4O4WA

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-gly mutant (tvag_497370)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFGFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o4wA00
2I9EA 4NXKA 3ZFHA 1TPEA 5D2VA 1GJPA 2X1TA 1X6UA 3GDTA 3ELFA 2YSWA 3BVJA 1F73A 3G18A 2W0UA 1K7EA 3TU9A 4MFEA 1WXJA 1JCMP 2J9XA 5D05A 4AF0B 1W31A 3KVKA 2A7RA 1KFCA 3RLUA 3W22A 1HL2A 4UUIA 3DFNA 1W5MA 1NF0A 4WOQA 3G1DA 3QW4B 2JGYA 2RDUA 3ZWTA 4RJEA 2X1UA 1GOXA 2ZTJA 2YX0A 1YPFA 4K38A 4UFJA 1XXXA 1SW3A 3TJXA 3W7PA 4EWND 3N73A 4JYEA 3L9CA 5CZSA 1FXQA 4GNJA 4R7JA 5D2YA 4UFHA 2A1YA 4NUWA 3NQDA 4BI5A 4O50A 4QM1A 1XC4A 1H7NA 3MP5A 4RCXA 1L2UA 3TXVA 3W87A 3QQ1A 4PODA 4C1KA 2I1OA 3NVTA 1JCNA 1TIMA 3U2OA 3OVQA 2A6LA 5AN7A 3W76A 1O60A 3O6CA 5J5RA 4LVFA 4GBUA 2YDAA 3EB2A 2H6RA 1TJPA 3THAA 3W7LA 2DU2A 4HSNA 4A29A 1KLYA 5D2XA 4NNBA 1FWSA 5EYWA 3NQCA 1M7OA 4UTWA 3NDOA 2ZA3A 3W1TA 2OJPA 3W2LA 2WQPA 4AHPA 4Y9AA 1GVSA 3PC0A 4NT0A 1WOBA 3LRLA 4XUGA 2XFWA 5AHNA 4EF8A 3S5ZA 3W3OA 5KZDA 1TPUA 3EXRA 2E68A 4DF1A 4Z0SA 4FIRA 3UQNA 3LXAA 1LLZA 4UTUA 1VHNA 3BG3A 4P2VA 2B0MA 5KINA 2QR6A 2RDWA 4M7SA 3VCRA 1G7UA 4JDBA 3TSMA 3T7VA 4TIMA 3W7JA 3MI3A 1SU5A 1RPXA 3W1AA 3C61A 3LBMA 4MJZA 2Y62A 1TSIA 1VGAA 4WY0A 2RH9A 4OE7A 3FJ6A 1Q6RA 1GVFA 3QFEA 1B57A 1RR2A 1ZY9A 2A21A 1EIXA 1FCVA 4WQ6A 4M6PA 1GG0A 3LLDA 3P7YA 3E0IA 5C54A 3PUOA 2FJKA 4UMCA 4JIQA 4MYAA 3DZ1A 5CGQA 2UV8G 5BNKA 1OFAA 1SUXA 2DJXA 4QAIA 2VKZG 3R89A 1J2WA 5FEWA 5HNRA 4MJMA 1AW2A 3MBDA 4UC5A 1S5VA 5CPOA 5F4XA 1UUOA 2Y7DA 4XBSA 3W84A 5BMWA 4HT3A 4AEOA 2YXGA 4AMAA 3M44A 4MY1A 4TMBA 1QAPA 4MZ8A 4KKXA 4O8RA 4TX9A 4ML9A 1AW5A 1OFBA 4O0ZA 3W7RA 3FLUA 1TB3A 5I3KA 2QKFA 4N02A 2QUUA 2PCQA 1DHPA 2JKAA 4UNLA 3I7RA 2DP3A 3NOEA 4WOZA 3S5YA 1I8JA 2Y70A 3S6DA 5D04C 3IGSA 1JQVA 2NXIA 3DFPA 3HGSA 3WJYA 5AYYA 1KFBA 3NPVA 4HHPA 3KAOA 1UASA 4NX0A 4UTTC 4LRSA 3UD6A 1I2QA 3DHFA 4FX6M 2V2HA 4XWUA 3NNTA 5K2ZA 3S5OA 3RMJA 4MY8A 2IQTA 3HO8A 4ZQNA 2Y63A 3NEVA 3QYQA 2AGKA 3ABQA 3EWUA 3PSWA 4Z1AA 4HNNA 2ATMA 3DHDA 1EPXA 1FDYA 2VEIA 3BLEA 1RQEA 3NM1A 3BK0A 1VZWA 2ISVA 3G0XA 3GAYA 5IBXC 2WKJA 1UCWA 2YR1A 1LTDA 3W9ZA 3UNDA 4AWUA 1S5TA 4LVAA 3QF0A 3LHYA 5K4ZA 2ZRYA 1IGSA 3PUEA 2EF9A 1MEWA 3TKFA 1TPH1 3WK0A 4YLWA 3BV4A 1PHQA 3TJLA 3TIMA 3W1LA 2B4GA 4Q32A 4FNRA 4UTHA 3USBA 2ZRZA 1QPNA 1XDLA 2ZZ1A 4RXGA 5D38A 1F2JA 4UTMA 3HJZA 1W56A 2ZA1A 1LYXA 1WDWA 3TMQA 1RD5A 5EL1A 3I7QA 3W7MA 5D03A 1SW7A 2Z6IA 3KVJA 4XKYB 2ZTKA 5FF4A 4ORMA 1U5JA 4OWGA 1KTBA 1MEIA 5DY3A 1BKSA 3P82A 3R8RA 5KZEA 4O28A 2ZDRA 3M5ZA 4O52A 3CEPA 2YPIA 4A2SA 1VR6A 5KZMA 1H7RA 1KM0A 4QITA 1OFDA 1K8YA 5DLCA 2J9YA 5EKYA 1Q3NA 1O95A 3BO9A 3MP4A 4PTNA 2OX1A 1H60A 3A21A 2DZSA 3N9SA 5H2ZA 5FF0A 1OJXA 1KM4A 4WJEA 3L5AA 5E0KA 4JTLA 2P0OA 2NUYA 3CLMA 3M1ZA 3M5YA 1DJNA 4JNMA 5A8GA 1DOSA 3GNNA 5LNUA 5U7SA 2E5DA 3EKLA 2A6NA 3DFQA 1CW2A 3NZRA 1Q6LA 5F4WA 1TV8A 2B7OA 3NQFA 3VNDA 4S2BA 3W70A 1H7PA 2ZRWA 3AO0A 3NG3A 3C3NA 3M41A 1TYGA 1YDOA 3TK7A 3OVRA 4DF2A 3TV8A 5LGZA 4XBKA 1KV5A 1UJPA 1TV5A 3EEGA 4JTHA 4DO4A 4CQ8A 3FYPA 3GLCA 3W74A 1IF2A 3TA6A 3CIXA 3GXPA 4RZ4A 3QW3A 1TPVA 3G22A 3EWXA 5CZ0A 2VFGA 3ZR4A 2PE4A 3Q37A 3GVGA 2PRMA 4YMZA 2A5HA 3W07A 1W54A 3N19B 4JX5A 3TQKA 1PE1A 3CTLA 5AHFA 4Z1CA 2FPYA 4DXVA 5K7JA 2C15A 3O15A 2JBMA 3NQGA 1W8SA 3NGJA 4BF9A 1FXPA 4DBEA 4UTLA 4MFDA 4UTIA 4UFKA 1XI3A 3LCFA 4NQ1A 3UWWA 1FQ0A 3SGZA 3STGA 1Q6OA 5DELA 4WXZA 4M5PA 4PL1A 4GWEA 4CLMA 3ABSA 4K7YA 1VCFA 4R34A 1FDZA 2D73A 2O7QA 2E6FA 1YXCA 3HG2A 5DY2A 1XUUA 2LLEA 1HG3A 1RQBA 3TROA 2QCHA 3G1FA 4EF9A 3KRZA 5C55A 4OQVA 1F74A 3MYOA 3Q94A 3HGRA 3IIVA 5I3JA 3G1SA 4R33A 5HR6A 2B7QA 2V2DA 