4O4WA

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-gly mutant (tvag_497370)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFGFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o4wA00
5HJLA 4HIBA 4K37A 2RDUA 1ALDA 3GDTA 5GVJA 1H51A 3LV5A 3CHVA 2X2GA 3MP4A 4AXKA 1OX6A 4MOZA 1XCFA 1Q6RA 1KM4A 3SR7A 1GVQA 1SO4A 5EA9A 2GQAA 3LCWA 1PV8A 3WK2A 2VKZG 1OFAA 4NJIA 1VJIA 1G7UA 1OYCA 4DXVA 4FEZA 3UYCA 1EIXA 4K38A 5K4ZA 1DQXA 1OX4A 3LOTA 1H7WA 3TA6A 1I4NA 3UWWA 5EBUA 4LT9A 3DAQA 3NL5A 1EWDA 1Q3NA 2ZTKA 4Z1DA 3M9YA 2FPVA 4BWLA 3CQ0A 2Z1BA 4BR1A 3I7SA 5D38A 3KRZA 3TAKA 4O18A 2CWNA 3N2XA 1JCYA 3S8HA 1SU5A 1GYLA 1OABA 3NQFA 3TDFA 5D32A 3W7EA 3NO5A 3LXBA 2WKJA 4FX8A 3SZ8A 3M5ZA 1TTIA 3TSMA 3QRHA 3WJXA 4GXMA 2NXGA 3W1XA 4AWTA 1TPEA 2XN2A 3R12A 3SGUA 1F74A 5EPDA 4Q32A 5FEPA 2YFOA 1W5QA 3BLFA 2NZLA 2YPIA 1DORA 3NQ8A 3M44A 4MYAA 3N2MA 4X3ZA 1KV5A 3NQ6A 2QKFA 4MZYA 2HS6A 3GKFA 5CGQA 5LKYA 3RLVA 2ZZ3A 4PCFA 3P67A 1W3IA 4S1FA 1ZAJA 5LGXA 5LNVA 1FBAA 4FNUA 3S1VA 1Q6LA 2CLLA 1SZGA 1B57A 1OFQA 4R53A 4WOZA 3P7YA 3TNOA 1PCKA 1GVFA 1KTNA 3SI9A 4D2JA 3LHYA 3TH6A 3TV8A 3A5FA 4NQ1A 3I65A 3N73A 5EKYA 1SW0A 3HGJA 4JDBA 3CIXA 3DFQA 1FWWA 2EKCA 3B05A 5I3JA 2GQ9A 2J9XA 3LCXA 2RDWA 4CQ8A 4Z1CA 4O0KA 1PS9A 3IIVA 3PWAA 3S5OA 4UTWC 4NJHA 1FCUA 2V2DA 4IMFA 2V5BA 1VCGA 3EX3A 4FNTA 5AHEA 4XKYB 3RK8A 3QMTA 4FB7A 2O7SA 4CCCA 3L5AA 1WYIA 4WX2A 1OX4B 1TRIA 4UFKA 3W7CA 2ZRYA 4JXCA 4QSHA 4MZ1A 3LCGA 4LVFA 1JUEA 2FTPA 3W83A 3UNDA 2VFFA 4Y96A 1WA3A 3HMJG 5FF2A 1LRQA 1XBYA 3GZ3A 1H7RA 3S6DA 2HSAA 1TMHA 3H55A 4FHAA 4M6VA 5LHEA 2NUXA 5HULA 1OFEA 4XBSA 1UJPA 3PC0A 5LNUA 4FIQA 3FYPA 3UQNA 2A6NA 1LZOA 4JTSA 4WZHA 3IIXA 4XZ9A 3PB0A 3O6CA 1TSIA 4MLRA 4JIQA 4GNJA 3QEZA 1ICPA 4PC8A 2E6DA 2XN0A 4HT3A 4MKNA 1X1OA 3Q2DA 1Z42A 3W87A 2X1UA 3DKJA 4JYEA 5D30A 4JR5A 1DVJA 3KXQA 1YXCA 2PURA 2TYSA 1CI1A 3T4CA 2ZRUA 2TSYA 3CM4A 3W3OA 4K6AA 2G97A 3L2IA 2RH9A 1VLIA 3V75A 3MI6A 4WQ6A 3R8RA 2X30A 3MW7A 5FEXA 1FWTA 3IVTA 3NQCA 2OMAA 4IXHA 1G69A 3L5LA 1VH7A 2VOMA 2PRHA 2YW4A 2W0UA 2YW3A 1ONRA 1FDYA 2C19A 4PEKA 3W07A 3WK0A 4TX9A 4FXSA 1W5MA 4IOTA 2CU0A 3W9ZA 1KA9F 2DORA 3WFAA 1LOLA 4RJEA 2ZZ7A 3MHUA 2FLIA 3S1WA 2Y89A 5G2WA 1X7FA 3BW3A 4EVZA 5BOOA 5LSMA 1GJPA 1W0MA 1THFD 3DGRA 1U83A 2QUUA 1G6CA 3L21A 1NFBA 5CZSA 1XUZA 2P10A 2V5LA 3GR7A 3LLFA 3QQ0A 1XL9A 3TROA 1K8XA 3PS7A 3CTLA 3C61A 1OFRA 5CSSA 3GK0A 4GC4A 3LLDA 3EWXA 3LHTA 5DXXA 2GVJA 3S5NA 4DPQA 1M7OA 1NVMA 2Y6ZA 4DBDA 3GB6A 1ZAIA 2OJPA 1VLWA 2Q3OA 2JGYA 3DFPA 4FNPA 1KTCA 1T8XA 3M5YA 5F4SA 3UWQA 3QC3A 3TMLA 1PL9A 3B4UA 1T0OA 3HIJA 4RCXA 3AO0A 3LB0A 5D2WA 3CLMA 1WV2A 3Q58A 3FA5A 3QSTA 2B7NA 2CLKA 5K4XA 1QFEA 3RFAA 1RD5A 3MP5A 4KWVA 4LRTA 4PL1A 5CPMA 3ZFHA 4EF8A 4JEQA 5DN1A 4HPJA 3LCFA 5AFDA 4MFDA 4RR4A 1GWJA 3M5XA 3HG3A 4BFAA 1Z44A 3MWAA 2WQPA 4NT0A 3EX4A 2YGYA 1JJKA 2CLMA 4LS2A 1XKYA 3HPXA 3NL3A 4JICA 1MXSA 3RMJA 1A5AA 3ABRA 1E51A 4N4QA 3W7GA 1LCOA 1HFBA 4LW7A 1RV8A 1XDLA 5G4WA 1OFBA 1H60A 3DHFA 4O1BA 3W7LA 2ZCGA 3GAKA 4JGDA 4PTNA 3E96A 4JTKA 3W1LA 7TIMA 1QNVA 4N6EA 1KM6A 1TRDA 2YZRA 3NR0A 2J9ZA 4IJBA 1P0NA 1H5YA 3EEGA 1GEQA 1X6UA 1LRNA 3T44A 2ABAA 1W5PA 1LBMA 2DJXA 1K7XA 3NVTA 2EAWA 3WJZA 4JYFA 4Z0JA 4QM1A 4WY0A 3O16A 5D02A 1R30A 5G5IA 4I7UA 5DCBA 3QSRA 3NYZA 4FXRA 1TTJA 2R14A 1QOQA 3TMQA 5KZEA 2P1FA 4O28A 3ATYA 4JTHA 4ZQNA 1VQTA 2AGKA 4K7VA 1I2OA 4ZQPA 2GJNA 1TO3A 3DZ1A 4UC5A 3EX6A 1JUKA 4DEFA 4MZ8A 4MYXA 1LOSA 1P5BA 3NQEA 1YADA 4IMCA 3DI0A 5HINA 4KWWA 3QW4B 3BV4A 3TR2A 4LUJA 3G1SA 3KFTA 1OYBA 4NJJA 2A4AA 3SW6A 4FF7A 3FEMA 5HUPA 2Y7EA 4P2VA 4JDYA 3BLEA 3P84A 3PM6A 3KOFA 3LTYA 1MSSA 1YXDA 3B06A 3MUXA 3W86A 1OJXA 3QJAA 3NQ7A 5L6UA 3IVSA 1LYXA 2ZZ4A 3LXAA 3O63A 3BG9A 4UTWA 5K3VA 3W2KA 2ZZ5A 3DH7A 2XFWA 2C16A 5A5WA 5HWNA 3BPWA 4RLIA 3W7JA 1BWKA 4UFIA 1W8SA 4ADTA 3CWNA 1TPFA 3FS2A 3R13A 1FY6A 3QQ1A 5TBOA 3UZJA 1FWNA 4S2BA 1TPH1 4JD4A 2QF7A 3B0PA 4LVAA 3W1RA 2OCZA 4TIMA 1RQBA 1BEUA 1WXJA 4XTDA 2QUVA 1K02A 4OBTA 2ISWA 4IMEA 3B8DA 3LI0A 2DZSA 3L9CA 2X1RA 5AOUA 1FWRA 4IMDA 1GG0A 4JTLA 1RPXA 4DBEA 5DBUA 2CLHA 1I8JA 1VZWA 4UTJA 3QZEA 5AHIA 2RHGA 5HR7A 3SGZA 5U7SA 4HSNA 2ZBTA 1JULA 4HSOA 3PR2A 5KZMA 3EWUA 3N3MA 1DKWA 3ZWSA 2ZTJA 3FOKA 3O05A 2E6YA 3W7IA 5F4XA 3TQ0A 1SW7A 3W75A 3M41A 4HPXA 4JTGA 1RVGA 3S9YA 4M6PA 5D2YA 4LVDA 4UTUA 5D33A 3NM1A 2E5BA 3BO9A 3WJYA 1JCJA 2E77A 3UY8A 4GFSA 5HWMA 4WY0F 2ABBA 2V81A 5H91A 1KV8A 1TYGA 2J6XA 4DQWA 1QR7A 3OVQA 1N8FA 5IBXC 1XBZA 4O54A 3ABSA 3UWYA 1G4SA 3UPBA 1F6PA 1W5NA 3TU9A 3NNTA 1KFLA 4M6QA 5KITA 3G3MA 3NOEA 2YYTA 3PF3A 3NA8A 4LVBA 1XXXA 4FIRA 3IIPA 1M7PA 2E5CA 4I7WA 3B04A 1SZEA 3TQKA 3P80A 4HKPA 3OA3A 3IEBA 3WK3A 5F2IA 3UWVA 1JVNA 4S2CA 1TPC1 1IXNA 3LGEA 3P81A 3L5MA 2BZNA 1N7KA 2V82A 2QCEA 2QJHA 5AYXA 4LRSA 1W1ZA 5DELA 5A8GA 4QQ3A 2J88A 1TPB1 3JR2A 2Z2UA 3W7NA 3NZ1A 4H4IA 6TIMA 3F03K 3KVJA 5CG7A 1TCDA 2QEZA 2UV8G 3C4UA 3U6WA 3CEPA 1W37A 3W88A 1SZNA 1Z48A 3LX9A 3EXSA 3P62A 1H62A 1ML1A 5FI8A 2RFGA 3I68A 1R47A 2YCEA 1UCWA 3GXNA 3M6YA 2CZDA 3H54A 3OVRA 1WDWA 4DPPA 1B4KA 3SECA 