4O4UA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) mutant trp-176-ala from haemophilus parasuis hp5
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
513
structure length
505
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTYLNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDIKKMVAVACCSNLEYMKFGQLWQQTQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLDPGRHDNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TbpB
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
total genus 116
structure length 505
sequence length 513
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4uA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4uA02
3KVDD 4AYID 1YS5A 4Z3TA 3PQSA 3HOEA 4AYMC 2KC0A 4O4UA 2W80C 4O3WA 4AYDC 4O49A 4U9CA 2W81C 3UAQA 2KDYA 4O3ZA 3PQUA 2LFUA 3HOLA 3VE1A 2Y7SA 4O4XA 3V8UA 4AYNA 5EE2A 4O3XB 4O3YA 3VE2A 2YPVA 5T5FA 4AYEC 4QQ1A
chains in the Genus database with same CATH superfamily
1SWLA 1VWBB 4ORYA 5G38A 1ADLA 4D65A 4IABA 4YBUA 5HWZA 1VWAB 4CK4A 4ORWA 4FRXA 3P6FA 3RDMA 3KFGA 2AT3X 4MVLA 2M4LA 3JS1A 3SY9A 1Z24A 2FTBA 4Z28A 3STKA 3OBLA 3HW9A 1SRIA 4AYDC 4UU2A 1GKAA 4YCHA 4U8UN 2XE5A 5F6BA 1E02A 2Q9SA 2FHLA 4CPIA 2IZLB 1KT6A 1CBIA 3BU9A 1AVGI 3FR5A 5DPQA 5AEOA 2XMXA 3PEDA 1TXLA 2L9CA 2WWPA 4GCQA 1VWJB 2IZIA 5JDPA 1ZNDA 4LZUA 1U0XA 1EW3A 3LK2A 1JMXA 4A60A 4ORUA 1B4MA 4E1SA 1OBQA 2M07A 1E54A 2Y0KA 1EXSA 4N75A 1O1UA 1HXXA 4FSPA 5EPQA 4ZR2A 2PORA 1SWEA 1G85A 2HNXA 4L1NA 3WJDA 1W5RA 3POQA 2ACPX 4WHIA 3T2XA 1HY2A 4GGRA 4GNYA 4BOEA 1RBPA 2HYSA 1VWKB 4OS3A 3EMNX 1E2TA 1A18A 5K06A 2ZLDA 3CBCA 3POUA 2OVAA 3AUMO 4O4OA 3WBGA 2QTKA 4U46A 1OEEA 3D97A 1T16A 1E00A 5H2FO 2WQAE 1X71A 3WU2O 1HBQA 4A1HA 3CR6A 3V8UA 4FBRA 1KQXA 2A5BA 3APXA 5EE2A 3ZQ3A 3PDFA 2XE2A 2MHDA 1SWFA 4TQ2A 3KVDD 4Z3TA 2GTLN 4D64A 3D4RA 1U17A 2VFCA 5IYUA 4U3QA 1Y9TA 1SWPA 4AFKA 4FSOA 2G79A 4FOZA 3RWXA 1VYGA 2UYWA 4GCPA 2G7BA 3MVFA 4FRTA 4YDAA 3KZIO 4OEMA 1RXKA 4DQ3A 3C76X 3O19A 4GE1A 5HZ5A 5K68A 3RDQA 3SLTA 3BS0A 2G5LA 3CMPA 2RTCB 2IZCB 4N7CA 1T1LA 1OSPO 3SLOA 1GT5A 3O22A 3FIDA 1BSOA 1STPA 2VFBA 2QM9A 1SWJA 5D5DA 2FHNX 1SY3A 3VPJE 4QZUA 2X45A 1G74A 1SWCA 5F58A 5HTEA 4O3XB 4FESA 1YS5A 4O9SA 1THQA 2AT8X 1MEPA 3GP6A 3TZGA 4YCEA 1GFQA 3JCUO 2EU7X 2FWVA 3HK1A 1BRQA 4NV7A 5HCEC 1RSUB 4MVKA 2Y32A 2F01A 3T24A 1CBQA 1Q9FA 3B2HA 3T6FA 4C4VA 2R74A 2RCQA 5LJDA 2BSZA 4YDBA 1KQWA 3RE6A 3S60A 3SYSA 5LJEA 3MBTA 2WSJA 4NYRA 2XE3A 4XMGA 3WZOA 4C00A 1VWFB 3KFHA 1ZNHA 1HMSA 3P6HA 4XNLA 1OBUA 5D48A 1SXUA 4YBPA 1YIVA 5ADXK 4ZJ0A 3EW1A 1HQPA 2GTLO 3D96A 3JSQA 2RTFB 3LTWA 3DA4A 3RDSA 2RQ0A 3DWOX 4LZVA 4K3CA 3HPEA 2Q2MA 3LV4A 3ZW0A 1KOIA 2AH7X 1KT7A 4GCSA 2RTMA 3P24A 2W2BA 1SWOA 2X27X 1GX3A 2QO5A 1RXJA 5B11O 4YVBA 1EPBA 5EDCA 3HTYA 3AEHA 4KH8A 2F73A 1X8UA 2A2UA 1HQQA 4RUUA 3SZDA 1JIWI 4QQ1A 2IZDB 3HWGA 2X46A 1DC9A 1ZNKA 4IAXA 2KC0A 4GHBA 2AXTO 3VGWA 4RJWA 2W2AA 1NP1A 4XMFA 1B56A 1SWHA 1PM1X 2JU3A 4JNJA 3OD9A 1ZNLA 1OBPA 4AZNA 1ACDA 5LJHA 3I17A 5F6ZA 4I60A 2WR6A 3ZUIA 4Y0RA 2JQYA 2MNHA 1LDQA 2X4MA 2FR3A 3VE1A 1MVGA 2HKDA 1P4TA 2GJ5A 4JO6A 3BDRA 4N74A 4MISA 2F09A 5HZ8A 5EEDA 3T1DA 5IRAA 4C5PA 4MVEA 1ICMA 5HA0A 1LNMA 1Y0GA 3HWBA 5G39A 3EC5A 1L6MA 4O3YA 3VZUX 4UB8O 4WFUA 3FYFA 4BX6A 1MM9A 3FA9A 1QJ9A 2BLGA 2XE1A 2DJFA 4IBAA 2RTOB 1PBYA 5L8NA 3QQ2A 5GTIO 4D5UA 2IWVA 1WBIA 4JCHA 4L3RA 2RTDB 4BX6B 1KZWA 3UEXA 3RDXA 1MUPA 1BM5A 2PI3O 3A0HO 4IMOA 2XG6A 1LDOA 1BSYA 2CM4A 3MG5A 2M06A 2QO4A 4K3BA 2Q4NA 2YNKA 1P6PA 1GXAA 1SWKA 2RTGB 4LKTA 3AA0B 5FENA 1A57A 3VHMA 5H9AA 1GFMA 4O4UA 1IKJA 5HBSA 1JYJA 3VG6A 5B2AO 4I95A 4BQUA 1NQNA 5D45A 3TGAA 4AZLA 1LICA 5HZ9A 2LKKA 4LKPA 3OJYC 8PRNA 1MPFA 1DZPA 5B5GA 1MX7A 4KR4A 2XTRA 1X89A 1Y53X 1SWGA 3BRYA 3SLJA 4NYQA 2A13A 4BVMA 3PRNA 5F1EA 1WUBA 1PMPA 1BLRA 1SY2A 3KFIA 5HAEA 4IMNA 1SXWA 2AF5A 4I3BA 1SLDB 2RTBB 1JBHA 1N7YA 1BJ7A 1KL5A 2ZFGA 3NQKA 2J1NA 4QRLA 4OELA 2KXPB 1OPBA 4RJXA 3ZZVA 1ZNGA 2LHFA 4QAEA 5D47A 3PECA 3RE5A 5E79O 2WJRA 3AA7A 2AL0X 1W6FA 4D6BA 3WVMA 1I05A 4KCAA 3HOLA 3EBKA 3H3IA 5CSEA 4OS8A 1VPRA 2OFMX 1SRGA 2Q39A 3G7XA 1I4UA 4GETA 5TISO 1ICNA 5KAIO 3P6EA 1N4JA 1YP6A 2R4PA 4MEEA 3PQSA 3VG4A 3PF1A 1CRBA 2RTLA 1A3YA 2DJGA 1VWLB 4U9CA 5HZ6A 4I9SA 2LBAA 5FVNA 1X8QA 4AYHA 2ASNX 2KTDA 3TGCA 1JZUA 3PH6A 4ES7A 3A2SX 5B10O 2OF8A 1GFNA 3BRNA 4KC8A 4QGWA 2MHLA 4AYID 1VWEB 3FR2A 2JMMA 4N58A 1OEKA 5LJCA 3I0AA 5F2BA 3VG3A 3EBWA 1GKAB 1KT5A 2P8GA 3NR3A 2KDYA 3PQUA 4AZRA 3LK3A 4RLCA 4GNWA 1X8NA 1BEBA 3BU1A 1TW4A 1EI5A 4GDAA 2QO6A 2ANSA 2X8FA 1OPFA 1ORMA 2N93A 3WYQA 3WJBA 2K23A 4ALOA 4FBVA 3D95A 2MO5A 5KICA 3LK3B 2C1QA 4ORXA 3ZW2A 1VYFA 1ZRYA 1NC9A 3NX1A 2OY7A 3LK2B 1OSMA 5G3AA 1MOYA 4TKHA 2KW1A 1MM4A 2XTQA 4ZGFA 3Q6LA 3AA6A 5HA1A 5L8OA 2A2GA 4LSIA 3APVA 2WVPA 1SLEB 2CZUA 4JGLA 4LSFA 4HFOA 1GX9A 3PORA 4ALBA 4FQEA 1N0SA 2JU7A 5DL5A 4ARHA 3NQ9A 1N43A 1FE3A 2UZ2A 1EUOA 2IWWA 4QYPA 4IB6A 4I3DA 4ZHDA 4YFQA 1X8PA 3NP1A 4AZMA 3MX7A 3VHHA 3N91A 3TGBA 2IZAA 1VWNB 1FENA 2HZRA 1DFVA 4NV8A 4EKVA 1JJJA 4YFRA 3DWNA 1N9MA 5AFUK 2RTKA 4DNEA 2JMBA 2CM9A 4AZPA 2OZQA 2ZAGA 3EYCA 5FQ7E 5HCDC 4PJ0O 2IZGB 5C0NA 4KC7A 2OYBO 1JMZA 5F7GA 4U8UO 4WFVA 2BC3A 4YGGA 4FZLA 3FW5A 4CSBA 1YWCA 