4O4WA

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-gly mutant (tvag_497370)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
b'RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFGFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o4wA00
2QDHA 3TJXA 4H3DA 1BWKA 4WOZA 2DZSA 4O0ZA 5FF4A 1OK6A 3UPBA 1W5NA 4M7TA 4O19A 4HNNA 2RDTA 1KFKA 3HO8A 4DPPA 3ATYA 2RFGA 2R8WA 4P61A 1W5OA 2QCDA 1ZENA 1HTIA 4UFHA 3TNOA 3KXQA 5EPDA 1QPRA 3W7NA 1QWGA 1QDSA 4YL2A 5U7SA 1S5WA 5G5IA 4E38A 1SSGA 2ALDA 2CWNA 2TPSA 1ZY9A 4IX2A 2A7PA 5CZJA 3W7IA 3DXIA 1FDZA 3N2MA 4Z1DA 4QNEA 2FB3A 3QMRA 3ZFHA 2YYUA 2QCNA 3DFPA 4ICNA 3GVGA 3WJZA 2ZZ1A 1H60A 2ZA1A 1PCWA 2C18A 3W2UA 4JGDA 3W1AA 5C5YA 4GNJA 3W7LA 4P2VA 1L6WA 4O14A 3BG5A 3DGRA 5F2LA 3RU6A 5D32A 2NXIA 3QYQA 2YSWA 3NM1A 3ZWTA 4S2CA 1JCYA 4HSNA 1I2NA 2JGYA 1GTEA 5DELA 3NL3A 4EIVA 3EB2A 4RZ6A 4UFJA 5HULA 1GVRA 3HF3A 1C9DA 3NGJA 5F4SA 3F1QA 3LLFA 5FF3A 1FUYA 1R30A 1SZEA 5KZDA 4O1BA 5FESA 2B4GA 1Q3NA 3KAOA 4JDBA 1K03A 1WQ5A 3W74A 3NPXA 3O1NA 4LC8A 1EUAA 3LCIA 3CQ0A 4HPJA 3WJXA 3DFNA 2CLIA 1A5AA 5LNRA 1LORA 2LLEA 5AHEA 2NWRA 1TQXA 1N55A 3UPWA 3NL5A 2A7NA 4JTLA 3I65A 4BF9A 3PS7A 1EP3A 2ABBA 1I4NA 1LYXA 2WQPA 2JGQA 2YFOA 3W7KA 4K8HA 2ZCGA 1SFJA 1DHPA 1ME8A 3E02A 1XFBA 1Q6RA 1TTIA 2E68A 5AHMA 4K8EA 1PHWA 4TMBA 3L68A 3NQ8A 2Z6JA 5D05A 1MSSA 1KFJA 5CPOA 4NJKA 1SQ7A 1KM3A 2ZDRA 3OVPA 3TMLA 4IGHA 3TH6A 1GVQA 1OFOA 4UTJA 1H1YA 3IV3A 3N34A 4X22A 5AYXA 4JTHA 3B03A 3KVKA 3ZR4A 3PULA 4XKYB 1KM5A 4WD0A 2QCFA 2CLKA 2A6LA 4MOZA 4XKYA 5HNRA 4IUOA 2R14A 3GAKA 3S42A 4FB7A 4EVZA 4ZQMA 1FWWA 3QEZA 3G8EA 1J2WA 4JN6A 4ZMGA 3M0ZA 1TRIA 3O63A 3W22A 1F73A 3IRDA 2GOUA 1J5TA 1B57A 5KZEA 1P1XA 5KTLA 5LNVA 1JR1A 1SU5A 2FB2A 1JUBA 3RNDA 1EX5A 3UYCA 2AAMA 1LRTA 1YXDA 2VFFA 3LHYA 1DVJA 3P5ZA 1UJPA 2B7OA 5IBXC 4WXYA 4UTTA 4OGZA 1SO4A 4PL1A 1LOLA 1QAPA 3HGJA 3IIXA 2TSYA 4LW7A 2ZRVA 3LHVA 2ZZ6A 1WOBA 2QEZA 4AHQA 3THAA 1FQ0A 3HOJA 3K30A 4RK8A 4GFSA 2V8ZA 2A5HA 4O17A 3QSTA 1KW1A 3UQNA 3KVMA 3BG9A 3OVRA 2G96A 1K7FA 3P80A 3I7RA 4IXHA 1M7PA 3LTYA 1MO0A 2PRHA 1D3GA 3H53A 4JTTA 4Z1AA 1MEWA 3P8IA 4FNTA 1VH7A 1OVDA 3R89A 3W88A 4N9DA 1OX5A 4DBEA 2C14A 5K3VA 1JCMP 4WQ6A 3W1MA 1TTQA 1XXXA 1WDWA 2VEIA 4S1FA 4FNQA 1O4UA 4N9CA 2X1SA 1KTCA 4N02A 3N3MA 1EWDA 1YDNA 5CPMA 1TQJA 4QNWA 2EGZA 3TX9A 3HQ1A 1YDOA 4NX0A 5G4WA 3TC7A 4JX6A 2OMAA 4LVDA 1YADA 4N9EA 1KFEA 1TREA 3CM4A 3NDOA 3TMQA 3UY8A 4HPXA 3TK7A 4L4MA 5LHFA 1TV8A 2FTPA 1PHQA 5CZTA 1TTPA 1UCWA 4ZQOA 1HG3A 2NWSA 1XM3A 3CEPA 1PV8A 4GJ1A 3GDRA 3WJWA 4OWGA 3TQVA 3S9YA 2E5BA 2A0NA 3IIPA 1A53A 2QDGA 1I2RA 4XBKA 1IXPA 3C2EA 3WJSA 3GDKA 1U5JA 4MIMA 3B8DA 3EXTA 3BG3A 3PB0A 2QCCA 4ZZ9A 1TMHA 2QCMA 3LBCA 1QO5A 1XUZA 2C16A 3QH2A 2H3BA 1EP1A 3NL6A 5DBUA 3P82A 3PBVA 4JTEA 5HUOA 4JTIA 3C61A 1H61A 4O8RA 3W7OA 4D2JA 5MHBA 2VKZG 1XI3A 2I1OA 4EF8A 3T44A 4O0KA 1THFD 3W83A 3QW4B 1I2QA 3PG8A 2C15A 5AHFA 3GDLA 3NQ6A 1MEHA 4GUFA 1OFDA 5C6MA 1F2JA 1R46A 3LCFA 1KM2A 4IJBA 5HUPA 2FIQA 4AXKA 1A5CA 4O53A 3IIZA 3KHJA 1NFBA 1IXNA 3LHWA 1KBJA 5LZLA 3I7QA 1TO3A 1F6PA 4K7VA 3DFQA 4YWIA 1H50A 3M41A 3T55A 1HL2A 3HIJA 5J5DA 3NZ1A 1GG1A 5GVJA 1H7OA 1ICQA 4UTMA 1LBFA 4PEKA 1FCQA 1A5SA 2V2HA 2WSQA 5BOOA 4LOCA 1Z42A 2VENA 1PE1A 1H7NA 3W1PA 3DHFA 5C54A 4LNYA 3C56A 3LHTA 4O57A 3B4UA 4UMAA 3STFA 5K2ZA 5G1TA 3FKKA 3LCLA 1H1ZA 4JXCA 1PL9A 5T26A 2WNNA 1W5MA 2A1YA 3LRMA 5E93A 3NQMA 1ZCOA 5CGQA 3VCRA 3LHZA 4ZVJA 3EWYA 4GC4A 4JNMA 3MWAA 2OX1A 3SR7A 1JRBA 1ALDA 4UTLA 1Q45A 5CZ0A 3G0SA 1I8JA 3DH7A 3EX2A 5E1QA 3LBMA 4ZQCA 1AL8A 3SZ8A 1W31A 2QR6A 3DAQA 4UTWA 2J6XA 3L2IA 1NF7A 5EL1A 4A21A 3G1HA 3GYEA 4BWLC 4NJIA 2CZEA 1TV7A 1K8ZA 4TMCA 1RR2A 3W75A 4DO4A 5HR6A 2CLOA 4WY0A 4UTIA 3T40A 3UWZA 1F6KA 1WX0A 5C55A 3DZ1A 3CIXA 4YLWA 3HPXA 3TW7A 3LRLA 3IVTA 3PSVA 1C29A 1SR9A 4Y8FA 3L9CA 3CU2A 3C52A 1S5TA 3LLDA 3LX9A 4DQWA 3D0CA 3TQ0A 3MO7A 5I3HA 3W1LA 4AWSA 4EOUA 1X1OA 1SO6A 3ATZA 3NQDA 2QF7A 1JULA 1XCFA 1LLWA 4WXZA 5DY3A 5K9XA 1TPWA 3TXZA 4CLMA 1FCUA 2Y7GA 4Z0JA 1KV8A 3LI1A 1GYLA 3MP4A 2B0MA 1W54A 2Q3RA 1D3HA 1NSJA 4ORMA 2QAFA 2AQWA 1FY6A 3IGXA 1LM1A 2FPYA 4YXGA 1Q6QA 2QUTA 4K6AA 3EXSA 4NUWA 2X30A 1ICPA 1OK4A 1GVFA 4JIPA 2PURA 1XBYA 1HO4A 2B7NA 5FF7A 5KINA 2FPVA 5AC7A 3L0KA 3CHVA 2C3ZA 4XTDA 5CPNA 3QZEA 3W1RA 4Y9AA 3LCGA 3MMTA 3NOEA 5DN1A 4O4VA 3NYZA 4G1KA 1RQEA 1BEUA 1LBMA 1LROA 4QSHA 5HQEA 3O06A 4MY9A 3PBWA 5FEZA 5EYWA 2J9ZA 2EHHA 2ZA2A 5I3IA 4KWWA 1V7YA 1KFBA 2WNZA 5G4EA 3TQKA 3NR0A 3NVTA 3R13A 4PODA 1GVSA 3HGRA 3CLMA 2CLHA 4PL2A 3S1VA 2WNQA 1LLZA 1G4TA 3KOFA 5LKYA 3QRHA 3BARA 1EP2A 5BW6A 3G1DA 2A85A 2CLEA 1T8XA 3W1QA 1JCNA 5K4XA 2X1UA 3L0NA 4A22A 2B7PA 2NV2A 4UMCA 5F2GA 2C6QA 2QCDB 4LV4A 4QM1A 2G95A 4E2BA 3OBKA 1L6SA 3SECA 3GKAA 4UFIA 3M7WA 4BR1A 3KVLA 4I7VA 1G7VA 1A5BA 1AW1A 3E12A 3NQVA 4Z0SA 3LXCA 3QMTA 4CCCA 4C1KA 1LRNA 1OYCA 1VS1A 3EWXA 3DFTA 3IEBA 3TR2A 1N7KA 1NEYA 1WBHA 4DBDA 4Z1BA 3E49A 3NPWA 3M5VA 4DELA 3BK0A 5CSRA 1ME7A 2YR1A 3HG5A 3P62A 4KFNA 5EA9A 3WJYA 4HT3A 1B9BA 1FXQA 4MJZA 4BK9A 3H54A 1R47A 5F1UA 5H91A 