2FGR A;  2J4U P;  4NP1 A;  5EDB A;  5HCE C;  3K3L A;  1YWD A;  4ORS A;  3UEU A;  2HMB A;  4COT A;  1SA8 A;  1DF3 A;  4KR4 A;  3TGC A;  2AT3 X;  4AZM A;  1GM6 A;  3VG4 A;  1QJ8 A;  3GAQ A;  4GE1 A;  4YFR A;  3D97 A;  4QYP A;  2YNK A;  1LIB A;  2FLJ A;  3FR5 A;  2N93 A;  1JIW I;  4YKM A;  2ASN X;  2Q2P A;  5LJD A;  4GCQ A;  4EDE A;  2OZQ A;  1JYJ A;  2MHD A;  3SY7 A;  3APV A;  2HYS A;  1KGL A;  3E3C A;  4D6A A;  2WUT A;  1ERB A;  1GFP A;  2AT6 X;  4LZU A;  2HZR A;  5FFH A;  2MNH A;  3P24 A;  4Y0Q A;  3TZG A;  1A3Y A;  4ZHF A;  1L6M A;  1QQS A;  3LHN A;  1PMP A;  4AFK A;  1EQD A;  2RCT A;  3AKN A;  4KT5 A;  5ADX L;  2KZ7 A;  2CBR A;  3HWG A;  4LZV A;  4RLC A;  4IB8 A;  2POA A;  3P6G A;  5B29 A;  5F6Z A;  4QGW A;  2KC0 A;  2A0A A;  5LJG A;  2P8G A;  3EMM A;  2E4J A;  3A2S X;  3NX1 A;  4LSH A;  4A1H A;  4FZL A;  3QRA A;  5FQ7 E;  2W2B A;  5D4A A;  5DG4 A;  4XNL A;  3HWF A;  5IO5 A;  4MIS A;  3IFB A;  1ZND A;  3FA7 A;  4XMF A;  4EEJ A;  1KOI A;  3C77 X;  1ORM A;  4FRT A;  2K4T A;  4E1T A;  3B2J A;  2OFM X;  3CQN A;  4O3X B;  2ACP X;  4C69 X;  2JU7 A;  3HOE A;  3S26 A;  3HWB A;  4FMS A;  4D5U A;  2XKL A;  4ZH9 A;  1QY2 A;  1XKI A;  1ICM A;  1KT4 A;  4U8U O;  2JN3 A;  1ZHW A;  1JZU A;  3PP6 A;  1B0O A;  1BRP A;  3KZA A;  4ZGF A;  4FT6 A;  3LK3 B;  4OMX A;  4AYD C;  1LPJ A;  5IO7 A;  3VPJ E;  3F9D A;  5EZ2 A;  1OEE A;  3QKG A;  4NYQ A;  4Y0P A;  3MVF A;  4GNW A;  4GRJ A;  5KIC A;  2X8T A;  1DZM A;  3EBW A;  1QY1 A;  1KZX A;  4GHB A;  2YG2 A;  2GTL O;  3Q6L A;  1GT4 A;  4OMW A;  3S5X A;  2NP1 A;  4ARH A;  5AFU K;  4ORX A;  1G74 A;  3BX7 A;  4D6B A;  2Q4N A;  1PBO A;  4YMY A;  3WOV A;  2K23 A;  4CSB A;  4QRL A;  1GXA A;  4N7D A;  4QQ1 A;  3O22 A;  4I95 A;  2RN4 A;  3SY9 A;  1RBP A;  2RD7 C;  4HWM A;  3L4R A;  2FWV A;  1KT7 A;  4UU2 A;  5HA1 A;  1SY1 A;  1MDC A;  4DQ4 A;  2ALL X;  3EM0 A;  2F09 A;  1QG5 A;  2ODJ A;  2Y0H A;  1HXU A;  1BSO A;  1SXX A;  3NQ3 A;  1LIE A;  1BWY A;  1PRN A;  