2HZQA 4GU8A 1K24A 3ZI8A 2C1SA 5D4AA 2FR2A 3NADA 1G5WA 1LIEA 2J4UP 4PR7A 2OMFA 3CQNA 3P6DA 4EXZA 3WOVA 3HOEA 3LK41 4AYMC 3EW2A 4GF4A 3AAEA 3HWEA 4BCSA 2IZFB 2XSTA 3ZUOA 1AB0A 2L68A 2R88A 4LSHA 2NNEA 4AZOA 2OY1O 2ZAIA 1EIIA 1ZHTA 2A0AA 2G78A 4GGTA 4CV7A 2QCBA 5H9LA 3ZWEA 1VWIB 4CDCA 1NQMA 3AAEB 1AELA 2R4LA 1QABE 3DTQA 4CTDA 3HWDA 1SLFB 4PSQA 1E5PA 4WBKA 1ZHWA 3U0DA 4D6AA 4PJ2A 1QY0A 1H91A 4FUVA 2HLVA 2OL7A 2LBVA 5IO5A 1RLBE 2RTRB 5IRWA 1IJ8A 4XNKA 4O4SA 5B66O 4GUZA 4QNIA 1PRNA 5HTDA 1VWRB 4HPDA 2FKJA 5BVTA 3APUA 1Y9LA 4CPHA 3AAAA 4C4VB 3WJCA 1HXZA 4AUIA 2QMIA 5BVQA 2OVSA 2YG2A 1HBPA 3ELZA 2IZEB 1VWGB 1GM6A 1GT1A 4TJZA 3PP6A 4CPHB 2OF9A 4IAWA 4GGZA 2AT0X 4OMWA 3UEWA 5PRNA 3G7GA 4OKAA 5KHPA 5H8TA 1S5LO 1IW2A 3B2KA 4JHQA 5ADXL 3CKGA 2KT4B 5B5FA 3WI5A 1E06A 1RAVA 3ZW0B 3EM0A 5DL7A 1GFPA 1ZHYA 1FTPA 3BRZA 4QYNA 3Q34A 1VWQB 3SOTA 4GJVA 1BSQA 2BS6A 1IZNA 2O4VA 3RY2A 3FR4A 4Y0PA 2RTAA 4C69X 3ZW1A 1TOWA 2Y7SA 4M6SA 1Y52X 2FGQX 3VZTX 2X32A 5H9NA 1FDQA 2KZ7A 2AT6X 1SXYA 1SRJA 2I5ZO 2KTSA 1IZNB 3RDUA 3NQ3A 3WYPA 2LB6A 5FFHA 3WJGA 3RBHA 2WUTA 3AKNA 2ACOA 2KZ7B 1KL4A 1K3BA 3VG7A 1UYOX 5EDBA 2F1TA 1TOUA 1SWTA 3KFFA 2PY1A 2MWHA 5AQ6A 3BLGA 3SYBA 3GAQA 1GT4A 4TNNA 1T68X 3FENA 1NGLA 2AMMX 2AT5X 1QJ8A 2OL6O 1LCWA 3CWKA 5DL8A 2OY8A 2X8TA 2W80C 4CDDA 3AA1A 5BVSA 2WEXA 1VWHB 4NNSA 4EQAC 3STNA 2BT9A 3K3LA 1CJ5A 4TKBA 3WZQA 3VZWX 2OFRX 5KIDA 1VWOB 3FDCA 4TLJA 3WI4A 4YKOA 2K4TA 2KD2A 2LA7A 3IA8A 4ODDA 4LSEA 3CKFA 2GH7A 4JFBA 1VWMB 1LF7A 3RBYA 1KFFA 4GZVA 1Q9GA 3WJEA 4GK9A 2JGSA 1R0UA 2MM3A 1NP4A 1LCZA 4HPCA 4ZH9A 2RTPB 1HXLA 2IZBA 4AW8A 3T0SA 3LHNA 1MX8A 1H6S1 3KQ0A 1U18A 1EIOA 2PRNA 2Y3FA 2FT9A 3C77X 4NNTA 4BGFA 2R8AA 4ZH6A 2RTQB 4FQBB 1HXUA 2G8CO 1D2UA 3DSZA 4LQZA 4INNA 2BS5A 2ZSCA 4A8ZA 1ZHZA 4ML7B 4BX7A 1UZ2X 2IFBA 4BBOA 1SWAA 2X56A 1OPAA 1QG5A 1BH3A 3K19A 5AJCA 2OY5O 1LELA 3T2WA 4OMXA 3BY0A 5B29A 4AKRA 2K62A 5LJBA 1S44A 3FEPA 1DZJA 2RTIB 5CE4A 2RTNB 3SY7A 1QWDA 1ERXA 4XMEA 1SWRA 3VY9X 3QRAA 1DZMA 1SWBA 4R0BA 2R4NA 1B0OA 4NW4A 1KT4A 4ORSA 3EMMA 4NP1A 2RTEB 1UREA 1PHOA 1YWDA 5IO6A 1MM5A 5IXGA 3RKGA 2RD7C 4MVIA 1LIBA 1ML7A 1FJ1E 3WZNA 4NLJA 1CBRA 4KRAA 3AA7B 3T6LA 2IZJA 3FELA 5G26A 4IB7A 2OFAA 1HMTA 1SXXA 3O0EA 4M7MA 7PRNA 3DZMA 2DM5A 5B3MO 3UPGA 4DQ4A 3VU1A 2RTJA 1O1VA 1BBPA 3VE2A 1QJPA 1XCAA 4GRJA 4QGVA 1PEEA 4PUXA 4MIRA 4O49A 3SZVA 2L67A 4IB9A 4G76A 1GGLA 2FGRA 5AJBA 2VDFA 2FS6A 4CDEA 5FQ8E 2RN4A 4A1YA 4QGXA 4FMSA 2K0LA 3PPTA 5DG4A 2A3FX 2R56A 4U8UM 3NJTA 1JJUA 2A8GA 4Z27A 1S7DA 5CYBA 5LKFA 1JJXA 4HPBA 3POXA 2CZTA 2WPUA 4ZHFA 2ODJA 4YGZA 1SWSA 4AYNA 4XMCA 3FW4A 4Y5DA 1G7NA 1FEMA 5B27A 4YMYA 4I3CA 3U03A 3BX8A 1A2DA 1STSB 4HWMA 3VG2A 1HN2A 2CBSA 1ERBA 5LJKA 1QQSA 4KIIA 2JU8A 2FRSA 4YFPA 1SWDA 1I04A 4IRWA 1DZKA 1W4TA 3AA6B 3PK2A 2F1CX 1XKIA 4UB6O 4AZQA 4DCBA 1D3SA 2JN3A 4N7DA 1KXOA 2RCTA 1BXWA 1SLGB 1AVDA 4EDEA 4E1TA 4XMHA 1VYOA 3F6ZB 4I6SA 3HWFA 2IZKA 3SAOA 2AVIA 5EZ2A 1RXHA 3UEVA 4OS0A 4FZMA 6PRNA 4B61A 4UU3A 4CDFA 4ZHGA 2CAMA 4FT6A 3DA3A 3VY8X 2BHVA 2RA6A 1N9YA 4FZNA 4FGIB 3BS2A 1QY2A 4ORRA 1B8EA 1Y55X 1QFVA 4I9RA 1I9HA 2X55A 3FYXA 4Z2OA 3OE3A 2OVDA 3FA6A 5AFUL 3F9DA 2GTLM 2POAA 2Z4IA 1GX8A 2Q2PA 2F1VA 3C78X 1SA8A 2Z4HA 4AYEC 1SWQA 4GDZA 3JTYA 5K67A 2JW1A 1YP7A 4XMDA 3JQOA 2XKLA 4O3ZA 2GC9A 3F8AA 2HMBA 1YWBA 2QOMA 3P6CA 1TVQA 3BX7A 4BUMX 1VWCB 2FGSA 5DL6A 1NDJA 4ZCBA 3VG5A 3B2JA 1LIDA 1BRPA 5IRUA 1GFOA 1SY0A 4Z6JA 5IO7A 3T20A 1BWYA 1T0VA 2OVEA 2IZHB 4ID2A 4AKMA 3RDOA 3WZPA 5B5EO 3U9PC 4IB8A 3VHIA 1IIUA 1LCVA 2ERVA 2R73A 1HMRA 3PGUA 4Y0QA 4Z2VA 5GV0A 1DV9A 5L8IA 4ZHCA 4G75A 4ZGUA 2C4IA 2O62A 3PGRA 5L3YA 4KR8A 3E3CA 3LK42 1ALBA 5BYPA 3AAAB 1AVEA 1KGLA 3L4RA 4RLBA 1CBSA 3D9WA 3C5OA 3B2LA 1JQPA 1O8VA 1LPJA 2FKGA 2X34A 1QFTA 1SWNA 1SY1A 3RSWA 1BT9A 3UU2A 3WXQA 1X8OA 3FA7A 4N59A 3TZSA 5T5FA 3CQRA 5FAZA 5KAFO 1SMPI 2AKQA 3TF6A 3RZYA 1ZHXA 2X9KA 3KZAA 3FEKA 3APWA 3FLLA 3S5XA 1JYDA 4KT5A 4B55A 1VWPB 3PGSA 3NX2A 1T8VA 5HZQA 1PTSA 4ZFXA 1FELA 1LFOA 4CPEA 3O2YA 1LIFA 2JOZA 4HPAA 4CPFA 3ZW1B 3PH5A 2N2LA 3SZJA 2W81C 1GT3A 2MF6A 2LFUA 5H9KA 1IFBA 4NLIA 3STMX 1I78A 2Y3EA 4GD9A 1LKEA 2GTFX 1DF3A 1SREA 5HCCC 3KVNA 1EPAA 1LUQA 1EALA 3B2IA 1SWUA 2RTHB 3RY1A 3CBSA 1OEJA 1DF8A 1KZXA 3ELXA 3MM0A 2Y2XA 2GE4A 1IKEA 4COTA 2MJIA 3X00A 2OFBA 1MDCA 2LFOA 2L5PA 1SRFA 5LKEA 5GTHO 4BJ8A 2I5VO 4GJSA 4YKMA 1JV4A 3AA1B 4EEJA 1G90A 1IFCA 2FLJA 1QY1A 1NBXA 2R4OA 2ALLX 5JD2A 1MK5A 4GH7A 1EQDA 2X8SA 4Y0SA 1I06A 4YH0A 4ON1A 3NSGA 3FMZA 2QOSC 4O4XA 3FA8A 4TKJA 5JR8A 3AA0A 2NNQA 2NNDA 4GKCA 4O3WA 3UEUA 2WQ9A 1KL3A 4YGHA 2OL8O 1HXTA 2NP1A 1STRB 1VWDB 1YUPA 2FS7A 3P02A 4Z2PA 2N2MA 1YWAA 1AQBA 4FBOA 3WJFA 4BX5A 1ZNEA 2WEWA 1KT3A 2Y0LA 3UAQA 2A5CA 3IFBA 2R89A 3SZHA 3NPOA 4K19A 3QRCA 3AKMA 4IL6O 4QZTA 3S5VA 2YMSA 4ZHHA 4BX5B 3FIQA 2E4JA 2CBRA 1UYNX 4BX7B 5CHKA 3GE2A 1PBOA 4Y59A 4RL9A 5EEEA 3S26A 2KXPA 2Y0HA 3P6GA 2W2FA 4RUNA 3BSZE 4EFGA 5D8JA 3A0BO 4AKRB 4F4BA 5LJGA 5FQ6E 1S2PA 1RSTB 3NBXX 2WJQA 3SZIA 1SRHA 3QKGA 2YPVA
chains in the Genus database with same CATH topology