3UD6A 1H7RA 2CLFA 3P81A 3G1YA 3W1TA 4LUJA 1U83A 5CKSA 2ZTJA 4AB4A 3QQ1A 3B0VC 1O5XA 2A7RA 3CC1A 1AK5A 5AHNA 1VCGA 3CB8A 5KSWA 5SWUA 2GQAA 5AOUA 3TW6A 3KFTA 2Z1BA 4R53A 3HB9A 1ZAHA 2QUUA 1B4EA 1ZAJA 2V5BA 3EKZA 3IVUA 5DLCA 2F7FA 5D33A 2DJLA 1WXJA 1IIGA 1ZNNA 5D30A 3N9SA 2H3DA 5HWMA 4FEZA 5AHLA 3B0UX 3IGUA 3L67A 1Z41A 3QPYA 2DP3A 4CNNA 3UXDA 5D38A 1KA9F 3O05A 3EWUA 3TSDA 5KMYA 3FJ6A 4O52A 4DF1A 3T4CA 1QMLA 2BSLA 2E1DA 3ABSA 1GQNA 1RVGA 4JX4A 3BV4A 3TAOA 8TIMA 1MXSA 1FWNA 3ZS4A 3LV6A 3M5ZA 1GJPA 3EX4A 3W7RA 2X1TA 2J24A 2VEMA 5F2IA 1H7PA 1OJXA 1BWLA 1QPNA 2HTMA 2QCLA 2WOQA 3P67A 4Q32A 2VFDA 2TMDA 5D37A 1G6CA 4FX8A 1SO3A 2V2CA 2VOMA 4RKAA 1JCLA 4L4LA 4NZJA 3G1VA 3Q2DA 2Y61A 3GDTA 3MW7A 3M16A 1XKYA 4K39A 2EPHA 5D09A 3NA8A 2P10A 3B0PA 1K8XA 3G1FA 4J9JA 4AEOA 5LGZA 3LXBA 4OE7A 5HR7A 5J5RA 4LWWA 3C2FA 1WYIA 4IMFA 1YTEA 1ZFJA 3NQAA 2GQ8A 4GUHA 1W37A 2RDWA 1PIIA 3CWNA 4X9SA 1LBLA 1C8VA 1F76A 5LNUA 4LRTA 3SGZA 3EWWA 3STCA 2GPTA 1NF0A 3TJLA 2WPBA 1DORA 2FQIA 5C2XA 3VE9A 1YTDA 2VXNA 4POCA 5HWJA 4KKXA 3MBDA 2BX7A 1JJKA 4QIUA 1KM4A 2CZDA 3E96A 3GNDA 3C2OA 3GXPA 2V0TA 4TX9A 2QCHA 3JR2A 3G3MA 3QFEA 5I3GA 2H90A 3O8AA 1YTKA 2ISVA 4WX2A 1G4SA 2CZ5A 1FCBA 2V2DA 5TBOA 4LV9A 2QJGA 3PAJA 2QCGA 4CQ9A 3MYPA 2W79A 1W5QA 4JTGA 3RLVA 3C4UA 3M9YA 3WK0A 3UWWA 2R94A 3RMJA 4IMEA 2DZTA 3JS3A 5AC6A 5G2IA 2Q3OA 4JTFA 2NX9A 2RKXA 3C2VA 3M6YA 1WAUA 4M7SA 2G97A 1P0KA 3DHDA 3NQFA 3QQ0A 3AJXA 2TRSA 1OABA 3HG3A 1DL3A 4RXGA 2J88A 4JDYA 4FNRA 3TV8A 2FFCA 2ZFAA 1VGAA 4MUZA 3TIMA 3R5EA 4JTJA 3C0JA 1NVMA 5D02A 2NZLA 4Z08A 4GXMA 4MYAA 2ATSA 3GR7A 3S5ZA 1IF2A 1VYSX 5EMUA 4LY8A 3AO0A 4UTWC 4H4IA 3MHFA 3PC0A 3W87A 4OT7A 1O5KA 3A23A 3UNDA 3M47A 2CZFA 1OFEA 3IIVA 5AC8A 4MKNA 1TPEA 2ZZ7A 3PBYA 3RF9A 1ME9A 3G22A 1M7OA 1TTJA 3EKLA 4NNCA 5D2VA 4RXFA 4EF9A 2BXVA 4O16A 4WUIA 3DFSA 3BLFA 1PCKA 3GK0A 3KRSA 1QPQA 4M19A 3GKFA 3W1XA 4N6EA 1K8YA 4FXSA 5AYYA 3T78A 2CFFA 4O10A 1KFCA 1JUKA 3HGOA 3LTSA 5LNSA 2V5LA 3YPIA 4O13A 2DZPA 2PRLA 1SZNA 4UNLA 3W23A 3WK2A 3PF3A 4JICA 1QNVA 5DCEA 4KFPA 1GG0A 4RLIA 4HNTA 1W1ZA 1VC4A 2Q8ZA 1OX4B 5D03A 3TSMA 1TPH1 4JTSA 3SFKA 2PRMA 2FJKA 4ONVA 1JRCA 4HKPA 3W7HA 1O95A 3KVJA 4UFKA 4E0CA 4ML9A 3MYOA 3F4WA 1OX4A 4Y96A 1VCVA 3UWVA 5FF2A 3L21A 2OCZA 2EKCA 1L2UA 5AHIA 3VKJA 2ZRWA 3LRKA 2CLLA 1SW3A 4ALDA 4DXVA 1F7BA 4W9TA 1BTMA 1EUNA 1Z44A 4JR5A 5FI8A 2E6DA 3IGSA 5L6UA 1LP6A 5A5WA 4UIOA 4FX7A 4CCDA 3EX6A 4JYDA 2JKEA 5BMXA 2Y7EA 4TIMA 1TPC1 2Y85A 3GXTA 3R2GA 1CX9A 3BVJA 4MYXA 4JTKA 3RK8A 4Y90A 3OHIA 1OHLA 2YZRA 1CW2A 2C13A 3NPVA 3LM7A 4DPQA 3A5VA 4CCEA 2HS8A 3QPZA 3QC3A 4O15A 4UR7A 2CU0A 5HMSA 1YDVA 2NX3A 2E5DA 4FX6M 3OVQA 4ZL1A 2ZRYA 4HHPA 2C0AA 1H63A 2E6FA 3QJAA 2A4AA 2QJHA 1R2TA 3S0CA 4NNBA 3W7DA 3S1UA 3O16A 5TQLA 3A22A 2ISWA 1CI1A 5TIMA 2DJXA 5AB3A 4NJHA 2O7SA 3G18A 2ZBTA 2ZA3A 3KRUA 3SI9A 3WK1A 2YFNA 1RD5A 1LZOA 3MP3A 4QITA 1K7EA 4OHQA 4E2DA 2PE4A 3BGGA 3NEVA 1YLVA 4TO8A 1GVOA 2BZNA 1UB3A 2P0OA 1JQVA 3CPRA 2OZ0A 4MZ1A 4AVFA 1OFAA 2YW3A 2QKFA 3EWBX 3G8RA 3PY2A 4QQ3A 3VE7A 5BMWA 4IMDA 2P1FA 2X1RA 1LCOA 4WY0B 5IBXA 1S5VA 3GR8A 4GWEA 2BWGA 3BLIA 3L5AA 1HO1A 2O7QA 4LU0A 1H7WA 3A21A 3I7SA 3S5NA 3P7YA 4A2RA 4KWVA 1X7FA 3LCHA 5CPLA 3FEMA 3ELFA 3U2OA 1VHNA 3HJZA 1DJQA 3DU0A 3S5YA 4DF2A 4UC5A 3HPSA 3W70A 3PVFA 2ZZ3A 3TCEA 5F4WA 2ATMA 5KZMA 5G1YA 2C19A 2Y70A 1OYBA 2ZZ2A 3QMSA 4FHAA 4WOQA 6TIMA 3HG2A 4A2SA 4NNAA 3BLEA 1KTBA 4NQ1A 1D9EA 2H8XA 3A24A 1GEQA 2A6NA 1T0OA 3USBA 2B7QA 4I7WA 4NXKA 3M43A 4WJEA 4HNUA 1JCJA 2FDSA 4LVGA 4RZ4A 5AN7A 3W73A 1VQTA 4M6VA 5DXXA 3W7JA 1RPXA 3O07A 3TROA 4X3ZA 5LSMA 1EPXA 4IMGA 5DCBA 3PUOA 4ZQNA 1UBSA 3QSRA 4PCFA 3ABQA 5AFDA 1FWSA 1G4PA 3R12A 1OF6A 4M6QA 2OT1A 1SZGA 3LOTA 6ALDA 3C3NA 3G1XA 3M1ZA 4UXDA 3FJLA 3GIYA 2VEKA 4Q4KA 3NQEA 1IXOA 2BTMA 3G3DA 1SUXA 2WKJA 1TB3A 4JS3A 1WOAA 1O60A 4U4MA 1XUUA 3P60A 1I2PA 1S3HA 3E9AA 3W72A 5DCDA 1JQXA 1TSIA 1QCWA 1SW0A 1EA0A 3WK3A 1KM0A 1AW2A 1G69A 3NZRA 4OV4A 2Y89A 3S5OA 4PTNA 1XC4A 3TFCA 1OG0A 5HJLA 1OF8A 2WJZA 4CNOA 1H5YA 2V81A 2X16A 1EEPA 1UUMA 1GPWA 1TJPA 4IXXA 1KM6A 1VYPX 3EEGA 2WSYA 3V1PA 5I3JA 3GDMA 3EX1A 5LGXA 1ADOA 4HIBA 1TPUA 3U6WA 1YYAA 2YXGA 3QM3A 3MJYA 3N2XA 4XBSA 3C6CA 1LTDA 1H51A 2GJNA 4BI7A 4CNPA 3VNDA 2PC4A 5E0KA 5K9DA 3RLUA 1MEIA 4UFMA 2WO5A 4GUJA 4IPIA 5LNWA 3G0UA 3PUDA 3W1NA 1DOSA 4UTTC 3W84A 4B5NA 4GE8A 3PSWA 3DKJA 3A5FA 4HN4A 1ML1A 4R33A 3LERA 4GRSA 1Y0EA 1F5ZA 3NQ7A 1KTNA 2EAWA 5D2XA 3STEA 4DF0A 1OFRA 2YW4A 3G24A 1IIHA 5CSSA 3MHGA 2QUVA 5HINA 3BW2A 2NUWA 4LVAA 4NJGA 5I3KA 3WFAA 1WV2A 4M5PA 4PH6A 4WZHA 5U4NA 2QJIA 1T99A 4PA8A 4MZYA 2BLEA 3FYOA 4UR8A 2YCEA 1KV5A 3W2JA 4RZ5A 3SW6A 4XZ9A 3UWUA 1MZHA 2OJPA 4MY1A 3CIWA 1F05A 1GTHA 4K7YA 4BWLA 1P4CA 2NLIA 1AG1O 4MPQA 3DI1A 2NX1A 1R2RA 3ABOA 3W7CA 3ABRA 2JK2A 2QCEA 2E6AA 3MHUA 3TAKA 3NNTA 5IM51 1WA3A 2Z6IA 3BW4A 3O15A 1XBVA 2HSAA 1YPIA 4X2RA 2H8ZA 4A3UA 1VPXA 4IMCA 3F4NA 3BPWA 2W0UA 4M6PA 5F1VA 5ABTA 4MFDA 3LCXA 4QAIA 2XN1A 3HG4A 4O28A 4FIQA 4O54A 4AAJA 3P61A 1RZMA 2GVJA 3MI2A 4JD4A 2NUYA 4Z1CA 5F2MA 4RV8A 4O18A 1OYAA 