3Q94A 2DP3A 3W1AA 1SR9A 3NM3A 2VFHA 5AHNA 3LBMA 2ZRWA 3EB2A 3KX6A 3S5YA 3BG3A 2GPTA 1H1ZA 4L4LA 1FXQA 4AHPA 3FKKA 1FUYA 2CLFA 2GVLA 2VFIA 1TTQA 3HO8A 3W85A 3JS3A 4ZMGA 5SWUA 3W7MA 3M43A 3L67A 4A2SA 1XBVA 2Z0IA 4MPQA 4O10A 1KFEA 1BTMA 4OHQA 3ZS4A 3ZWTA 2CZ5A 2ZYFA 3G1AA 1IXOA 3TIMA 3TC7A 3BK0A 5J5RA 3G3DA 4LWWA 3TK7A 4E2DA 2V2CA 3QF0A 3THQA 1KW1A 1M6JA 4LUIA 4N02A 1PHQA 4PH6A 2DZVA 3HG4A 4ZL1A 4UMAA 3KVLA 3W7HA 3G8RA 1S3HA 1TTPA 2I9EA 3SY5A 3QMSA 2ZA2A 3W6YA 2CZEA 4MFEA 3ATZA 3HF3A 1MEWA 4C1KA 5L9FA 4WXZA 4FO4A 1A53A 2QCDB 4GUFA 4WD0A 2JBMA 3C56A 3O1NA 4GUHA 4GE8A 1SO5A 1TIMA 4K7YA 4H3DA 2TRSA 4RKAA 2Y85A 1C8VA 1ME8A 3G1YA 2R94A 4CQAA 1KM1A 5LHFA 2BTMA 1DV7A 2QCGA 3USBA 3RLUA 2AQWA 4M19A 4TU1A 4UFJA 4MUZA 1IF2A 4N9DA 1M5WA 2FPTA 3A24A 4QJ1A 1R2RA 2DZXA 3JRKA 1T96A 4XWUA 1FCBA 3TAOA 3NQMA 3FKRA 4JY8A 5E93A 4R7JA 1QPOA 1SO3A 4Y6GA 5LGZA 1TPUA 3PUDA 4MY8A 4O15A 1I45A 4L4MA 5LNWA 2A6LA 5CZ0A 4QNEA 1FDJA 3DKLA 4AMAA 4E0CA 3NPUA 1OF8A 5LZLA 1T99A 3O8AA 3HQ1A 3OEXA 1D3GA 4M7SA 1V5XA 1ZALA 1G4PA 3DFTA 3IIZA 3UPWA 2WV8A 1KBIA 4UTKA 3W70A 3IIOA 3TCEA 4NUWA 3G1XA 1YTEA 3S0CA 4QITA 2ZZ6A 4HNTA 2I1OA 2J27A 3BVJA 5FF7A 4N6FA 4DO6A 4JTTA 4QAIA 5DBTA 1WBHA 3QPZA 1GOXA 1OG0A 2A85A 1GVOA 1O5KA 4O57A 4JTJA 3C2VA 4IMGA 4U4MA 4AH7A 4A2RA 2X16A 1OF6A 3FJ6A 3M16A 3F4NA 1FCQA 5FEWA 4N9CA 2GQ8A 3EWWA 1IXQA 3PB2A 5I3IA 4AEOA 1HTIA 1VR6A 2DU2A 4IWWA 1OK6A 4O16A 3W2LA 2VEPA 4E2BA 3NDOA 1EP2A 1U5JA 6ALDA 3P74A 4XQ6A 3C2RA 3O15A 4JN6A 1W3NA 4EF9A 3SJ3A 4EWND 2A0NA 2D73A 4OT7A 2Y70A 1I2PA 1OHLA 4JTFA 1N55A 1TPVA 5CZTA 3L68A 4MJZA 3UY7A 3C6CA 3W2NA 1KLYA 3KRUA 3G1HA 3LBCA 4U28A 2H3BA 4CQ9A 4LC8A 1P4CA 2GOUA 3DU0A 3F4WA 2F7FA 5I3KA 4CNPA 2I14A 3CT7A 3PSWA 3MHFA 2CLIA 2YXGA 4Q33A 5CKSA 5C6MA 1YPFA 4A29A 5IBXA 2NX3A 3GLCA 3PBVA 4UR8A 3C8FA 3HGRA 3PBUA 1FXPA 4WOQA 3CU2A 2C14A 4A22A 1VGAA 3W1MA 1PHWA 1YDOA 1FX6A 2NWRA 1B3OA 1RQEA 1TREA 3TC6A 3F1QA 4PL2A 3NZRA 3GDMA 4NZJA 3NQAA 5FF4A 4DF1A 3VKJA 4AF0A 4O13A 3G24A 3QH2A 2CLOA 2Y7DA 1BKSA 1S5VA 2FDSA 3CIWA 4BI5A 4ZQCA 4OGZA 1H7XA 3W71A 1QDSA 1B9BA 1K03A 4UTIA 2A1YA 2ZQ0A 2VFDA 3G0SA 3QMRA 2FB2A 4IUOA 5FF0A 4Z1BA 2JKPA 1QPRA 1ICSA 3BARA 1W54A 1H50A 5KZDA 4YCOA 2Q8ZA 3A5VA 5BMXA 3LCLA 5BW6A 3B0UX 5I3HA 2V30A 2QAPA 4B5NA 4GWEA 3EXTA 2QDHA 3Q37A 4IX0A 3TKFA 4Z1AA 5C54A 1YYAA 2VC6A 4CLMA 1K8YA 4JNMA 1GQNA 4UFMA 2OZ0A 3MI3A 4QIUA 5EL1A 2CW6A 1AK5A 2Y88A 4FNSA 5C2XA 4O0ZA 3PULA 2VEKA 4DO4A 4O19A 4K8EA 2C6QA 2FJKA 3H53A 1LTDA 3I7QA 2VFGA 1KBJA 4FNRA 1GVSA 3UD6A 2QCLA 4RZ6A 2YYUA 1K7FA 2ZZ1A 4UTTC 1LBLA 1O4UA 1JCLA 4UTHA 2A7RA 3PAJA 1R46A 5TIMA 1LM1A 3STCA 4LS1A 5LNRA 3MBDA 1OFPA 1PVNA 3FFSA 4ZQRA 2E09A 1JQXA 5F1VA 1Z41A 2WO5A 4JX6A 3CPRA 3VFLA 2BSLA 2QUTA 4R34A 5D2TA 3ABOA 1QO2A 2A7PA 3YPIA 4BK9A 3TSDA 2FQIA 1NF7A 4UTLA 2Z6IA 1HO4A 3CC1A 4LC6A 5HNRA 3LHUA 2NUYA 4UXDA 5HMSA 2V8ZA 3G18A 2PRMA 4MIMA 1YPIA 1X8FA 1DHPA 4BI7A 3TW7A 1SFLA 1WOAA 3KAOA 5AB3A 4YLWA 4RX0A 4PA8A 2OT1A 4AF0B 3LHZA 3W7QA 4A21A 1L2UA 2QJIA 3QW3A 3W1QA 3TXVA 4ZVJA 1KTBA 2DZWA 2Y61A 3DENA 4KFPA 1X1ZA 3S1UA 5D04C 2ISSA 3HG2A 2QAFA 4R33A 2DZUA 5DXYA 1OFDA 1IGSA 2R8WA 3E49A 3I7RA 3QYQA 1IXPA 3G0XA 1D9EA 1EP3A 3OIXA 2JKAA 2YX0A 3W2JA 2WSQA 5HUOA 3BGGA 5KSWA 1TPWA 2NWSA 4N2YA 3HG5A 1CW2A 3PSVA 3BLIA 3TQVA 1NSJA 1ZHAA 3N14A 2V2HA 3QPYA 4CCEA 4Y90A 3S5ZA 1KFKA 3FYOA 2W79A 1V7YA 2NV2A 5DY3A 2QCNA 2QCCA 3PBWA 1L6SA 5G2IA 5F4WA 3TXZA 4KKXA 4Y9AA 5CSRA 1WX0A 4O8RA 2Y63A 1GZGA 2CZFA 3EKZA 4MJMA 1SSGA 2G95A 4H6KA 2Y7FA 3W76A 4J9JA 4JTIA 4UR7A 2NX9A 5AYZA 4WY0B 3TJXA 1KFJA 3GX9A 2YR1A 1TV8A 3M47A 3EXRA 2BX7A 3EX1A 3BGJA 2WNZA 3L0KA 3G1FA 2J24A 1VC4A 3IGSA 1Q6OA 3QM3A 4M5PA 1A5BA 1A5SA 5F2MA 4K8HA 5F1UA 3MBFA 5DCDA 1QCWA 5C5YA 1ZJIA 1GG1A 2VELA 4ZQOA 4NJGA 1YTKA 1K7EA 3CEUA 1VYPX 3IGXA 3NPXA 4YL2A 3NAVA 1H7OA 3OVPA 2GVGA 4UMBA 1H63A 4O12A 3W74A 4YMZA 5CZJA 4X22A 3UWUA 2JK2A 1VPXA 2QCFA 3GIYA 1AL7A 3LCHA 1XM3A 5C55A 4ML9A 2HS8A 3PUEA 5CPOA 3WJSA 5DY2A 1NAL1 3LTPA 4UNLA 2ATMA 3SSJA 3G1VA 2QDGA 1KLZA 2V9DA 4FNQA 4MY1A 2KZHA 2A2IA 4N9BA 2NLIA 2EGZA 1GVRA 5CPNA 2NV1A 2Y62A 3KHJA 2JKEA 3GDKA 4JTUA 3PY2A 3HOJA 3GNDA 3MHGA 4UFLA 1JR1A 1OFOA 2ZRXA 3FIGA 4NU7A 2VFEA 3NEVA 5I3GA 1MEIA 5AN7A 1QPQA 1D3HA 5IM51 1GYNA 1TV7A 2VEIA 3INPA 3S1XA 1RQHA 4CCDA 1H7NA 1KFBA 5K7JA 2GJLA 1AW1A 3EWZA 4JTEA 1C29A 4AWUA 3QFEA 4ADUA 3PG8A 3MJYA 3DFNA 1HG3A 2BLEA 2ZA3A 1O60A 3MO7A 3MYPA 1O94A 1VHCA 5E0KA 4NXSA 3C52A 3STFA 1JQVA 1S5WA 4GUIA 3M1ZA 4EIVA 1ZENA 3SFKA 3O06A 3NPWA 4OWGA 2NX1A 3W1PA 4XKYA 1R2TA 3MYOA 1PIIA 3G8EA 2DZTA 2EHHA 3HJZA 3W73A 3N9SA 1F05A 3FJLA 4NVTA 5E1QA 1YTDA 4ALDA 3RNDA 1EX5A 4IPJA 1C9DA 1SUXA 4NNAA 3G0UA 4O4VA 1UASA 1G7VA 1CX9A 3I6RA 5D03A 2CFFA 5K2ZA 3STGA 1NEYA 3R89A 4LNYA 4TMBA 3T78A 1QAPA 3NL6A 3T7VA 4ORIA 2W6RA 4RXFA 4UUIA 3DXIA 4Q4KA 3BW2A 4UTTA 4ORMA 1ZY9A 1G67A 3T40A 3OBKA 1TQJA 3C0JA 1A5CA 1JCXA 1EUNA 1RR2A 2GUUA 4OU1A 4P61A 3IV3A 4POCA 1Q45A 1JUBA 2Z6JA 2H8XA 4LY8A 4UFHA 2EF9A 3HGOA 3LHWA 1G4TA 1WQ5A 3P5ZA 3CWOX 3NQDA 1XFBA 3W1NA 