3F6ZB 5BVQA 4I6SA 3FA9A 3HWFA 2BLGA 1QJ9A 2XE1A 4ORYA 1ADLA 3SAOA 4D65A 2OVSA 2YG2A 4IABA 5EZ2A 4YBUA 4IBAA 3UEVA 1HBPA 4OS0A 5L8NA 3ELZA 5HWZA 4FZMA 4CK4A 6PRNA 4ORWA 1GM6A 4FRXA 4B61A 4D5UA 1GT1A 3P6FA 4TJZA 4JCHA 4UU3A 3PP6A 3KFGA 4L3RA 2AT3X 4ZHGA 4IAWA 4MVLA 1KZWA 4FT6A 3UEXA 3DA3A 3VY8X 2BHVA 2M4LA 2AT0X 3JS1A 3SY9A 1Z24A 2FTBA 1MUPA 2RA6A 4OMWA 3UEWA 1BM5A 3STKA 4FZNA 4FGIB 5PRNA 3BS2A 1QY2A 4ORRA 3OBLA 3G7GA 5KHPA 1B8EA 1QFVA 4I9RA 4IMOA 2XG6A 5H8TA 3FYXA 3HW9A 1BSYA 4AYDC 2CM4A 1IW2A 3B2KA 2M06A 4UU2A 1GKAA 2QO4A 3OE3A 5ADXL 2KT4B 2OVDA 3FA6A 5AFUL 4YCHA 3WI5A 2Q4NA 4U8UN 2XE5A 3F9DA 5F6BA 1E06A 1E02A 2Q9SA 2GTLM 2POAA 2Z4IA 1GX8A 2YNKA 3ZW0B 1P6PA 2Q2PA 3EM0A 5DL7A 2F1VA 3C78X 1GXAA 4LKTA 1SA8A 2Z4HA 4AYEC 1GFPA 1KT6A 1CBIA 3AA0B 3BU9A 1ZHYA 1FTPA 5FENA 4GDZA 3JTYA 4QYNA 1A57A 1AVGI 3SOTA 2JW1A 1YP7A 5H9AA 3FR5A 1GFMA 1BSQA 4O4UA 4XMDA 1IKJA 2BS6A 3JQOA 5DPQA 5HBSA 1JYJA 5AEOA 1IZNA 3VG6A 2O4VA 2XMXA 3FR4A 3PEDA 1TXLA 4Y0PA 4I95A 2XKLA 4C69X 4O3ZA 2GC9A 3F8AA 2L9CA 3ZW1A 4BQUA 3TGAA 5D45A 2WWPA 1TOWA 2HMBA 4AZLA 4GCQA 1YWBA 1LICA 5HZ9A 2Y7SA 2LKKA 5JDPA 4M6SA 4LKPA 1ZNDA 4LZUA 3OJYC 2FGQX 3VZTX 5H9NA 1FDQA 3P6CA 2KZ7A 2AT6X 1U0XA 8PRNA 1SXYA 1TVQA 1MPFA 1EW3A 3LK2A 1DZPA 2KTSA 3BX7A 1MX7A 1IZNB 4KR4A 2XTRA 1X89A 3NQ3A 4A60A 4ORUA 4BUMX 1B4MA 4E1SA 2LB6A 5FFHA 3WJGA 4NYQA 1OBQA 3RBHA 2WUTA 5DL6A 4ZCBA 2M07A 3AKNA 3B2JA 3VG5A 1E54A 1LIDA 2Y0KA 2ACOA 1EXSA 2A13A 1BRPA 4BVMA 2KZ7B 3PRNA 1GFOA 5F1EA 1O1UA 3VG7A 1HXXA 1SY0A 5IO7A 3T20A 5EDBA 1BWYA 5EPQA 2F1TA 1PMPA 4ZR2A 1TOUA 4FSPA 1BLRA 1SY2A 2PORA 1T0VA 2OVEA 3KFIA 3KFFA 5HAEA 2PY1A 4IMNA 1SXWA 2MWHA 1G85A 4I3BA 5AQ6A 3BLGA 1JBHA 2HNXA 4L1NA 4ID2A 3SYBA 3WJDA 1BJ7A 4AKMA 2ZFGA 3NQKA 3GAQA 2J1NA 4QRLA 3POQA 1GT4A 4TNNA 2ACPX 4WHIA 1T68X 2KXPB 3U9PC 4IB8A 3FENA 1IIUA 1OPBA 4RJXA 1NGLA 2ERVA 2AMMX 2R73A 4GNYA 4BOEA 3ZZVA 1HMRA 4Y0QA 1ZNGA 1RBPA 2LHFA 2HYSA 4QAEA 5D47A 2AT5X 1QJ8A 5GV0A 4OS3A 3PECA 1DV9A 3EMNX 3CWKA 5L8IA 5DL8A 4ZHCA 3AA7A 1A18A 2AL0X 5K06A 4G75A 2ZLDA 4ZGUA 2X8TA 3CBCA 2W80C 3AA1A 3VG3A 2OVAA 4D6BA 3POUA 5BVSA 3WVMA 1I05A 4O4OA 2WEXA 2O62A 3WBGA 2QTKA 1OEEA 4NNSA 4EQAC 3D97A 4KCAA 3STNA 4KR8A 3E3CA 1E00A 3HOLA 3LK42 2WQAE 1X71A 2BT9A 3EBKA 3H3IA 1HBQA 4OS8A 1VPRA 3K3LA 2OFMX 1CJ5A 1ALBA 2Q39A 3G7XA 4A1HA 4TKBA 3CR6A 3V8UA 1I4UA 4GETA 4FBRA 1KQXA 1ICNA 5BYPA 3APXA 3AAAB 5EE2A 3ZQ3A 3VZWX 2OFRX 5KIDA 2XE2A 4TLJA 2MHDA 3WI4A 4TQ2A 4YKOA 2K4TA 3P6EA 3KVDD 1YP6A 2KD2A 2LA7A 1KGLA 3IA8A 3L4RA 4Z3TA 3PQSA 2GTLN 3VG4A 4RLBA 4D64A 4ODDA 1CBSA 4LSEA 3D4RA 3C5OA 4JFBA 3B2LA 1CRBA 1O8VA 1LF7A 1U17A 1A3YA 3RBYA 4U9CA 5HZ6A 4I9SA 4GZVA 2LBAA 1Q9GA 5FVNA 1LPJA 1X8QA 4GK9A 3WJEA 2ASNX 4AYHA 2KTDA 3TGCA 1JZUA 1R0UA 1QFTA 1SY1A 3PH6A 3RSWA 4ES7A 1BT9A 3A2SX 2MM3A 1NP4A 4U3QA 5IYUA 1Y9TA 3UU2A 3WXQA 4AFKA 4FSOA 1X8OA 3FA7A 2G79A 1GFNA 4HPCA 4FOZA 4N59A 3BRNA 4KC8A 3RWXA 1VYGA 4QGWA 4ZH9A 3TZSA 4GCPA 5T5FA 2G7BA 2MHLA 3CQRA 3MVFA 5FAZA 4FRTA 4AYID 3FR2A 1SMPI 2JMMA 2AKQA 4YDAA 4N58A 1OEKA 3TF6A 5LJCA 3I0AA 3RZYA 1ZHXA 4AW8A 4DQ3A 3T0SA 3KZAA 3LHNA 3FEKA 1MX8A 3APWA 1GKAB 1KT5A 2P8GA 3C76X 3EBWA 3FLLA 3O19A 4GE1A 5HZ5A 1H6S1 3NR3A 3S5XA 3KQ0A 2KDYA 1U18A 3PQUA 1JYDA 4KT5A 4AZRA 3LK3A 4RLCA 4GNWA 3NX2A 1T8VA 1X8NA 3CMPA 1BEBA 3BU1A 1EIOA 5HZQA 2PRNA 1TW4A 1EI5A 2FT9A 3C77X 2QO6A 4N7CA 4NNTA 4ZFXA 1FELA 2ANSA 2X8FA 1LFOA 1OPFA 4ZH6A 1ORMA 1GT5A 2N93A 4FQBB 1HXUA 3O22A 3O2YA 1LIFA 2JOZA 1BSOA 2K23A 3WJBA 1D2UA 3DSZA 4LQZA 4ALOA 4FBVA 4INNA 3D95A 4HPAA 2QM9A 2BS5A 2MO5A 5KICA 5D5DA 3ZW1B 4A8ZA 3LK3B 1ZHZA 3PH5A 4ML7B 1UZ2X 2IFBA 2N2LA 2W81C 4ORXA 1SY3A 3ZW2A 1GT3A 3VPJE 2LFUA 4QZUA 1VYFA 5H9KA 1IFBA 2X45A 1OPAA 1QG5A 1G74A 4NLIA 1BH3A 1ZRYA 3K19A 5AJCA 3STMX 3NX1A 5F58A 5HTEA 4O3XB 3LK2B 1OSMA 1LKEA 4OMXA 4TKHA 4FESA 3BY0A 2KW1A 1YS5A 4O9SA 5B29A 1THQA 2GTFX 1DF3A 1MM4A 2XTQA 2AT8X 4ZGFA 3GP6A 3Q6LA 3AA6A 5HA1A 4AKRA 2K62A 5LJBA 3TZGA 5HCCC 1EPAA 1S44A 4YCEA 1GFQA 5L8OA 2A2GA 4LSIA 3APVA 2EU7X 3FEPA 1DZJA 2FWVA 3HK1A 1BRQA 2CZUA 3B2IA 4JGLA 5HCEC 1EALA 4LSFA 5CE4A 4HFOA 1GX9A 3SY7A 4MVKA 3PORA 3CBSA 1QWDA 4ALBA 1OEJA 1ERXA 1N0SA 4XMEA 3T24A 3VY9X 1CBQA 1Q9FA 1DZMA 2JU7A 3QRAA 4R0BA 3ELXA 1KZXA 5DL5A 4ARHA 3B2HA 1B0OA 4NW4A 1KT4A 3NQ9A 4ORSA 2R74A 2RCQA 5LJDA 4YDBA 1KQWA 1FE3A 2Y2XA 2GE4A 3EMMA 3S60A 3SYSA 4NP1A 1EUOA 1IKEA 4COTA 1UREA 4QYPA 4IB6A 2MJIA 1PHOA 1YWDA 5LJEA 3MBTA 5IO6A 4I3DA 1MM5A 2WSJA 4ZHDA 4YFQA 1X8PA 3RKGA 2RD7C 4NYRA 2XE3A 1MDCA 4MVIA 4XMGA 2LFOA 3NP1A 1LIBA 2L5PA 4AZMA 3MX7A 3KFHA 1ZNHA 1ML7A 1HMSA 4AUIA 3N91A 5LKEA 3TGBA 3P6HA 4NLJA 1CBRA 4XNLA 4KRAA 3AA7B 1OBUA 1FENA 2HZRA 1DFVA 3FELA 4YKMA 1JV4A 1SXUA 5D48A 4IB7A 1YIVA 4YBPA 5G26A 5ADXK 1JJJA 3AA1B 4YFRA 4ZJ0A 5AFUK 1HQPA 2GTLO 1HMTA 3D96A 3JSQA 4EEJA 1SXXA 2JMBA 3O0EA 1G90A 1IFCA 2CM9A 4M7MA 7PRNA 2FLJA 1QY1A 4AZPA 2OZQA 2ZAGA 3DA4A 3EYCA 2RQ0A 2ALLX 2DM5A 5FQ7E 5HCDC 3UPGA 4GH7A 3VU1A 4DQ4A 1EQDA 4LZVA 5C0NA 4KC7A 2X8SA 4Y0SA 1I06A 5F7GA 2Q2MA 4U8UO 4YH0A 1O1VA 1BBPA 4ON1A 4WFVA 3VE2A 3NSGA 4YGGA 3FMZA 3LV4A 2QOSC 4O4XA 1KOIA 3ZW0A 3FA8A 2AH7X 1QJPA 1KT7A 4FZLA 1XCAA 4TKJA 3FW5A 5JR8A 4CSBA 4GCSA 4GRJA 3AA0A 2NNQA 4QGVA 3P24A 2W2BA 1YWCA 2HZQA 1PEEA 2X27X 4PUXA 2NNDA 2QO5A 4GU8A 4GKCA 4O3WA 4MIRA 4O49A 3SZVA 2L67A 3ZI8A 4IB9A 2WQ9A 3UEUA 4G76A 5D4AA 1GGLA 1EPBA 