3LI0A 2V30A 1PS9A 4N4PA 3TA6A 3MBFA 4GUGA 5H2ZA 1KM1A 1VR6A 2HS6A 3L66A 5EY5A 4UNKA 3UWQA 4ADSA 3W2NA 1YXCA 3PBUA 5DY2A 2VFHA 2VEPA 4K37A 1DJNA 4NU7A 3TSBA 3GAYA 2FPTA 4ADTA 4MLJA 3C8FA 1P5BA 4FNPA 1DBTA 1O94A 1M5WA 4N2YA 4AWTA 3M44A 1QPOA 4YMZA 4AH7A 1JUEA 4JY9A 3GLCA 4FNUA 4CQ8A 3N19B 2DZXA 2J27A 3O6DA 4ADUA 5G2HA 2NUXA 4O11A 3N14A 5D2TA 1HUVA 3SSJA 3FLUA 4AWUA 3EX3A 3PWAA 1LDCA 4JEQA 2HMCA 4RCXA 1XL9A 3KRZA 3UWYA 1TJRA 1TYGA 1WBJA 1OX6A 3NM3A 5DBTA 1VHCA 1VLIA 4QISA 4O1DA 2V9DA 3TE9A 3NQ2A 3UZ5A 4JTUA 4LS0A 4Y6GA 7TIMA 5LHEA 4IWWA 3PM6A 4HSOA 3Q58A 4GUIA 1E51A 2IQTA 2YX0A 3QW3A 2A2IA 2I14A 3EWZA 4Q33A 3W2KA 1X6UA 3LXAA 4FXRA 3W3OA 3FFSA 3BO9A 2WSRA 4LS1A 1L6YA 3ZWSA 4O1CA 1GWJA 3O6CA 3GX9A 1IXQA 1JVNA 2ZTKA 5F4XA 1FCVA 4S2BA 2Z0IA 1SPQA 4H6KA 1VRDA 1SZFA 3INPA 3L5LA 1TPDA 3PR2A 2YGYA 3W7GA 4YCPA 1W0MA 2GQ9A 4MFEA 3NG3A 4I7UA 4LTSA 3C2RA 3L65A 1LOQA 3HGSA 1SW7A 1W5PA 2Y63A 1XBZA 2QAPA 4YCOA 3R8RA 3UZJA 3H55A 2VFIA 3PUEA 1I2OA 3W07A 2ISSA 2G5WA 3W6YA 1AL7A 2Y62A 1ZAIA 3TC6A 1K02A 3MI6A 1W3IA 1B4KA 3UY7A 5K4ZA 3NAVA 2X2GA 3NQCA 4NZFA 2ABAA 3BGJA 3NPUA 4A29A 3I6RA 1HFBA 4XTIA 1OFQA 3P8JA 1V5XA 4IOTA 4CQAA 1W56A 2E77A 3LTPA 3SGUA 3LV5A 3LGEA 1KLZA 4XQ6A 2RH9A 3DKLA 1ONRA 3TUUA 3FKRA 4FF7A 4AHOA 4DEFA 1P0NA 1DV7A 1EWEA 3EXRA 3GNNA 3CT7A 1LRQA 2ZZ5A 4N9BA 3TXVA 2WV8A 2R91A 1Q6LA 2GUUA 1F74A 5BNKA 2GJLA 3SJ3A 1ZJIA 3B04A 3FS2A 2KZHA 1OFBA 5FEPA 4JX5A 3GXNA 1KFLA 1QOQA 4OQVA 5G2WA 4UTUA 4AMAA 4MZ8A 5L9FA 3I68A 3DENA 4TU1A 4O1AA 3Q37A 3HMJG 4LT9A 4ORIA 1DKWA 4HNVA 1VYRA 2JKAA 3W7QA 4K36A 1I45A 4MVAA 4UTHA 3SIZA 1TIMA 3OG3A 4IPJA 1TRDA 4PFMA 5FF0A 3M5XA 3MP5A 4BI5A 3HBLA 2VFGA 3LCWA 1ZHAA 2FLIA 3S1WA 2VELA 3PB2A 4DO6A 3ANYA 1GT8A 2J9YA 3P74A 1B3OA 4N6FA 2AGKA 1UUOA 2JKPA 5A8GA 3OA3A 1QO2A 1TV5A 4UUIA 2W6RA 5EKYA 1RV8A 2D73A 3GB6A 1FDYA 3W85A 2Y7DA 1IGSA 1DQXA 3L0GA 3T7VA 5D2WA 1T96A 2VFEA 2TYSA 3LHUA 3HPZA 4I9AA 5D2YA 4RX0A 2GVLA 4RR4A 4O50A 5FEXA 2EF9A 4JY8A 4U28A 3A9IA 3W7MA 1G4EA 2YDAA 1YPFA 3NXFA 3TU9A 1A50A 1W3NA 4O4WA 2JBMA 4LRSA 1R2SA 4GBUA 2C1HA 1XDLA 3NL2A 3G1AA 3G1SA 1J4EA 1X8FA 3VI2A 4N4QA 3TDFA 3W2MA 2Y88A 1G67A 2Y6ZA 3B05A 2RDUA 1SSDA 3O6YX 4R7JA 4AHPA 4JYEA 2I9EA 3N9RA 3W1UA 3STGA 2ZQ0A 4JIQA 1XBXA 3GZ3A 1G7UA 4LVBA 1QOPA 1SO5A 1VLWA 1KBIA 1ICSA 4LVFA 3BW3A 1FWRA 4UTKA 1DQWA 1AW5A 3TKFA 2E5CA 1GOXA 4UMBA 1K7XA 4NXSA 2GVGA 3CWOX 4DO5A 3THQA 1GZGA 3W7PA 1H7XA 3W2LA 4JYFA 3PG9A 3FOKA 4R34A 4ZQRA 1FXPA 3CEUA 3W76A 4FNSA 3IVSA 2F84A 3S6DA 1BKSA 5EBUA 4K38A 2VC6A 1XDMA 1YXYA 2ZRUA 1VCFA 4XUGA 3V75A 1TPB1 3RFAA 4BI6A 2DU2A 1L9WA 3F03K 2NXHA 4LS2A 1KLYA 4MY8A 4FO4A 2DZVA 2ZRXA 4IX0A 3B06A 4OBTA 2CLMA 2E6YA 1QR7A 3OIXA 1N8FA 1QFEA 2ZRZA 2DZUA 4XWUA 3FA5A 2Q8LA 4BFAA 5KITA 1NAL1 4WY0F 4NVTA 1SFLA 3Q94A 4TR9A 1RQBA 1W3TA 5HWNA 1GYNA 1VJIA 3OEXA 3DBPA 5DXYA 2PCQA 3FIGA 4O12A 1TPFA 3N73A 4MLRA 2YPIA 4OV9A 2ZZ4A 2UV8G 3M5YA 1TPVA 4LC6A 3W86A 1Q6OA 1AMKA 1UASA 1OFPA 4UCGA 3NQGA 4PC8A 1TCDA 1K3UA 4NX5A 2RHGA 2Z2UA 3MI3A 2OT0A 2A21A 3P5YA 5FEWA 3KX6A 2XN2A 4FIRA 5I3FA 3FYPA 3LDVA 3DFOA 3QF0A 3VFLA 4EWND 5K7JA 3TFXA 1FWTA 5AYZA 1LOSA 3NO5A 3S8HA 4OU1A 1FBAA 3E0IA 1JCXA 2XFWA 3CTLA 1W8SA 1RQHA 1EB3A 3LB0A 3SY5A 2E09A 2ZYFA 1Z48A 3W71A 2DORA 5CG7A 3G0XA 3L5MA 3UXAA 4LUIA 1ZALA 4MJMA 4QJ1A 2NV1A 4AF0B 4C1LA 4RJEA 4NJJA 3IIOA 2DZWA 5D04C 2YYTA 2NXGA 1PVNA 4AF0A 4IQLA 1EIXA 1FDJA 3U8GA 3W9ZA 2XN0A 5K9CA 1M6JA 2V82A 2H6RA 3S1XA 1VZWA 3P84A 4UFLA 4KFOA 4ZQPA 3DI0A 3MUXA 3JRKA 4NT0A 2CW6A 5CZSA 1FX6A 2Y7FA 3W7EA 1X1ZA 2J9XA 1H62A 5BRBA
chains in the Genus database with same CATH superfamily
4H3DA 1JZ2A 1BWKA 4WOZA 2DZSA 3AAMA 1EJXC 4ZO6A 4AQLA 2GLKA 4M7TA 4O19A 1XRSA 3ATYA 1F3EA 2OZ3A 3M0HA 4P61A 1Q6FA 4B15A 2PDBA 3FAWA 1HTIA 1EQCA 3U5UA 3SURA 3TNOA 5EPDA 3SUUA 1QWGA 3FGCB 4YL2A 5U7SA 4E38A 2OX4A 1BXBA 2CWNA 3IACA 4AZGA 1V6TA 4W8LA 1IZCA 1U33A 6XIMA 1E6RA 4MJ2A 4Y9MA 3NURA 3ZFHA 1RJQA 3GTFA 4ERGA 3GVGA 1H60A 1J0JA 3AIRA 1SJCA 3QGVA 4JGDA 3W1AA 4PN2A 1V3LA 2GGJA 1RBOB 2PGFA 4P2VA 5D8ZA 1NELA 2A3BA 2DVXA 3BV7A 3GVRA 2B31A 4MF4A 1JDFA 2F6XA 2C0HA 3FY1A 3DYPA 2ZKMX 1M68A 2DUZA 4GG9A 4V33A 1UR3M 3EB2A 3BE7A 4PCPA 3APGA 4QLLA 4RZ6A 2A3HA 1EJUC 5FF3A 1XCXA 3OBAA 1R30A 4JDBA 3GXFA 2QPXA 4E2OA 3WLLA 1MZRA 4NAFB 5I3DA 3BAJA 3ZJ7A 1EUAA 3LCIA 1WAWA 3DFNA 2WWCA 6REQB 1Q8JA 2X05A 5LNRA 2J6VA 3SFWA 1ELSA 1LORA 5AHEA 1XYMA 2NSXA 3UPWA 1ISWA 3NL5A 1TCMA 3HV8A 4KF1A 3I65A 3LN3A 1EP3A 2AKMA 2RJGA 2ABBA 2XJ7A 2IPGA 3HURA 1JDDA 3W7KA 3LQLA 1EJWC 1SFJA 4A8IA 1DHPA 1XIEA 1HJQA 1YIXA 1E1FA 1TTIA 1AMYA 1JEZA 5I6SA 5HXMA 4K8EA 1V3MA 2Z6JA 3NQ8A 4JHOA 5D05A 4F0SA 2YCLA 3E74A 5JVLA 5CBBA 4A3RA 5CPOA 4NJKA 7REQB 3W27A 4QDMA 1SMAA 3F2DA 4IGHA 1J18A 2Y5SA 3W53A 4UWMA 3PZQA 4X22A 2R9RA 3B03A 4HMCA 3EMZA 5HQLA 1B31A 2HCVA 1UKOA 4BHYA 4XKYA 4WLCA 4FS9A 2PLMA 3S42A 4FB7A 4EVZA 1S1PA 1A0EA 2YB1A 3KCLA 5CAKA 4JN6A 3MWCA 4WKFA 3O63A 4XISA 4KQNA 1MW2A 1EDGA 1CPUA 3F2BA 4PSRA 2PAJA 2GVYA 3GFYA 1CECA 3WNNA 2YKKA 1VBJA 3R0DA 3RNDA 2FJUB 1LWJA 3GXMA 3KM8A 