4QYN A;  4U8U M;  4FBR A;  3GP6 A;  1HBQ A;  2JOZ A;  1ERX A;  1HXT A;  5BVS A;  3ZW0 A;  3TGB A;  3VG2 A;  3OJY C;  1EII A;  2CM4 A;  3AA7 A;  1QFV A;  1OPF A;  3D95 A;  4JFB A;  3PQU A;  4ORY A;  4CV7 A;  1MM5 A;  5HA0 A;  4MVK A;  4GF4 A;  1DV9 A;  2L9C A;  4IAW A;  3AA6 B;  1JYD A;  2AT5 X;  4NNT A;  5D48 A;  1ZHZ A;  2M06 A;  2QTK A;  1DC9 A;  3AA6 A;  5GV0 A;  4O3Z A;  4A8Z A;  2GTL M;  1E54 A;  3POU A;  4KH8 A;  4YFP A;  1EAL A;  1T68 X;  5HBS A;  1EI5 A;  2LB6 A;  4QGX A;  2Q39 A;  3HWE A;  1JJJ A;  4E1S A;  3FEL A;  4EQA C;  3AA0 B;  3VG3 A;  4ODD A;  3FMZ A;  4YDA A;  5FAZ A;  1HMT A;  4EXZ A;  4PJ2 A;  3HK1 A;  4ZHD A;  3NAD A;  4INN A;  3FIQ A;  4N59 A;  1SY2 A;  2Y0L A;  2A13 A;  2ZAG A;  4GCP A;  2WQ9 A;  3O19 A;  2OVD A;  4JGL A;  2BT9 A;  1SXW A;  1U18 A;  1LIC A;  2OVS A;  1YIV A;  2FTB A;  3NPO A;  1QAB E;  1O1U A;  2HNX A;  5HTE A;  4LKP A;  5HCC C;  3UU2 A;  2FRS A;  5JR8 A;  2XE1 A;  4LSE A;  1RLB E;  5AJB A;  1AQB A;  3SZV A;  2FS6 A;  1G90 A;  4B61 A;  3EMN X;  4AYI D;  3FEP A;  4AZO A;  3I17 A;  2LFO A;  3D4R A;  1FEL A;  2W81 C;  3LK4 1;  3APX A;  3O2Y A;  1ADL A;  3BDR A;  2BHV A;  2R56 A;  4ID2 A;  4M6S A;  5EPQ A;  1QJP A;  4O3W A;  4I3B A;  1UZ2 X;  4ORW A;  5KID A;  1KQW A;  1BM5 A;  4AZP A;  2Q9S A;  3G7G A;  2CM9 A;  3STK A;  2OVE A;  2JMM A;  4GDZ A;  3KFI A;  4HFO A;  4Y0R A;  1KT6 A;  2OFR X;  3WJG A;  4AYE C;  2X8S A;  2XST A;  3PH5 A;  4LSF A;  4IAB A;  4I9S A;  4L3R A;  1E06 A;  1Y9L A;  3AAE A;  1GFQ A;  1IW2 A;  3BX8 A;  4GU8 A;  5F1E A;  4G76 A;  8PRN A;  2L67 A;  1X8Q A;  2JU3 A;  4KC8 A;  2N2M A;  1U17 A;  1IZN B;  3O0E A;  3POX A;  4MIR A;  4O4O A;  2K0L A;  1EW3 A;  1X8O A;  5IYU A;  3RBH A;  3ZUO A;  2ANS A;  1JJX A;  2XE2 A;  4ORU A;  4FSP A;  3F6Z B;  3JS1 A;  4YGZ A;  5D47 A;  1MX8 A;  5H9A A;  4XMD A;  4KCA A;  2O4V A;  4FOZ A;  2F1V A;  1GKA A;  3RSW A;  2J1N A;  4NLJ A;  1A2D A;  3CBS A;  4G75 A;  1AEL A;  3ZI8 A;  4IMO A;  