2FR2A 3HTYA 4YGHA 5EDCA 3NADA 1G5WA 1HXTA 1LIEA 5AJBA 2FGRA 2NP1A 4KH8A 2F73A 2J4UP 1X8UA 2FS6A 1YUPA 2A2UA 2FS7A 2OMFA 3P02A 3CQNA 5FQ8E 2RN4A 4RUUA 4A1YA 1JIWI 4QGXA 4QQ1A 3SZDA 4FMSA 3HWGA 3P6DA 2K0LA 2N2MA 1YWAA 3PPTA 1AQBA 4FBOA 2X46A 3WJFA 1DC9A 3WOVA 4EXZA 1ZNKA 2A3FX 2R56A 5DG4A 1ZNEA 4U8UM 3HOEA 3LK41 4AYMC 4IAXA 2KC0A 4GF4A 3AAEA 3HWEA 4GHBA 2WEWA 1S7DA 2XSTA 5CYBA 1AB0A 5LKFA 3ZUOA 2L68A 4HPBA 1JJXA 1KT3A 2Y0LA 3POXA 2CZTA 4RJWA 2W2AA 3UAQA 4ZHFA 4LSHA 1NP1A 4XMFA 2ODJA 2NNEA 3IFBA 1B56A 4AZOA 3NPOA 4YGZA 2ZAIA 4K19A 1EIIA 4AYNA 1PM1X 1ZHTA 3QRCA 3AKMA 2A0AA 2G78A 4QZTA 4XMCA 3S5VA 2JU3A 2YMSA 4CV7A 3OD9A 4ZHHA 1ZNLA 3FW4A 1OBPA 1G7NA 1FEMA 5H9LA 4AZNA 3ZWEA 1ACDA 3FIQA 5B27A 2E4JA 4YMYA 4I3CA 3AAEB 3U03A 2CBRA 1AELA 3BX8A 5LJHA 1A2DA 3I17A 4HWMA 5F6ZA 1QABE 3DTQA 3VG2A 1HN2A 3GE2A 2CBSA 2WR6A 3HWDA 1ERBA 5LJKA 1QQSA 3ZUIA 4Y0RA 4KIIA 2MNHA 1PBOA 2JU8A 4PSQA 1E5PA 4RL9A 2FR3A 4WBKA 5EEEA 2FRSA 3VE1A 3U0DA 4D6AA 3S26A 1MVGA 1ZHWA 4PJ2A 2KXPA 1P4TA 2Y0HA 3P6GA 2W2FA 4YFPA 2GJ5A 3BDRA 1QY0A 1H91A 4MISA 4FUVA 2HLVA 4RUNA 3BSZE 2LBVA 4EFGA 5IO5A 2F09A 5D8JA 1RLBE 5HZ8A 1I04A 5EEDA 1DZKA 3AA6B 4AKRB 3T1DA 1XKIA 4XNKA 4O4SA 4AZQA 5LJGA 4F4BA 5FQ6E 4MVEA 1S2PA 4QNIA 1ICMA 5HA0A 1LNMA 1PRNA 1D3SA 2JN3A 3HWBA 5HTDA 3NBXX 4N7DA 1KXOA 2RCTA 1BXWA 4HPDA 1L6MA 4O3YA 4EDEA 4E1TA 5BVTA 3APUA 1Y9LA 4XMHA 3QKGA 2YPVA 3VZUX 3AAAA 3WJCA 4WFUA 3FYFA 2QMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVD D;  4AYI D;  1YS5 A;  4Z3T A;  3PQS A;  3HOE A;  4AYM C;  2KC0 A;  4O4U A;  2W80 C;  4O3W A;  4AYD C;  4O49 A;  4U9C A;  2W81 C;  3UAQ A;  2KDY A;  4O3Z A;  3PQU A;  2LFU A;  3HOL A;  3VE1 A;  2Y7S A;  4O4X A;  3V8U A;  4AYN A;  5EE2 A;  4O3X B;  4O3Y A;  3VE2 A;  2YPV A;  5T5F A;  4AYE C;  4QQ1 A; 
#chains in the Genus database with same CATH topology
 1SWL A;  1VWB B;  4ORY A;  5G38 A;  1ADL A;  4D65 A;  4IAB A;  4YBU A;  5HWZ A;  1VWA B;  4CK4 A;  4ORW A;  4FRX A;  3P6F A;  3RDM A;  3KFG A;  2AT3 X;  4MVL A;  2M4L A;  3JS1 A;  3SY9 A;  1Z24 A;  2FTB A;  4Z28 A;  3STK A;  3OBL A;  3HW9 A;  1SRI A;  4AYD C;  4UU2 A;  1GKA A;  4YCH A;  4U8U N;  2XE5 A;  5F6B A;  1E02 A;  2Q9S A;  2FHL A;  4CPI A;  2IZL B;  1KT6 A;  1CBI A;  3BU9 A;  1AVG I;  3FR5 A;  5DPQ A;  5AEO A;  2XMX A;  3PED A;  1TXL A;  2L9C A;  2WWP A;  4GCQ A;  1VWJ B;  2IZI A;  5JDP A;  1ZND A;  4LZU A;  1U0X A;  1EW3 A;  3LK2 A;  1JMX A;  4A60 A;  4ORU A;  1B4M A;  4E1S A;  1OBQ A;  2M07 A;  1E54 A;  2Y0K A;  1EXS A;  4N75 A;  1O1U A;  1HXX A;  4FSP A;  5EPQ A;  4ZR2 A;  2POR A;  1SWE A;  1G85 A;  2HNX A;  4L1N A;  3WJD A;  1W5R A;  3POQ A;  2ACP X;  4WHI A;  3T2X A;  1HY2 A;  4GGR A;  4GNY A;  4BOE A;  1RBP A;  2HYS A;  1VWK B;  4OS3 A;  3EMN X;  1E2T A;  1A18 A;  5K06 A;  2ZLD A;  3CBC A;  3POU A;  2OVA A;  3AUM O;  4O4O A;  3WBG A;  2QTK A;  4U46 A;  1OEE A;  3D97 A;  1T16 A;  1E00 A;  5H2F O;  2WQA E;  1X71 A;  3WU2 O;  1HBQ A;  4A1H A;  3CR6 A;  3V8U A;  4FBR A;  1KQX A;  2A5B A;  3APX A;  5EE2 A;  3ZQ3 A;  3PDF A;  2XE2 A;  2MHD A;  1SWF A;  4TQ2 A;  3KVD D;  4Z3T A;  2GTL N;  4D64 A;  3D4R A;  1U17 A;  2VFC A;  5IYU A;  4U3Q A;  1Y9T A;  1SWP A;  4AFK A;  4FSO A;  2G79 A;  4FOZ A;  3RWX A;  1VYG A;  2UYW A;  4GCP A;  2G7B A;  3MVF A;  4FRT A;  4YDA A;  3KZI O;  4OEM A;  1RXK A;  4DQ3 A;  3C76 X;  3O19 A;  4GE1 A;  5HZ5 A;  5K68 A;  3RDQ A;  3SLT A;  3BS0 A;  2G5L A;  3CMP A;  2RTC B;  2IZC B;  4N7C A;  1T1L A;  1OSP O;  3SLO A;  1GT5 A;  3O22 A;  3FID A;  1BSO A;  1STP A;  2VFB A;  2QM9 A;  1SWJ A;  5D5D A;  2FHN X;  1SY3 A;  3VPJ E;  4QZU A;  2X45 A;  1G74 A;  1SWC A;  5F58 A;  5HTE A;  4O3X B;  4FES A;  1YS5 A;  4O9S A;  1THQ A;  2AT8 X;  1MEP A;  3GP6 A;  3TZG A;  4YCE A;  1GFQ A;  3JCU O;  2EU7 X;  2FWV A;  3HK1 A;  1BRQ A;  4NV7 A;  5HCE C;  1RSU B;  4MVK A;  2Y32 A;  2F01 A;  3T24 A;  1CBQ A;  1Q9F A;  3B2H A;  3T6F A;  4C4V A;  2R74 A;  2RCQ A;  5LJD A;  2BSZ A;  4YDB A;  1KQW A;  3RE6 A;  3S60 A;  3SYS A;  5LJE A;  3MBT A;  2WSJ A;  4NYR A;  2XE3 A;  4XMG A;  3WZO A;  4C00 A;  1VWF B;  3KFH A;  1ZNH A;  1HMS A;  3P6H A;  4XNL A;  1OBU A;  5D48 A;  1SXU A;  4YBP A;  1YIV A;  5ADX K;  4ZJ0 A;  3EW1 A;  1HQP A;  2GTL O;  3D96 A;  3JSQ A;  2RTF B;  3LTW A;  3DA4 A;  3RDS A;  2RQ0 A;  3DWO X;  4LZV A;  4K3C A;  3HPE A;  2Q2M A;  3LV4 A;  3ZW0 A;  1KOI A;  2AH7 X;  1KT7 A;  4GCS A;  2RTM A;  3P24 A;  2W2B A;  1SWO A;  2X27 X;  1GX3 A;  2QO5 A;  1RXJ A;  5B11 O;  4YVB A;  1EPB A;  5EDC A;  3HTY A;  3AEH A;  4KH8 A;  2F73 A;  1X8U A;  2A2U A;  1HQQ A;  4RUU A;  3SZD A;  1JIW I;  4QQ1 A;  2IZD B;  3HWG A;  2X46 A;  1DC9 A;  1ZNK A;  4IAX A;  2KC0 A;  4GHB A;  2AXT O;  3VGW A;  4RJW A;  2W2A A;  1NP1 A;  4XMF A;  1B56 A;  1SWH A;  1PM1 X;  2JU3 A;  4JNJ A;  3OD9 A;  1ZNL A;  1OBP A;  4AZN A;  1ACD A;  5LJH A;  3I17 A;  5F6Z A;  4I60 A;  2WR6 A;  3ZUI A;  4Y0R A;  2JQY A;  2MNH A;  1LDQ A;  2X4M A;  2FR3 A;  3VE1 A;  1MVG A;  2HKD A;  1P4T A;  2GJ5 A;  4JO6 A;  3BDR A;  4N74 A;  4MIS A;  2F09 A;  5HZ8 A;  5EED A;  3T1D A;  5IRA A;  4C5P A;  4MVE A;  1ICM A;  5HA0 A;  1LNM A;  1Y0G