4FHAA 2BXVA 4N9DA 2A2IA 1F6KA 2J24A 3TFXA 4UFIA 2R91A 1ZNNA 5FF2A 1OYAA 4JTKA 1DJQA 5AYXA 1D3GA 4WD0A 2JKEA 1DVJA 5CZJA 2CLKA 1AW1A 2CZ5A 3BARA 5E93A 4FX8A 1R47A 3BW3A 3UY8A 1I4NA 1KFJA 3STCA 3B0PA 3LCIA 4DQWA 4HKPA 1RQHA 1VYSX 2RHGA 3THQA 1DQXA 4X3ZA 2A85A 1BTMA 4AXKA 2NX1A 2Z0IA 1S5WA 1LZOA 1L9WA 2FB3A 5CKSA 2VXNA 4UFLA 4MLJA 3NQ7A 3FIGA 2WNZA 3DENA 1FCBA 3DI0A 3UXAA 4K36A 5FEZA 2CWNA 3MP3A 2ZCGA 1KFLA 3BG5A 2NX9A 1GPWA 4D2JA 3WJSA 4Y90A 2Y89A 3GDMA 2VEKA 3LHUA 3F03K 3D0CA 3NQ6A 3TQVA 4BR1A 2H3BA 5K3VA 2QDGA 3UWYA 1Q6QA 1K8ZA 4BK9A 4NJKA 2NLIA 1QO2A 1X1ZA 5FESA 3DFOA 3GYEA 3UWVA 3LHVA 1T8XA 1O5KA 5AC8A 5HWMA 1FWWA 3LM7A 1NFBA 4O17A 1XL9A 1K02A 3B04A 4RLIA 2DJLA 1SO4A 4HPJA 1BWKA 5KITA 2ZRUA 3JRKA 3ATYA 2F7FA 1TV7A 3BPWA 4DPQA 1H1YA 1TTIA 2V8ZA 5HQEA 4B5NA 4ONVA 5TIMA 5TQLA 3IV3A 3M6YA 4Q33A 5D32A 3SECA 3S42A 3A9IA 4JS3A 5A5WA 2DZTA 3BW4A 1JCYA 1WOAA 1IXPA 4IQLA 5MHBA 4ALDA 3P67A 1OYCA 4FXRA 2V9DA 3HMJG 4O4WA 1I2PA 4OHQA 1GT8A 4AHOA 1AK5A 1VLIA 4LRTA 1GVRA 4N6EA 3TE9A 5DCEA 1VJIA 2X1RA 1WYIA 4OV9A 2FPVA 3LV5A 3S1XA 5F2IA 5HJLA 3IIZA 2QEZA 1Z48A 3FKRA 1M6JA 3NYZA 3TAKA 4H6KA 3M9YA 1XCFA 1JUEA 5AC6A 5BOOA 3JS3A 2W6RA 3O63A 1XKYA 2Q3RA 3BLFA 1VYRA 1XBYA 3SI9A 3DAQA 5LGXA 4AWTA 5HWJA 1XUZA 3IVUA 1RVGA 4WXYA 3LERA 2CLIA 2ZRVA 3NAVA 1ZHAA 5F1VA 3UZ5A 5G4WA 3K30A 2H8ZA 4IMDA 1FWTA 5I3IA 3P84A 1OFPA 5EPDA 3L0NA 1QPQA 1YPIA 4JDYA 3NQ2A 3UYCA 1I2RA 3W1MA 1PCKA 8TIMA 1VHCA 4JX6A 3IVTA 2FIQA 4ADSA 3SSJA 1V5XA 3LHZA 1TTJA 4PCFA 4BWLA 4L4MA 3IGXA 3IRDA 4DO6A 4Z1DA 2QCGA 2W79A 2WNQA 4U4MA 1JUKA 2PRLA 1XBZA 1X8FA 4O13A 2V82A 4P61A 4LT9A 1YTEA 3IGUA 3ZWSA 3LHTA 3O06A 4IOTA 3S1WA 3G1VA 2KZHA 2FLIA 2QCFA 3OA3A 3C0JA 1GYLA 3C52A 4AH7A 1B9BA 1L6YA 4GRSA 3W7NA 3SW6A 1XBVA 3QQ0A 2NXHA 1XFBA 5FEPA 3W7GA 2Y85A 1LOQA 2E09A 3HG4A 1A53A 2X16A 3S5NA 3B4UA 4NZFA 3UPBA 3QJAA 2ISWA 4NXSA 4HIBA 3OEXA 4O1BA 5LKYA 3EWYA 3LGEA 4Y8FA 4UTWC 5G4EA 2O7SA 2HSAA 1QO5A 3PBUA 4XTIA 4UR8A 3INPA 1MZHA 3M7WA 1ICSA 1FCQA 2GPTA 5LZLA 1DORA 3P8JA 1W3IA 3I6RA 3B0VC 4LS0A 4MLRA 5D2TA 3L66A 4YL2A 2A7NA 3N3MA 3ABOA 4JTEA 4N4QA 1NAL1 1F6PA 3GDKA 5AHMA 1H7OA 3EX4A 2Y7GA 3LRKA 5LNRA 1AL7A 2HMCA 3DI1A 2HS8A 4Z1BA 1EP1A 2CU0A 3WK3A 1LRTA 3A23A 1TTQA 2VFIA 1KM6A 3QSTA 4WUIA 1TJRA 1YTDA 4NJJA 4ZZ9A 2C6QA 3GNDA 2WSYA 4NNAA 5K9DA 1LBLA 3TCEA 5LHFA 4QISA 2C16A 1SSGA 3P80A 1TQJA 4AHQA 1G67A 1QPOA 1FBAA 1H7XA 4N4PA 5D33A 3TR2A 1GEQA 3LHWA 3O6DA 4GUJA 2CLLA 3E12A 1THFD 1GTEA 3E96A 2WOQA 3LB0A 3L21A 3IIXA 4PEKA 3WFAA 1AL8A 3S1VA 2TRSA 4LC6A 3LBCA 4CCEA 3UWZA 5L9FA 1W37A 4M6QA 3G0UA 3FA5A 2OCZA 1I2NA 3MUXA 1K3UA 3MHGA 2GVJA 5FEXA 4N9EA 5I3HA 2ZBTA 2E1DA 3UWQA 1QFEA 2VELA 2A4AA 3BLIA 3KXQA 1VRDA 1C29A 2H90A 4ZL1A 2ABBA 4KWVA 5LNWA 1YLVA 2VFHA 2DZXA 1OVDA 1GVQA 1PV8A 3A5VA 3LDVA 4LV4A 3NL3A 3P81A 3SZ8A 3GR8A 2NUXA 3P5ZA 1OK6A 4WY0B 1LORA 1GZGA 4K8EA 4NU7A 2Q8LA 3BW2A 1LRQA 2TYSA 1R2SA 3W6YA 4LVGA 6TIMA 3W7QA 3DH7A 3HGOA 1TQXA 4A2RA 2QAFA 2EPHA 2VOMA 1DL3A 1WQ5A 2FDSA 3LTYA 3CEUA 3UWUA 1JCLA 2P1FA 5LHEA 1GVOA 3C2FA 3M16A 4ORIA 3SIZA 3MO7A 4IJBA 3LI0A 3GIYA 2Y6ZA 1WAUA 2YYTA 4CNPA 1K7FA 2GQAA 4QJ1A 4UNKA 4EOUA 4Y6GA 3HF3A 5DBTA 3G1XA 3S9YA 4AWSA 1KM1A 3W7OA 1OF8A 1FWNA 2PURA 1DBTA 1TPWA 1R30A 3HPZA 1SW0A 2Y88A 3T78A 4XKYA 4MY9A 3C6CA 3QMRA 3FS2A 3W72A 1M5WA 3O8AA 4YWIA 3SR7A 1LBMA 3TSBA 3QH2A 4X2RA 3I65A 4AAJA 3W1NA 2C3ZA 3PG8A 2HTMA 2QDHA 2ZZ7A 3QPZA 4CNNA 2VEPA 2CZFA 3LLFA 3BGGA 2G97A 1OFOA 2YFNA 5G1YA 3TW7A 3PR2A 3B0UX 1L6SA 3DBPA 3PS7A 2Q8ZA 3RF9A 3E49A 2V81A 1G4EA 1UB3A 3MBFA 4QSHA 3FYOA 2HS6A 4ZVJA 1Z41A 4UR7A 2CLMA 5L6UA 4JIPA 2R14A 4LV9A 1D3HA 1KBJA 1A5AA 2NX3A 