1WOBA 1SSDA 1Y0EA 3L66A 2A21A 1JCMP 4YWIA 4FX7A 3P5YA 4AB4A 4ADSA 4DF2A 3UXAA 1HL2A 1AW5A 1H1YA 1FDZA 1ICQA 2P0OA 4JYDA 4PODA 4HNNA 1EB3A 4O1CA 1SW3A 4LU0A 5HQEA 2G96A 4MY9A 5EYWA 4CNOA 2A7NA 3E9AA 3GKAA 3GAYA 4RXGA 3P8JA 3GYEA 3C2OA 3M7WA 1PCWA 3GNNA 1ZNNA 3MI2A 3TUUA 3W7DA 2QR6A 4OE7A 2VEMA 4GJ1A 3O6DA 4XUGA 3STEA 3C3NA 8TIMA 1AMKA 2C18A 1W5OA 1LRTA 3W2UA 1SQ7A 1EP1A 1K3UA 3VE9A 1RZMA 3EX2A 1HUVA 2OX1A 4TO8A 1OYAA 3PVFA 1JRBA 1DOSA 4GRSA 3B0VC 3TE9A 3BG5A 3IVUA 4O4WA 3W72A 3NXFA 5F2LA 4PFMA 5D2VA 2ATSA 4Y8FA 3W7RA 2F84A 2B0MA 4GUGA 1XUUA 2C3ZA 3EWBX 5MHBA 4A3UA 3LERA 3T55A 2WJZA 5AYYA 3LRMA 5FF3A 5CPLA 2WPBA 3AJXA 1KM0A 4Z0SA 5EY5A 4YXGA 3A21A 1OK4A 2FB3A 2FPYA 3ZR4A 4XBKA 4HNVA 1LLWA 1MZHA 1VCFA 1O5XA 2JGQA 1ME7A 2PC4A 1YDNA 3W7OA 3PUOA 4I9AA 1FCVA 5G4EA 5LNSA 5DCEA 1LORA 3TFCA 4RV8A 3HPSA 2E68A 1W3TA 3R5EA 5T26A 4ICNA 3GDLA 1P0KA 1QWGA 4UNKA 2TPSA 3P60A 5K9XA 2C0AA 4HHPA 3RF9A 5I3FA 4LV4A 2B7OA 1VCVA 2ZZ2A 3A23A 4XTIA 5G2HA 1HO1A 1F76A 3DI1A 4UCGA 1EEPA 4IGHA 1ADOA 3UZ5A 2X1SA 1SZFA 2NXHA 3KVMA 5HWJA 1VYRA 3N9RA 4X2RA 4HN4A 5J5DA 1UBSA 4BI6A 1VHNA 4CNNA 1QO5A 4QISA 4LTSA 2NUWA 1I2RA 1GTHA 2H90A 4O1DA 4Z08A 1AL8A 1JRCA 4NZFA 2B7QA 1YXYA 1MEHA 2A5HA 4NNBA 1L9WA 1XC4A 5AC8A 3RU6A 4ONVA 4ZZ9A 1UB3A 4G1KA 1OVDA 4K36A 5D05A 3VCRA 1ZCOA 2XN1A 3UXDA 1I2NA 4JX5A 2ZRZA 5K9DA 3LRLA 1J4EA 1KM3A 2Q8LA 3OG3A 2Q3RA 1LBFA 5TQLA 4YCPA 4OQVA 3PG9A 4MLJA 3LTSA 2NXIA 4I7VA 3C2EA 1XBXA 3NG3A 1I2QA 1VYSX 5HR6A 3EKLA 4ZQMA 2WOQA 4BF9A 2H3DA 3HB9A 1W31A 1ME9A 3FLUA 2VENA 5KTLA 2CLEA 1YDVA 2WNNA 3GXPA 3BW4A 5D09A 4DF0A 1EPXA 3TJLA 5D2XA 2YFNA 4TR9A 4O52A 4O14A 2BXVA 3GR8A 2QCMA 1OX5A 2ZFAA 3NPVA 1FQ0A 3LXCA 4AAJA 1W56A 4BWLC 5BMWA 1KM5A 3THAA 3V1PA 3HPZA 1GPWA 3TSBA 1DJNA 2C13A 3WK1A 4LV9A 4O53A 2DJLA 4K39A 4WUIA 3SIZA 3P61A 1L6WA 1SFJA 2PCQA 5FEZA 2Y7GA 1QOPA 3W22A 1TB3A 3E02A 3G1DA 3LV6A 2QCHA 3G22A 4NXKA 3W23A 3NL2A 2E6FA 4IXXA 3IGUA 1DL3A 2HMCA 4IQLA 2FFCA 2ALDA 3LRKA 1O95A 2E6AA 3S42A 1F73A 1EWEA 4AVFA 3TW6A 5FESA 3VI2A 3LDVA 4LVGA 2YSWA 2YDAA 3P82A 4MVAA 4AHQA 3R2GA 3CB8A 4JX4A 2R91A 3DBPA 3EWYA 2BWGA 2HTMA 3A9IA 4LOCA 3W2MA 3W1TA 5G1YA 3W1UA 3LHVA 2VXNA 3LCIA 1TJRA 4EOUA 1IIGA 1LP6A 4LS0A 4GBUA 4TMCA 2WNQA 2E5DA 5AC6A 1F6KA 2H6RA 1F2JA 1SO6A 3MMTA 1JCNA 3L0GA 1R2SA 1QMLA 1LLZA 4WJEA 4NJKA 5EMUA 2AAMA 1DBTA 1H61A 1LROA 4O50A 4OV4A 1DQWA 4NNCA 3DFOA 5AHFA 2RKXA 3ELFA 1FWSA 1G4EA 3NQVA 4WXYA 2WSYA 5DLCA 1VS1A 3IRDA 1AW2A 2LLEA 1XI3A 3O07A 5G1TA 1B4EA 1J2WA 2E1DA 2ISVA 1EA0A 2PE4A 2C1HA 1Q6QA 1TJPA 4O11A 1SPQA 3A22A 3D0CA 4AWSA 3W7KA 4RZ5A 3L65A 5H2ZA 4UMCA 2FIQA 4JY9A 5AC7A 2WSRA 4KFNA 4NX0A 5ABTA 4RZ4A 3NQ2A 2QJGA 2B4GA 3TX9A 2C15A 3OHIA 3GXTA 3M5VA 1NF0A 3GDRA 4N4PA 2EPHA 3KVKA 3VE7A 5KINA 4E38A 4FX6M 1WBJA 2X1TA 4JIPA 4OV9A 1UUMA 3L0NA 4N9EA 4C1LA 1KM2A 1LOQA 5BNKA 3M0ZA 5D37A 2V0TA 4X9SA 2IQTA 1VRDA 1BWLA 3LM7A 3E12A 4GUJA 3N34A 3E0IA 4RK8A 3HBLA 2H8ZA 3DHDA 1A50A 3W84A 3DFSA 3U2OA 1AG1O 3K30A 2O7QA 4KFOA 1GT8A 1ZAHA 3NQGA 4IPIA 3UWZA 3NGJA 3PBYA 5F2GA 1IIHA 1K8ZA 1LDCA 1PE1A 1H7PA 1YLVA 1TQXA 2RDTA 3GVGA 4UIOA 1MO0A 5KMYA 1P1XA 1DJQA 2ZRVA 3P8IA 4DO5A 3LI1A 2OT0A 1UUOA 4UTMA 4O1AA 4O17A 1KFCA 2DZPA 3MP3A 3U8GA 1EUAA 2TMDA 4NX5A 4HNUA 4W9TA 5U4NA 3W7PA 1QPNA 4AHOA 1TV5A 4DELA 5AHLA 2QCDA 4IX2A 3C2FA 4QNWA 1TPDA 1F5ZA 3VNDA 2J9YA 3O6YX 1F7BA 2G5WA 5AHMA 1WAUA 1J5TA 3ABQA 1ZFJA 2PRLA 3TFXA 1L6YA 1XDMA 3WJWA 1S5TA 3HGSA 4M7TA 5BRBA 3KRSA 1GTEA 3N19B 2ZA1A 2B7PA 3B03A 3ANYA 5K9CA 4JS3A 2ZDRA
chains in the Genus database with same CATH superfamily
3SUWA 3GDTA 1Q2RA 3DHUA 2F2KA 3N4EA 3CHVA 3CQJA 3BSGA 4MOZA 1Q6RA 3VMPA 1SO4A 3RRAA 3GTFA 1CXKA 3LCWA 1CLXA 4A3RA 1EQCA 3SY1A 2RJGA 2VKZG 1UD4A 4NJIA 3N9KA 1VJIA 3CUXA 4DXVA 4FEZA 5DX7A 3UYCA 1EIXA 4K38A 3BC9A 3THUA 3S9ZA 3LOTA 3TA6A 3DUGA 1E9LA 1WDSA 4LT9A 3TN4A 1BHGA 3NZQA 4LNCA 2XWEA 2FPVA 1QXLA 4BR1A 1PX3A 2PLJA 5D38A 1K70A 3TAKA 2EPLX 3H7UA 3N25A 3E5BA 1GYLA 4PMXA 3VC5A 1P1MA 5D32A 3UG3A 2ZADA 2MUCA 3SZ8A 4AVNA 1TTIA 4X60A 3FV9A 1W17A 2XIQA 4PB5A 2BODX 3TW9A 4US5A 1ZP4A 1F8IA 5REQB 4FK9A 4WEVX 2YFOA 3IK2A 2VGGA 2NZLA 2YPIA 3BMVA 1QW7A 3M44A 2E4TA 4X3ZA 8CGTA 1FKWA 4X63A 2QKFA 4TV6A 5HANA 4MZYA 3BCDA 5BOFA 3HPAA 4F0KA 5CGQA 3CMGA 3RLVA 4CQDA 4S1FA 4JOMA 3S1VA 3VK5A 3WIJA 4JFTA 3P7YA 5IRPA 1GVFA 3A5FA 1ITUA 2HRWA 2XU2A 1UR1A 3N73A 4L9YA 5BXTA 1SW0A 4JDBA 1E6RA 4M82A 4X2PA 3CIXA 2OFJA 4GJJA 2XFYA 1V79A 4RZBA 2J9XA 2J62A 4A3HA 5HDRA 1UR8A 3PWAA 2V2DA 4F0LA 2PDIA 3EX3A 1OX4B 2NT1A 1TRIA 4M81A 3W7CA 2G37A 4MZ1A 1JPIA 4IPLA 2IUZA 4WKFA 9XIAA 4REQB 3S6TA 3GD6A 3QHNA 5FF2A 4B5SA 2HSAA 1TMHA 1L0PA 5LHEA 2HE8A 5E6ZA 4URIA 4XBSA 3FYPA 1LZOA 2YXXA 4DYJA 4WZHA 4XZ9A 1BXBA 1ZBKA 2A3BA 1AUSL 3BLLA 4ASTA 2GJXB 1TSIA 3UG5A 3QEZA 4FLQA 4ZR8A 4PC8A 7ODCA 3B0XA 1Z8AA 4HT3A 2DSVA 1Q7ZA 1DTUA 3APGA 4RUBA 2ASHA 2X1UA 1I6NA 1FH7A 2YLLA 1DVJA 1FWFC 1V0KA 1CI1A 3CM4A 2J79A 3L2LA 2G97A 3VABA 5E70A 3V75A 1PWLA 2Y24A 3MI6A 2HXTA 5GNZA 2YB1A 2YCJA 3R8RA 3UGRA 3NTYA 2OEMA 2VRKA 3VINA 3NQCA 