A;  3HWB A;  5G39 A;  3EC5 A;  1L6M A;  4O3Y A;  3VZU X;  4UB8 O;  4WFU A;  3FYF A;  4BX6 A;  1MM9 A;  3FA9 A;  1QJ9 A;  2BLG A;  2XE1 A;  2DJF A;  4IBA A;  2RTO B;  1PBY A;  5L8N A;  3QQ2 A;  5GTI O;  4D5U A;  2IWV A;  1WBI A;  4JCH A;  4L3R A;  2RTD B;  4BX6 B;  1KZW A;  3UEX A;  3RDX A;  1MUP A;  1BM5 A;  2PI3 O;  3A0H O;  4IMO A;  2XG6 A;  1LDO A;  1BSY A;  2CM4 A;  3MG5 A;  2M06 A;  2QO4 A;  4K3B A;  2Q4N A;  2YNK A;  1P6P A;  1GXA A;  1SWK A;  2RTG B;  4LKT A;  3AA0 B;  5FEN A;  1A57 A;  3VHM A;  5H9A A;  1GFM A;  4O4U A;  1IKJ A;  5HBS A;  1JYJ A;  3VG6 A;  5B2A O;  4I95 A;  4BQU A;  1NQN A;  5D45 A;  3TGA A;  4AZL A;  1LIC A;  5HZ9 A;  2LKK A;  4LKP A;  3OJY C;  8PRN A;  1MPF A;  1DZP A;  5B5G A;  1MX7 A;  4KR4 A;  2XTR A;  1X89 A;  1Y53 X;  1SWG A;  3BRY A;  3SLJ A;  4NYQ A;  2A13 A;  4BVM A;  3PRN A;  5F1E A;  1WUB A;  1PMP A;  1BLR A;  1SY2 A;  3KFI A;  5HAE A;  4IMN A;  1SXW A;  2AF5 A;  4I3B A;  1SLD B;  2RTB B;  1JBH A;  1N7Y A;  1BJ7 A;  1KL5 A;  2ZFG A;  3NQK A;  2J1N A;  4QRL A;  4OEL A;  2KXP B;  1OPB A;  4RJX A;  3ZZV A;  1ZNG A;  2LHF A;  4QAE A;  5D47 A;  3PEC A;  3RE5 A;  5E79 O;  2WJR A;  3AA7 A;  2AL0 X;  1W6F A;  4D6B A;  3WVM A;  1I05 A;  4KCA A;  3HOL A;  3EBK A;  3H3I A;  5CSE A;  4OS8 A;  1VPR A;  2OFM X;  1SRG A;  2Q39 A;  3G7X A;  1I4U A;  4GET A;  5TIS O;  1ICN A;  5KAI O;  3P6E A;  1N4J A;  1YP6 A;  2R4P A;  4MEE A;  3PQS A;  3VG4 A;  3PF1 A;  1CRB A;  2RTL A;  1A3Y A;  2DJG A;  1VWL B;  4U9C A;  5HZ6 A;  4I9S A;  2LBA A;  5FVN A;  1X8Q A;  4AYH A;  2ASN X;  2KTD A;  3TGC A;  1JZU A;  3PH6 A;  4ES7 A;  3A2S X;  5B10 O;  2OF8 A;  1GFN A;  3BRN A;  4KC8 A;  4QGW A;  2MHL A;  4AYI D;  1VWE B;  3FR2 A;  2JMM A;  4N58 A;  1OEK A;  5LJC A;  3I0A A;  5F2B A;  3VG3 A;  3EBW A;  1GKA B;  1KT5 A;  2P8G A;  3NR3 A;  2KDY A;  3PQU A;  4AZR A;  3LK3 A;  4RLC A;  4GNW A;  1X8N A;  1BEB A;  3BU1 A;  1TW4 A;  1EI5 A;  4GDA A;  2QO6 A;  2ANS A;  2X8F A;  1OPF A;  1ORM A;  2N93 A;  3WYQ A;  3WJB A;  2K23 A;  4ALO A;  4FBV A;  3D95 A;  2MO5 A;  5KIC A;  3LK3 B;  2C1Q A;  4ORX A;  3ZW2 A;  1VYF A;  1ZRY A;  1NC9 A;  3NX1 A;  2OY7 A;  3LK2 B;  1OSM A;  5G3A A;  1MOY A;  4TKH A;  2KW1 A;  1MM4 A;  2XTQ A;  4ZGF A;  3Q6L A;  3AA6 A;  5HA1 A;  5L8O A;  2A2G A;  4LSI A;  3APV A;  2WVP A;  1SLE B;  2CZU A;  4JGL A;  4LSF A;  4HFO A;  1GX9 A;  3POR A;  4ALB A;  4FQE A;  1N0S A;  2JU7 A;  5DL5 A;  4ARH A;  3NQ9 A;  1N43 A;  1FE3 A;  2UZ2 A;  1EUO A;  2IWW A;  4QYP A;  4IB6 A;  4I3D A;  4ZHD A;  4YFQ A;  1X8P A;  3NP1 A;  4AZM A;  3MX7 A;  3VHH A;  3N91 A;  3TGB A;  2IZA A;  1VWN B;  1FEN A;  2HZR A;  1DFV A;  4NV8 A;  4EKV A;  1JJJ A;  4YFR A;  3DWN A;  1N9M A;  5AFU K;  2RTK A;  4DNE A;  2JMB A;  2CM9 A;  4AZP A;  2OZQ A;  2ZAG A;  3EYC A;  5FQ7 E;  5HCD C;  4PJ0 O;  2IZG B;  5C0N A;  4KC7 A;  2OYB O;  1JMZ A;  5F7G A;  4U8U O;  4WFV A;  2BC3 A;  4YGG A;  4FZL A;  3FW5 A;  4CSB A;  1YWC A;  2HZQ A;  4GU8 A;  1K24 A;  3ZI8 A;  2C1S A;  5D4A A;  2FR2 A;  3NAD A;  1G5W A;  1LIE A;  2J4U P;  4PR7 A;  2OMF A;  3CQN A;  3P6D A;  4EXZ A;  3WOV A;  3HOE A;  3LK4 1;  4AYM C;  3EW2 A;  4GF4 A;  3AAE A;  3HWE A;  4BCS A;  2IZF B;  2XST A;  3ZUO A;  1AB0 A;  2L68 A;  2R88 A;  4LSH A;  2NNE A;  4AZO A;  2OY1 O;  2ZAI A;  1EII A;  1ZHT A;  2A0A A;  2G78 A;  4GGT A;  4CV7 A;  2QCB A;  5H9L A;  3ZWE A;  1VWI B;  4CDC A;  1NQM A;  3AAE B;  1AEL A;  2R4L A;  1QAB E;  3DTQ A;  4CTD A;  3HWD A;  1SLF B;  4PSQ A;  1E5P A;  4WBK A;  1ZHW A;  3U0D A;  4D6A A;  4PJ2 A;  1QY0 A;  1H91 A;  4FUV A;  2HLV A;  2OL7 A;  2LBV A;  5IO5 A;  1RLB E;  2RTR B;  5IRW A;  1IJ8 A;  4XNK A;  4O4S A;  5B66 O;  4GUZ A;  4QNI A;  1PRN A;  5HTD A;  1VWR B;  4HPD A;  2FKJ A;  5BVT A;  3APU A;  1Y9L A;  4CPH A;  3AAA A;  4C4V B;  3WJC A;  1HXZ A;  4AUI A;  2QMI A;  5BVQ A;  2OVS A;  2YG2 A;  1HBP A;  3ELZ A;  2IZE B;  1VWG B;  1GM6 A;  1GT1 A;  4TJZ A;  3PP6 A;  4CPH B;  2OF9 A;  4IAW A;  4GGZ A;  2AT0 X;  4OMW A;  3UEW A;  5PRN A;  3G7G A;  4OKA A;  5KHP A;  5H8T A;  1S5L O;  1IW2 A;  3B2K A;  4JHQ A;  5ADX L;  3CKG A;  2KT4 B;  5B5F A;  3WI5 A;  1E06 A;  1RAV A;  3ZW0 B;  3EM0 A;  5DL7 A;  1GFP A;  1ZHY A;  1FTP A;  3BRZ A;  4QYN A;  3Q34 A;  1VWQ B;  3SOT A;  4GJV A;  1BSQ A;  2BS6 A;  1IZN A;  2O4V A;  3RY2 A;  3FR4 A;  4Y0P A;  2RTA A;  4C69 X;  3ZW1 A;  1TOW A;  2Y7S A;  4M6S A;  1Y52 X;  2FGQ X;  3VZT X;  2X32 A;  5H9N A;  1FDQ A;  2KZ7 A;  2AT6 X;  1SXY A;  1SRJ A;  2I5Z O;  2KTS A;  1IZN B;  3RDU A;  3NQ3 A;  3WYP A;  2LB6 A;  5FFH A;  3WJG A;  3RBH A;  2WUT A;  3AKN A;  2ACO A;  2KZ7 B;  1KL4 A;  1K3B A;  3VG7 A;  1UYO X;  5EDB A;  2F1T A;  1TOU A;  1SWT A;  3KFF A;  2PY1 A;  2MWH A;  5AQ6 A;  3BLG A;  3SYB A;  3GAQ A;  1GT4 A;  4TNN A;  1T68 X;  3FEN A;  1NGL A;  2AMM X;  2AT5 X;  1QJ8 A;  2OL6 O;  1LCW A;  3CWK A;  5DL8 A;  2OY8 A;  2X8T A;  2W80 C;  4CDD A;  3AA1 A;  5BVS A;  2WEX A;  1VWH B;  4NNS A;  4EQA C;  3STN A;  2BT9 A;  3K3L A;  1CJ5 A;  4TKB A;  3WZQ A;  3VZW X;  2OFR X;  5KID A;  1VWO B;  3FDC A;  4TLJ A;  3WI4 A;  4YKO A;  2K4T A;  2KD2 A;  2LA7 A;  3IA8 