5F4SA 3KX6A 4DO5A 1H50A 3PBWA 1N55A 1QMLA 1IIHA 1YADA 1ZAIA 4IMEA 4KFPA 3S0CA 3NA8A 3O6YX 5C5YA 2WSQA 2E6DA 3TXZA 1ADOA 5AYZA 3RFAA 4QNWA 2E5BA 4UMAA 1G7VA 5DN1A 4WY0F 3JR2A 4POCA 3EWZA 5HINA 4O14A 4JTTA 5AHEA 3NO5A 5AHLA 3W86A 3N34A 5C2XA 4LS2A 4HNVA 3PY2A 4EIVA 3G0SA 4GUIA 3M43A 2V30A 3LXBA 3Q2DA 5G2WA 2J88A 3W1RA 1JCXA 1HFBA 4HNUA 4N6FA 2C14A 5LSMA 2QUTA 1P0KA 2TMDA 1IXQA 4TO8A 3PB2A 3B05A 2QCNA 1U83A 1YDNA 4NJIA 4FNQA 1SSDA 1Q45A 4UFMA 2QCCA 3L68A 4NZJA 3DKJA 1F5ZA 1IIGA 3EKZA 3LX9A 3W1UA 2RFGA 1LCOA 2RDTA 4LNYA 1ONRA 3NL6A 1M7PA 3CT7A 5T26A 3CU2A 1C8VA 3TFCA 2TSYA 1ICPA 1WBHA 3IEBA 2B7PA 2G95A 3QRHA 4LUJA 1G4TA 2X2GA 2A7PA 4N9CA 3HIJA 4PFMA 1LDCA 3LOTA 2GQ8A 3CHVA 1ALDA 2J9ZA 4K39A 1W3TA 3TNOA 3W2MA 2ZFAA 2GJNA 1J5TA 4FNTA 1VC4A 3KFTA 1QNVA 2AQWA 4FXSA 2F84A 3NQ8A 3GAKA 4FF7A 1E51A 2CZDA 1W5QA 1X7FA 2GOUA 3PM6A 4I7UA 1I2OA 5D30A 1D9EA 2QAPA 3W7IA 1ML1A 1TREA 2A0NA 4BI7A 1R2RA 2G5WA 5K4XA 1P4CA 4LS1A 4JYFA 3M0ZA 1JRCA 2NV2A 2ZZ6A 4JTUA 1HO1A 3G8EA 1VLWA 3QZEA 4G1KA 5CG7A 3NL2A 2AAMA 2DZWA 1O4UA 4JXCA 1MO0A 4GUFA 2XN1A 4LVBA 3NQVA 3IVSA 5CPNA 2R8WA 4LU0A 4NVTA 3W83A 4O10A 1G6CA 1TRDA 4MUZA 4FX7A 3WK2A 4ZQRA 3EX1A 3NR0A 4WZHA 5G5IA 7TIMA 3P5YA 1VCGA 1OK4A 1OFRA 4K8HA 3STEA 4AVFA 3A24A 1EP2A 3H55A 2QCMA 3Q58A 2DZUA 3EX3A 1J4EA 4DF0A 3E9AA 4W9TA 3W2NA 3W2UA 4OV4A 5DXYA 1EA0A 5HWNA 1MEHA 4CCDA 5AOUA 3DKLA 1C9DA 3MI2A 2NUWA 2WV8A 1ZENA 3NXFA 1EB3A 4NJHA 1QOQA 4DEFA 3PF3A 3VFLA 3HOJA 3QMTA 4ZMGA 1JQXA 2ZZ2A 3S8HA 2E77A 2JKPA 2JK2A 3MHUA 2V2CA 3LCLA 1OX5A 4EVZA 1HTIA 4GXMA 1SPQA 1PL9A 4O16A 4JTIA 1QOPA 2V5LA 5FF7A 4O57A 1FCUA 4JX4A 2Z2UA 3QMSA 4LOCA 1QR7A 5AC7A 2GUUA 4E0CA 1TPC1 3LCHA 1PIIA 3C2OA 1IXOA 1W1ZA 2J6XA 5J5DA 1H7WA 1VYPX 2VFDA 4JD4A 3HPSA 2PRHA 3FEMA 1R2TA 3VKJA 5E1QA 1W3NA 4A21A 3H54A 4MOZA 1X1OA 4LWWA 2FPTA 3AJXA 3LCXA 4UTTA 3P62A 2ZQ0A 2BTMA 2XN0A 4O18A 2OZ0A 3KRUA 4GC4A 4U28A 1OX6A 4AF0A 5G2HA 1EWEA 3A5FA 4YCPA 2NWRA 3UZJA 2CW6A 3BGJA 1SZGA 4MZYA 1NEYA 4GUHA 4RX0A 1QWGA 1SQ7A 3ANYA 4TR9A 3T55A 4NJGA 1YDVA 4FNSA 2ZZ3A 3QM3A 4JICA 1WBJA 4FNUA 3TH6A 1Z44A 3NQEA 4E2BA 1NF7A 3EXTA 4JTGA 3TDFA 5HR7A 3PUDA 3ZS4A 1ZALA 4UXDA 1GTHA 2B7NA 3B8DA 3TQ0A 1QCWA 3R12A 1OG0A 2ATSA 4Y96A 3W23A 2GJLA 2JGQA 2BLEA 1KFEA 4UTJA 1GWJA 4MKNA 1QDSA 5HMSA 3W1XA 4ZQCA 5AB3A 4MPQA 5I3FA 4DPPA 5LNVA 1OX4B 4FB7A 1JRBA 2Y61A 2ZA2A 4UIOA 3UXDA 4JY9A 3C56A 3IIPA 2YW4A 4KWWA 1G4PA 4WX2A 3DFSA 1JULA 1LM1A 3SY5A 4H3DA 3FKKA 2NV1A 1H51A 3H53A 1SO3A 4NNCA 2YGYA 3N2MA 3G1AA 4ADUA 4UCGA 3HG3A 2ZZ4A 3FOKA 2H8XA 5KSWA 4HNTA 1G4SA 4FEZA 3CQ0A 2Z1BA 2ZYFA 4M19A 1TPDA 1UBSA 2CLFA 3O1NA 1B4KA 3O05A 3F1QA 3C2RA 5G1TA 4LW7A 1DKWA 4IMFA 3SFKA 1OYBA 1V7YA 3F4NA 1VCVA 3DXIA 1FY6A 3DFTA 1G69A 5U4NA 5BMXA 3YPIA 2EGZA 3I7SA 2WJZA 3WJWA 1NVMA 1FUYA 3PB0A 1LROA 5K9XA 4L4LA 3STFA 2QJHA 3G3DA 1PCWA 1ZAHA 2YW3A 1A5SA 2E5CA 2RKXA 3W7CA 4DBDA 4OU1A 3VE9A 2QJIA 4HSOA 1L6WA 4PC8A 2C19A 2GVLA 4RR4A 2X1SA 1PS9A 5F2LA 5EA9A 1SR9A 3W85A 2QJGA 1OFEA 2FTPA 4XQ6A 4QNEA 2C1HA 3R2GA 5LNSA 5KTLA 3LRMA 1N7KA 3L0KA 1LBFA 1Y0EA 4JEQA 4HPXA 4K7VA 2ALDA 2EKCA 4ICNA 1F76A 4MYXA 4ZQPA 3OG3A 4JY8A 3L5MA 5AFDA 2CLEA 4XZ9A 2YCEA 6ALDA 4PL2A 3C4UA 1GYNA 1T96A 1EEPA 1SO5A 2WNNA 2XN2A 4OT7A 5D09A 4OGZA 5DCDA 1XDMA 2E6YA 4X22A 3T40A 5ABTA 3WK1A 2FFCA 3NPWA 1JCJA 4ZQOA 4QQ3A 2P10A 3KVLA 2QCDB 4O0KA 5G2IA 3I68A 4I9AA 4IUOA 1H62A 3W2JA 3VE7A 4DELA 3GKAA 5CSSA 4IX0A 3TUUA 1TCDA 4GUGA 2ABAA 1S3HA 3GKFA 4FO4A 3HB9A 3NL5A 1FX6A 4RXFA 1P1XA 1KA9F 1GG1A 3CPRA 4Q4KA 1ZAJA 4Z0JA 3LTPA 1YXYA 3W2KA 1JR1A 1A50A 4YCOA 4LVDA 3EX2A 1LLWA 3RLVA 1CI1A 2OT0A 2GVGA 3GX9A 4O15A 4M6VA 2CLHA 