1QNPA 4IXHA 3PJWA 1G69A 2VNCA 4D1JA 3U48A 1TR1A 3MMWA 3W07A 4TX9A 2E40A 2IQ0A 2DORA 5I07A 3ZSSA 1BYDA 5I2UA 2GVEA 3BAJA 2FLIA 3VDHA 1X7FA 3OPSA 4H04A 1M53A 4GGBA 1NDWA 2GK1A 3L21A 5CZSA 3GR7A 2BVTA 3TVAA 4IQJA 4GINA 4ICCX 3RO8A 3SBFA 4Z2HA 2GWNA 3GK0A 4GC4A 4K1WA 3QY8A 3LLDA 3I10A 1RK6A 5HMFA 4DZ5A 1NVMA 4DBDA 2CESA 1DWAM 4NI3A 1UKPA 1Q8AA 4W5UA 3UR7A 2D24A 3DN5A 5I00A 1EC7A 3HIJA 3ONCA 4J4KA 4QDWA 1E40A 1A80A 2D69A 2OSYA 4ZB2A 5D2WA 2HVNA 4AISA 3FA5A 2B7NA 3WQCA 2CLKA 1QBAA 5K4XA 3AMLA 3RFAA 3ZFHA 4U3AA 1RALA 2OGYA 4L65A 2X0SA 3OQEA 3LCFA 1HIZA 3VMNA 2Q09A 3KWSA 3T1GA 4BFAA 1Z44A 1ZPTA 2WQPA 1DWGM 1Y65A 4PCPA 3UNTA 4KESA 1TZ7A 2CLMA 1XKYA 2OZTA 1VEMA 1MXSA 3E6EA 9XIMA 2GFTA 3NQBA 4HU0A 1NQKA 4HA3A 1XYMA 2Y2WA 1XDLA 3CUZA 2VC5A 4O1BA 2ZCGA 1OGGA 4PTNA 3KTCA 3E96A 4JTKA 4MG4A 4Y9NA 2YZRA 3WQOA 1R9YA 2I16A 1GEQA 1TZ9A 2NLYA 4JTCA 1PKNA 3VIIA 2DIEA 2YL9A 4MHBA 2WZIA 4AD5A 4IIEA 4Z0JA 4WY0A 4UZSA 1R30A 5G5IA 1HVXA 4PRRA 3HFYA 1EJUC 1E55A 4FXRA 1TTJA 4GY0A 1L8PA 3TMQA 3FX4A 4O28A 1EGMA 4XUYA 4W8BA 4ZQPA 2X09A 1TO3A 2VEFA 2Z1VA 3UT0A 4AXNA 1JAEA 1LOSA 4IF2A 4IMCA 3SCPA 3DI0A 3OGVA 3MY9A 4KWWA 1E5JA 3MCMA 4NJJA 2A4AA 3SW6A 4FF7A 2DH2A 4CN6A 3DG6A 4ZA0A 1VFOA 3JUGA 2J47A 3GG7A 2VO5A 3WD4A 4R9XA 3KOFA 3KLKA 3PJTA 4QEHA 3F2DA 1E4IA 3MUXA 1KRCC 4NL1A 3R7MA 3IVSA 4R85A 1LYXA 3OHMB 4HB7A 3W02A 3LXAA 4DI8A 3QTGA 2Z4GA 3CUHA 3WBAA 3AMCA 3BPWA 3S3GA 3XINA 2V5KA 3LPGA 3R13A 5IHRA 2ZICA 4DUOA 1O6IA 1NWRA 1OD0A 5JXQA 3IGHX 3B0PA 4LVAA 2FTWA 3W1RA 2QJMA 1HNYA 3M0XA 4TIMA 4XTDA 1WXJA 3EMQA 1C7TA 1BTCA 2DZSA 3VIPA 3UP8A 3DYMA 3L9CA 3MDWA 1FWRA 4IMDA 1GG0A 2HCVA 3R10A 3PPHA 3VOCA 2CLHA 1TIWA 1VZWA 4U2ZA 5AHIA 2VUNA 3VGFA 1MXGA 1E9YB 1XX1A 4D71A 4B3LA 4H8UA 4KEUA 3EWUA 4DNMA 3N3MA 4WJ8A 5E5CA 1XRSA 3TQ0A 3W75A 3M41A 3IUDA 1BF2A 1RVGA 3S9YA 2WZTA 1OC6A 4LF1A 4IZGA 1AH3A 3NSNA 2YA0A 4QLKA 2X0HA 2E5BA 4L7ZA 1XLKA 3U57A 4W7WA 5HWMA 1KRMA 4MWAE 2PLCA 1TYGA 3MVIA 1HL9A 4D6DA 1IT8A 4DQWA 4ZB5A 1LL7A 4GVGA 1XBZA 3UWYA 2PWUA 3UPBA 1F6PA 3NNTA 4M6QA 4L1GA 3GFYA 3NOEA 2P8CA 1G0CA 4FIRA 1M7PA 3AMGA 2BY3A 3M07A 2A3EA 4J3VA 2W62A 3CL6A 4I7WA 3B04A 5LXEA 2QZRA 2OXNA 2PDMA 2OELA 2W67A 3P81A 6A3HA 3GTHA 3PZVA 5AYXA 2VEGA 2E0PA 5DELA 4EXQA 4YIWA 3W7NA 1KGUA 3NZ1A 4H4IA 3G77A 2D3NA 3SQLA 4XZBA 4GZJA 2UV8G 4YN5A 6TAAA 3H2FA 1W37A 1RBOB 2BXYA 4IP7A 1W2VA 3P62A 3NDZA 5FSDC 1POJA 3NEHA 1DHKA 3SECA 2G3NA 3DC0A 8XIAA 3NWRA 2VFHA 5AHNA 3VDCA 3I4KA 1O7AA 3KX6A 1XH1A 3TOYA 2BNJA 4AHPA 2CLFA 1E0UA 1TTQA 5C9ZA 3HO8A 3W85A 3JS3A 4AIEA 2ZDSA 2OU4A 3H21A 2Z0IA 1PZ3A 2I17A 4WSHA 1KFEA 1VJZA 5HQMA 1A5UA 1PKYA 3J7HA 3TC7A 3H12A 4IICA 4GQBA 4DJDD 1KR1A 3THQA 1M6JA 1TV3A 3WEOA 2RGMA 3HG4A 3OGRA 4AEFA 2GGEA 3T42A 3AU2A 4EAMA 1S3HA 1TTPA 2I9EA 1XYCA 3HF3A 3H26A 4NI8A 1FRBA 4C1KA 3N1AA 4FO4A 1Z6KA 3TZFA 3GXMA 4GUFA 4WD0A 5CBBA 3C56A 3M0LA 3O1NA 5IFTA 1GQIA 2BMBA 4JKKA 4H3DA 1C8VA 4I8DA 5A6AA 2R94A 1KM1A 4FALA 4JQ2A 3ZJ8A 3USBA 3RLUA 4AZ7A 4MGGA 5E0CA 2OR2A 1VPQA 1A3XA 4MUZA 2RAGA 4N9DA 2R82A 3F5KA 4XO7A 3VD5A 4B4FA 2VCCA 3CV6A 1R2RA 2DZXA 5LIWX 1A49A 1T96A 2IKHA 1FCBA 1EIBA 3NQMA 4R7JA 1UIPA 1SO3A 4D6CA 4O15A 4F0SA 4Q8QA 5CBJA 2A6LA 3VOGA 4EKJA 1UJQA 1CPUA 3GG0A 3OA5A 3RHGA 3OEXA 1D3GA 4Y9PA 4TOQA 3ITOA 5H8MA 3IIZA 2VZUA 3UPWA 2BV9A 3ISIX 4UTKA 1UKOA 3G1XA 1YTEA 3S0CA 2J27A 4DJFC 1CGUA 3PZTA 3BVJA 3T09A 1BF6A 1V7AA 3ENLA 4JTTA 1RP8A 4PUJA 3CO8A 3WSUA 1GOXA 3FNDA 2WHLA 4LBRA 5BYWA 1O5KA 1U5HA 2NW0A 2X16A 2WPGA 3IJ6A 5FEWA 1S2UA 1ITCA 4PZVA 3UPMA 5I3IA 4IWWA 2PU0A 1TX0A 1UROA 4IP4A 2VEPA 1FA2A 3NDOA 4FI4A 1U5JA 5HMEA 4DUWA 2XYLA 1Z69A 5I24A 4NAEA 3REQB 2W66A 1OHLA 3SCWA 1ADSA 1AH4A 1OWQA 4GVIA 1FHVA 2QVNA 3G1HA 3LBCA 3ZO9A 1BWVA 4W87A 1F4AA 5FD0A 2I14A 1XSJA 3CT7A 3MHFA 4LSBA 4MMWA 4ZENA 2CLIA 2V5CA 5CKSA 3RRXA 1GCYA 1YPFA 4A29A 4J1OA 1UWTA 5IBXA 2NX3A 3GLCA 3ARTA 4OUEA 2BOGX 2DVTA 3HFTA 4DN1A 3AWOA 3HGRA 3ID7A 1FKXA 2WHKA 2C14A 4A22A 4D6GA 1J6OA 2G4FA 1FX6A 2NWRA 4HZ7A 4F79A 2IKGA 3RIKA 4W88A 2PI6A 1B90A 3U7BA 3VM5A 3NZRA 2HPMA 2QT3A 1XQKA 3NQAA 4DF1A 3VKJA 3G24A 3FGCA 4L64A 3SCRA 3CIWA 1QDSA 1P6BA 1C92A 1NOUA 2O9PA 4YCOA 4JTAA 5A8MA 3FSUA 3A5VA 5I3HA 3A4XA 4E3TA 4NZ5A 3VDGA 3ANUA 4C6BA 3MS8A 3N13A 4NY2A 4TX8A 4JNMA 2Y8UA 4AQLA 2OZ0A 4XAYA 1ZRQA 4YTQA 5EL1A 2CW6A 4K68A 6REQA 4FNSA 1NWUA 5C2XA 1PTDA 1ZJBA 4LYKA 4O19A 2C6QA 1GJWA 2VZSA 2VFGA 2PDLA 3WEZA 4FNRA 2PLKA 2QCLA 4RZ6A 2POTA 1K7FA 1E6SM 3UA3A 4E6MA 1LBLA 4Q7NA 4FSAA 1O4UA 2ONEA 2A7RA 4C5ZA 1R46A 1LM1A 1XQLA 5B7ZA 4ZQRA 1OFPA 5CAKA 1JQXA 4JX6A 4QE4A 3CPRA 3VFLA 2QUTA 4R34A 4AVOA 1QO2A 3AICA 1EJWC 3YPIA 5C8BB 2JF6A 3VGEA 1VEPA 1MFUA 3ZJ6A 2NUYA 4UXDA 3SM0A 1KKRA 1YPIA 2DDXA 4CD6A 1SFLA 3KS5A 4RPQA 2VX7A 3KAOA 2Q02A 1KXVA 3SRDA 4MADA 3W27A 2AAAA 4QFUA 4S3DA 2J8FA 1VBRA 4XZLX 4AYSA 3F7JA 1KTBA 4S3BA 2C1GA 4KFPA 4IUGA 4M24A 1B2YA 4DWSD 3S1UA 2QAFA 4R33A 1TVLA 1IGSA 2PFHA 3E49A 4OOZA 1IXPA 1EP3A 1E6PA 3OIXA 2JKAA 1F6YA 3KLLA 1DJHA 2WSQA 3BGGA 3KL3A 5KETA 3QOKA 1UD6A 2JE8A 1R86A 1TPWA 1NM9A 1O68A 5DMMA 