2YLLA 1JYXA 4OGZA 1SO4A 3AXIA 1QAPA 2BDQA 2CYGA 5CGMA 2PF0A 3LHVA 3RIKA 1LUCB 4AZCA 3OZOA 3O7UA 3QR0A 3THAA 2W92A 5CPTA 3HOJA 3B4YA 4PUNA 4XO7A 2INEA 4BQ4A 3RILA 3ITXA 3I6EA 3P80A 3T8LA 2PRHA 4MWAB 1D3GA 3CHEA 1GORA 3R89A 2ZVIA 4S3BA 2C14A 3W1MA 4HA4A 3SN1A 1W3KA 2VEIA 4Q22A 4DO7A 1YPXA 4FNQA 1GNXA 3KZPA 3N3MA 3CHFA 3QPEA 3SEPA 4QNWA 3HQ1A 1IV8A 2VM8A 4LVDA 2CBIA 2XUCA 1QI4A 3CM4A 3TMQA 3UY8A 3VM5A 1TTPA 3UZWA 4V2XA 1H1NA 3D46A 4I5XA 3E2QA 4B4FA 2IKJA 3EWDA 3GDRA 2OYMA 3CO8A 3WJWA 3WD1A 2JF7A 2E5BA 2A0NA 4XBKA 1I2RA 2BG5A 4MIMA 4X0NA 1A3HA 2QCMA 4U31A 3EPMA 1EP1A 4EPKA 2DH3A 1PTGA 3L4WA 3PP7A 1W9UA 3W7OA 4M6UA 1GHSA 2WAGA 4EF8A 2VGGA 3ONCA 4O0KA 2VVSA 2UY2A 3QW4B 4F3HA 3PG8A 5AHFA 4ZFMA 5AVHA 2WM1A 5HUPA 3V0SA 4DJDC 3COTA 3RPDA 4AD4A 5C9XA 4D6IA 2WJEA 3DHPA 3OP2A 3KHJA 4HHLA 2E28A 3LHWA 1X6NA 1KBJA 5LZLA 4IZGA 4AMCA 3VNMA 1TO3A 1F6PA 1XIFA 2BHYA 3IAPA 4YU1A 1F3TA 2OYKA 4UTMA 4H8HA 4HYWA 3WL0A 1FCQA 4LBRA 5BOOA 1H7NA 3W1PA 1ZGDA 4GVFA 2NSOA 4UMAA 3FKKA 5I24A 1HX0A 1ZJHA 1E71M 1W5MA 3JU2A 4JEJA 3VCRA 3Q65A 4ZVJA 4M8UA 2Z1KA 1P43A 5AKQA 2OX1A 3SR7A 4JFSA 5CZ0A 3KTXA 6CGTA 5E1QA 4ZQCA 5FOOA 1REQA 2HVMA 2I5GA 4AXNA 1NF7A 5EL1A 4BWLC 4U2YA 3WBWA 4M3PA 1TV7A 4TMCA 1E55A 1RR2A 3KUMA 4DO4A 5CAHA 2ZWZA 2VEFA 3NTYA 2Z24A 3WLSA 2ZVRA 3R0UA 1WX0A 1O1HA 4BQ2A 4YLWA 3HZ3A 4LB4A 3HPXA 4RNFA 3IVTA 4HN8A 4PFHA 1C29A 4G7FA 4DRSA 1CDGA 1SR9A 1W8GA 4HJWA 3GNOA 1UG6A 4QAWA 5M17A 4CQDA 3TR9A 3LLDA 3LX9A 2NQHA 2FFIA 1R7AA 3KWSA 3TYZA 5I3HA 4E8DA 4EOUA 4QE5A 1X1OA 3N2CA 3ATZA 3NQDA 4GXPA 1XCFA 1R8LA 1LLWA 4IHCA 4I9MA 4Z0JA 4X2PA 3DC8A 1UIPA 3WIJA 1GYLA 2Q3RA 1D3HA 3RO6A 4L4OA 1QW9A 3IGXA 4AISA 2FPYA 3WX7A 4K6AA 3GHRA 3R10A 3UP8A 2J8GA 3DOPA 4NUWA 2X30A 2NVCA 2F2KA 4JIPA 3N11A 2PURA 2B7NA 5FF7A 1UR4A 3QY6A 3VKKA 3L12A 1RALA 5ABHA 1J79A 3MMTA 3NOEA 5DN1A 3QV9A 3GFZA 4NZ1A 1RQEA 3CL6A 4EX4A 1IR1A 4PUKA 1OD8A 3CAKA 3OGVA 1BVNP 5FEZA 3VZZA 1R3QA 3CHCA 1EGMA 1V7YA 1KFBA 2FGLA 3EPNA 3NR0A 3R13A 4PODA 1RK5A 1QNSA 4C1NB 3HGRA 1CGYA 4QR6A 1NFGA 3W25A 3HFTA 1EDQA 1G4TA 2NVAA 1CBGA 2OG9A 1WZAA 5LKYA 3QRHA 3FN9A 5CPQA 3G1DA 2A85A 3GRIA 3W1QA 3L0NA 1HKMA 4DNHA 4UMCA 2QCDB 4IGNA 3NO3A 4PZVA 4E2BA 3M7WA 4I7VA 3NQVA 8RUCA 4Z0SA 1XLBA 1LRNA 4F66A 1VS1A 3DFTA 1UH2A 1NEYA 3WO8A 3E49A 3NPWA 2XIIA 4DELA 3W24A 5CSRA 1QBAA 3HG5A 3WJYA 1EHNA 1O5RA 2F9RA 4MJZA 1J8VA 3QHOA 4MM1A 1R47A 5F1UA 1HP4A 1B1YA 4LUJA 5IXEA 1Q6DA 2ACUA 3B0VC 1S2WA 2A7RA 4C6JA 5AHNA 1DJHA 3CB8A 2GGEA 3VIMA 3B0XA 5KSWA 4HPNA 1U30A 1M3UA 1J11A 3GBDA 4JQAA 3TW6A 1W3JA 2Z1BA 2QUUA 3IVUA 1MQQA 5D33A 1JF5A 4H19A 1SVDA 5D30A 5AHLA 2XDFA 1S46A 3B0UX 3L67A 4G7EA 3QPYA 4CNNA 3UXDA 4ZSTA 5D38A 1KA9F 1POJA 4O52A 5HAOA 3EAUA 1QMLA 2WQDA 3ABSA 2HXTA 3LV6A 3B8WA 1R3RA 5DMLA 1H2JA 2J24A 3ALFA 4LCSA 4KRTA 3GNXA 2WOQA 3SRFA 2TMDA 5D37A 4FX8A 2V2CA 5BCAA 5D8WA 3VGEA 3ID7A 3GXIA 3KW3A 3T09A 4E3TA 1DWGM 5IOBA 3MW7A 2EPHA 5JBDA 3VC6A 3G1FA 4J9JA 3BCFA 1MW1A 2OQHA 4RL3A 5J5RA 3O2LA 1DJYA 3HPFA 1WYIA 4WGXA 4C65A 1NTHA 2GFTA 5BXRA 1NY1A 1CWYA 4GUHA 2RDWA 1PIIA 5C9ZA 3WDRA 4E8CA 4X9SA 1LBLA 1F76A 2FYMA 3WEOA 4YVXA 1NF0A 2WPBA 1PWMA 1DORA 3NO1A 4R9XA 5C2XA 3VE9A 2J7EA 3QR3A 3MT1A 3CYVA 4KKXA 4QCEA 1ODUA 3E0FA 1ZBWA 2CLPA 3EYPA 2PLKA 3GXPA 4NKCA 2QCHA 3BSMA 4C6NA 2IXVA 5LA0A 1AQ0A 4KMQA 3WFLA 3O8AA 3PZUA 1LT8A 2CZ5A 1EXPA 2Y1HA 2YL8A 1A49A 2J7GA 2VURA 3MYPA 3H21A 3RLVA 1Z69A 2VCAA 3RMJA 3PPHA 4IIEA 2AKZA 3FA4A 4D6DA 1ZU8A 3B97A 1MW3A 3C8NA 3QQ0A 2TRSA 2J88A 5CC3A 4JDYA 3OLIA 2AQOA 2ZFAA 1PDZA 4MUZA 3W37A 3VKAA 1NVMA 3HTWA 3CUZA 1TKKA 4GQ0A 4LY8A 1LQ0A 3VKCA 3H70A 4H4IA 3IJ6A 3LA4A 2VDGA 4G8TA 3A23A 3UNDA 3SY1A 3M47A 1OFEA 1PX3A 3L23A 1TPEA 2ZZ7A 1EBHA 4CD7A 1TTJA 1E1CB 4EF9A 2Y8UA 3N1AA 3KRSA 1QPQA 4YNGA 3N13A 3W1XA 3T78A 4FXSA 5BOEA 1PZ1A 2CFFA 4PMXA 3LZ5A 1JUKA 1O5QA 4AG0A 3YPIA 1IEQA 1Z3NA 4HPGA 3H2CA 3BICA 1A5NC 4JTRA 1ZBCA 2ISDA 3VKBA 1VC4A 4PCSA 1KWGA 2Q8ZA 4PMUA 3M07A 3XIMA 4A8LA 3GH5A 4ONVA 3W7HA 2OVLA 2A3LA 3WQ8A 4E0CA 1KB3A 1NDWA 5EFFA 2OELA 5DX7A 4E8GA 1OB0A 1VCVA 2YL5A 2HJPA 1CZ1A 2Y8VA 2ZRWA 3LRKA 4J35A 4DXVA 4PBFA 4W9TA 5FAGA 4HK5A 1EUNA 1G1YA 5A6AA 2E6DA 4KH2A 1P0EA 2ONEA 3L4YA 4ZXOA 3QXBA 1F8MA 3ZO9A 4AYSA 5DEZA 4CD4A 2IW0A 3CZ8A 2X7VA 4ATLA 1DIEA 1K6AA 4OZOA 1RD6A 1S2VA 1TPC1 3GXTA 3MMWA 2X09A 3BVJA 2PEVA 1OHLA 1CW2A 2Z4GA 4FLRA 5DMYA 3AMGA 4IIDA 4LB3A 4MB1A 2RGLA 1RXOB 4O15A 4ERAA 1HNYA 1YDVA 1QW8A 2JEQA 2NX3A 3VO0A 2ZRYA 4B4HA 4HHPA 1W6TA 2A4AA 1R2TA 2ANUA 4GHRA 1F61A 2WHMA 3Q45A 4WVXA 4D1JA 2BHUA 3G18A 2ZBTA 3MUIA 3SI9A 1O66A 3WK1A 3PNZA 3MP3A 4QITA 4Q4RA 4A6GA 1F07A 1S38A 1YLVA 2WZEA 4ES4A 4PMNA 5MKGB 4TX8A 2P0OA 3CPRA 3ZVIA 3IWPA 4LUTA 3OVGA 2WZIA 4Y7EA 5HMFA 3D47A 2DZAA 2DIKA 3DDMA 1E15A 1LCOA 4WY0B 2PBGA 4G1NA 3BLIA 2NT0A 4PULA 5BWAA 1MYRA 1W9VA 2WC7A 4HGXA 3GUGA 3E0LA 4MNLA 2HVOA 1X7FA 3R7MA 2PTWA 2Z00A 4S3CA 3U2OA 2GJRA 1UR1A 3IPWA 1W9BM 1VHNA 4MNKA 3S5YA 1IWBA 3VA8A 4D6FA 2ATMA 3B40A 2C19A 4FHAA 3QMSA 2XVKA 4NNAA 1OBAA 4CD8A 2G3FA 3NDYA 3WLJA 1D3CA 1H09A 8A3HA 1WUFA 2GWGA 