5D02A 5FI8A 1ZFJA 1JJKA 1LOLA 5IM51 2J27A 3PULA 3OIXA 3GR7A 4LY8A 3PG9A 4JN6A 3PSVA 3NQAA 5BW6A 4S2CA 2OMAA 3S1UA 3O07A 1KTNA 1KTCA 5DXXA 4IMCA 4R53A 1KM3A 2CFFA 4O19A 4O4VA 3MW7A 1EP3A 4S1FA 1KV8A 3QPYA 1XBXA 3GDLA 3GXNA 3W7EA 4RKAA 1OABA 1ZCOA 5HULA 1WA3A 3R13A 4JYDA 3RNDA 1RZMA 1SO6A 4TU1A 1LOSA 2FQIA 3W7KA 1TO3A 3NZ1A 4JR5A 3W1PA 1N8FA 4O53A 2VENA 3WJXA 1H5YA 1WX0A 2E6AA 3OBKA 3G24A 4IX2A 2VEMA 4CQAA 3NQMA 3SGUA 1ZJIA 2YZRA 3CB8A 2BSLA 1GQNA 3W75A 1W0MA 2BWGA 2ISSA 1TMHA 1P0NA 5FF3A 5F2GA 4HN4A 5AHIA 5EBUA 1KM2A 1RV8A 1YTKA 1O5XA 2Y7FA 1HO4A 2BZNA 1DQWA 2DORA 3QSRA 5DCBA 2BX7A 3LTSA 1EX5A 3N2XA 2EAWA 4XTDA 4IPIA 2C18A 1SZFA 3E02A 1ME7A 5CPMA 1F7BA 1JVNA 3TAOA 1OFQA 5I3GA 2C0AA 1I45A 1LP6A 1B3OA 1P5BA 3U6WA 4IXHA 4KFOA 2CLOA 5CSRA 3G1YA 5CPLA 1O94A 4NX5A 3W73A 2WO5A 3CM4A 3CIWA 4O1AA 1JUBA 3M47A 2EHHA 5KMYA 1TPB1 4LUIA 1T99A 4N9BA 3TC6A 1MSSA 1VQTA 1AMKA 3LCWA 4E38A 3PAJA 2WSRA 1KW1A 1WV2A 1H1ZA 3KRSA 4O11A 1YXDA 4UMBA 4RZ5A 4QIUA 5SWUA 3WJZA 2VFEA 3GB6A 3KOFA 2ZRXA 3PBVA 3NPUA 1YYAA 3C2EA 1K8XA 3HG5A 4JGDA 2DZPA 1BEUA 4H4IA 1PVNA 4BFAA 4I7VA 3P60A 3UPWA 3CC1A 1VH7A 3PVFA 3B03A 1ICQA 3EXSA 1K7XA 3T44A 4CCCA 4N2YA 5DBUA 4O1DA 3W7HA 1H63A 3L67A 3VI2A 2ZZ5A 1EUAA 3TW6A 4FIQA 5D37A 4M7TA 4IXXA 3W88A 3U8GA 4J9JA 3C2VA 1TRIA 4GE8A 4JTJA 4CNOA 4OBTA 1SZNA 4IGHA 1KLZA 3CWOX 4C1LA 3L0GA 3O16A 4A3UA 4GFSA 1KM5A 1VPXA 1ME9A 2WPBA 3OHIA 1PHWA 1TPFA 3RK8A 1HUVA 2V0TA 2YYUA 5TBOA 3L2IA 1UUMA 4FNPA 4IWWA 1FWRA 2V5BA 4I7WA 3QEZA 2QF7A 5EY5A 1Z42A 3TSDA 3IIOA 3B06A 3RU6A 1SFLA 2NXGA 3GZ3A 1KBIA 3R5EA 4K37A 3BG9A 3C8FA 3HBLA 2H3DA 1F05A 3L65A 4CQ9A 1AG1O 3HGJA 4GJ1A 4MZ1A 3N9RA 5C6MA 1BWLA 1SZEA 2G96A 3G8RA 3QC3A 5F1UA 2Q3OA 4Z08A 2DZVA 4K6AA 3MJYA 4PH6A 1ME8A 3KHJA 5D2WA 4UTKA 3MMTA 1A5BA 1MXSA 3ABRA 2Y7EA 3M5VA 3G3MA 3EWWA 1TTPA 1VS1A 3NPXA 2I14A 3V75A 4ADTA 2R94A 2NWSA 3TX9A 3NM3A 4BI6A 1QPRA 1W5PA 2OT1A 3P61A 3W71A 3MHFA 2YFOA 4O12A 3GK0A 3ATZA 1FDJA 4TMCA 1T0OA 4LC8A 5HUPA 4A22A 3DU0A 3LV6A 5IBXA 1B4EA 1DV7A 1H61A 1W5OA 4IPJA 3PWAA 5H91A 3M5XA 3CWNA 1OF6A 2NZLA 3G1HA 4YXGA 3TMLA 1CX9A 3MI6A 4JTSA 1IXNA 3FJLA 5HUOA 4PA8A 3MYPA 3A22A 1OX4A 5EMUA 1EUNA 1R46A 2X30A 3F4WA 4MVAA 2VFFA 4RK8A 3UY7A 3GDRA 5BRBA 3N14A 1LRNA 4LTSA 2Z6JA 4AB4A 3LXCA 2FB2A 3FFSA 3P8IA 4E2DA 3HPXA 1KFKA 4O1CA 2CZEA 3W7DA 4IMGA 1K03A 1SFJA 3MWAA 4RV8A 3SJ3A 2QCEA 3KVMA 3GXTA 2GQ9A 4ZQMA 1NSJA 2C13A 5F2MA 3W1QA 4BWLC 4MIMA 3EX6A 4O54A 4KFNA 3HQ1A 3DGRA 1EWDA 2QUVA 2PC4A 1A5CA 1XM3A 5K9CA 2VC6A 3P74A 3PBYA 3LCGA 3TC7A 2QCDA 5GVJA 3EWBX 1OHLA 3LI1A 4RZ6A 4X9SA 3OVPA 4JTFA 2TPSA 3L5LA 5CZTA 1W5NA 3T4CA 2QCLA 3V1PA
chains in the Genus database with same CATH superfamily
3WNKA 1QHPA 4O8AA 4GK8A 3ELFA 1AQHA 2YSWA 1LL4A 2EG6A 4US5D 4P8WA 1WXJA 1GZJA 3F5LA 4IPNB 5D05A 1OB0A 3VCCA 1IR1A 4JNZA 2A7RA 1XV8A 1HL2A 3ZVHB 1J79A 1DP0A 3CZ8A 2J7EA 1XIFA 5FL1A 3CLWA 3G1DA 4HMNA 3HQOA 4MPKA 2RDUA 1A3HA 2DUAA 3ZWTA 3FJNA 2VUNA 1GOXA 3RPMA 3TJ4A 1YPFA 4UTFA 1EGZA 1XXXA 2ZX7A 4B3KA 1SJCA 1RSCA 1KXTA 3N73A 3QY6A 3URAA 1WXZA 2GVEA 1CLXA 4UFHA 1U33A 3W02A 3U4FA 4NUWA 1QI3A 4BI5A 1XC4A 4WDXA 4RCXA 4PEEA 2PSNA 1B3ZA 1UPMB 2I1OA 3P14A 3C3UA 1JCNA 1TIMA 3U2OA 3OVQA 3BCDA 3VGHA 3W76A 2XH0A 5J5RA 4LVFA 1BGAA 4GBUA 3BMVA 3BSGA 2NSXA 3EB2A 4YPJA 3RM8A 5EYWA 3NQCA 1R9ZA 2FZNA 1XLLA 3BSMA 1NY1A 1A5MC 4TXEA 4XUGA 3ANUA 5AHNA 3N6JA 4EF8A 4Z0SA 3LQGA 2VT0A 1TKKA 2PWUA 3WZ0E 3H2NA 3M0MA 4RW5A 5AVHA 1VHNA 3BG3A 5KINA 2OG9A 3UJFA 3WUBA 4YS1A 2RDWA 1GVEA 2PF8A 4L6HA 3TSMA 2W63A 3W7JA 4IQEA 3C61A 4W88A 2BHZA 1VGAA 2WVTA 4ERAA 2I56A 1WO2A 4YYFA 1IQ8A 1HJVA 1RAKA 3R6IA 1L6FA 1OCJA 