3CR6 A;  1HMS A;  3HTY A;  4ZHG A;  5PRN A;  1KT3 A;  4AYM C;  3NSG A;  1ALB A;  1IFB A;  1CBI A;  5F6B A;  4I3D A;  3FA6 A;  4HPB A;  3UEX A;  2ERV A;  4OS8 A;  3LK2 A;  1IKJ A;  4IB9 A;  3RKG A;  3S60 A;  5F7G A;  1U0X A;  3UPG A;  1H91 A;  2N2L A;  4OS3 A;  5HZQ A;  1YS5 A;  4I6S A;  3SYS A;  4AYN A;  2KW1 A;  2W2A A;  5AFU L;  1GFO A;  1ZHY A;  1MPF A;  4Z3T A;  3F8A A;  2NNE A;  1B56 A;  1LFO A;  4A1Y A;  3C78 X;  5IO6 A;  2X27 X;  2WEW A;  1SXU A;  1THQ A;  1X8P A;  4TKH A;  4I9R A;  4RUN A;  3T1D A;  2K62 A;  3EYC A;  3POR A;  3T20 A;  3KVD D;  1P4T A;  5DL6 A;  1CBQ A;  3CBC A;  2ZAI A;  1D2U A;  1X8N A;  4U9C A;  1FDQ A;  3APU A;  4HPC A;  1H6S 1;  2G79 A;  1N0S A;  5FQ6 E;  3AAA A;  1ZHT A;  1KXO A;  2W80 C;  1E5P A;  3ELX A;  5HZ6 A;  1BEB A;  3C5O A;  4FES A;  3VZT X;  1IIU A;  4ORR A;  1FE3 A;  1TW4 A;  3FEN A;  4PSQ A;  5BVT A;  3JSQ A;  4N58 A;  2AH7 X;  5HTD A;  1X89 A;  4AKM A;  4AZL A;  4FZN A;  7PRN A;  5HZ9 A;  1QJ9 A;  4WHI A;  3DSZ A;  3ZW1 B;  3NP1 A;  3DA3 A;  2R73 A;  5K06 A;  5CYB A;  5ADX K;  1BSQ A;  3B2H A;  4GNY A;  2A3F X;  2GC9 A;  1Q9F A;  3I0A A;  1BH3 A;  2AL0 X;  3MX7 A;  3ELZ A;  5HZ5 A;  1B4M A;  1ZNK A;  1IKE A;  2X46 A;  3H3I A;  4OS0 A;  4YCH A;  3WJB A;  2QO5 A;  3P6E A;  1NGL A;  2NND A;  4ES7 A;  5F58 A;  1VYG A;  1QFT A;  5G26 A;  1BT9 A;  3WBG A;  1GFM A;  3ZW0 B;  1NP4 A;  4ML7 B;  5D8J A;  3FR2 A;  1EUO A;  2CZU A;  2Z4I A;  3MBT A;  4GK9 A;  4IBA A;  1HQP A;  3STN A;  4TKJ A;  5L8N A;  3WJD A;  1YWB A;  4A60 A;  3AAA B;  3FR4 A;  2GE4 A;  3VE2 A;  3CWK A;  2JW1 A;  3AKM A;  2BLG A;  3ZZV A;  1GKA B;  3KFF A;  3VY9 X;  4XMC A;  4JCH A;  4IB6 A;  1AB0 A;  3HW9 A;  2YPV A;  2FT9 A;  4YGG A;  3PED A;  3WVM A;  4D64 A;  3FW5 A;  4WFV A;  4RLB A;  4GZV A;  2KTD A;  2WEX A;  2L68 A;  4YGH A;  1BRQ A;  4FGI B;  1YP7 A;  1ML7 A;  4BOE A;  1OSM A;  3POQ A;  4MVI A;  5H9L A;  3NBX X;  3P6F A;  1SY0 A;  1MM4 A;  3U9P C;  3N91 A;  1D3S