4HNUA 3AIQA 1JCJA 4HYRA 2BXZA 4LYKA 5AYIA 4WF7A 3CYJA 5AN7A 3NZGA 5DXXA 3NWRA 4CGTA 2VGIA 1JYVA 3BLPX 1K70A 3RJXA 5LSMA 3GH7A 3ITVA 3WLKX 1KXQA 3QSRA 3S47A 5JBFA 5AFDA 4QRNA 4HB7A 4B91A 1G4PA 1T40A 4AC1X 2OT1A 1SZGA 2V5KA 2G3NA 2O4MA 3T9PA 1NU5A 4UXDA 2CBVA 2I17A 3GIYA 4Y9PA 1E0VA 2DT1A 4QDWA 8CGTA 1J93A 4ATWA 2DQXA 1IXOA 3QV8A 2G0WA 2QDDA 1SZRA 4W8BA 2PZ0A 1WOAA 4TX6A 3P60A 4J7RA 1S3HA 4REQA 1JQXA 1KGXA 1XP3A 4JIRA 5A6BA 1AW2A 1G69A 2Y89A 1KNWA 2PDNA 1U5HA 1YQ2A 3GIPA 2A3CA 3K4AA 5HJLA 3PK7A 3P93A 2OEKA 2W4XA 4DWSD 4CNOA 4IXXA 1KM6A 3SCUA 2WSYA 3V1PA 2SFPA 2DUXA 3EX1A 4UQEA 2HISA 3FXYA 4HIBA 3U6WA 1QK0A 3BDKA 3IJ9A 3MU7A 1E0TA 3FW6A 3S5SA 1ZUAX 3BMXA 4XBSA 3VUPA 4PBEA 5AVNA 4GY1A 3WDPP 2BOFX 2GJNA 3IGHX 3CZKA 2QIWA 3RLUA 3WH6A 1MEIA 4UFMA 3CAWA 1R9XA 3KTSA 2WBKA 1XIIA 2OO6A 3W84A 5C71A 1A0CA 4B5NA 1VEPA 3DKJA 4QG6A 4R33A 4DZHA 2XFFA 1EIBA 1Y65A 3CUGA 3WNKA 1CLXA 3N2TA 1MRQA 3NQ7A 1KTNA 1UBPC 2YW4A 2PLCA 5CSSA 1TMQA 2J7CA 1UH3A 1R86A 4S3EA 2YA2A 1I0DA 4NJGA 4E5TA 1MW0A 1OSEA 5U4NA 2R1PA 4PA8A 1GPFA 3W2JA 3GC4A 3ANUA 1MZHA 2OJPA 5M3WA 3CAQA 3CIWA 4L61A 4DBSA 5HQMA 1P4CA 1W1PA 2NLIA 4MPQA 5A2AA 2FGBA 3GTNA 3WBEA 3UJ2A 3SCVA 3MHUA 2E6AA 4ZODA 1RY8A 2QV5A 3T6CA 1OGSA 3FAXA 1QVBA 2HSAA 3CPUA 1YPIA 4WKAA 3VD7A 4W88A 3RG6A 4QAIA 3HG4A 2OEJA 4GGBA 4JD4A 4Z1CA 4R27A 4RV8A 4GKTA 4QJ3B 3MBFA 5GJNA 4A4AA 5AY7A 4GUGA 2XGBA 1HP5A 5H2ZA 4XD6A 1KM1A 1VR6A 3I3BA 1C92A 1I75A 4ADSA 3W2NA 2J7DA 1QW7A 4K37A 2QW5A 4AD0A 4QG8A 4MLJA 3C8FA 3AALA 2FMOA 1M5WA 4AWTA 3M44A 4C6BA 4Y8EA 1GQJA 3GLCA 4JY9A 4FNUA 4HZ8A 2JEPA 2VOTA 4JTQA 2VDIA 1YX1A 1UD5A 4I5RA 4AWUA 3ZT6A 1NFPA 3EX3A 4RCXA 3UWYA 1CENA 1ODZA 1S2AA 3NM3A 1Q7QA 2W9MA 1E9LA 5DBTA 3MB9A 2V9DA 3E0WA 4BQ3A 4MPKA 1BVZA 4CD5A 1H11A 3AS1A 3CAVA 3VIGA 1TZ7A 3LQGA 3A47A 4IT1A 1MUCA 2J7FA 3FFSA 3BO9A 1RCXB 2WSRA 1L6YA 1FTXA 3QZ6A 3OW1A 1R6WA 3GX9A 2O56A 4AVNA 2ZTKA 3BC9A 4GYFA 5F4XA 1FCVA 4HZMA 1I9CB 4ZGYA 3L5LA 1SZFA 3INPA 1TPDA 2J7BA 2ZUSA 2PGEA 4MFEA 1GJUA 2B81A 4TVDA 3C2RA 1UC5A 1V3HA 3CXOA 1XLEA 3HGSA 3OA5A 1UW9A 3U48A 3KOWA 3JZUA 3PUEA 1PTAA 3LYEA 4M1RA 3W07A 5EMMA 4OOUA 1AL7A 1W2VA 5HANA 3TC6A 1K02A 3MI6A 1B4KA 2E8ZA 5K4ZA 3BJTA 4Y2WA 3BGJA 2Q8XA 1EO7A 3KBMA 3KOXA 3OJGA 4XTIA 3VDHA 3LTPA 3SGUA 3LV5A 2OB3A 1IE7C 3I3EA 1DTNA 3MS8A 1ZP4A 1UP2A 2OSWA 1CT5A 3NEHA 4B3LA 4AHOA 2CXEA 1KBKA 1YE4A 3G6LA 1DV7A 1EWEA 4YYFA 1XV8A 5DRIA 1LRQA 1Q8AA 4N9BA 1DQUA 3KEHA 1Q6LA 1OEPA 4GI8A 3OQ8A 1FWFC 2KZHA 3EDDA 4JX5A 4NRRA 1QOQA 4UTUA 2E25A 1JZ8A 2I9UA 3VNZA 4AY8A 3Q37A 3HMJG 4IIBA 1YBQB 4H8VA 1KRMA 4K36A 4MVAA 4UTHA 3SIZA 3M5XA 4QEHA 2FLIA 3P2VA 1Q4NX 3VNKA 4MNMA 1A4LA 4IFRA 4CNSA 4XIAA 3M0YA 2GGIA 2PDJA 1UUOA 2JKPA 5A8GA 3V5CA 2W6RA 1RV8A 3FDGA 1FDYA 3LG3A 2IKGA 4JAWA 3WLPA 2VFEA 4S23A 3HQOA 3WY1A 4C6QA 4UCFA 3SQLA 4PRRA 4RR4A 1WCGA 1PZ3A 1P48A 2EF9A 4JY8A 1XYAA 2XGIA 1Q7MA 3W7MA 4PUDA 3SGGA 2YDAA 1RJRA 4DHGA 1A5MC 1V6UA 3KS5A 1A50A 1W3NA 4N7QA 4UOQA 2PDUA 4ILSA 2BY0A 3MDUA 1XDLA 3NL2A 5G1MA 3G1AA 1X8FA 1QI5A 1G67A 2Y6ZA 5C0QA 1SSDA 1SM9A 5I07A 3N9RA 3W1UA 3STGA 2W91A 2Y0FA 4ACZA 3TP4A 3GDBA 2EJ1A 2HEJA 3CUIA 1VLWA 3SADA 5I00A 4LVFA 4C60A 4I6KA 3BW3A 1FWRA 1HZYA 3VIJA 1UKTA 1E0UA 3R25A 1JYNA 1QHPA 1GZGA 2PPGA 3AIWA 4B3ZA 3ZT5A 2OGYA 3PTQA 1XYCA 4JYFA 4DZAA 3C5QA 3PG9A 3FOKA 1BQCA 3ARSA 4W5ZA 2DW6A 3GWQA 1X97A 2GK1B 1FXPA 3CEUA 3TEVA 3SCNA 3KE0A 3DG7A 4ZFCA 1XDMA 1YXYA 3FX4A 4RDZA 1T8QA 2ZC1A 2EPLX 2ZRUA 1GVYA 1W9DM 3CL7A 3RFAA 4E4FA 2DU2A 1VB9A 3W38A 2J78A 5DT5A 1KLYA 4FO4A 2DZVA 3VIPA 2E6YA 4B3KA 4L9XA 2OZ8A 4KGLA 1VJSA 3VYLA 4XWUA 1TMLA 1UQZA 1GK8A 4OIFA 2Q8LA 2E4TA 3MC5A 4NVTA 2DZBA 3Q94A 1XQKA 2GJPA 3N04A 1BG4A 5HWNA 1VJIA 2X0YA 3OEXA 3VDGA 2PCQA 4O12A 5ENLA 1TPFA 3N73A 4BCEA 2XVGA 2XHYA 4MLRA 4GABA 2EPOA 5CC7A 2NLYA 3BGAA 2ZZ4A 4CQBA 2UV8G 1JYWA 3RN6A 3TCSA 4LC6A 2CXGA 1LT7A 2ZXBA 1C7SA 4CEXC 2ZUMA 4GYKA 3WQGA 1K3UA 4NX5A 4Q8UA 4R5EA 4BJHA 4F2UA 3T0TA 3P5YA 3FJ4A 5I3FA 4LPCA 1RVKA 3ITOA 3ZT7A 3BAXA 3DFOA 1DIDA 2ZIDA 3GG1A 4EWND 4XBJA 2VT0A 1WE5A 4D72A 1E6QM 5ABFA 4CNUA 1VFLA 2E09A 4PMQA 2ZYFA 1N82A 2DORA 1ZALA 2R82A 3SJNA 2NV1A 4TV5A 2OOGA 4RJEA 4L1WA 3IIOA 2YJQA 1B3XA 3K46A 3RX2A 8XIMA 5EMLA 4HHHA 4AF0A 2AMXA 3C0LA 3FVMA 3U8GA 5K9CA 3BJSA 1BWVA 2V82A 3UA4A 1ITQA 3W7EA 1UWSA 5G4HC 2J9XA 3U7BA 4CD6A 4HOZA 3MVTA 3T0CA 2V38A 1SYTA 3KCJA 3CTTA 5HMDA 4W87A 4AYGA 3L4ZA 3L4XA 4O0ZA 1OK6A 5I5RA 3XISA 5XIMA 5JBEA 1NDVA 2RDTA 3HO8A 2RFGA 1ZENA 4GINA 4UFHA 3KXQA 2NQJA 3CWHA 3W7NA 1QDSA 2OZTA 5G5IA 4JIEA 4RE0A 1SSGA 1XW8A 2TPSA 3AHVA 5CZJA 3N6HA 3DXIA 1FDZA 3N2MA 4QP0A 3VGFA 1R38A 4QNEA 4Z1DA 1LWHA 2EG8A 4LYRA 3QMRA 1WKYA 1B0IA 1GZ1A 3ISIX 2YYUA 2Y5JA 2DDXA 2OQYA 1OC7A 3GQYA 3S2JA 3CQKA 3LBOA 1PCWA 2C18A 5C5YA 3VGGA 3R8HA 1E73M 4YS1A 5I02A 4O14A 4MHBA 3WQCA 4U3CA 3H4GA 3DGRA 4D9PA 2PUZA 5F2LA 3RU6A 1NM9A 5D32A 2NXIA 4JPGA 3BAWA 1JPIA 4D6CA 1JCYA 3TTOA 2JGYA 3JW7A 2EEXA 2UWFA 3NL3A 3S9IA 2HK0A 4UFJA 1C9DA 5F4SA 3TYBA 1HT6A 1CLKA 1FUYA 2PP3A 2B4GA 1Q3NA 3NFUA 4GBDA 3SCPA 2PF8A 1K03A 1WQ5A 1XLCA 