A;  4ODD A;  4LSE A;  3CKF A;  2GH7 A;  4JFB A;  1VWM B;  1LF7 A;  3RBY A;  1KFF A;  4GZV A;  1Q9G A;  3WJE A;  4GK9 A;  2JGS A;  1R0U A;  2MM3 A;  1NP4 A;  1LCZ A;  4HPC A;  4ZH9 A;  2RTP B;  1HXL A;  2IZB A;  4AW8 A;  3T0S A;  3LHN A;  1MX8 A;  1H6S 1;  3KQ0 A;  1U18 A;  1EIO A;  2PRN A;  2Y3F A;  2FT9 A;  3C77 X;  4NNT A;  4BGF A;  2R8A A;  4ZH6 A;  2RTQ B;  4FQB B;  1HXU A;  2G8C O;  1D2U A;  3DSZ A;  4LQZ A;  4INN A;  2BS5 A;  2ZSC A;  4A8Z A;  1ZHZ A;  4ML7 B;  4BX7 A;  1UZ2 X;  2IFB A;  4BBO A;  1SWA A;  2X56 A;  1OPA A;  1QG5 A;  1BH3 A;  3K19 A;  5AJC A;  2OY5 O;  1LEL A;  3T2W A;  4OMX A;  3BY0 A;  5B29 A;  4AKR A;  2K62 A;  5LJB A;  1S44 A;  3FEP A;  1DZJ A;  2RTI B;  5CE4 A;  2RTN B;  3SY7 A;  1QWD A;  1ERX A;  4XME A;  1SWR A;  3VY9 X;  3QRA A;  1DZM A;  1SWB A;  4R0B A;  2R4N A;  1B0O A;  4NW4 A;  1KT4 A;  4ORS A;  3EMM A;  4NP1 A;  2RTE B;  1URE A;  1PHO A;  1YWD A;  5IO6 A;  1MM5 A;  5IXG A;  3RKG A;  2RD7 C;  4MVI A;  1LIB A;  1ML7 A;  1FJ1 E;  3WZN A;  4NLJ A;  1CBR A;  4KRA A;  3AA7 B;  3T6L A;  2IZJ A;  3FEL A;  5G26 A;  4IB7 A;  2OFA A;  1HMT A;  1SXX A;  3O0E A;  4M7M A;  7PRN A;  3DZM A;  2DM5 A;  5B3M O;  3UPG A;  4DQ4 A;  3VU1 A;  2RTJ A;  1O1V A;  1BBP A;  3VE2 A;  1QJP A;  1XCA A;  4GRJ A;  4QGV A;  1PEE A;  4PUX A;  4MIR A;  4O49 A;  3SZV A;  2L67 A;  4IB9 A;  4G76 A;  1GGL A;  2FGR A;  5AJB A;  2VDF A;  2FS6 A;  4CDE A;  5FQ8 E;  2RN4 A;  4A1Y A;  4QGX A;  4FMS A;  2K0L A;  3PPT A;  5DG4 A;  2A3F X;  2R56 A;  4U8U M;  3NJT A;  1JJU A;  2A8G A;  4Z27 A;  1S7D A;  5CYB A;  5LKF A;  1JJX A;  4HPB A;  3POX A;  2CZT A;  2WPU A;  4ZHF A;  2ODJ A;  4YGZ A;  1SWS A;  4AYN A;  4XMC A;  3FW4 A;  4Y5D A;  1G7N A;  1FEM A;  5B27 A;  4YMY A;  4I3C A;  3U03 A;  3BX8 A;  1A2D A;  1STS B;  4HWM A;  3VG2 A;  1HN2 A;  2CBS A;  1ERB A;  5LJK A;  1QQS A;  4KII A;  2JU8 A;  2FRS A;  4YFP A;  1SWD A;  1I04 A;  4IRW A;  1DZK A;  1W4T A;  3AA6 B;  3PK2 A;  2F1C X;  1XKI A;  4UB6 O;  4AZQ A;  4DCB A;  1D3S A;  2JN3 A;  4N7D A;  1KXO A;  2RCT A;  1BXW A;  1SLG B;  1AVD A;  4EDE A;  4E1T A;  4XMH A;  1VYO A;  3F6Z B;  4I6S A;  3HWF A;  2IZK A;  3SAO A;  2AVI A;  5EZ2 A;  1RXH A;  3UEV A;  4OS0 A;  4FZM A;  6PRN A;  4B61 A;  4UU3 A;  4CDF A;  4ZHG A;  2CAM A;  4FT6 A;  3DA3 A;  3VY8 X;  2BHV A;  2RA6 A;  1N9Y A;  4FZN A;  4FGI B;  3BS2 A;  1QY2 A;  4ORR A;  1B8E A;  1Y55 X;  1QFV A;  4I9R A;  1I9H A;  2X55 A;  3FYX A;  4Z2O A;  3OE3 A;  2OVD A;  3FA6 A;  5AFU L;  3F9D A;  2GTL M;  2POA A;  2Z4I A;  1GX8 A;  2Q2P A;  2F1V A;  3C78 X;  1SA8 A;  2Z4H A;  4AYE C;  1SWQ A;  4GDZ A;  3JTY A;  5K67 A;  2JW1 A;  1YP7 A;  4XMD A;  3JQO A;  2XKL A;  4O3Z A;  2GC9 A;  3F8A A;  2HMB A;  1YWB A;  2QOM A;  3P6C A;  1TVQ A;  3BX7 A;  4BUM X;  1VWC B;  2FGS A;  5DL6 A;  1NDJ A;  4ZCB A;  3VG5 A;  3B2J A;  1LID A;  1BRP A;  5IRU A;  1GFO A;  1SY0 A;  4Z6J A;  5IO7 A;  3T20 A;  1BWY A;  1T0V A;  2OVE A;  2IZH B;  4ID2 A;  4AKM A;  3RDO A;  3WZP A;  5B5E O;  3U9P C;  4IB8 A;  3VHI A;  1IIU A;  1LCV A;  2ERV A;  2R73 A;  1HMR A;  3PGU A;  4Y0Q A;  4Z2V A;  5GV0 A;  1DV9 A;  5L8I A;  4ZHC A;  4G75 A;  4ZGU A;  2C4I A;  2O62 A;  3PGR A;  5L3Y A;  4KR8 A;  3E3C A;  3LK4 2;  1ALB A;  5BYP A;  3AAA B;  1AVE A;  1KGL A;  3L4R A;  4RLB A;  1CBS A;  3D9W A;  3C5O A;  3B2L A;  1JQP A;  1O8V A;  1LPJ A;  2FKG A;  2X34 A;  1QFT A;  1SWN A;  1SY1 A;  3RSW A;  1BT9 A;  3UU2 A;  3WXQ A;  1X8O A;  3FA7 A;  4N59 A;  3TZS A;  5T5F A;  3CQR A;  5FAZ A;  5KAF O;  1SMP I;  2AKQ A;  3TF6 A;  3RZY A;  1ZHX A;  2X9K A;  3KZA A;  3FEK A;  3APW A;  3FLL A;  3S5X A;  1JYD A;  4KT5 A;  4B55 A;  1VWP B;  3PGS A;  3NX2 A;  1T8V A;  5HZQ A;  1PTS A;  4ZFX A;  1FEL A;  1LFO A;  4CPE A;  3O2Y A;  1LIF A;  2JOZ A;  4HPA A;  4CPF A;  3ZW1 B;  3PH5 A;  2N2L A;  3SZJ A;  2W81 C;  1GT3 A;  2MF6 A;  2LFU A;  5H9K A;  1IFB A;  4NLI A;  3STM X;  1I78 A;  2Y3E A;  4GD9 A;  1LKE A;  2GTF X;  1DF3 A;  1SRE A;  5HCC C;  3KVN A;  1EPA A;  1LUQ A;  1EAL A;  3B2I A;  1SWU A;  2RTH B;  3RY1 A;  3CBS A;  1OEJ A;  1DF8 A;  1KZX A;  3ELX A;  3MM0 A;  2Y2X A;  2GE4 A;  1IKE A;  4COT A;  2MJI A;  3X00 A;  2OFB A;  1MDC A;  2LFO A;  2L5P A;  1SRF A;  5LKE A;  5GTH O;  4BJ8 A;  2I5V O;  4GJS A;  4YKM A;  1JV4 A;  3AA1 B;  4EEJ A;  1G90 A;  1IFC A;  2FLJ A;  1QY1 A;  1NBX A;  2R4O A;  2ALL X;  5JD2 A;  1MK5 A;  4GH7 A;  1EQD A;  2X8S A;  4Y0S A;  1I06 A;  4YH0 A;  4ON1 A;  3NSG A;  3FMZ A;  2QOS C;  4O4X A;  3FA8 A;  4TKJ A;  5JR8 A;  3AA0 A;  2NNQ A;  2NND A;  4GKC A;  4O3W A;  3UEU A;  2WQ9 A;  1KL3 A;  4YGH A;  2OL8 O;  1HXT A;  2NP1 A;  1STR B;  1VWD B;  1YUP A;  2FS7 A;  3P02 A;  4Z2P A;  2N2M A;  1YWA A;  1AQB A;  4FBO A;  3WJF A;  4BX5 A;  1ZNE A;  2WEW A;  1KT3 A;  2Y0L A;  3UAQ A;  2A5C A;  3IFB A;  2R89 A;  3SZH A;  3NPO A;  4K19 A;  3QRC A;  3AKM A;  4IL6 O;  4QZT A;  3S5V A;  2YMS A;  4ZHH A;  4BX5 B;  3FIQ A;  2E4J A;  2CBR A;  1UYN X;  4BX7 B;  5CHK A;  3GE2 A;  1PBO A;  4Y59 A;  4RL9 A;  5EEE A;  3S26 A;  2KXP A;  2Y0H A;  3P6G A;  2W2F A;  4RUN A;  3BSZ E;  4EFG A;  5D8J A;  3A0B O;  4AKR B;  4F4B A;  5LJG A;  5FQ6 E;  1S2P A;  1RST B;  3NBX X;  2WJQ A;  3SZI A;  1SRH A;  3QKG A;  2YPV A; 