3QFEA 1B57A 3E1F1 4ATWA 1XWYA 1AD4A 3BICA 4M6PA 3E0IA 2GFTA 4MKVA 3SCNA 1EJVC 1EX1A 3DZ1A 1SUXA 4C7FA 5C71A 2DJXA 2NVDA 4QAIA 2VKZG 4UR9A 1J2WA 5HNRA 1AW2A 2X0YA 3MBDA 3N6HA 1S5VA 5CPOA 1SFSA 4XBSA 2WKLA 5I09A 4TX6A 3WQEA 4MZ8A 4F4RA 4KKXA 2GJXA 3GW0A 4ML9A 4O0ZA 3FLUA 5I3KA 5A8PA 2D0GA 4N02A 3WLIA 1DHPA 4F0SA 3FSTA 3I7RA 1BYCA 4FXJA 3S6DA 4PUJA 1JQVA 4LBSA 5CLWA 1NOUA 2NXIA 3DFPA 3WQ8A 4H2CA 3NPVA 3GY1A 4HHPA 4DAFA 1E56A 1FFQA 4PMJA 2B81A 3NNTA 5K2ZA 3KOWA 3S5OA 1V3KA 2Y63A 4WDTA 2WHMA 4HNNA 1XQLA 1YBQB 1EPXA 3SEPA 3JUGA 1RQEA 2DIKA 2X42A 1EDQA 3BK0A 1VZWA 1GHSA 1HP4A 3GVQA 3G0XA 4J3SA 1EIBA 1LTDA 3UNDA 3QF0A 2C79A 3WK0A 4YLWA 3HU7A 1E0WA 3WLPA 3VIHA 2ZRZA 2ZZ1A 4KCVA 3IJQA 3VNKA 1F2JA 2NVAA 4IHCA 4JFUA 3VIJA 1H1NA 3HM7A 3AS1A 3I7QA 2A3HA 1ZJHA 4DLFA 2AQVA 2V68A 2Z6IA 4XKYB 2ZTKA 5FF4A 3QN3A 1UD4A 4OWGA 3WLQA 1ITXA 4NASA 5DY3A 1JI1A 3GYCA 4B9YA 4CD4A 1TX0A 2VRJA 5KZEA 3CZEA 2WXDM 3M5ZA 3AU2A 4O52A 1L2QA 1RK6A 2BHYA 5KZMA 1K8YA 4A3RA 1X98A 2J9YA 1Q3NA 4UQAA 3AC0A 3MP4A 4PTNA 4J7RA 4GACA 4OZOA 4JQ3A 4XIAA 1ENUA 1KM4A 2OB3A 3RUBL 4JTLA 3M5YA 3I6TA 3NZQA 5U7SA 4B15A 3EKLA 2A6NA 2OOGA 1CW2A 3SUVA 2FHFA 4W93A 1TV8A 1JF6A 1MQQA 1UWQA 1H4PA 3CL8A 4NF7A 3B40A 1UH2A 1FFRA 3TYAA 1H7PA 2XFFA 1PJ9A 4HCDA 1D3CA 1TYGA 4C5ZA 1BG9A 2HISA 4DF2A 5LGZA 1VFFA 1XCXA 3EEGA 3TN5A 1GOMA 3Q45A 4JTHA 1TMLA 3W74A 1ECEA 5JVLA 1W9PA 3RCYA 1JD9A 3PK7A 4DB7A 3N19B 2AL1A 1PE1A 4GZ7A 4Z1CA 3UZXA 1U5VA 3L4ZA 4AXNA 5K7JA 1Q7ZA 2CPUA 3TYCA 4GI4A 2VTFA 1FXPA 1AODA 3I10A 4UTIA 1TA3A 3QKEA 1AH0A 4NQ1A 3ARYA 4F9JA 3STGA 3ZYZA 5DELA 1QUMA 1UH3A 2OYMA 2UWFA 4GWEA 2PTDA 2ZX5A 4JQAA 4GPNA 1FDZA 1J5SA 1YXCA 2PGFA 1E6ZA 3TROA 1D7FA 2QCHA 3MU7A 3H2OA 5LIXX 1KFWA 2HPMA 8XIAA 4PB4A 1ONXA 5H8MA 3WDJA 2B7QA 2V2DA 1XGEA 2NQHA 2BXVA 4N9DA 2A2IA 4U3CA 2J24A 4ZO9A 2CC0A 3ABZA 4UFIA 1IV8A 5LA1A 2O9RA 4JTKA 1DJQA 5AYXA 1IEVA 2JKEA 5I2UA 5JIPA 2CLKA 1C93A 3BARA 3LLXA 5E93A 5CSUA 2F38A 1R47A 1J2BA 4QLJA 3EZ4A 3UY8A 1I4NA 3B0PA 1YRRA 4DQWA 1V79A 5CCZA 4Q8TA 1RA0A 1VYSX 1W3JA 1FVPA 2MUCA 1IGWA 3GXFA 2Z0IA 2XPKA 1FKXA 1S5WA 1LZOA 2FB3A 4MLJA 3FIGA 5AZ1A 2C1GA 3KCLA 2GUBA 4QROA 1KFLA 1EH9A 5EFFA 2NX9A 3ARWA 3WJSA 2VEKA 4DJFA 3TQVA 3NZGA 4BR1A 2H3BA 2QDGA 3B0YA 3UWYA 1Q6QA 2H9AB 1K77A 1EXPA 4NAFB 3CAWA 2IXUA 1O5KA 5I23A 1V77A 3LM7A 5CPSA 4HNCA 1J12A 2XG9A 3BAIA 4RLIA 3C8NA 5KITA 4GOAA 4LUSA 3ATYA 4L9XA 4AD5A 3VDAA 2V8ZA 5HQEA 2PLCA 3H7RA 5TIMA 2OELA 3A3WA 5D32A 1LWJA 3SECA 2MNRA 2ZOXA 1JCYA 1PSCA 3MVIA 1GK8A 5BXSA 5MHBA 5M5DA 1LQ0A 4O4WA 1XFCA 5I0DA 3NO1A 2YCIX 1GVRA 4N6EA 3E38A 4GHRA 3DCPA 1E40A 5EFDA 1FWDC 1WPCA 4L64A 4AZIA 1TMQA 3DBNA 1Z48A 3NYZA 1KBKA 3LUTA 1EJRC 1XCFA 3PFMA 3MC5A 1XIDA 5DT5A 1P43A 2Z1KA 5A95A 1XBYA 4LCSA 3SI9A 3WD0A 3L2LA 4CN1A 1MDLA 3E2VA 3GSMA 1RK5A 3QC0A 4E8CA 2HVNA 1M7JA 1S2AA 3LERA 4H41A 3W6MA 2H9AA 2ZRVA 1NOFA 4GVGA 5G4WA 2WBGA 3K30A 5HANA 4IMDA 1FWTA 5I3IA 1OFPA 5EPDA 1QPQA 3WH5A 2Q02A 3W1MA 8TIMA 1VHCA 4YTSA 3L23A 2PP1A 2XFRA 3IVTA 2FIQA 5HNTA 3LNPA 4B91A 4J3XA 5FJTA 1TTJA 4BWLA 3APGA 1E0UA 4DO6A 4XVDA 3ZMRA 1DWHM 1YE4A 4Z1DA 3WQDA 1JUKA 1DHKA 3FW6A 2OLSA 3SN1A 2FZBA 3M6DA 4Q22A 4HK6A 3ZWSA 4IOTA 3R1ZA 3G1VA 2KZHA 4RW3A 3QBUA 2W5FA 3CUHA 1E4NA 3MZ2A 3ORWA 2PCEA 4AH7A 1PIGA 4GRSA 1XBVA 3QQ0A 3R4IA 1IEQA 1KQZA 1KBLA 2Y2WA 5HPCA 3W7GA 1LOQA 1H0GA 2E09A 6ENLA 4AZGA 3T05A 4NZFA 4IP4A 1PTGA 4NXSA 4J2PA 1AVAA 5LKYA 3QLDA 1XISA 2O7SA 3PBUA 3INPA 4RE4A 1MZHA 1BYAA 3VIFA 3F2CA 2JEPA 3MZNA 5CAHA 1DORA 3B0VC 3EMCA 2A7NA 4JTEA 1NAL1 2XH4A 1F6PA 2QJNA 2VOTA 4IFOA 3EX4A 3ARXA 2IS7A 1EF3A 2HS8A 4EK7A 2VD9A 1JZ7A 3OBEA 2XSBA 2CU0A 3WK3A 3URBA 3M0JA 