4LC8A 4AD2A 2F8QA 1B5TA 1XH1A 2NWRA 1N55A 1XYBA 3AYRA 3SCWA 1EF3A 2VRJA 1W32A 4H04A 4JTLA 4AD1A 5LIWX 4PB3A 3S2NA 1NDZA 2C1IA 3VDBA 1N8WA 4Z17A 2WQPA 4W7VA 2ZCGA 2P8BA 2WMIB 1QJWA 1XFBA 4S39A 4L1XA 3N18A 4XKMA 3L68A 1MSSA 3BAKA 1JGMA 1SQ7A 2ZDRA 4HPHA 3MUZ1 4UTJA 3ME3A 1H1YA 1RPKA 7REQA 3MSYA 2X40A 1ZP3A 4JTHA 1E3ZA 3S9ZA 3ZR4A 3PULA 4LBUA 3MMUA 4IH3A 1KM5A 1XG4A 3H2MA 4WD0A 1NOUA 3GAKA 1OT2A 3QEZA 3G8EA 4ZMGA 3M0ZA 2ZADA 5F7UA 3W22A 1F73A 4I5UA 3E2VA 1GHRA 4DLFA 4DWSB 5KZEA 4ZO7A 5KTLA 3HQNA 4YPJA 5HJYA 2XGZA 4HSHA 5CSYA 3GS6A 3UR7A 2J25A 4EANA 3UYCA 2AAMA 1RHCA 3AHZA 4B5VA 3WN6A 3PPFA 3LHYA 5IBXC 3EB4A 1MRAA 3IIXA 4LW7A 1WOBA 1QATA 2DUAA 1BRLB 4H6EA 2QEZA 3WQ4A 5HATA 5JMUA 3K30A 2V8ZA 3PNUA 3LLXA 4JHMA 2A5HA 4O17A 4IF2A 1TWDA 1TWSA 3OVRA 4RE3A 2G96A 5H6HA 4XAFA 3I7RA 4IXHA 1OADA 3CLWA 3AC0A 3H53A 4JTTA 4Z1AA 3RLGA 4ASTA 4F0RA 3W88A 3EOUA 4MWAA 4N9DA 4H00A 4ZB5A 1FWBC 4U33A 4LUSA 4YN5A 5BOFA 2V3EA 4B5UA 1W1VA 3PZ9A 1WDWA 3AXKA 1Q65A 1WZKA 2PU1A 1YEYA 2D2GA 1O4UA 1I1XA 2YCJA 5DFAA 4CVUA 2X1SA 3T8QA 2YLAA 1YDNA 1UC4A 2Z27A 3BCDA 3I3DA 4N9EA 1VFTA 9RUBA 2QPUA 4I9TA 2OWCA 4L4MA 5LHFA 2FTPA 3CASA 1TWZA 1UCWA 2QT3A 5MF5A 1KKOA 5C7HA 2NWSA 3CMFA 1PV8A 1S3TC 2WZTA 5I7GA 2V5CA 3TQVA 1TE6A 3NVDA 1A53A 3WQOA 3WJSA 3PPCA 3GDKA 3LU2A 2INFA 3PB0A 4ZZ9A 1TMHA 4OUEA 1XUZA 2YDRA 3FSTA 3P82A 1Y7VA 2C1GA 3N17A 5E09A 3C61A 4O8RA 5MHBA 4I6VA 3RGTA 5CZKA 3T44A 3EEZA 3VIKA 3W83A 3USZA 1I2QA 3AS0A 3KLLA 3NQ6A 4GUFA 4DZ5A 1E0WA 2XWDA 3LCFA 2FKPA 1EC9A 1IEVA 2WCGA 1EOMA 2W62A 1NFBA 5A8MA 1N2VA 4HVXA 3VIOA 4K7VA 1XGZA 4YWIA 2REQB 3OOQA 4B5TA 4YTSA 3QV7A 3HIJA 5J5DA 3NZ1A 1GG1A 5GVJA 4ZA0A 4PEKA 4OJYA 3D3FA 2ADAA 2VENA 4J2PA 2CHRA 1ZTVA 5C54A 1RCOB 3ZLFA 4LNYA 3STFA 5K2ZA 5G1TA 4AIEA 1NOWA 4ENLA 3LCLA 1SMDA 2A1YA 2ZUUA 3C2YA 4B2DD 2J47A 3M0LA 5CGQA 2INZA 3V16A 2QJJA 1EPVA 3VNYA 3UGVA 5JIWA 3RITA 4DYJA 4JTAA 3ZSSA 1ALDA 4ROPA 1Q45A 1YW1A 3G0SA 3GVQA 1I8JA 3EX2A 4XAGA 3APTA 3MV01 4AW7A 1S2TA 3GTHA 4LQ1A 3DAQA 2QR6A 4HCLA 1S2CA 2J6XA 3L2IA 2WMJA 3G1HA 3GYEA 1K8ZA 2D0GA 2C79A 3AS2A 2ZX6A 4AD3A 3T40A 1F6KA 5A8QA 4OBRA 2YA1A 1PAMA 3R0KA 4AWEA 4RUBA 4Y8FA 4GIEA 1GGOA 4OFCA 4JFVA 3C52A 1S5TA 2GVEA 3AYVA 4DQWA 3DG6A 2AL2B 1DXIA 4HZ6A 5BZAA 3O0FA 4FXFA 2QF7A 1ZQ5A 4QLJA 4WXZA 3TXZA 1KV8A 1UWAA 1UOZA 2JE8A 5I23A 1W54A 3MUY1 1NSJA 4MJ4A 3K4DA 1LM1A 3UJFA 4YXGA 3GY1A 1E6PA 4FA3A 1F8IA 2HNEA 1RP8A 1XBYA 2D2HA 5AC7A 1XINA 2J13A 3W1RA 1Y5WA 1MFVA 2WJFA 4LH8A 1V77A 1BEUA 1LBMA 1LROA 1FFQA 5FA5A 3PBWA 2QXWA 2HDJA 1SJBA 4BS0A 4P5UA 2J9ZA 3VMOA 1O7AA 4NASA 1CIUA 2DSKA 2EHHA 4KWWA 1CXIA 5FL0A 2WNZA 2WVVB 3OB8A 3NVTA 3CLMA 3EDJA 3DYMA 3UR8A 3CZLA 4EACA 4C1NA 3BARA 1HL8A 2CLEA 1GQKA 4ZSUA 4A22A 3NOYA 5E70A 3K2GA 3PZOA 2G95A 5CJMA 1A5BA 3E12A 4DWSC 1PZ2A 4AEFA 4C1KA 1N7KA 1WBHA 1RCQA 4DBDA 3S4TA 4H9UA 4KGJA 2YR1A 3T05A 4HT3A 3T0DA 4BK9A 2RJHA 3V0UA 3UD6A 2PP1A 4LANA 3FXGA 4M0XA 2XH0A 5CBJA 1JZ6A 3G1YA 3W1TA 1U83A 4AB4A 3QQ1A 1X38A 5GJMA 4L6OA 1AK5A 3WQDA 2DH2A 1VEMA 1MDLA 3EA1A 5SWUA 4ZOAA 2WMKA 3JUGA 2D2OA 5AOUA 3N2BA 1B4EA 2V5BA 3GG0A 1WXJA 3UWEA 3WLNA 3N9SA 5HWMA 5JUVA 1GKPA 2VCCA 4FEZA 1JPKA 2WJDA 3O05A 1XJBA 3EWUA 5KMYA 3WMLA 3AISA 5LIKX 1T41A 3T4CA 2ZX7A 2BSLA 2E1DA 1GQNA 1RVGA 4JZ5A 3OLEA 1MXSA 1NARA 1AJZA 3ENLA 4PUMA 1UQYA 2R1KA 3TN6A 2VEMA 3RRAA 1H7PA 4IJCA 5EFDA 1OIFA 2ZUTA 2VFDA 4UR9A 1SO3A 1D8CA 3VM7A 4L4LA 3G1VA 4PTXA 3Q2DA 5LA2A 3GDTA 4PMJA 1AH3A 1XKYA 4F48A 5D09A 3HFYA 2P10A 3OZPA 3UZZA 4AEOA 5LGZA 5HR7A 3KDOA 3C2FA 1DWFM 3NQAA 1XPYA 1W37A 5FIPA 4C90A 5LNUA 4LRTA 2E9BA 3EWWA 4QX4A 5HDRA 2GPTA 1J5SA 2DSWA 4KBXA 3KBVA 1B3VA 2D20A 2J62A 2YA0A 3ABZA 2CIPA 3WLOA 1ISXA 1KM4A 2CZDA 4QJ5B 3E96A 3ZLGA 2QMJA 3KOZA 4QE1A 3C2OA 4TX9A 3JR2A 3H2OA 2OKTA 1NWTA 1VFHA 4AUBA 4ZENA 1HIZA 1YTKA 4WX2A 1G4SA 5LXEA 3QKEA 2VX6A 1Y5XA 1V4YA 2V2DA 5TBOA 3RXZA 3WNMA 2XM1A 4PUEA 3PAJA 1CNVA 1JPHA 2QCGA 2POZA 2W79A 3LD5A 3WQFA 4TXEA 4JTGA 1AZ1A 1XF0A 1ISVA 3UWWA 2R94A 2DZTA 2CNCA 3JS3A 5AC6A 4JTFA 2RKXA 3M6YA 2F2HA 3NQFA 3AJXA 2VX5A 1DL3A 1O12A 4NYUA 2FFCA 4S3GA 3AWNA 1V0KA 1FVPA 4RE2A 2V5JA 1FRBA 3OZYA 3TIMA 4AZCB 4H9VA 2NZLA 1UZ4A 3TOPA 2ATSA 3GR7A 3WQ5A 1IF2A 5EMUA 2ALRA 3AO0A 4UTWC 3BANA 2PWVA 3MHFA 3CMGA 3PC0A 2MNRA 3WNPA 4PSPA 3LGGA 2CZFA 3IIVA 5AC8A 4MKNA 4GI4A 3RF9A 5FJUA 7ENLA 3QTPA 4QE4A 1ME9A 3G22A 3OIHA 4JKKA 4NNCA 4WUIA 3DFSA 3NSXA 1BKHA 3NXLA 4M19A 1E1CA 4IJRA 3F2CA 1K8YA 3W01A 4G5DA 3SCOA 4A3QA 4IIFA 3WEMA 3AYSA 5E6YA 3LK6A 1XGDA 3WF1A 3PF3A 4RNIA 4GA8A 4S3JA 4PUJA 4ROQA 1KGWA 4HNTA 2G8ZA 2VZVA 1WB0A 1OX4B 5D03A 1HL9A 3TSMA 1TPH1 2FJKA 3CB3A 1GYMA 4UFKA 2XFYA 4ML9A 3MYOA 4IL2A 2DEPA 3WD4A 2YZ5A 1TZ9A 3GHUA 1L2UA 5AHIA 3VKJA 2CLLA 4ALDA 1JFHA 1F7BA 3HM7A 3SSZA 5A6BD 4AIOA 2GJXB 3IGSA 1LP6A 3VFCA 3WSUA 5D9OA 4QJ4B 3R11A 4FX7A 1UD3A 2GUBA 4H8UA 4CCDA 4JYDA 4MDPA 4ICCX 2Y7EA 1R85A 4TIMA 4V27A 3RU8X 2Y85A 3R2GA 5TNVA 4MYXA 1S1RA 4XX6A 3RK8A 4Y90A 5JH2A 1EF2A 3OHIA 1MVYA 1J2BA 4YJ5A 5CBIA 3AIUA 3ARXA 3A5VA 2MUCA 4IGSA 1T6MA 1HJWA 3VIIA 3T07A 1JZ3A 