#chains in the Genus database with same CATH homology
 3F6Z B;  5BVQ A;  4I6S A;  3FA9 A;  3HWF A;  2BLG A;  1QJ9 A;  2XE1 A;  4ORY A;  1ADL A;  3SAO A;  4D65 A;  2OVS A;  2YG2 A;  4IAB A;  5EZ2 A;  4YBU A;  4IBA A;  3UEV A;  1HBP A;  4OS0 A;  5L8N A;  3ELZ A;  5HWZ A;  4FZM A;  4CK4 A;  6PRN A;  4ORW A;  1GM6 A;  4FRX A;  4B61 A;  4D5U A;  1GT1 A;  3P6F A;  4TJZ A;  4JCH A;  4UU3 A;  3PP6 A;  3KFG A;  4L3R A;  2AT3 X;  4ZHG A;  4IAW A;  4MVL A;  1KZW A;  4FT6 A;  3UEX A;  3DA3 A;  3VY8 X;  2BHV A;  2M4L A;  2AT0 X;  3JS1 A;  3SY9 A;  1Z24 A;  2FTB A;  1MUP A;  2RA6 A;  4OMW A;  3UEW A;  1BM5 A;  3STK A;  4FZN A;  4FGI B;  5PRN A;  3BS2 A;  1QY2 A;  4ORR A;  3OBL A;  3G7G A;  5KHP A;  1B8E A;  1QFV A;  4I9R A;  4IMO A;  2XG6 A;  5H8T A;  3FYX A;  3HW9 A;  1BSY A;  4AYD C;  2CM4 A;  1IW2 A;  3B2K A;  2M06 A;  4UU2 A;  1GKA A;  2QO4 A;  3OE3 A;  5ADX L;  2KT4 B;  2OVD A;  3FA6 A;  5AFU L;  4YCH A;  3WI5 A;  2Q4N A;  4U8U N;  2XE5 A;  3F9D A;  5F6B A;  1E06 A;  1E02 A;  2Q9S A;  2GTL M;  2POA A;  2Z4I A;  1GX8 A;  2YNK A;  3ZW0 B;  1P6P A;  2Q2P A;  3EM0 A;  5DL7 A;  2F1V A;  3C78 X;  1GXA A;  4LKT A;  1SA8 A;  2Z4H A;  4AYE C;  1GFP A;  1KT6 A;  1CBI A;  3AA0 B;  3BU9 A;  1ZHY A;  1FTP A;  5FEN A;  4GDZ A;  3JTY A;  4QYN A;  1A57 A;  1AVG I;  3SOT A;  2JW1 A;  1YP7 A;  5H9A A;  3FR5 A;  1GFM A;  1BSQ A;  4O4U A;  4XMD A;  1IKJ A;  2BS6 A;  3JQO A;  5DPQ A;  5HBS A;  1JYJ A;  5AEO A;  1IZN A;  3VG6 A;  2O4V A;  2XMX A;  3FR4 A;  3PED A;  1TXL A;  4Y0P A;  4I95 A;  2XKL A;  4C69 X;  4O3Z A;  2GC9 A;  3F8A A;  2L9C A;  3ZW1 A;  4BQU A;  3TGA A;  5D45 A;  2WWP A;  1TOW A;  2HMB A;  4AZL A;  4GCQ A;  1YWB A;  1LIC A;  5HZ9 A;  2Y7S A;  2LKK A;  5JDP A;  4M6S A;  4LKP A;  1ZND A;  4LZU A;  3OJY C;  2FGQ X;  3VZT X;  5H9N A;  1FDQ A;  3P6C A;  2KZ7 A;  2AT6 X;  1U0X A;  8PRN A;  1SXY A;  1TVQ A;  1MPF A;  1EW3 A;  3LK2 A;  1DZP A;  2KTS A;  3BX7 A;  1MX7 A;  1IZN B;  4KR4 A;  2XTR A;  1X89 A;  3NQ3 A;  4A60 A;  4ORU A;  4BUM X;  1B4M A;  4E1S A;  2LB6 A;  5FFH A;  3WJG A;  4NYQ A;  1OBQ A;  3RBH A;  2WUT A;  5DL6 A;  4ZCB A;  2M07 A;  3AKN A;  3B2J A;  3VG5 A;  1E54 A;  1LID A;  2Y0K A;  2ACO A;  1EXS A;  2A13 A;  1BRP A;  4BVM A;  2KZ7 B;  3PRN A;  1GFO A;  5F1E A;  1O1U A;  3VG7 A;  1HXX A;  1SY0 A;  5IO7 A;  3T20 A;  5EDB A;  1BWY A;  5EPQ A;  2F1T A;  1PMP A;  4ZR2 A;  1TOU A;  4FSP A;  1BLR A;  1SY2 A;  2POR A;  1T0V A;  2OVE A;  3KFI A;  3KFF A;  5HAE A;  2PY1 A;  4IMN A;  1SXW A;  2MWH A;  1G85 A;  4I3B A;  5AQ6 A;  3BLG A;  1JBH A;  2HNX A;  4L1N A;  4ID2 A;  3SYB A;  3WJD A;  1BJ7 A;  4AKM A;  2ZFG A;  3NQK A;  3GAQ A;  2J1N A;  4QRL A;  3POQ A;  1GT4 A;  4TNN A;  2ACP X;  4WHI A;  1T68 X;  2KXP B;  3U9P C;  4IB8 A;  3FEN A;  1IIU A;  1OPB A;  4RJX A;  1NGL A;  2ERV A;  2AMM X;  2R73 A;  4GNY A;  4BOE A;  3ZZV A;  1HMR A;  4Y0Q A;  1ZNG A;  1RBP A;  2LHF A;  2HYS A;  4QAE A;  5D47 A;  2AT5 X;  1QJ8 A;  5GV0 A;  4OS3 A;  3PEC A;  1DV9 A;  3EMN X;  3CWK A;  5L8I A;  5DL8 A;  4ZHC A;  3AA7 A;  1A18 A;  2AL0 X;  5K06 A;  4G75 A;  2ZLD A;  4ZGU A;  2X8T A;  3CBC A;  2W80 C;  3AA1 A;  3VG3 A;  2OVA A;  4D6B A;  3POU A;  5BVS A;  3WVM A;  1I05 A;  4O4O A;  2WEX A;  2O62 A;  3WBG A;  2QTK A;  1OEE A;  4NNS A;  4EQA C;  3D97 A;  4KCA A;  3STN A;  4KR8 A;  3E3C A;  1E00 A;  3HOL A;  3LK4 2;  2WQA E;  1X71 A;  2BT9 A;  3EBK A;  3H3I A;  1HBQ A;  4OS8 A;  1VPR A;  3K3L A;  2OFM X;  1CJ5 A;  1ALB A;  2Q39 A;  3G7X A;  4A1H A;  4TKB A;  3CR6 A;  3V8U A;  1I4U A;  4GET A;  4FBR A;  1KQX A;  1ICN A;  5BYP A;  3APX A;  3AAA B;  5EE2 A;  3ZQ3 A;  3VZW X;  2OFR X;  5KID A;  2XE2 A;  4TLJ A;  2MHD A;  3WI4 A;  4TQ2 A;  4YKO A;  2K4T A;  3P6E A;  3KVD D;  1YP6 A;  2KD2 A;  2LA7 A;  1KGL A;  3IA8 A;  3L4R A;  4Z3T A;  3PQS A;  2GTL N;  3VG4 A;  4RLB A;  4D64 A;  4ODD A;  1CBS A;  4LSE A;  3D4R A;  3C5O A;  4JFB A;  3B2L A;  1CRB A;  1O8V A;  1LF7 A;  1U17 A;  1A3Y A;  3RBY A;  4U9C A;  5HZ6 A;  4I9S A;  4GZV A;  2LBA A;  1Q9G A;  5FVN A;  1LPJ A;  1X8Q A;  4GK9 A;  3WJE A;  2ASN X;  4AYH A;  2KTD A;  3TGC A;  1JZU A;  1R0U A;  1QFT A;  1SY1 A;  3PH6 A;  3RSW A;  4ES7 A;  1BT9 A;  3A2S X;  2MM3 A;  1NP4 A;  4U3Q A;  5IYU A;  1Y9T A;  3UU2 A;  3WXQ A;  4AFK A;  4FSO A;  1X8O A;  3FA7 A;  2G79 A;  1GFN A;  4HPC A;  4FOZ A;  4N59 A;  3BRN A;  4KC8 A;  3RWX A;  1VYG A;  4QGW A;  4ZH9 A;  3TZS A;  4GCP A;  5T5F A;  2G7B A;  2MHL A;  3CQR A;  3MVF A;  5FAZ A;  4FRT A;  4AYI D;  3FR2 A;  1SMP I;  2JMM A;  2AKQ A;  4YDA A;  4N58 A;  1OEK A;  3TF6 A;  5LJC A;  3I0A A;  3RZY A;  1ZHX A;  4AW8 A;  4DQ3 A;  3T0S A;  3KZA A;  3LHN A;  3FEK A;  1MX8 A;  3APW A;  1GKA B;  1KT5 A;  2P8G A;  3C76 X;  3EBW A;  3FLL A;  3O19 A;  4GE1 A;  5HZ5 A;  1H6S 1;  3NR3 A;  3S5X A;  3KQ0 A;  2KDY A;  1U18 A;  3PQU A;  1JYD A;  4KT5 A;  4AZR A;  3LK3 A;  4RLC A;  4GNW A;  3NX2 A;  1T8V A;  1X8N A;  3CMP A;  1BEB A;  3BU1 A;  1EIO A;  5HZQ A;  2PRN A;  1TW4 A;  1EI5 A;  2FT9 A;  3C77 X;  2QO6 A;  4N7C