A;  2MM3 A;  4RJW A;  1CBR A;  2QMI A;  3ZW2 A;  2AMM X;  3D96 A;  4M7M A;  3STM X;  5KHP A;  2R74 A;  4AKR A;  2L5P A;  4QZT A;  1BLR A;  4WBK A;  3JQO A;  4K19 A;  4AZR A;  4Y0S A;  4FZM A;  5EEE A;  5DL8 A;  5EE2 A;  4QZU A;  2F73 A;  1AVG I;  4TQ2 A;  4YH0 A;  4QGV A;  3RBY A;  5HWZ A;  1XCA A;  4YKO A;  1TVQ A;  1JV4 A;  1G7N A;  3V8U A;  5AJC A;  1PHO A;  2XTQ A;  5D45 A;  2G7B A;  3HOL A;  3T0S A;  6PRN A;  4BQU A;  3ZQ3 A;  2G78 A;  2FS7 A;  3IA8 A;  3S5V A;  3UAQ A;  4R0B A;  2XE5 A;  1LIF A;  1S44 A;  4L1N A;  4HPA A;  3KFG A;  1P6P A;  1ZHX A;  4TNN A;  3VG7 A;  1ZNG A;  1OEJ A;  4NLI A;  3VY8 X;  1SY3 A;  3B2K A;  2XMX A;  1ZRY A;  5D5D A;  2OVA A;  1HXX A;  4ZCB A;  3BRN A;  1BBP A;  2LFU A;  1MUP A;  3AAE B;  3APW A;  1O8V A;  2KDY A;  3KFH A;  2PY1 A;  5LKE A;  1OEK A;  1GX8 A;  1B8E A;  3OE3 A;  2CZT A;  2QOS C;  4NYR A;  2BS6 A;  3B2L A;  4KR8 A;  1VYF A;  4U3Q A;  2W2F A;  3B2I A;  3PEC A;  4GCS A;  1S7D A;  4LKT A;  1DZK A;  5BYP A;  2JU8 A;  1ICN A;  2X8F A;  1YWC A;  1CJ5 A;  1I04 A;  1EPA A;  2HLV A;  3FLL A;  1DZP A;  5AQ6 A;  1IZN A;  2KXP A;  2KXP B;  5DPQ A;  1FEN A;  1QY0 A;  4WFU A;  4AZN A;  4ZJ0 A;  4ZH6 A;  3P02 A;  2GTF X;  2Y7S A;  5FEN A;  4O49 A;  3FA9 A;  4PUX A;  4BVM A;  3BS2 A;  2RA6 A;  3VZW X;  1LID A;  3OBL A;  3RZY A;  1LNM A;  3P6C A;  4TJZ A;  2XE3 A;  1BJ7 A;  4EFG A;  5HCD C;  2ZLD A;  3NQK A;  1HMR A;  3FEK A;  2AT8 X;  3WJC A;  1PEE A;  4FBV A;  1KT5 A;  2GJ5 A;  4KC7 A;  1A57 A;  3NQ9 A;  1T0V A;  4FBO A;  1GGL A;  3BLG A;  2A2U A;  1YUP A;  4IB7 A;  5LJB A;  3AA1 B;  1VPR A;  1E02 A;  3FW4 A;  3BSZ E;  2QO4 A;  3U0D A;  1X8U A;  3VE1 A;  1SMP I;  1I05 A;  3TZS A;  1OBQ A;  2EU7 X;  3LV4 A;  2FR3 A;  5LJK A;  4GH7 A;  4RL9 A;  5LKF A;  2FGQ X;  2YMS A;  4FSO A;  3LK3 A;  3TF6 A;  3UEV A;  3BU1 A;  3BY0 A;  2Z4H A;  3ZWE A;  4KII A;  2KD2 A;  3AA1 A;  1ZNH A;  3GE2 A;  1GFN A;  4AYH A;  4XME A;  3ZUI A;  3C76 X;  4CK4 A;  3AA7 