5I77A 4UR7A 1IEWA 1JFXA 1Q2SA 1OCBA 2CCRA 4GJJA 4FX6M 3OVQA 2ZUNA 4ZL1A 3E5BA 1EBGA 2E6FA 3V36A 4JQ3A 3S0CA 4NNBA 3KDNA 4BQ5A 1J96A 3O16A 4CU8A 4CQCA 1CI1A 1ZPTA 1GONA 2V5DA 5J04A 5AB3A 4WDWA 3QY7A 2PGWA 2XM2A 1Q13A 2ZA3A 3KRUA 4FLSA 3UXIA 3AWOA 1QU4A 2YFNA 2AL1A 4E2DA 3TA9A 3UEQA 3AIBA 1JCTA 1Q5MA 1ZJBA 1MXDA 2YIHA 3ARVA 1JQVA 2OZ0A 4MZ1A 3EDKA 1R87A 3AXMA 5MKGA 1PIFA 3AU2A 3WBAA 3PY2A 3VE7A 1P0DA 2CETA 1KCLA 4IMDA 1EL3A 4QROA 1R5YA 1UJQA 3RRXA 1S5VA 2DT2A 2BWGA 1HO1A 4M81A 3WELA 4QBXA 1L6FA 1V0NA 4LAZA 1H7WA 3A21A 4D8ZA 4GFIA 3VXGA 2WMGA 2QLYA 3F5JA 3SO7A 4P7OA 3U9IA 3AFBA 3J7HA 3PJWA 4NY2A 2PDQA 4DF2A 3HPSA 3PVFA 2ZZ3A 1UR8A 2DFAA 4EE9A 4DBUA 1UUQA 4FALA 6TIMA 4A2SA 3BLEA 3EMQA 3RCMA 1YRRA 1C8QA 3BSHA 4HZ7A 1I60A 3G6MA 2B7QA 3D3AA 3ITYA 2PI6A 3M0JA 4I7WA 4NXKA 2X42A 3A9BA 1YE6A 3EWCA 2PB1A 2FHFA 2FDSA 2RGMA 4KEMA 1VQTA 1JG9A 4M6VA 3CH0A 4WJXA 1DJZA 3W7JA 1RPXA 3O07A 3ORWA 4KPLA 5DCBA 3RCYA 3B8UA 2ZDSA 1OM0A 3AZSA 3RAOA 1FWSA 2VQTA 3RHGA 4E4UA 1ZZMA 2GSEA 2ZX9A 3KOYA 3H23A 3NSMA 3C3NA 4JN8A 4PMZA 5CJNA 1SFSA 3G1XA 4MB3A 4B90A 3FJLA 3U2CA 4H9TA 3G3DA 1SUXA 1PTDA 2WW5A 3KS6A 1TB3A 4V28A 3KBNA 4U4MA 1XUUA 1BG9A 2VD8A 5DCDA 4HOWA 1VFMA 1KM0A 3PN8A 1P0BA 4U5IA 4PTNA 1QHZA 3BLOA 3TFCA 1OG0A 1W3LA 2VEGA 4H9ZA 2V81A 3R4IA 1UUMA 2I7GA 3GTIA 3ZM8A 1JZ7A 2WK2A 4R88A 3W28A 2PDPA 4ZB2A 1NWRA 1YYAA 2YXGA 2EKGA 3V5FA 3N2XA 1M04A 1Q4WA 1OINA 3H2EA 1W91A 1BGAA 2TODA 5E0KA 3VU2A 3EBVA 4FXJA 2G4FA 5K9DA 1YNQA 3WH8A 3POCA 3CL8A 1FWDC 2P76A 2WO5A 4GUJA 3CK5A 3G0UA 3PUDA 1DOSA 4LEQA 4U2ZA 2QUMA 1V8EA 3PSWA 4HN4A 5FJJA 1ML1A 4GRSA 1V0MA 4F8XA 2EAWA 2IKHA 3CZGA 2FDMA 3DFHA 4ZR8A 3BW2A 4LVAA 1FA2A 4GKLA 4ZO9A 3TC3A 2A3EA 1CXKA 4WZHA 2QJIA 4JQ1A 2BLEA 4G7EB 4DB7A 4KWOA 1LLOA 2D24A 4UR8A 5BXSA 2V63A 2HE8A 2NVDA 1KV5A 1TIWA 1EJ7L 3WQPA 4B9ZA 4MY1A 4K7YA 5AZ1A 1R2RA 4HA3A 4ZEPA 1E4NA 3ABRA 1OQFA 1T5AA 2BMBA 1AD4A 3NNTA 5IM51 1WA3A 2Z6IA 1BQGA 3WLQA 4X2RA 2D22A 5ABTA 3OTRA 4YTUA 2CKRA 3LCXA 2XN1A 3WG6A 5C9UA 2QYGA 3P61A 2GVJA 2NUYA 1OYAA 2V30A 3LI0A 1PS9A 4KS0A 4CU6A 3ONBA 1KCKA 4I8DA 3L66A 3OLGA 4UNKA 3RYSA 4A8RA 4HD5A 1YXCA 1XIGA 3UBPC 1PIGA 4Q8QA 3MZ2A 3GAYA 2XZ7A 1G5AA 4P8UA 4FNPA 1DBTA 1YKWA 1QPOA 4B5WA 4AH7A 4GI9A 2XIQA 3N19B 5E6ZA 3WDJA 2J27A 4AZHA 2PS2A 3BL3A 1M7JA 1HUVA 1R9YA 2OXNA 4FR6A 4JTDA 3PWAA 1LDCA 1KXTA 1F6YA 5KEZA 5CLWA 5I09A 2G3IA 3KRZA 1TJRA 1TYGA 1WBJA 4MGGA 3ZR6A 2D0HA 3N4FA 1VLIA 4QISA 2FZMA 3W00A 3OPSA 4Q6XA 2YXOA 3TE9A 4LS0A 4Y6GA 3POHA 4WRHA 3PFRA 1HKWA 5C2CA 1E51A 9CGTA 2D1ZA 1R0MA 2YX0A 2I14A 4NAEB 1TZZA 4LYQA 4TVUA 3IJQA 2G4JA 1TV3A 1UPMB 3PZIA 3LXAA 4RDVA 3W3OA 3ZWSA 4H9YA 4O1CA 3O6CA 3WF0A 1X98A 3CV1A 4LAOA 4GX8A 3SUVA 4O1FA 4X0VA 4B92A 3PR2A 2WVSA 2YGYA 3W7GA 2P3EA 1J6OA 3WF4A 3L65A 5HBFA 2QAPA 4YCOA 1L6GA 3UZJA 3I4KA 2VFIA 2G5WA 3TYDA 4QTGA 2Y62A 2QUNA 1EQPA 4P7NA 4J3TA 1W3IA 4CN4A 3NAVA 2IS7A 3NQCA 4NZFA 1ONWA 3NPUA 2F6KA 3I6RA 2VWSA 1HFBA 2EBNA 1OFQA 4IOTA 4CQAA 4LJ3A 2EO7A 1EDTA 5ABGA 2VO5A 1W2PA 2CWXA 2RH9A 1IYXA 1GZJA 1AJ2A 1RLCL 3CQHA 1ONRA 2I5IA 1ZCCA 1E43A 3WDIA 3UESA 3FKRA 1UR0A 4FF7A 4NF7A 4DEFA 2XVLA 1OC5A 3VCCA 3RM8A 3ARTA 1ENUA 3GNNA 4IIGA 1BHGA 2QJNA 1RBAA 4RNJA 1HGWA 1E6ZA 5BNKA 4V15A 3DIPA 3B04A 4G9PA 3GXNA 5GNYA 2YL6A 1S39A 1KFLA 2ON3A 3F4CA 3N29A 4XZBA 2I16A 4V1XA 2PDKA 4GPNA 4F0MA 4P7QA 4INFA 1ZBVA 4ORIA 4RW5A 1XLHA 4QDPA 1TIMA 3OG3A 4PFMA 1K9FA 3LCWA 2VFGA 3VNJA 3PB2A 2D2JA 1CXEA 3GNRA 3P74A 3MPGA 1EFZA 1M1BA 5A6SA 1Q85A 3K1DA 3NZQA 3OA3A 3TZFA 3BAYA 3BH4A 4LY4A 3N4EA 1GOOA 1FWHC 3LEPA 3W26A 2D69A 2ZUVA 1IGSA 3T7VA 5D2WA 3IANA 4C7FA 3LHUA 4I9AA 1LF1A 3KTCA 1CGVA 2GVLA 2BASA 1PKYA 5FEXA 5JQ9A 1VFSA 4XAPA 3A9IA 1K9EA 1YPFA 1OWQA 2R1LA 2GDUA 4DUXA 2HROA 4LRSA 2ZXQA 2V3FA 1VENA 3OODA 2H9AB 3W2MA 1UR9A 3ZJ6A 1K8CA 3O6YX 5D4YA 1PO9A 2I9EA 3APYA 3KBWA 4LUTB 4JIQA 2WM0A 1CYGA 1XBXA 3UJSA 4LVBA 1QOPA 1KBIA 5A69A 1DQWA 3THDA 3W02A 3E3HA 1POKA 2Y8KA 3SM0A 4UQDA 2GVGA 3CWOX 4PBGA 4D8AA 3IJ7A 1Q6EA 4MG4A 2OSXA 3IVSA 1UHVA 1BKSA 2VC6A 4A8NA 1VCFA 2GK1A 4XUGA 1F4AA 2PC8A 1K9DA 3NZPA 3MUCA 4WDTA 1QFEA 3OIXA 2DZUA 2YOCA 1TJ1A 3FA5A 5KITA 2FZNA 2AQVA 4WY0F 2GUYA 3RDKA 1YNYA 1IWAA 3EMCA 2BGSA 3DBNA 1GYNA 4XZHA 3WYZA 5FKYA 4GH1A 2EXOA 4DYEA 4D8LA 4DYKA 3M5YA 2IPJA 3KL5A 2Y24A 9XIMA 1Q6OA 1AMKA 1KBLA 4BEQA 1F9CA 4B16A 1OFPA 3WQ6A 2Z1WA 4UCGA 3N12A 4RE4A 2Z2UA 4DM1A 1IR2A 4LUYA 1WZMA 2XN2A 3FYPA 5CEWA 3W4RA 3QF0A 2BVDA 5K7JA 1PYFA 3NO5A 3S8HA 2BVWA 5H8MA 4O1EA 3E0IA 1JCXA 2VRQA 1RQHA 3SDOA 1EB3A 1VJZA 4S3DA 3AUJA 3V4BA 2PDGA 4QQUA 1EJVC 3CUXA 1Z48A 1QXLA 3QQWA 5CG7A 3GO2A 5CQ1A 1F4HA 3L5MA 3UZXA 4KCVA 4MJMA 4W86A 1HQTA 1MUMA 1C7TA 2AOSA 2YYTA 1PVNA 4KCWA 3VZXA 2D3LA 8XIAA 2Z26A 1YNPA 4HQVA 4RDYA 2PMQA 4IQLA 4GQRA 1FDJA 3W9ZA 1IEIA 1M6JA 4DI8A 2H6RA 3S1XA 1VZWA 4KFOA 2X41A 3MUXA 4NT0A 3LUTA 4IPNB 4PMVA 4FOKA 1VF8A 1FX6A 1XD0A 2Y7FA 3TYAA 1OGGA 3U57A 3GIQA 4EK7A 3KP0A 1X6LA 2QDHA 4DJFA 3MCMA 2W3ZA 2PZNA 5FF4A 3UPBA 1QPKA 1W5NA 3DFYA 1MMFA 1KFKA 4DPPA 3ES8A 3WLRA 1WDSA 2ISFA 4HJFA 2R8WA 2BXYA 