A;  4NNT A;  4ZFX A;  1FEL A;  2ANS A;  2X8F A;  1LFO A;  1OPF A;  4ZH6 A;  1ORM A;  1GT5 A;  2N93 A;  4FQB B;  1HXU A;  3O22 A;  3O2Y A;  1LIF A;  2JOZ A;  1BSO A;  2K23 A;  3WJB A;  1D2U A;  3DSZ A;  4LQZ A;  4ALO A;  4FBV A;  4INN A;  3D95 A;  4HPA A;  2QM9 A;  2BS5 A;  2MO5 A;  5KIC A;  5D5D A;  3ZW1 B;  4A8Z A;  3LK3 B;  1ZHZ A;  3PH5 A;  4ML7 B;  1UZ2 X;  2IFB A;  2N2L A;  2W81 C;  4ORX A;  1SY3 A;  3ZW2 A;  1GT3 A;  3VPJ E;  2LFU A;  4QZU A;  1VYF A;  5H9K A;  1IFB A;  2X45 A;  1OPA A;  1QG5 A;  1G74 A;  4NLI A;  1BH3 A;  1ZRY A;  3K19 A;  5AJC A;  3STM X;  3NX1 A;  5F58 A;  5HTE A;  4O3X B;  3LK2 B;  1OSM A;  1LKE A;  4OMX A;  4TKH A;  4FES A;  3BY0 A;  2KW1 A;  1YS5 A;  4O9S A;  5B29 A;  1THQ A;  2GTF X;  1DF3 A;  1MM4 A;  2XTQ A;  2AT8 X;  4ZGF A;  3GP6 A;  3Q6L A;  3AA6 A;  5HA1 A;  4AKR A;  2K62 A;  5LJB A;  3TZG A;  5HCC C;  1EPA A;  1S44 A;  4YCE A;  1GFQ A;  5L8O A;  2A2G A;  4LSI A;  3APV A;  2EU7 X;  3FEP A;  1DZJ A;  2FWV A;  3HK1 A;  1BRQ A;  2CZU A;  3B2I A;  4JGL A;  5HCE C;  1EAL A;  4LSF A;  5CE4 A;  4HFO A;  1GX9 A;  3SY7 A;  4MVK A;  3POR A;  3CBS A;  1QWD A;  4ALB A;  1OEJ A;  1ERX A;  1N0S A;  4XME A;  3T24 A;  3VY9 X;  1CBQ A;  1Q9F A;  1DZM A;  2JU7 A;  3QRA A;  4R0B A;  3ELX A;  1KZX A;  5DL5 A;  4ARH A;  3B2H A;  1B0O A;  4NW4 A;  1KT4 A;  3NQ9 A;  4ORS A;  2R74 A;  2RCQ A;  5LJD A;  4YDB A;  1KQW A;  1FE3 A;  2Y2X A;  2GE4 A;  3EMM A;  3S60 A;  3SYS A;  4NP1 A;  1EUO A;  1IKE A;  4COT A;  1URE A;  4QYP A;  4IB6 A;  2MJI A;  1PHO A;  1YWD A;  5LJE A;  3MBT A;  5IO6 A;  4I3D A;  1MM5 A;  2WSJ A;  4ZHD A;  4YFQ A;  1X8P A;  3RKG A;  2RD7 C;  4NYR A;  2XE3 A;  1MDC A;  4MVI A;  4XMG A;  2LFO A;  3NP1 A;  1LIB A;  2L5P A;  4AZM A;  3MX7 A;  3KFH A;  1ZNH A;  1ML7 A;  1HMS A;  4AUI A;  3N91 A;  5LKE A;  3TGB A;  3P6H A;  4NLJ A;  1CBR A;  4XNL A;  4KRA A;  3AA7 B;  1OBU A;  1FEN A;  2HZR A;  1DFV A;  3FEL A;  4YKM A;  1JV4 A;  1SXU A;  5D48 A;  4IB7 A;  1YIV A;  4YBP A;  5G26 A;  5ADX K;  1JJJ A;  3AA1 B;  4YFR A;  4ZJ0 A;  5AFU K;  1HQP A;  2GTL O;  1HMT A;  3D96 A;  3JSQ A;  4EEJ A;  1SXX A;  2JMB A;  3O0E A;  1G90 A;  1IFC A;  2CM9 A;  4M7M A;  7PRN A;  2FLJ A;  1QY1 A;  4AZP A;  2OZQ A;  2ZAG A;  3DA4 A;  3EYC A;  2RQ0 A;  2ALL X;  2DM5 A;  5FQ7 E;  5HCD C;  3UPG A;  4GH7 A;  3VU1 A;  4DQ4 A;  1EQD A;  4LZV A;  5C0N A;  4KC7 A;  2X8S A;  4Y0S A;  1I06 A;  5F7G A;  2Q2M A;  4U8U O;  4YH0 A;  1O1V A;  1BBP A;  4ON1 A;  4WFV A;  3VE2 A;  3NSG A;  4YGG A;  3FMZ A;  3LV4 A;  2QOS C;  4O4X A;  1KOI A;  3ZW0 A;  3FA8 A;  2AH7 X;  1QJP A;  1KT7 A;  4FZL A;  1XCA A;  4TKJ A;  3FW5 A;  5JR8 A;  4CSB A;  4GCS A;  4GRJ A;  3AA0 A;  2NNQ A;  4QGV A;  3P24 A;  2W2B A;  1YWC A;  2HZQ A;  1PEE A;  2X27 X;  4PUX A;  2NND A;  2QO5 A;  4GU8 A;  4GKC A;  4O3W A;  4MIR A;  4O49 A;  3SZV A;  2L67 A;  3ZI8 A;  4IB9 A;  2WQ9 A;  3UEU A;  4G76 A;  5D4A A;  1GGL A;  1EPB A;  2FR2 A;  3HTY A;  4YGH A;  5EDC A;  3NAD A;  1G5W A;  1HXT A;  1LIE A;  5AJB A;  2FGR A;  2NP1 A;  4KH8 A;  2F73 A;  2J4U P;  1X8U A;  2FS6 A;  1YUP A;  2A2U A;  2FS7 A;  2OMF A;  3P02 A;  3CQN A;  5FQ8 E;  2RN4 A;  4RUU A;  4A1Y A;  1JIW I;  4QGX A;  4QQ1 A;  3SZD A;  4FMS A;  3HWG A;  3P6D A;  2K0L A;  2N2M A;  1YWA A;  3PPT A;  1AQB A;  4FBO A;  2X46 A;  3WJF A;  1DC9 A;  3WOV A;  4EXZ A;  1ZNK A;  2A3F X;  2R56 A;  5DG4 A;  1ZNE A;  4U8U M;  3HOE A;  3LK4 1;  4AYM C;  4IAX A;  2KC0 A;  4GF4 A;  3AAE A;  3HWE A;  4GHB A;  2WEW A;  1S7D A;  2XST A;  5CYB A;  1AB0 A;  5LKF A;  3ZUO A;  2L68 A;  4HPB A;  1JJX A;  1KT3 A;  2Y0L A;  3POX A;  2CZT A;  4RJW A;  2W2A A;  3UAQ A;  4ZHF A;  4LSH A;  1NP1 A;  4XMF A;  2ODJ A;  2NNE A;  3IFB A;  1B56 A;  4AZO A;  3NPO A;  4YGZ A;  2ZAI A;  4K19 A;  1EII A;  4AYN A;  1PM1 X;  1ZHT A;  3QRC A;  3AKM A;  2A0A A;  2G78 A;  4QZT A;  4XMC A;  3S5V A;  2JU3 A;  2YMS A;  4CV7 A;  3OD9 A;  4ZHH A;  1ZNL A;  3FW4 A;  1OBP A;  1G7N A;  1FEM A;  5H9L A;  4AZN A;  3ZWE A;  1ACD A;  3FIQ A;  5B27 A;  2E4J A;  4YMY A;  4I3C A;  3AAE B;  3U03 A;  2CBR A;  1AEL A;  3BX8 A;  5LJH A;  1A2D A;  3I17 A;  4HWM A;  5F6Z A;  1QAB E;  3DTQ A;  3VG2 A;  1HN2 A;  3GE2 A;  2CBS A;  2WR6 A;  3HWD A;  1ERB A;  5LJK A;  1QQS A;  3ZUI A;  4Y0R A;  4KII A;  2MNH A;  1PBO A;  2JU8 A;  4PSQ A;  1E5P A;  4RL9 A;  2FR3 A;  4WBK A;  5EEE A;  2FRS A;  3VE1 A;  3U0D A;  4D6A A;  3S26 A;  1MVG A;  1ZHW A;  4PJ2 A;  2KXP A;  1P4T A;  2Y0H A;  3P6G A;  2W2F A;  4YFP A;  2GJ5 A;  3BDR A;  1QY0 A;  1H91 A;  4MIS A;  4FUV A;  2HLV A;  4RUN A;  3BSZ E;  2LBV A;  4EFG A;  5IO5 A;  2F09 A;  5D8J A;  1RLB E;  5HZ8 A;  1I04 A;  5EED A;  1DZK A;  3AA6 B;  4AKR B;  3T1D A;  1XKI A;  4XNK A;  4O4S A;  4AZQ A;  5LJG A;  4F4B A;  5FQ6 E;  4MVE A;  1S2P A;  4QNI A;  1ICM A;  5HA0 A;  1LNM A;  1PRN A;  1D3S A;  2JN3 A;  3HWB A;  5HTD A;  3NBX X;  4N7D A;  1KXO A;  2RCT A;  1BXW A;  4HPD A;  1L6M A;  4O3Y A;  4EDE A;  4E1T A;  5BVT A;  3APU A;  1Y9L A;  4XMH A;  3QKG A;  2YPV A;  3VZU X;  3AAA A;  3WJC A;  4WFU A;  3FYF A;  2QMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...