3NSMA 4HZ6A 3TQVA 3PNZA 2V2HA 4PUNA 3KZSA 3NIYA 2VL4A 1GW1A 2ZUWA 3TJ4A 4H9TA 2I57A 3E0WA 3T08A 2QCCA 5HA7A 1XP3A 4B5WA 4OFCA 1WX0A 4BZYA 2R1LA 4D6FA 4XIMA 2G95A 2P3EA 3C2YA 2VR2A 3W76A 4PMOA 1VD6A 4J9JA 3UBPC 5AYZA 1ZZMA 5A6JA 3RLGA 1KFJA 3GX9A 4TVDA 2RUSA 2HQAA 2BX7A 3WUBA 3KCOA 1WDPA 1Z7AA 3BGJA 3LMYA 2R24A 4LJ3A 3G1FA 2J24A 4E3VA 4US5D 4KMQA 3B9NA 4MWAD 1B0IA 5F1UA 1V93A 1KQYA 1QCWA 1MW3A 2VELA 4PBEA 4NJGA 1IWPA 3BE7A 2HISA 4EPKA 4IFOA 3ARPA 4AZHA 1AQMA 2P8BA 2GVGA 3WBEA 1H63A 2HK1A 1XLLA 5HPCA 1NWSA 3FAXA 1M7JA 4X22A 2E25A 1DP0A 3RU8X 1GOWA 1AL7A 3LCHA 1VRXA 1EDGA 4WHBA 3LGDA 1ZGDA 2ATMA 1M65A 1P6CA 1R7AA 4N9BA 2Y62A 3VGBA 3GDKA 1XS2A 3PY2A 4UFLA 1OFOA 5HK4A 2ZRXA 2CC0A 3FIGA 4Q7BA 3LEPA 5I3GA 2EXOA 3FEQA 5AN7A 1UKQA 2PAJA 2OO6A 2PDWA 4ZTXA 1I0BA 1TV7A 2G3IA 3PTKA 3INPA 1V3JA 4EXAA 1FHDA 4JTEA 3MTWA 4WKHA 3QFEA 4ADUA 1CWYA 1QHZA 3MJYA 2WMHA 3DFNA 4JNZA 1HG3A 3SCUA 3A3WA 2ZA3A 5E09A 4UTFA 4NXSA 3C52A 3STFA 4GUIA 4XKMA 2ZXBA 4RE4A 3SFKA 3UJ2A 3S9IA 3KZPA 2DZTA 1CYGA 3EDJA 3LPFA 1UWAA 3HJZA 4HPGA 3N9SA 2YJQA 1KBBA 1ONWA 3HURA 2QLYA 1EYWA 4REQA 1EX5A 3IACA 2PUZA 4UR9A 1C9DA 4NNAA 4FR1A 1UASA 5IOBA 1WCGA 3PPCA 3KW3A 4ACZB 4Q4RA 4TXEA 3R89A 1OIFA 3VNLA 5EGRA 3F4DA 3T78A 2DW7A 4Q4KA 4UTTA 1DE6A 4IQEA 1G67A 3B4YA 3OBKA 1JCXA 1XLDA 3SADA 4MF4A 2FZNA 3VX1A 2DQXA 5I6SA 4OU1A 4P61A 1QHOA 5AKQA 4POCA 4W89A 5LIXX 3WKZA 1JUBA 4C6IA 2H8XA 1A0EA 4ZOEA 3C3UA 4JTRA 3AYSA 2VYOA 3BL3A 3P5ZA 3SEPA 3WD0A 2P50A 1YIXA 4JPGA 3NQDA 4P8XA 4HU8A 1XFBA 1Y0EA 1W9PA 3VDBA 3L66A 4I6VA 4YWIA 3O7UA 1HKIA 4DF2A 4I9TA 3QGAC 2CHNA 1HL2A 4PYSA 1NOFA 1FDZA 5H8PA 4HJFA 2P0OA 1BSLA 4PODA 3K1GA 1SW3A 5HQEA 2G96A 5EYWA 3BZGA 3GAYA 4RXGA 4JIEA 3I3EA 2UWFA 1D7KA 1E9ZB 3GVRA 4PTMA 3QFWA 3K1DA 3O6DA 5CH9A 1HQTA 1RLDA 8TIMA 4KCWA 3GVVA 2ZC1A 1B3WA 3V0TA 1PKLA 1EP1A 1E1CB 1RZMA 5FJIA 4C6PA 3EX2A 2OX1A 3PVFA 5E6YA 1DPMA 3OTRA 4WGXA 2GQ3A 5A8QA 2NSOA 2HNHA 4CU6A 2ATSA 3V0UA 1F61A 4S23A 4GUGA 1E0XA 3EWBX 1XICA 2UY3A 3NZGA 1M41A 2GOKA 3B9DA 5AYYA 1UWUA 1N8WA 5CPLA 1GOKA 3L4WA 4WGHA 3A21A 3ZR4A 4XBKA 4HNVA 1MZHA 2VUYA 2JGQA 2PC4A 3DYOA 3R11A 3M0MA 3PZOA 4D8ZA 1XLJA 3W7OA 3G6LA 3AIRA 5CZKA 3VIGA 3PUOA 1OT1A 5G4EA 4PGLA 4PMNA 1LORA 4WDUA 1FFQA 4JZ5A 2NVDA 4IG2A 4PUDA 2E68A 3UR8A 3R5EA 4J5NA 1P0KA 1QWGA 5JMUA 2DT0A 3FDGA 3P60A 2C0AA 4HHPA 3CAVA 2SFPA 3CHFA 5I3FA 2DSZA 2DIKA 3MC5A 5G2HA 3IWPA 1L2QA 4WJXA 3E1F1 4UQCA 1ADOA 3UZ5A 2INEA 1SZFA 3KVMA 5HWJA 3ALFA 4LBUA 3KL0A 4HCDA 1UBSA 3F5JA 2VQTA 2NUWA 3N12A 2H90A 2OKOA 4Z08A 1XIEA 2B7QA 3LS9A 1Q66A 1MEHA 1YXYA 4NNBA 1L9WA 2FVMA 2J7CA 4ZZ9A 3VCRA 4LBSA 4KCVA 4WCJA 4E4FA 3IK4A 3LSBA 1ZSXA 2Q3RA 5TQLA 4YCPA 1QNOA 5EU9A 4OQVA 4MLJA 1ELSA 3LTSA 1S2AA 4I7VA 3C2EA 1XBXA 3VZZA 4E8DA 4ZQMA 4YTSA 4BF9A 2H3DA 3CT2A 4HVXA 3HB9A 3ARWA 2CLEA 3KDOA 4CUCA 1YDVA 1FWGC 3BW4A 5CLTA 2QULA 3LMZA 4DF0A 1JF5A 2B31A 3G1RA 4TR9A 4TVUA 3UW6A 3K8KA 3RG6A 2KAUC 2OLHA 3MUCA 2QCMA 1WP6A 3VCNA 1OX5A 2G50A 2ZFAA 4JQ4A 4UQEA 4O1FA 4AAJA 4D6JA 5A6KA 3LENA 1W9VA 3SCVA 1RAKA 1E71M 2HJPA 1EX1A 3THAA 4P7RA 3TSBA 3N2TA 1DJNA 4HHLA 2WKLA 2DJLA 3H7RA 4CVWA 3SIZA 4HU4A 3RCYA 2Y7GA 1TB3A 3E02A 3G1DA 2GJRA 3W23A 1WDDA 2X2YA 3Q4DA 1GKRA 2FHBA 4IXXA 2ALDA 3LRKA 1O95A 2E6AA 1GPFA 3GTNA 4MUPA 1EJXC 2WWDA 2CPUA 2NQ9A 1UWIA 3W25A 4CEXC 3TN3A 4LVGA 1ENUA 1MWOA 3U2EA 1RVKA 1IZKA 1XG3A 2G8ZA 3E5PA 3EA2A 3DBPA 1XIDA 3W4RA 1V0MA 3OZMA 4ZXOA 1J93A 1UZHA 1UKTA 5HJXA 3O2LA 1E73M 3W1UA 1IIGA 1E43A 1KBKA 4GBUA 5A6MA 1D8WA 4QEEA 1AFSA 1VAHA 4S3FA 4WVXA 1Q13A 1R2SA 2W92A 4ATWA 1LROA 2OQLA 3CZGA 4OV4A 4H9XA 4ACYA 3WH5A 2FVKA 3ELFA 3EKGA 4L1XA 1MDLA 1CZ1A 2WSYA 1E6XM 3O07A 1EA0A 1JDCA 2PE4A 4KQNA 1QHPA 1Z89A 2VX4A 1TJPA 3SN0A 3SURA 4AWSA 2FGLA 4C5YA 4FXJA 4GIAA 2BGSA 2HPIA 2FIQA 5AC4A 4JY9A 2WSRA 2CBIA 4MJ4A 3W0KA 4J3WA 2TAAA 1TVNA 3NQ2A 2B4GA 3OHIA 3M5VA 3WL1A 1E9IA 5E0FA 3S2JA 4XSMA 1KRAC 5KINA 4PRTA 2GSEA 2P88A 5M2FX 1WBJA 2QYGA 4HNOA 3WH6A 4MJ2A 5FJJA 4B5UA 1ZTVA 4XZMX 4C1LA 5D37A 4NIRA 4X9SA 2AMXA 1PSCA 1P48A 1VRDA 3OGSA 4G1NA 3I3DA 1K9TA 3BAWA 4RK8A 2VHLA 3F5LA 3UZWA 5JVLA 4AEEA 3W84A 3V5CA 3U2OA 3SCQA 4H1ZA 3LSCA 3BURA 4CVUA 1OQFA 3S2NA 2WBGA 2O7QA 2BOEX 3IJLA 4UQAA 1FP9A 1TKKA 5CC7A 2D2HA 3TYDA 1OM0A 3STPA 4IPIA 4AZCB 3UWZA 3PBYA 1XKJA 2OYKA 1EGZA 1IIHA 4JQAA 4GIEA 1LDCA 1PE1A 2DUZA 2WW5A 5KMYA 1Q7MA 1DJQA 3P8IA 1XCWA 2ALRA 2OT0A 3T05A 3O3RA 3AAMA 2DZPA 1EUAA 2TMDA 1FWEC 1QPNA 1TV5A 4DELA 1OCBA 4IX2A 3FJNA 3N2BA 3ABQA 1ZFJA 3TFXA 1XDMA 2F6KA 1S1RA 3HGSA 3KRSA 4R27A 1P7TB 4NAFB 2B7PA 3EOLA 3ANYA 4JFWA 4JS3A 4HIBA 5GVJA 1H51A 3IUHA 2ZX5A 2X2GA 2P5NA 2D20A 3B8TA 1OX6A 5D9PA 1IHIA 3SR7A 2PP0A 1W1A1 1TG7A 2ZXQA 5EA9A 4AFYA 1PV8A 5ABGA 1KO0A 1OFAA 2NQZA 2WM0A 4LY4A 1QW8A 3L23A 2B81A 2ICSA 1PYFA 3GHUA 1H7WA 3QHMA 1I4NA 4GKLA 3UWWA 3MVTA 5EBUA 1AQHA 3DAQA 1Q3NA 1JD7A 3PHAA 3CV2A 4KEZA 3VIHA 4Q4QA 3UYIA 4FLSA 2WVVB 3RO6A 1LQ2A 2G3FA 4W84A 3I7SA 2Z00A 3NYDA 1TR9A 4O18A 1W3JA 1ZBWA 4B9YA 1LT7A 3S8HA 1SU5A 1TUXA 4HMNA 1OABA 3NQFA 1JF6A 3TDFA 3LXBA 1VFFA 3M5ZA 