2AGTA 1W5OA 3UJRA 5FACA 2WVUA 1H4PA 1FHVA 4MMWA 1BGGA 3JVAA 3FCPA 2J77A 4MWAD 1E0XA 3G2GA 4IX2A 3W7IA 4FI4A 3GU1A 1HVQA 3PHAA 2R1MA 4R7WA 3U4FA 2VRKA 2FB3A 4UNIA 2QCNA 2XH7A 3DFPA 3GG8A 4M80A 2NQ9A 3WJZA 3KZSA 1QK2A 2ZZ1A 3QOMA 1AQFA 2CITA 2CEQA 4A3YA 3W2UA 1D8WA 3UERA 2E40A 3BG5A 3G5EA 1XYZA 4H7ZA 1XLMA 4KW2A 4KRUA 2PDFA 1D7FA 3QYQA 4JN7A 1FH9A 2FZBA 3FHAA 3IV8A 1I2NA 1GTEA 3SRHA 2Q71A 4UQCA 1TUXA 1LL6A 3PUGA 3F1QA 2OLSA 1PXGA 5KZDA 3OGRA 4O1BA 5BWFA 3KAOA 1DJGA 7CGTA 3W74A 3NPXA 1QNQA 3VKDA 3AMLA 2CLIA 2LLEA 3VGBA 3T2OA 3B8IA 4KETA 1SJDA 1ITCA 4IFKA 2QIIA 4MDOA 1I4NA 2VCBA 4K8HA 3KLKA 1ME8A 3E02A 1Q6RA 4TMBA 4S3FA 3ZVHB 3KL0A 1K1DA 1KFJA 1E4MM 1EEXA 3OVPA 4YVVA 3TMLA 4KERA 3TH6A 1GVQA 3IV3A 2YBUA 3TTSA 4E4PA 5AYXA 1E9YB 1UD4A 3KVKA 3E2RA 1R3YA 2UY5A 4IQEA 1X8CA 4KCTA 3QLDA 4FMVA 3VK5A 2QCFA 2CLKA 4L65A 2A6LA 3U3HA 1UD8A 3UR2A 4IUOA 2R14A 4G6CA 1U22A 1P6CA 4ZQMA 3KWXA 4ERIA 3SIMA 1TRIA 3WDHA 4DJEA 4C6MA 3IRDA 1J5TA 1P1XA 1QBBA 2VTFA 5LNVA 1JR1A 2ZX5A 5D9PA 3EGJA 4DWSA 1K9TA 4G2DA 4KEZA 3NQBA 3REQB 3F7JA 1Z9AA 1YXDA 2VFFA 3P5ZA 7PTDA 1XD1A 4UTTA 4MAVA 1DXFA 1FWEC 2BFGA 4YHGA 1BD0A 2ZRVA 2ZZ6A 1FH8A 4WCJA 1L8NA 4WR3A 4AHQA 4MUPA 5IDIA 3GUWA 1NWSA 3QSTA 1E1EA 4HMNA 3KVMA 3BG9A 1M7PA 3LTYA 5CC6A 3B9EA 4LSBA 1MEWA 3P8IA 4FNTA 4B9YA 3ARZA 1TR9A 1V3KA 2VGFA 1BPLB 2GQ3A 1US0A 4JQ4A 4O0QA 4MAZA 5K3VA 1JCMP 2QPSA 1XXXA 3QHNA 3K8KA 1C8YA 2WHJA 2FH6A 5TD4A 4N9CA 1KTCA 4N02A 2X0SA 3UT0A 5CPMA 1TQJA 1M9HA 1LL7A 2EGZA 5G4WA 3TC7A 3ZJKA 2OMAA 2VX7A 1YADA 1TREA 3DGBA 3BMVA 3TK7A 4AX7A 1TV8A 2V6AA 1PHQA 3CEPA 3E6EA 4JL1A 3G77A 4DZIA 4K68A 4JL2A 3EOOA 2ACQA 4OWGA 3S9YA 3IIPA 2QDGA 3S6TA 1JAKA 3RCNA 1Y8BA 4W93A 4Z2JA 3B8DA 3EXTA 1VFUA 3CBWA 2QCCA 3U0HA 1QO5A 3QH2A 2H3BA 1AH4A 4PTDA 1H61A 1VBRA 3ZLHA 2VKZG 5I03A 3RM4A 1ONXA 3GHSA 2PWFA 3MSRA 1OFDA 5C6MA 1R46A 1E6XM 2PDLA 2AAAA 4IJBA 4GVGA 2DSVA 3ITTA 1A5CA 3BSGA 1IXNA 2XG9A 2WKLA 1SJAA 3I7QA 4ACZB 2IUZA 1E6SM 3T55A 1HL2A 1DHKA 4R9OA 4E6MA 4J1OA 1A5SA 2REQA 2WSQA 3IJDA 3SUTA 3QGKC 4LOCA 1PE1A 4JFWA 1AH0A 3B0YA 3W81A 3LHTA 2FZ9A 1C9WA 3B4UA 5FJRA 3SY8A 1RK6A 4GYPC 1UMYA 1H1ZA 4ZB0A 4JXCA 1PL9A 5E93A 3NQMA 1OCNA 1MWOA 3GD6A 4GC4A 3UG8A 4JNMA 5I78A 2CHOA 3MWAA 4IQJA 1JRBA 5I06A 4UTLA 1XH2A 3MKKA 3DH7A 1UR2A 4XD4A 1AL8A 3SZ8A 2Z25A 3VIFA 1FHDA 1M03A 2QNEA 4GOAA 3ECQA 4UTWA 2OWXA 2ZUWA 2FGZA 5LIYX 4NJIA 3WDQA 2BGNE 4FLOA 2CLOA 2G3MA 5LXXA 3PANA 5I0DA 4J5NA 5C55A 1XLFA 3C3UA 1BF6A 3CIXA 1SFTA 1X1NA 3TW7A 3LRLA 4C7DA 3MO4A 2OKOA 1FWGC 3BOFA 3RPTA 3KRBA 2EPNA 1IZKA 2QQ6A 2QGHA 3LPPA 1GQLA 4LXFA 1VIZA 4ACYA 1V3IA 4W4QA 3WLTA 1GJWA 2AL2A 5M2FX 4CKQA 5ECUA 5DY3A 1TPWA 6A3HA 1FCUA 2Y7GA 1V0LA 3VABA 3LI1A 1CGXA 2B0MA 2FVMA 1QRQA 4BEUA 5JU6A 2QAFA 1FY6A 2PWHA 1ONEA 1NP2A 1P7TB 5ABFB 1G0CA 3UCQA 1BTCA 3M6DA 1DIKA 1ICPA 4I3GA 1GVFA 2XIOA 2BP1A 3SCSA 2WC3A 1H5VA 3W6MA 1O6IA 5GJPA 1KQZA 3L0KA 1UD6A 1BFNA 1ECEA 4GCXA 3AU6A 5BU6A 3M0VA 3QZEA 3PZMA 3LZ3A 3LCGA 3UU0A 4DAFA 4OBSA 2VZOA 3CH9A 3NYZA 4O4VA 1KC7A 3O06A 4MY9A 3VILA 1XIBA 5EYWA 1TUFA 1WDDA 2XINA 1W1YA 4IP7A 4WDUA 5G4EA 2P88A 3TQKA 1GVSA 4DWDA 3GC5A 3LENA 3NIYA 2CLHA 2DQWA 2WNQA 1LLZA 2WVVA 1LQAA 3CZJA 4GZJA 1EP2A 3T0AA 5BW6A 1T8XA 3VDAA 4TTGA 2OSYA 2X1UA 2EQDA 2B7PA 2NV2A 4KIEA 2C6QA 2VWTA 3AHXA 4LV4A 4QM1A 1UWTA 4B5XA 4AZBA 1YHTA 3GKAA 4LBSA 3UXLA 2YDSA 1AW1A 4L6HA 3M4HA 4RDWA 1OYCA 3EWXA 2VC5A 3TR2A 5AC5A 1Z6KA 2J79A 3M5VA 1VP5A 3BK0A 3H4WA 4KFNA 5EA9A 1QASA 3EDFA 3H54A 2XU2A 1KR1A 4H1ZA 3B9AA 1H7RA 1JDAA 4NIRA 3ZZ1A 3P6LA 1J0HA 4M51A 5CKSA 3W29A 7XIMA 3CC1A 2RAGA 3HQPA 3FSUA 5TAOA 3LSBA 3EPOA 4MNJA 3S46A 1F3WA 1BF2A 1C3FA 1RA0A 4C6CA 4R53A 2KAUC 5ECVA 1XLIA 5DLCA 2F7FA 3LMZA 1IIGA 1Z8AA 3VGHA 1VKFA 3AMKA 1R3WA 3FJ6A 4DF1A 1GOQA 1P6WA 8TIMA 4JX4A 3BV4A 4JBRA 3GU9A 3M5ZA 3Q67A 1B54A 1XH0A 3W7RA 1JL8A 3GM8A 1RSCA 1KFWA 4DUWA 1OJXA 1BWLA 1WDPA 2HTMA 2R1NA 4Q32A 1G6CA 3PWIA 2VOMA 4NZJA 2Y61A 1QUMA 4RV3A 1QI0A 5GNZA 3M16A 4YVPA 4K39A 5A95A 1QI2A 5BROA 1K8XA 3AIEA 3V5OA 2I57A 3RPMA 3MCNA 3LXBA 4HYVA 1A3XA 4ECLA 3UZYA 4LWWA 1CTNA 5M1TA 3THCA 5CG0A 3CWNA 1V6XA 4PUWA 5DT7A 4KCUA 1C8VA 1DWAM 3SGZA 3WEZA 2E8YA 4FF5A 3STCA 1VPQA 5D9MA 4HA1A 3T42A 4IM4A 2VXNA 2CBUA 3ES7A 4POCA 2BX7A 1JJKA 1BSLA 3GNDA 3OGSA 3MMDA 4HOXA 4E3VA 1XPGA 2GL5A 3VDCA 2Q01A 3WMBA 1A80A 3IUDA 5HJXA 4H7CA 4LV9A 2QJGA 2EJAA 2JIWA 4CQ9A 1W5QA 2OR2A 4W8AA 3M9YA 1XSIA 4L6DA 3I4EA 2OTDA 4IMEA 4Q8NA 1CCWB 2Q3OA 5G2IA 5ABEA 3C2VA 1WAUA 4M7SA 2G97A 1P0KA 5BRQA 3HG3A 4RXGA 4D6EA 5RUBA 4FNRA 5HPOA 3WUBA 3TV8A 1MQRA 3U2ZA 3C0JA 4YIWA 4DY1A 4Z08A 2VC9A 2YCIX 3S5ZA 5CCZA 1VYSX 3TLQA 4K1WA 3R1ZA 4GC3A 3TTQA 4OT7A 3WH7A 4IGMA 1HVXA 2HVNA 3PZVA 4J2MA 2OFJA 3QVQA 1FKWA 3PJTA 4AIBA 5D2VA 2BXVA 4NP7A 4O16A 3BLFA 3GK0A 3UCDA 4UQBA 4WIWA 4LUSB 3UJEA 4GJIA 4Q7NA 3GKFA 1AZ2A 4GMEA 4CCZA 5T9BG 5AYYA 1KFCA 3LPFA 1RBLA 3M0XA 4AVOA 3LTSA 3DX5A 5LNSA 3AXHA 2V5LA 4IL0A 2GZXA 3L4UA 4PTMA 4O13A 2DZPA 2PRLA 1SZNA 2D0FA 4UNLA 1QI3A 4GISA 4JICA 5DCEA 3K8MA 4KFPA 1PZ0A 1UIOA 5E0FA 3SRKA 2BS9A 1R3TA 4GGHA