2HQAA 1KM6A 3H4WA 1TJRA 4L4PA 4NJJA 2ODOA 2C6QA 2REQB 3GNDA 4JIEA 3WDQA 3QHNA 1NFGA 1W1YA 1ZU8A 1Q7QA 2CKSA 2C16A 4HQVA 3R58A 3RXZA 3P80A 1UD6A 1TQJA 4KETA 2WCGA 4AHQA 1QPOA 4U5IA 3P6LA 3GE7A 4N4PA 4H1ZA 3TR2A 1QJWA 4GUJA 2JF7A 3FGCA 3E12A 4C6KA 1GTEA 4P7NA 2WOQA 4F0LA 4E3TA 1M7XA 1F3EA 4FK9A 2I17A 3TP4A 4HK7A 1W9XA 5L9FA 5DFAA 3VGGA 3U2EA 4M6QA 2O56A 2OCZA 4P8XA 3MUXA 4IH3A 1JI2A 2GVJA 1ISYA 2GWNA 5FEXA 4N9EA 4PMXA 1QFEA 3H24A 5B7ZA 3KBVA 3WBAA 3HQPA 3NWRA 1C29A 2H90A 3T07A 1CEOA 1OT1A 1UKQA 5LNWA 1OVDA 1ADDA 1M9HA 3GW3A 4IP5A 3A5VA 4LV4A 3P81A 1FH9A 1QT1A 1LORA 1GZGA 3ONBA 1XYAA 3BW2A 4PTDA 4MB1A 4JTDA 1R2SA 3H4GA 3W6YA 3W7QA 1PKMA 3HGOA 1J01A 4QS5A 3SUSA 4U2ZA 3ARVA 4AVNA 3UWUA 1JCLA 1Z6KA 4DUOA 1PTDA 3M16A 2INFA 1NWUA 3MO7A 4IJBA 3GIYA 2Y6ZA 1WAUA 1PKNA 4TV5A 4MGGA 5I00A 1OD0A 3VXGA 3UA4A 3QGAC 4UNKA 4EOUA 2PDIA 1A5KC 1OGGA 3OG2A 1TE6A 1ZBVA 3CZLA 1LWIA 4MY9A 1XLEA 2Z29A 3POCA 2C1IA 3FS2A 4HU0A 3O8AA 1ZSXA 2VRKA 4QDWA 3TSBA 3SR7A 4X2RA 4AAJA 4ICCX 3QPZA 4CNNA 2CZFA 3GXDA 1KGUA 2G37A 3PANA 1U1UA 5G1YA 3WMBA 1M53A 3TW7A 1UR8A 5A94A 4Z1YA 3FV9A 2BMBA 1A0DA 3PS7A 4B5WA 2Q8ZA 2IPGA 3VFCA 2HRWA 4WDWA 1V8EA 1E9IA 1YX1A 4CVWA 5AC4A 3C0LA 3XINA 4HGXA 1E6RA 2HS6A 1EYEA 3O0KA 1UQZA 3H2EA 4J3TA 4I9MA 1JPMA 1DPMA 3GNXA 4LV9A 1KBJA 5F4SA 3KX6A 5HDRA 1QMLA 1Y5WA 3ID7A 2WSQA 2E6DA 2RGLA 3TXZA 1MQRA 4YNGA 3VKCA 2PA6A 4UMAA 1CIUA 4WEVX 2HE8A 3AROA 3N34A 3VNMA 3WIJA 4XKMA 4HNVA 4UB9A 3MMDA 3PY2A 1EPVA 3BANA 1R8LA 4B4HA 1Z8AA 4GUIA 1TV2A 1XC6A 3M43A 5H1WA 3Q2DA 2J88A 3TYZA 1LT7A 1NFPA 4UZUA 1HN1A 4HNUA 3QV7A 3EDFA 1X38A 3UGRA 3QR0A 3TTEA 3ZO9A 3B05A 2QCNA 1JDDA 3L68A 1JZ3A 1IIGA 5A2BA 1ISZA 2RFGA 4REQB 3NL6A 3T6CA 3RO6A 1BLIA 1LUCA 3CQIA 1ICPA 3P93A 3QRHA 4RPPA 3JZUA 1AH4A 1G4TA 3MS8A 4OJYA 2A7PA 4PFMA 2AMXA 1LDCA 4I5RA 2GQ8A 1ALDA 4XG1A 4XAFA 3W2MA 2WWDA 4JIHA 3SCWA 4FNTA 4MNLA 5LXEA 3V5FA 4DM2A 2AQWA 1QNQA 2F84A 4X0VA 2P8BA 1HL9A 2JE8A 2PWDA 2NQZA 3SRHA 2D23A 4I7UA 1TWIA 4PCPA 4BQ3A 1PWMA 1IEIA 1ML1A 4XISA 2A0NA 4BI7A 2FVKA 2FDMA 5HQLA 3CV6A 3N4FA 4ERGA 5K4XA 1ZTVA 2WVVA 3M0ZA 4MB5A 1VLWA 1DJYA 1UD2A 3SUUA 5JH1A 5CG7A 3WLLA 1BPLB 2X41A 1P7TA 4JXCA 5EMYA 4LYPA 4JTCA 1MNZA 4XD4A 5CPNA 3KCJA 2R8WA 4PUEA 3W83A 3VO0A 1DEDA 4FX7A 4ZQRA 1VEPA 1ZRQA 3KEHA 3ZVIA 3NR0A 5G5IA 4P7OA 1B5TA 2QS8A 4GLEA 4M81A 1ZGDA 4K8HA 3GD6A 3A24A 7CGTA 5ABEA 4CU8A 2OO0A 2R6OA 3H22A 4FA3A 4NIRA 3E9AA 4ZODA 4OV4A 5DXYA 5HWNA 1MEHA 4ICMA 5AOUA 1C9DA 2WV8A 3SCVA 3TCSA 1ZENA 4QEEA 1ELSA 2WANA 3VFLA 4A4AA 4C6PA 3HOJA 3UCDA 3ZVHA 4ZMGA 4IZGA 1F4AA 5HA7A 3GVWA 2P76A 5I6SA 1PL9A 5A6KA 1QOPA 5FF7A 3KTSA 3CUZA 1E3XA 4X63A 2FVMA 2PTYA 1BWVA 4JFTA 5J5DA 5I79A 3HPSA 4A35A 1R2TA 3H54A 2ONEA 3AJXA 4GGHA 2PGEA 5EBAA 4BQ4A 4S3AA 4O18A 2BGSA 2VCCA 1J0HA 2OQHA 5G2HA 4QR6A 2CW6A 5JH2A 3BGJA 1SZGA 4GUHA 1QWGA 1VJZA 2JIWA 4S39A 1VJSA 1YDVA 2QZRA 2X0HA 1WBJA 1AQFA 3WNLA 1Z44A 4C1NB 4PUMA 4IFKA 2O9OA 3TDFA 5HR7A 3SCPA 4UXDA 1GTHA 3V4BA 1PO9A 4PMQA 2B7NA 3VGDA 3UXIA 1QCWA 4Y96A 1PYFA 2GJLA 1ZB5A 1C92A 1GWJA 1OINA 1ISXA 4ZQCA 4MPQA 3E6EA 2J62A 5I3FA 4DPPA 4NG3A 3CV1A 4FB7A 4KWWA 4WX2A 2WM1A 3ZJKA 1YQ2A 2OU4A 2VX7A 1LM1A 4H3DA 3QXBA 1H51A 4LAOA 4LF2A 2YGYA 5A6LA 3P0WA 4RZBA 2ZUTA 3WDHA 1RH9A 1MZRA 3PNUA 4HNTA 2VCAA 1VPQA 1TPDA 4Q4SA 3S83A 1B30A 4Y2WA 3TOYA 4L6DA 4LSBA 1DKWA 3ISIX 1V7YA 1V93A 1MW1A 4TX8A 4W7VA 3ZM8A 3OO2A 2RUSA 2NT0A 3L4WA 1NIUA 3PB0A 3TLQA 4YWSA 2DV0A 3TONA 2OX4A 2OSXA 4XD5A 4DBDA 4HSOA 3WCZA 5ENLA 1RP9A 4PC8A 3ARPA 5F2LA 2DUZA 4IJRA 1TA3B 4FMVA 3K8MA 5FJJA 3L4XA 1R3YA 1PAMA 2C91A 3GR4A 1SM9A 3WDRA 2C1HA 3PZUA 4QJ3B 1TCMA 4PULA 3LRMA 2Q01A 4QQUA 