1A5KC 3EYPA 2X05A 2DV0A 1TPEA 3R25A 4MDPA 3R12A 1K77A 3F2BA 4PUEA 1F74A 5EPDA 4Q32A 2GDUA 3TR9A 1W5QA 4IIGA 1XGDA 4YYFA 4JHMA 4LX4A 4QX4A 2WMFA 1L6GA 1D7FA 3IPWA 2HS6A 1WXZA 1XYAA 2WMGA 4PCFA 1Q6FA 2I5QA 5I02A 4H41A 2GUBA 3ARVA 3PZQA 3PZMA 1XW8A 3KE0A 2OEKA 1KTNA 3UCCA 4NQ1A 3I65A 4KBXA 1WPCA 1UC5A 2FH8A 1GYMA 3FY1A 1WE5A 2PB1A 3KBJA 2EKCA 3S83A 5I3JA 1S2WA 4V2XA 2DT2A 3GU1A 4IMAA 2W3ZA 4Z1CA 4O0KA 1PS9A 3IIVA 1UH3A 2VMFA 1I60A 5D9NA 5T8GA 3W37A 4IMFA 3WUGA 1LG1A 4FB7A 2DZBA 3RX3A 1WYIA 4WX2A 1C9WA 2ZRYA 4JXCA 4QSHA 4DAIA 3GXDA 3H70A 4LVFA 3WBYA 4IGMA 1JUEA 3UNDA 3QBUA 4IH3A 3R6IA 3HMJG 4H9ZA 1XBYA 3GZ3A 1H7RA 3ITCA 2VD9A 3H55A 3BLKA 4EWJA 2BS9A 2NUXA 5HULA 1HKKA 3TWAA 3DCPA 3WQDA 1AJ2A 2A6NA 3WH7A 1TE6A 4NILA 3FVMA 3PBGA 3TCSA 1NOWA 1EYEA 3RR4A 5CJ5A 4KETA 4MLRA 2Y1HA 1NWTA 2BB0A 1CECA 1QJWA 4L80A 2PTWA 4H6RA 4A4AA 2QPSA 4MKNA 4BQ3A 3KBWA 3RYSA 1IEVA 3DFHA 4JYEA 1EEXA 2OGJA 3RMEA 4QCEA 2XFFA 1YXCA 4JIIX 3T4CA 3W3OA 3L2IA 1XRTA 1LJYA 1VLIA 4Y2WA 3BMXA 4FS9A 4ZO6A 1M3UA 3MW7A 5FEXA 1X38A 4QXIA 3URQA 2JQXA 2XSBA 3GFZA 2PRHA 4J27A 1ONRA 1FDYA 2C19A 4PEKA 3WK0A 2EG6A 3KP1A 1W5MA 4IOTA 3GWQA 1WDRA 4RJEA 1Q4NX 4GQ0A 2FZBA 3MHUA 2OYLA 3S1WA 2Y89A 1GQLA 3BW3A 4HYVA 4RDWA 5LSMA 1XLCA 5LIUX 1THFD 4E4PA 3EDDA 4DWSC 3QY7A 1NFBA 3OU8A 3A3XA 1XUZA 2V5LA 5I77A 3QQ0A 3A3HA 4HTYA 2J77A 4RPPA 1XL9A 1K8XA 3BQ6A 3CHEA 3GH5A 1SGJA 2DVUA 3AQUA 4XD4A 3U2ZA 1M7OA 1UHVA 5B7YA 3GB6A 3CYJA 1VLWA 4P7NA 5C9UA 5JH1A 2ADAA 3DFPA 1R3TA 4H9VA 4EPDC 1GHSA 1T8XA 3M5YA 3CGTA 5F4SA 2Z1KA 3UXLA 3QC3A 2KX9A 3B4UA 4RCXA 3AO0A 3SN4A 4YVVA 1WV2A 5CBIA 1VIWA 3THDA 3MP5A 4I5XA 4PL1A 4B4HA 1WKFA 4JEQA 4HPJA 4MFDA 4RR4A 1GWJA 3M5XA 2WC4A 1Y7VA 4PMZA 3URNA 5A1AA 4NT0A 2YGYA 3PNUA 4R3UA 2IXVA 3N17A 1H4PA 4MWAC 1RV8A 1JZ3A 3NVDA 5G4WA 1OFBA 3DHFA 4D6IA 3WL0A 3W1LA 4IL0A 1GUVA 1MYRA 4GYFA 3NR0A 4PSRA 3EEGA 2CEQA 1LRNA 1W5PA 2DJXA 1E0VA 1K7XA 3NVTA 1UYQA 3QGVA 3O16A 5D02A 4GI6A 4I7UA 4V27A 5DCBA 1E1EA 1J0KA 3GSMA 3CAKA 3M7SA 4RE3A 3B8UA 4MTVA 4JTHA 4ZQNA 1VQTA 4K7VA 4WKAA 1RJQA 1PJ9A 3CXOA 2GJNA 3EX6A 1XIHA 3OVGA 1LL4A 1P5BA 3I4EA 4AIBA 4LCSA 5HINA 4ECLA 4CN4A 3QW4B 1C93A 3G1SA 3AJ7A 2ZC8A 1QBBA 2Y7EA 4P2VA 5KZ6A 3BLEA 3P84A 2Z7GA 2FGZA 2PP1A 2DUXA 3PM6A 3RPDA 3LTYA 5JQ9A 1K6WA 5M03A 1Q6EA 1K8CA 3NQ7A 5L6UA 2VCBA 1H09A 2ZZ4A 5A5WA 5HWNA 1IR2A 1KKOA 1WUEA 3VGHA 4ADTA 4GYKA 3ORWA 4W5ZA 3QQ1A 1CGXA 3VM7A 1FWNA 3D6NA 3CK5A 2BHZA 2XSAA 3PP7A 5AY7A 3CQKA 3S47A 2WHJA 3WQ5A 4EX4A 4OBTA 2ISWA 1QI3A 4IMEA 3LI0A 1KXQA 4PMVA 1M7XA 4GYJA 4JTLA 1TWWA 4C7GA 1RPXA 1RSCA 3EWDA 4DBEA 2OWCA 3VVGA 1J01A 6PTDA 1GORA 4C6LA 4CCZA 2ZBTA 1LG2A 1XWYA 3PR2A 1GVIA 3ZWSA 3FOKA 4XO6A 5FA5A 5F4XA 1SW7A 3B8VA 3SUSA 4W8LA 4W7UA 4LVDA 5D33A 3NM1A 2HVMA 2CBUA 3BO9A 2D1ZA 4GQRA 1PIFA 3FHQA 5H91A 3AI0A 1HJVA 4ACZA 1QR7A 1N8FA 3D5HA 5CXPA 4O54A 1S46A 4W86A 4MB3A 1QUMA 1W5NA 1KFLA 2QGHA 2YYTA 1CB7B 4ZO8A 3NA8A 2J8GA 4MKSA 4LVBA 4PFHA 3FN9A 3IIPA 2Z1WA 3P80A 2HBVA 2Y5JA 2GLKA 4F2BA 1IXNA 4HYWA 3AXHA 1N7KA 4C6QA 2UZ9A 2W4XA 3L4UA 3EMZA 2QJHA 1B30A 5ENLA 3HQPA 4Z42C 4F0HA 4DX3A 3M0JA 1TPB1 2Z2UA 1R0MA 3F03K 5I0DA 1A5NC 2QEZA 3C4UA 3U6WA 3CEPA 1Q6GA 1KNWA 2CNCA 3LX9A 3EXSA 1EKOA 1H62A 2VC7A 3GXNA 3M6YA 4AIOA 2CZDA 3OVRA 1WDWA 4DPPA 3EOUA 4JL1A 3Q94A 2DP3A 3NM3A 2DIJA 3O0FA 1TV4A 3GHTA 3EB2A 2GPTA 4P5UA 3EA3A 2OLSA 5IFPA 1FXQA 5FAJA 1VFSA 3GXFA 3H7VA 3M0YA 2VFIA 4XZIA 1XLEA 2HZGA 1PZ1A 2PA6A 3L67A 4DYKA 5CJNA 4MPQA 2E1WA 3ZWTA 1UW9A 2CZ5A 2OSXA 4V33A 4F8XA 2J66A 1KB3A 3H2EA 2VR5A 1TVPA 1FWIC 2YBUA 1TJ0A 4G2DA 2V2CA 4ZEPA 1KW1A 3C5QA 1VFUA 4ZE4A 1JDAA 4PH6A 2DZVA 3FVDA 4UMAA 1S3TC 2HK0A 1EFZA 3QMSA 1EXBA 4QP0A 3URAA 3ATZA 2PDXA 1JDEA 2BGNE 1XLBA 1S2CA 3OZPA 1IEXA 4GE8A 1SO5A 1TIMA 1X1NA 1B9ZA 1R3YA 4K7YA 4RKAA 3WF0A 1A3WA 2BTMA 1M01A 1VF8A 4TU1A 1M5WA 3WNPA 4J28A 1IWBA 3CASA 4XWUA 3RILA 3WF4A 1Q85A 4EK7A 4Y6GA 5LGZA 3VD3A 4MY8A 1I45A 4L4MA 4PUMA 4GIRA 5CZ0A 2V3EA 3QOMA 1FH8A 4QNEA 2WB5A 4XV0A 5I06A 1RPKA 1QT1A 3BTNA 3B9OA 5LZLA 1T99A 4I9JA 4M7SA 3SRHA 1G4PA 2FJUB 4QBXA 1GNXA 4JCMA 4I8YA 2HWGA 3WLPA 3TCEA 2BVWA 3OIHA 2IKJA 5FF7A 1V02E 2ZUSA 1WBHA 3HV9A 3E0VA 5AVHA 4GYPC 3RR1A 4U4MA 4AH7A 2XISA 3L7RA 1OF6A 1RXOB 3H4WA 2CKRA 4Q8PA 1X7IA 1US0A 3NSXA 3EWWA 3PB2A 1D8CA 4PULA 2WXDM 4PEEA 1IV8A 1VR6A 2DU2A 2XVGA 3CAWA 4XX6A 4J40A 4J35A 1OK6A 4XZNX 1GHRA 3PZ9A 1X97A 1AD1A 3C2RA 3GRIA 4OZOA 4RNIA 4JHZA 4JN6A 1N82A 1XGZA 2Y70A 2YBVA 1N55A 3L68A 4MJZA 2VGIA 1XFCA 3W2NA 4LFYA 4M8UA 1OC7A 5G4HC 1KLYA 4XVDA 2H3BA 3BSHA 3AROA 1W2PA 2GOUA 4WRHA 5CCZA 1VPYA 5A8OA 3SQMA 3CTTA 1OCJA 4X0NA 2ZXAA 4WR3A 1E4LA 3MUAA 4ERGA 4UR8A 1UC4A 3C8FA 1DWFM 2IPFA 3VNKA 3V0SA 3SCSA 3WDRA 1A5OC 2CYGA 1FXPA 3CU2A 4QSFA 3GNOA 4LPCA 1Q5MA 3TYAA 1GOIA 1NDVA 3ZLGA 1Y8BA 5CEWA 1IEIA 3GUWA 3BAKA 4K1GA 4R7OA 1VIZA 2FHFA 4AF0A 2OYMA 4E5TA 2NQ5A 3PJXA 1XGEA 2CLOA 5DANA 2Y7DA 1BKSA 4YWSA 4DRSA 4CNTA 2ZX9A 3W71A 4B16A 5FSEC 1K03A 2A1YA 3QMRA 2FB2A 2INZA 1W54A 1AZ2A 4XD3A 5I7GA 2Q8ZA 1FTXA 4INFA 4B5NA 4GWEA 4IX0A 2VC6A 1K8YA 1GQNA 