B;  5T5F A;  2MWH A;  4GKC A;  5EED A;  5DL7 A;  5HAE A;  2BS5 A;  5C0N A;  3LK4 2;  1GT5 A;  5B27 A;  5L8I A;  5CE4 A;  2KZ7 B;  3SAO A;  1OBP A;  4FUV A;  4YFQ A;  1G85 A;  2WWP A;  3CMP A;  1URE A;  5LJC A;  1DZJ A;  1G5W A;  1BSY A;  4AW8 A;  2ZFG A;  4D65 A;  1NP1 A;  3WI4 A;  2AKQ A;  3QRC A;  4TLJ A;  3DTQ A;  3WXQ A;  1QWD A;  1IFC A;  1O1V A;  3KQ0 A;  2LBA A;  1GX9 A;  4NW4 A;  2A2G A;  1Y9T A;  4O3Y A;  4O4S A;  2JMB A;  5L8O A;  2O62 A;  2RQ0 A;  1KQX A;  3VG5 A;  5AEO A;  4YBP A;  4UU3 A;  3PPT A;  3P6D A;  5FQ8 E;  2LBV A;  1OBU A;  4RJX A;  1ACD A;  5H9K A;  4BUM X;  2M4L A;  4IMN A;  3JTY A;  5LJH A;  3FA8 A;  2QM9 A;  1EIO A;  1EPB A;  3WJF A;  3SYB A;  1OPB A;  2LKK A;  3PQS A;  2X45 A;  2DM5 A;  3CQR A;  2WSJ A;  2FR2 A;  2GTL N;  3HWD A;  1HBP A;  3NX2 A;  4O4U A;  2QO6 A;  4RUU A;  4ALO A;  4FRX A;  3RWX A;  1JBH A;  2CBS A;  2AT0 X;  2IFB A;  1Z24 A;  4XMH A;  4QAE A;  4ZGU A;  2F1T A;  4XNK A;  4MVL A;  2KT4 B;  3ZW1 A;  3UEW A;  1CBS A;  4F4B A;  4DQ3 A;  3T24 A;  1ZNE A;  4U8U N;  3WJE A;  4ZHC A;  4ZR2 A;  3VG6 A;  4AKR B;  2MO5 A;  1GT3 A;  1E00 A;  1GT1 A;  1YP6 A;  2POR A;  1LKE A;  4ZHH A;  4XMG A;  1I06 A;  1T8V A;  2OMF A;  1X71 A;  3VU1 A;  2XG6 A;  4GET A;  3SOT A;  4FQB B;  2HZQ A;  2WR6 A;  5H9N A;  3WI5 A;  2XTR A;  3K19 A;  3TGA A;  1I4U A;  5FVN A;  4QNI A;  5HZ8 A;  1BXW A;  2LHF A;  5JDP A;  2Y2X A;  2MHL A;  1FEM A;  4AUI A;  3EBK A;  1R0U A;  4ZFX A;  2KTS A;  2LA7 A;  4YDB A;  4NNS A;  4AZQ A;  3P6H A;  3VZU X;  4YCE A;  1TXL A;  1YWA A;  1ZNL A;  4N7C A;  5LJE A;  4ON1 A;  4LQZ A;  4LSI A;  1LF7 A;  2ACO A;  3FYF A;  4TKB A;  3SZD A;  3PH6 A;  3OD9 A;  1PM1 X;  1OPA A;  4IAX A;  1Q9G A;  1MX7 A;  4KRA A;  1TOU A;  4O4X A;  5DL5 A;  1FTP A;  3G7X A;  1EXS A;  4MVE A;  4YBU A;  5H8T A;  5BVQ A;  3DA4 A;  1TOW A;  3LK2 B;  1MVG A;  3NR3 A;  4ALB A;  1DFV A;  4O9S A;  4HPD A;  1CRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...