1P0DA 1Y0EA 4K7VA 4LUTB 3UCQA 3WBYA 3OG3A 3VUPA 1V51A 1HJUA 2CLEA 3SCTA 3AUOA 2YCEA 2PBGA 6ALDA 3C4UA 1GYNA 1T96A 1EEPA 2XN2A 1O7AA 4OGZA 5DCDA 1A3XA 4ZQOA 1WP6A 4O0KA 5G2IA 4J35A 1MRQA 3H70A 2YXXA 3I68A 3W2JA 4HPGA 3RJXA 3OU8A 2OKTA 3TUUA 1HF6A 1XIGA 4MNJA 4KCTA 4AC1X 4BQ2A 4GYFA 3W2KA 1A50A 1CGYA 3GC4A 4IGMA 2GVGA 1W1A1 2J77A 1E6PA 2CLHA 1WKFA 2W66A 3PSVA 3IAPA 2NQ9A 5BW6A 2Z27A 3S1UA 4H9VA 1GQJA 1R3QA 4EKJA 2CFFA 1F61A 3MW7A 3SQLA 5CGMA 4X2PA 4GJJA 3W7EA 2P5NA 4RKAA 3W25A 3G6LA 1RZMA 8RUCA 3R0KA 3NZ1A 1H5YA 1IHIA 1EOMA 3OBKA 3AWNA 4L6OA 3VIKA 1W9VA 1XLBA 3PFRA 4JPGA 3MPGA 4JOMA 5AECA 5FJUA 2Y5JA 3NQMA 3CB8A 3MDUA 2GDQA 3JW7A 4QDMA 4S3KA 1V0NA 3DFYA 2UZ9A 3CUGA 3M64A 2C7FA 1O5XA 2PU1A 5GNYA 4GBDA 2D2HA 1T8QA 4QFUA 3BLLA 1W9UA 3OYXA 3QSRA 1S2UA 4RNHA 2BX7A 2OSYA 2Z1SA 4HMEA 3WF4A 4XTDA 4IPIA 3CT2A 4PMVA 5CPMA 1VFOA 1F7BA 2R24A 3SCRA 5I3GA 1I45A 4WKFA 2J7HA 3UR5A 4PCNA 4CEUC 4NX5A 2WO5A 3CM4A 1JUBA 3M47A 1UR3M 3TC6A 1VQTA 1PX3A 4FALA 2WSRA 3B8WA 1XD0A 3TR9A 1VPYA 3SN0A 2WWCA 1UZHA 3RLGA 1A47A 3RJYA 1HKKA 3FN9A 4UMBA 2XH7A 4H6EA 2YCJA 3KOFA 1IT7A 3CV7A 2E7FA 3H6OA 3TNBA 4M51A 2EQDA 3C2EA 3HG5A 2DZPA 1T40A 1BAGA 4XZNX 3PJUA 1M1BA 3LK6A 2W27A 1WCGA 3B03A 1Y7VA 3EA3A 3EXSA 4W8AA 3T44A 4O1DA 1H63A 3K8LA 5D37A 4IXXA 2R82A 4DJEC 4J9JA 3C2VA 4GE8A 1SGJA 3CAKA 1P6WA 1SZNA 3R7MA 1U1JA 1KLZA 3VINA 1AFSA 1AQMA 3W4RA 2V6AA 2FGLA 3U57A 3MTWA 3CWOX 2NLYA 4D1JA 1JZ2A 8XIMA 4JL2A 3AYRA 4WKHA 1HUVA 1V3HA 4KH2A 4YJ5A 2WZHA 3L2IA 1ZPTA 1UUMA 3EOLA 1FWRA 3GM8A 1OIMA 4I6KA 3TSDA 3ONCA 3B06A 2D22A 4GQQA 1PKYA 3SRFA 2BV9A 2EBNA 1E4MM 1XGDA 4IISA 4RE2A 1ZJBA 1TJ2A 3HBLA 4S38A 4YTTA 2PS2A 2EPOA 1SZEA 3G8RA 3QC3A 2INZA 2Q3OA 2DZVA 2W3ZA 3MJYA 1HQTA 3WLKX 4UTKA 4FLRA 2F6XA 3ABRA 4S3CA 3G3MA 2YA1A 2I14A 3V75A 4Q4RA 3CXOA 3GU2A 4W8BA 3NM3A 4BI6A 2Z4GA 2YFOA 3GK0A 4PUKA 4B2DA 4TMCA 1NU5A 1C8QA 3OIHA 5CBIA 5IBXA 4IPJA 3CWNA 2Z7KA 1W1TA 2HJPA 4GI9A 1CX9A 3DG3A 5EMUA 1YNQA 1PB0A 4PRTA 3F4WA 2VC5A 3ABXA 4IIHA 1VAHA 1DJHA 5REQA 3LXCA 3FFSA 3EAUA 2JF6A 3RR4A 1J96A 3AYVA 3F2DA 4F9DA 3GXMA 3W7DA 3SRKA 4CU6A 1B54A 3C2YA 4EPDC 3KVMA 1TZZA 3UA3A 2YLAA 4CNSA 2GQ9A 3WKZA 4ZQMA 1NSJA 2C13A 3O3RA 3W1QA 4O54A 3DGRA 2VC6A 3ENLA 3PBYA 6CGTA 3LI1A 3OVPA 5CZTA 2Q09A 2PD5A 3T4CA 5CZSA 2QCLA 3ZFHA 3FY1A 4MWAD 1X6UA 1JG9A 5IRPA 1F73A 1V6UA 3WLOA 4MFEA 3MSGA 1R85A 1JCMP 2J9XA 4KRUA 1XYFA 1UWRA 1KFCA 4LUTA 3DFNA 1W5MA 1NQKA 4Q4OA 1FHVA 1KGXA 1R3VA 2JGYA 3D46A 3KOYA 3BLOA 4IMAA 2DT1A 4RV3A 3FDKA 2WMFA 4GIAA 4QG8A 1XLMA 4LYRA 1SW3A 3TJXA 4PUNA 3QV6A 4JYEA 4P7LA 2DEPA 4GNJA 2P8CA 3OLIA 3SJNA 4QM1A 4PGLA 5HNNA 3MP5A 1L2UA 1RCQA 1S46A 3NVTA 1EEXA 1TWDA 4IIFA 3T8LA 3NOYA 1EZ2A 2G3NA 1GQKA 1QHOA 4CKQA 1O60A 3PUGA 4KWSA 5HATA 2VHLA 1TJPA 4IF2A 2G8ZA 2DU2A 5D2XA 2D2JA 4NNBA 4K1WA 3VMNA 1GOWA 5HMEA 4DJDD 5G1MA 4CNTA 2MANA 5D8ZA 2NVCA 4Y9AA 4HNLA 4ROQA 4QE4A 4AIEA 2WKGA 1MNSA 1EXBA 1ESWA 3S5ZA 3GG1A 4KGLA 2E68A 1LLZA 2YZ5A 4U10A 3SBFA 2O9PA 2VMFA 4DAIA 2B0MA 5DQPA 1G7UA 4JDBA 1ZL1A 3WH9A 2NQLA 1SU5A 3W1AA 3LBMA 1JNEA 4MJZA 2Y62A 1GEHA 4FR1A 3AZSA 3REQB 2VVNA 3GVVA 2YDRA 2WCSA 7TAAA 1FA2A 3GG8A 3FJ6A 3H4XA 4GQRA 1HJQA 2A3LA 2A21A 2VZUA 1EIXA 1J93A 1GG0A 3P7YA 2E9MA 2WK2A 4LF1A 1KKOA 4H6RA 2HNEA 1KRBC 1EBGA 4W4QA 5CGQA 1OFAA 3MDWA 3R89A 1KKRA 4UC5A 3PZOA 4OVXA 2BOFX 2Y7DA 2J7BA 3E0WA 4AEOA 3P0XA 3AMLA 4MDOA 3ZR6A 3M44A 4TMBA 1QAPA 4V2XA 2G50A 3ICJA 3PWGA 3ZZ1A 3WMSA 4WJ8A 1HXJA 3FGCB 4TUFA 3NOEA 2DP3A 4WOZA 3TTQA 1P6CA 4AWEA 1A3WA 3CH0A 4MJ2A 3HGSA 3WJYA 2PDWA 3OVGA 2YJQA 4NAEA 1KFBA 3LN3A 3HMCA 3KAOA 1OC5A 2I5GA 1UASA 4LRSA 1IWBA 3UD6A 4GH1A 3FCPA 3JVAA 4MY8A 3HO8A 