2WCGA 2ISDA 4NAEB 1EQPA 2RGLA 3LYEA 2UY5A 1JZ5A 3JW7A 1EJ7L 2Y88A 4O0ZA 1HJUA 3WQPA 2VEKA 4DO4A 1UPPA 3B8IA 1LTDA 4AUBA 4RNHA 1KBJA 1J11A 5AZ1A 4MAVA 2TODA 3GTXA 3GNRA 3RPTA 1T41A 2ZZ1A 2O56A 3UF9A 7REQB 2HXUA 4UTHA 1XSKA 3PAJA 2QJJA 4LS1A 3DDMA 3DFYA 4Z2JA 3MBDA 3ZJ7A 1R3RA 2WO5A 3WFZA 4H7CA 5D2TA 3WLNA 3WLTA 4M29A 1TMQA 2QIIA 4I5RA 1C91A 4BK9A 3OYZA 3TSDA 4F9DA 2FQIA 4UTLA 3CHCA 2Z6IA 1NU5A 3LHUA 5HMSA 3D46A 2J7DA 1X8FA 4BI7A 1VFTA 4AZCA 1CENA 5AB3A 4YLWA 5BRQA 2OT1A 4W4QA 1EGVA 3A4JA 1A0DA 4HOXA 3WNMA 1L2UA 2PU1A 3QW3A 1H2JA 3TXVA 3W1QA 3USZA 4L9XA 1T8QA 2ISSA 1UR3M 5I3DA 5DXYA 2YB4A 5CPSA 2PWHA 2J74A 4LH8A 2V6AA 2YX0A 1TJ2A 5HUOA 2NSXA 5KSWA 1P7TA 4NAFA 2NWSA 4H2HA 4PCNA 4V28A 1Z32X 4DJFA 3HG5A 1CW2A 1W3HA 4CCEA 3QPYA 4Q6JA 4Y90A 1VKFA 1KFKA 3FYOA 1V7YA 2NV2A 5A94A 1BKHA 2DPEA 3CLWA 5F4WA 5CSRA 1DJWA 4Y9AA 3VZXA 3ZLFA 3FA4A 1N2VA 3EKZA 4EACA 1SSGA 4H6KA 3VZYA 4DYEA 1EDTA 3BOLA 1JDFA 3TJXA 1TV8A 4KF1A 4Q4SA 2BFGA 2FYMA 1YX1A 3UEQA 3GY1A 1VC4A 3RM8A 4HSHA 2WVVA 1A5BA 1MRQA 1A5SA 4K8HA 3K4DA 1S2VA 4GJIA 1ZJIA 4PUUA 3K8MA 3NFUA 5DT5A 3SFWA 4ZQOA 3CEUA 1UZ1A 1VYPX 1S2TA 3T9PA 4YL2A 2OO0A 4AD1A 1QRQA 5FJUA 4UMBA 3QV8A 3TTOA 1DIEA 4O12A 3W74A 4MB5A 1Q65A 1VPXA 3UR5A 2QCFA 3GIYA 1IYXA 3Q67A 3AYVA 2HS8A 3PUEA 3WJSA 5DY2A 3SCTA 3AMDA 1OCQA 1KLZA 4IL2A 5LA1A 2V9DA 2KZHA 4S3EA 2NLIA 1GVRA 2NV1A 4JTUA 2ZWYA 4NU7A 1GK8A 2UY2A 1QPQA 3WNOA 4DLFA 1QPKA 2GGHA 2VEIA 4DIAA 5T9CE 1F3XA 1IR1A 3WNKA 3AIVA 2GJLA 1AW1A 5CSUA 3EWZA 3QVQA 2V5DA 2FDMA 2J7HA 1PDYA 3M1ZA 3T2QA 4EIVA 1ZENA 3BLPX 5ABFB 3E2VA 1MUWA 3NPWA 4OWGA 2NX1A 1PIIA 3AS3A 3G8EA 4KRTA 2EHHA 5FKYA 1PUDA 1XIBA 3H22A 5C2GA 3WELA 1ZL1A 1QVBA 1R7OA 5A2CA 1CIUA 1SUXA 3G0UA 4O4VA 1CX9A 3I6RA 4CGTA 3VOJA 1RY8A 1HZYA 1NEYA 1A4MA 4TMBA 3O9NA 3C0QA 1YNYA 3T7VA 2VGBA 4I5UA 2W6RA 5F7UA 4FOUA 1JPDX 4H9UA 4ORMA 1TQJA 1A5CA 3C0SA 5A8PA 1PB0A 3ZR5A 3GM8A 1V8EA 4RDZA 4IPPA 1JIBA 2PMQA 3IV3A 2ACSA 1IT0A 1OSEA 3KOWA 4UFHA 2VD8A 2EF9A 3HGOA 2QNEA 3LHWA 4YVXA 5HOSA 4GD0A 1RBLA 3AFBA 3THCA 4H8NA 1PO9A 4QAWA 1UA7A 2P0IA 4AB4A 4ADSA 1ICQA 4B9ZA 4BHYA 4JYDA 4RE0A 1MNSA 4MY9A 4CNOA 2NVCA 2A7NA 1ZU8A 3KTSA 3R43A 1EH9A 3E2RA 3M7WA 1IWAA 2E9MA 3MI2A 4Y9MA 3TUUA 2WLZA 2QR6A 4OE7A 2VEMA 4GJ1A 4XUGA 3VILA 2VZVA 2YL5A 2J25A 5DRCA 3STEA 1EDQA 2OB3A 1AMKA 4H19A 4LAUA 1LRTA 1SQ7A 1YE6A 1MFVA 1BYBA 2WANA 1HUVA 5FACA 1P0EA 3VFCA 1XD1A 4GC3A 2REQB 3AS0A 4WF7A 3ITXA 4AY1A 4O4WA 1E3XA 2WVUA 3MV11 3CBWA 3EMCA 1JZ8A 5MF5A 2B0MA 1XUUA 3LERA 1WZAA 1LQAA 4CU7A 3LRMA 3AJXA 2YZ5A 4Z0SA 1J0IA 3CL8A 2FB3A 4JHOA 2XIIA 2IKIA 1LLWA 4DUXA 1O5XA 2AL1A 1QI5A 1NH6A 1YDNA 2WKGA 3VNJA 2V63A 4U33A 4I9AA 4XD6A 3G5EA 3TFCA 1U2YA 1F9CA 2GDVA 1W3TA 4ICNA 4UNKA 2ZUTA 3VXGA 3A64A 4UBPC 1AMYA 4F66A 4DM2A 1EPVA 3TYUA 4LV4A 4G56A 3ONBA 3VNYA 3B0YA 4B2DA 2ZZ2A 3A23A 4XK2A 4XTIA 1HO1A 4UCGA 1EEPA 4M1RA 4IGHA 3AISA 1B1YA 2X1SA 2ZUVA 3AZRA 3N9RA 4HN4A 2PZ0A 3NO3A 4CNNA 4LTSA 4J3ZA 1I2RA 1GTHA 4AZGA 4NZFA 1JYXA 4PMJA 4ROQA 2IXUA 3RU6A 4K36A 2PWEA 1ZCOA 1MQRA 4MDOA 4Q8VA 1JG9A 3OG3A 3MZ2A 3WD3A 5CC5A 3B8WA 7CGTA 4GGHA 3TOPA 4LAOA 3MSYA 3RLHA 3GS6A 5MKGB 2UY4A 3KL5A 3TYCA 1MRAA 1V0LA 1AH0A 5D2XA 4O52A 1CBGA 3BJTA 4GY1A 3ME3A 1J0HA 2JEPA 2E8YA 2P53A 3NPVA 1FQ0A 4UB9A 3K4AA 4RW3A 3GU9A 4QG9A 4BWLC 3QZ6A 3WH8A 5BMWA 1LLOA 1KM5A 1C7SA 3DBNA 3KM8A 3WK1A 1YNQA 3PUGA 4O53A 1KGXA 4K39A 3WNLA 1QW9A 4IG2B 1L6WA 1SFJA 3W22A 1ZLPA 2P3ZA 2QCHA 3NL2A 3AS2A 3MUIA 3ICJA 3IGUA 2HMCA 3KOXA 2VI0A 4IQLA 1YMYA 1F3TA 3TEVA 3GW3A 3QPEA 1EWEA 4AVFA 4F4RA 4KRZA 2XFRA 3FXGA 5FESA 3E2SA 3EWCA 4HK6A 3LDVA 3GTIA 2D0GA 2XVLA 3OBEA 2YDAA 2A79A 3P82A 2QGYA 2Z1SA 1OD8A 1E15A 2BWGA 3S2MA 4LOCA 4GCXA 4PMUA 1W1PA 4S38A 3SGGA 3LHVA 3GR4A 4LQ1A 2VXNA 3VUPA 2V38A 1H41A 2QF8A 1LP6A 4JN7A 4LS0A 4TMCA 3SUUA 1EL3A 3HJEA 2E5DA 1LL6A 5AC6A 1F6KA 2H6RA 3R0KA 3ABXA 3APYA 4NJKA 4GI4A 3P93A 2AAMA 2XVKA 1W9UA 5HQLA 4ZFMA 4NNCA 2CXGA 2RKXA 1K9DA 1UQYA 3NQVA 5FJPA 5BZAA 5DLCA 1H1NA 3IRDA 3MPGA 4C7DA 5G1TA 1B4EA 3POCA 2D0HA 1J2WA 1E6ZA 3MV01 2X8RA 1NTHA 2C1HA 3WDIA 3GUGA 4O11A 1R9XA 3A22A 4KWOA 3L65A 4L1WA 1ITQA 5EFDA 4S3GA 5ABTA 3EB4A 3H2AA 2C15A 1ZBCA 2HEJA 3EEZA 5AVNA 1J18A 4AY7A 3KVKA 1BG4A 3VE7A 5DQPA 4GQGA 4QG6A 1E70M 2XH0A 1UUMA 3GIQA 1G9HA 3L0NA 4N9EA 1KM2A 3WLHA 4C6MA 3H4GA 2OLAA 2EKGA 4JBRA 4YTUA 3WLOA 3C8NA 3LM7A 2PC8A 3E12A 1QNRA 2G41A 1XDJA 4GUJA 3GHRA 3N34A 2JF7A 3E0IA 3XISA 4UNIA 1JZ6A 2H8ZA 4C60A 1SMAA 3DFSA 3MKKA 4RNJA 4EANA 4AG0A 3V3WA 3K30A 3QR0A 4G7EB 3IJ9A 3UFYA 4HK5A 2X7VA 1HP4A 3NQGA 3OBAA 3BQ5A 1QI2A 4WIWA 2OZ8A 5F2GA 4L6OA 1PDZA 1TQXA 4KT2A 1MO0A 1V6UA 1JYNA 4BA0A 4RDVA 1TWZA 1UZ4A 1UUOA 1K4GA 2J13A 3MP3A 3U8GA 1I1WA 4U31A 4HNUA 2F6XA 3TA9A 2J7FA 2A3LA 5AHLA 3C2FA 1F5ZA 3DECA 4Y8EA 3VNDA 2J9YA 3LQLA 1F7BA 3PTDA 3WJWA 2ZVRA 4I9MA 3RM9A 3GG8A 2ZA1A 1CXFA 5K9CA 1V3MA 2ZDRA 1NDYA 1FWBC 1LWIA 1PTGA 1UWQA 5HJLA 4K37A 2RDUA 3HM7A 4LXFA 3AIUA 3OQ8A 4YNGA 4AZ5A 3MP4A 1XCFA 1KM4A 2W91A 1P43A 3VNZA 4TVCA 5PTDA 4PUWA 2GQAA 1K6AA 1V6YA 1G7UA 2D0FA 3GHSA 4LAMA 2J4GA 1KRBC 5TAOA 1HT6A 2FMOA 1EWDA 5CGMA 2ZTKA 5HNNA 1KXHA 2PD9A 5AYBA 3M9YA 3GG1A 1HW6A 5HNTA 1EBHA 4S3CA 3W7EA 3NO5A 4HMDA 2WKJA 4FX8A 3TSMA 3PZNA 3QRHA 5FJTA 3WJXA 1RY0A 4XAPA 5JIPA 2GZXA 4GXMA 2NXGA 3W1XA 3CZLA 4AWTA 4AD3A 3SN1A 5FEPA 5AC5A 3T2OA 4UZUA 4P8UA 4DJED 3OJGA 2D23A 5M17A 4HNCA 3NO1A 2VZTA 3QLDA 3JVAA 5EBAA 2WAGA 2PDJA 1E0WA 1J9YA 2ZZ3A 3CNYA 1W3IA 3GQYA 1ZAJA 1FBAA 4FNUA 1VJSA 1Q6LA 2VWTA 2VOTA 2CLLA 4B5TA 1OFQA 4J3TA 4WOZA 4B15A 4HPNA 3TNOA 4HMEA 2OZ3A 3LHYA 3BAYA 3P0WA 2XH4A 5DMYA 1LWHA 1MQQA 3LU2A 2WJEA 4A6GA 4E8GA 3VGGA 4FA3A 2DQWA 4JIRA 3LA4A 3NOYA 3B05A 1LUCB 4B5XA 2GQ9A 3LCXA 5FOOA 1XCXA 2PDBA 1ISWA 3S5OA 4J7RA 4UTWC 4NJHA 2WCSA 3VIOA 3M46A 2C0HA 4CCCA 3N4AA 4UFKA 2FZ8A 1UH4A 5FJRA 1CGYA 5BWFA 1MMFA 1ECEA 4ZSUA 1HKWA 3ZZ1A 1FWCC 1LRQA 1XRVA 4R5EA 5BXPA 4M6VA 1DWHM 1OFEA 2Y8VA 3QC0A 4JTSA 3V5OA 1J10A 3PB0A 4Q4OA 3O6CA 2WSKA 2IPGA 1ICPA 1US3A 3QR1A 3CYVA 2VURA 3PN8A 2IMRA 1TWIA 8A3HA 2FKPA 1MNZA 4YU1A 3Q2DA 3WQ8A 5ABHA 1JAKA 2QS8A 2OX4A 4FF5A 5EMMA 5AECA 4GXWA 3FCPA 4Q4PA 3SIMA 2TYSA 4Q8OA 2ZRUA 2TSYA 4K6AA 1CEOA 1EHAA 5XINA 2OWXA 3VIJA 1TELA 2WSPA 5BXSA 3EA1A 3ARQA 4L5ZA 2NT0A 3L5LA 2Z1XA 1G01A 3ZJKA 4Z2KA 2YW4A 4GX8A 4LCRA 2W0UA 2YW3A 2ZE3A 1KBLA 1G5AA 7REQA 4FXSA 4HNLA 2CU0A 3W9ZA 1KA9F 3WFAA 1LOLA 2ZZ7A 2PDHA 3RGTA 1TZZA 4EVZA 5BOOA 3W6MA 2G3MA 3U4AA 3EPNA 6ENLA 1U83A 4XBJA 1G6CA 1LWJA 2G0WA 1OIMA 4H00A 3UXIA 3T2PA 2P10A 5IDZA 3LLFA 5H1WA 3TROA 1XIGA 3CTLA 3C61A 5CSSA 5KEZA 3EWXA 2V3GA 3LHTA 5DXXA 2GVJA 2IQDA 4OTKA 4DPQA 2OJPA 3W00A 2Q3OA 2Z2AA 4Q8MA 4FP1A 5LA2A 4FNPA 1KTCA 1XLAA 1OZMA 3EOOA 3UWQA 3A4WA 4AWEA 4NHVA 1BPLB 1JI2A 3TMLA 4H83A 1T0OA 3HPFA 1SR0A 3IUIA 2QJNA 3LB0A 3CLMA 3B97A 3B8SA 3Q58A 1UOZA 5JUVA 1FVPA 1QFEA 2P76A 1WKDA 1RD5A 4KWVA 4LRTA 1Y5VA 5ECUA 4H8HA 5DN1A 4NASA 5AFDA 1EZWA 2PPGA 3HG3A 1S1PA 4OIFA 4QJ5B 3VMOA 3ZMRA 3EX4A 1SJBA 3CZ8A 2BASA 3HPXA 4LS2A 2ACRA 4QCFA 3ABRA 4N4QA 3WCZA 3W7GA 4MNKA 1HFBA 1ZQ5A 1H60A 3GAKA 3CIVA 4JGDA 4DXXA 4YJ5A 1QNVA 1TRDA 5D9OA 1P0NA 1UD5A 1CXIA 1H5YA 3AIWA 4LF2A 4DZIA 4O1EA 2EPKX 2EJAA 3WJZA 4QM1A 4CD8A 4NZ1A 3PWGA 4CNUA 2PF8A 3QSRA 3WLSA 4D6HA 3NYZA 4FLOA 1AQ0A 5KZEA 3ATYA 3WNNA 2AGKA 5GQBA 1U5VA 4LYPA 1CLVA 2EEXA 4DEFA 4MZ8A 4MYXA 3NQEA 1YADA 3K4WA 2QUMA 1F3WA 3TR2A 5IDIA 3QQWA 1X98A 1T6MA 3LG3A 3LGGA 4GK8A 3U5YA 1HGWA 4ZO9A 3DESA 1MSSA 3B06A 3PZUA 2QW5A 3W86A 3QJAA 1TE1A 4DI9A 5K3VA 2FFIA 3A9BA 3BG9A 3TJIA 2ZZ5A 3W2KA 1H49A 3DH7A 4CEUC 1J8VA 3WQ4A 1P0BA 4G8TA 2PODA 3W7JA 1BWKA 4UFIA 2IW0A 3KOZA 1TPFA 4PUKA 1EJRC 3BAXA 2HVOA 2FVLA 2EPOA 3KBNA 3LLXA 2OVLA 2YL6A 3MT1A 1RQBA 1BEUA 2QUVA 1K02A 2X1RA 5AOUA 7ENLA 1OADA 1JD9A 3AIBA 3OLDA 5DBUA 1YBQB 3QZEA 3XIMA 2RHGA 3ITVA 5HR7A 5ABFA 2DFAA 5U7SA 1EF2A 4HSNA 1JULA 4HSOA 5KZMA 4C90A 3VIMA 3SUTA 1JZ4A 3SB0A 3W7IA 1ECQA 2E6YA 3K8LA 2BOFX 3RN6A 3MKCA 4JTGA 3QLLA 1WNOA 4M6PA 3RCMA 3PAOA 5HNUA 4AMCA 3GXIA 1JCJA 2E77A 3UY8A 1J0YA 3R8GA 4GFSA 2V81A 2O0TA 5CC6A 1W3LA 4WDXA 1JXKA 1IGWA 4GKTA 5C7HA 5A95A 2E67A 3BANA 2J7GA 2YKKA 3BZJA 3TU9A 5KITA 2YDSA 1VFLA 2GGJA 1HVQA 3OLIA 3PF3A 4OBRA 2PDNA 3QTPA 2E5CA 3CZJA 4HOZA 2QV5A 3CQIA 3SAZA 4HKPA 4F48A 3WK3A 3UWVA 1JVNA 3AIEA 4S2CA 1TPC1 3LGEA 3L5MA 2O9TA 4GHRA 4DWSA 2WNWA 2V82A 1BVZA 2QCEA 2XZ7A 2WZHA 3EGJA 5A8GA 2QV4A 4QQ3A 2J88A 2V68A 3QXBA 2FZMA 5CG7A 3W88A 4IGNA 1Z48A 2O4QA 4IIHA 4KCUA 1ML1A 3CUJA 3GVQA 4W8AA 4HPHA 1B4KA 1KR0A 4YTTA 3W1AA 1SR9A 2XG9A 5GNXA 4AZBA 3LBMA 1E4NA 1WZKA 1GZ1A 3WD2A 1OY0A 3OLEA 3BG3A 5HJYA 1BQCA 1H1ZA 4L4LA 4UOZA 4FR6A 1G94A 5DT7A 1FUYA 3L4ZA 1RJRA 4G6CA 4LYRA 5SWUA 3CV1A 3VOIA 1XBVA 3D47A 4D6EA 2Y5SA 2R1MA 1BTMA 4M51A 3TTSA 1OB0A 1IXOA 3MUY1 3TIMA 2REQA 5I79A 1NIUA 3QF0A 1R38A 1JPHA 4LUIA 2CCRA 4N02A 4MWAA 3VOHA 2XTKA 3WMLA 3SY5A 2DZAA 2CZEA 4L6DA 1DYSA 1QI4A 1MEWA 3A47A 2Y4SA 1A53A 3OP2A 4E2VA 4HYRA 5CPQA 3W82A 1RLCL 4ZBCA 3MUZ1 4B2DD 4BCEA 4AU0A 2TRSA 1JNDA 2VT0A 2DUAA 3RPMA 3G1YA 4NZ4A 4FLRA 2EG8A 3EPOA 1GW9A 1I75A 2QCGA 4HCLA 2AQWA 4M19A 3UJEA 1KC7A 4TTUA 1IF2A 3P0XA 1AZ1A 4QJ1A 3PJUA 4B3KA 1GEHA 3JRKA 3LQGA 3FKRA 4JY8A 1QPOA 3ITYA 3MDUA 3HN3A 2YL8A 3BWWA 3CO4A 1OF8A 1XIIA 4BS0A 3O8AA 3HQ1A 2PEVA 1V5XA 1V51A 1ZALA 3ES7A 4XVEA 1O5RA 3ZT6A 2WV8A 4QS6A 1MZRA 3BH4A 2DH3A 2ZZ6A 4HNTA 2ACUA 4N6FA 2ANUA 4GO9A 4HN8A 1ZUAX 2E8ZA 5DBTA 3QPZA 1F4HA 3NJ3A 3D3AA 1AJ0A 1GVOA 4O57A 3C2VA 5LA0A 1XISA 5MKGA 5A6LA 5C71A 3ZOAA 1HX0A 1UP0A 3M16A 3F4NA 3S6OA 3ZVHB 2GQ8A 3FYYA 1IXQA 1HTIA 3WQEA 2QXWA 4O16A 3W2LA 4ATLA 3DG3A 2DSWA 3GFXA 6ALDA 3GVWA 2D2JA 3P74A 4XQ6A 2AL2B 1BVWA 4EF9A 4EWND 1CTNA 1SM9A 4OT7A 4DBWA 1I2PA 1TPVA 4MB1A 1K9FA 3UY7A 3PZIA 3C6CA 3TONA 3KRUA 2ZX8A 4BY3A 3PPFA 1AJZA 4LC8A 3R94A 3F4WA 4LUTB 4H8VA 4PBFA 1PPIA 2YLAA 2YA2A 2CLPA 1UQZA 1J0JA 2OKTA 1POKA 4Q33A 5AZ0A 5C6MA 3W26A 5CQ1A 1UP3A 5I09A 3ARZA 2OOGA 1GJUA 3M4HA 1PX4A 4A8LA 3VTRA 1BRLB 1EC9A 4HHMA 1JPMA 1PHWA 1YDOA 3TN6A 1W1VA 2PBOA 2WJFA 2AGTA 4UQDA 1OZQA 2XHYA 1B3OA 3A13A 3F1QA 9CGTA 3WQGA 3GDMA 2UBPC 1B3XA 3KBSA 1AA1B 1ISYA 2NQHA 4O13A 1A47A 3QH2A 3P2VA