4GYKA 3NEVA 3EWUA 3RPTA 4Z1AA 3EOEA 4B16A 4DJFC 2VEIA 3BLEA 4PMYA 1DYSA 3OLEA 1H11A 1ONWA 3W9ZA 1VIWA 4QG9A 1S5TA 2VDGA 3LHYA 4XAPA 3JU2A 4R9OA 3VM5A 3GU1A 1TPH1 2FVLA 3C5QA 1MXGA 1TR9A 3TJLA 3TIMA 4H83A 4DLMA 2HCVA 4Q32A 1NOWA 1R7OA 4F2BA 1QPNA 1XDLA 4U33A 4RXGA 1CECA 1W3HA 5D38A 4UTMA 2ZA1A 1WDWA 1RD5A 2HE5A 2F8QA 3W7MA 4F0KA 1F9CA 1JAEA 3UJSA 1SW7A 3KVJA 5I3DA 3PJWA 4Z17A 3P82A 3DEQA 3GC5A 2DVTA 4Q8VA 4GG9A 3NZPA 3V1HA 4O28A 1T6MA 3OHMB 2XVGA 5B7YA 3LPOA 1H7RA 2QV5A 4QITA 1K4HA 1HJWA 5IDIA 1WDDA 1CGXA 1LT8A 4EAYA 1OFDA 5DLCA 3RO8A 1NWTA 4JQ1A 2QJJA 4WJXA 2PDHA 1PUDA 4JKMA 1BXBA 3A21A 3KUMA 3UT0A 1GW1A 1OJXA 1XF0A 1LUCB 5A8GA 1RUSA 1ZLPA 2DSKA 2E5DA 4DZ5A 3S6OA 4KEZA 3DFQA 4GD0A 1DIDA 4JL1A 5F4WA 3GXIA 4DJEA 3THCA 2V3DA 3AO0A 2PDUA 1JFXA 2PDJA 1YDOA 3OVRA 3L4UA 6REQA 1VD6A 3CHFA 3LENA 4XBKA 1EDGA 2ZXQA 5CBBA 3GLCA 4G7EA 1C90A 3GXPA 2OKOA 4OFCA 4RZ4A 1G1YA 2VFGA 5DMYA 2FTWA 3ZR4A 4BF7A 3LEPA 4GVIA 3GVGA 1XLJA 2XIBA 4Q8NA 3W07A 4FAMA 2O92A 3CTLA 3RN6A 4V28A 4FLOA 4DXVA 4S3FA 4NSBA 1PX8A 3AU6A 1Y5VA 3NGJA 3MO4A 4DBEA 1XRVA 5E9XA 4MFDA 4I8DA 1UWAA 4D6IA 1HP5A 1CENA 3GG0A 2XH2A 2O0TA 4M5PA 4PL1A 2DY3A 2YCKX 4K7YA 1BYBA 2O7QA 3CQJA 2E67A 2BVYA 4JAWA 2LLEA 1RQBA 3F7JA 1Y5XA 3WQCA 1AA1B 3WD1A 5AYIA 1F74A 1E43A 3IIVA 3UR2A 1J0JA 4NAFA 3G1SA 4R33A 1V6XA 4FHAA 2P0IA 1EO7A 1GGOA 4QAWA 2V5CA 5FF2A 4LALA 1DVJA 5CZJA 2UBPC 2ON3A 1O6IA 4KEMA 1KFJA 2PTZA 3LCIA 4HYRA 4OUIA 3U9IA 1Q63A 1OGSA 1BTMA 4KBXA 2NX1A 3KHDA 2WMJA 3BAXA 5CKSA 2VXNA 1V02A 4UFLA 2PWHA 3NQ7A 2XGZA 4IGSA 1W1PA 1FCBA 1EJWC 1EBHA 3DI0A 4K36A 2CWNA 5FJIA 3VC5A 1GPWA 4G9PA 1EJ7L 2Y89A 3F4DA 3WLTA 2PTXA 3F03K 3GH7A 5C8BB 5K3VA 3NQBA 1K8ZA 4NJKA 4HMDA 1Z3NA 2D1ZA 1EZWA 4GFIA 4JCMA 1W2VA 2D0FA 3UWVA 1E6NA 1T8XA 2GK1A 1HKVA 4FZIA 5HWMA 2GGEA 3VZYA 4XAYA 3U7BA 4ZEPA 1K02A 3POHA 1V0LA 3RLHA 3B04A 2DJLA 3WH6A 4B5UA 1BWKA 4PMNA 1XLFA 2VDIA 1Z9AA 4DPQA 4LAZA 1FHDA 5TQLA 1X7IA 2X8RA 4Y9MA 1QOXA 3A9IA 5A5WA 3ZQ9A 1WOAA 3E2RA 1IXPA 1LQ2A 3MANA 3MV01 4D6CA 3AHZA 2P3ZA 1TE1A 1AH3A 2V9DA 1I2PA 1V3IA 4OHQA 4LRTA 5LIYX 4R7OA 3EWDA 3TA9A 1ZP3A 4P8VA 1GPFA 1VJIA 1WYIA 1W3KA 4KF1A 4OV9A 1Q8AA 1IWPA 2I9UA 2XYLA 3HURA 2QEZA 3IIZA 4CN4A 4IIGA 3M9YA 3TYEA 3N2BA 1XLAA 4AQLA 3JS3A 2W6RA 2Z1VA 2QV4A 1XKYA 2A3AA 2VGBA 3N9KA 4LCRA 3DAQA 1CDGA 4WKAA 4WIWA 1OZQA 4AWTA 1UH4A 4L56A 3PPFA 5HWJA 1XUZA 3IVUA 1HKMA 3GFZA 4WXYA 3GUGA 1ZBKA 2CLIA 4FPSA 1V02E 1I0DA 4W8LA 4C6FA 1Z69A 1XYMA 1M41A 3P84A 1V4YA 3L0NA 3LNMA 3NQ2A 1I2RA 2BXYA 5I24A 4ZO6A 2XIQA 3SSJA 3IGXA 4UQ9A 3D3AA 1XIHA 1XBZA 2O55A 4IL2A 1HJXA 4B9ZA 4FP1A 4P61A 2D24A 5C2CA 3W82A 4AZHA 1QWKA 1YTEA 1NP0A 1DJWA 3LHTA 3S1WA 2YL5A 1YW1A 2QCFA 4BJHA 4HSHA 3C0JA 3GHUA 3W7NA 3SW6A 3A4XA 4GC3A 2DIJA 4A05A 4ZTYA 3S47A 3U5UA 4NZ1A 2BNJA 4JIIX 4PYSA 4Q7BA 2X16A 1UUQA 3S5NA 4PMZA 3UPBA 2YA2A 4PBFA 4HU4A 4HIBA 1O1ZA 3UJRA 3LGEA 4LH8A 4UTWC 3NIYA 3LMZA 2HSAA 4XTIA 1Q5MA 4UR8A 2Y1HA 3H12A 3M7WA 5MF5A 2GPTA 3FSUA 5LZLA 7XIMA 1M03A 3RAOA 1PWLA 4LS0A 5D2TA 5JBDA 1LL6A 4N4QA 1JPDX 5AHMA 2QIWA 1E9LA 3LRKA 4KT2A 1AL7A 1UD8A 4L9YA 2XZ7A 2D69A 2IW0A 5GJMA 4Z1BA 5I07A 3UXLA 5AYBA 1SFTA 2QF8A 1TIWA 2R9RA 4LJ3A 2VFIA 3BMXA 4DX3A 4WHBA 3TYBA 1FP8A 5J04A 2INEA 3TN3A 4C65A 4NNAA 1LBLA 3HJEA 4DNHA 1E0VA 1VRXA 5CC5A 1A5LC 2X7WA 3WBWA 4TVUA 1FBAA 1S1PA 3DDMA 5D33A 3PZGA 3LHWA 1E71M 3E96A 2Z7GA 5CEWA 3QZ6A 3EDDA 5D9OA 3LB0A 3IIXA 3QFWA 2GSHA 3WFAA 3S1VA 3ZIZA 4ZR8A 3R43A 1PPIA 3LBCA 4CCEA 1XYZA 1HNYA 2HXTA 3UWZA 1W37A 3G0UA 3FA5A 2C8NA 1I2NA 1EQPA 4M3PA 1K3UA 1OC7A 5CSYA 1NWSA 1WZKA 3UWQA 2VELA 3HPAA 5LXXA 3WD2A 3KXQA 3H7VA 3PPCA 4R5EA 2HK1A 1UZDA 3P3BA 5EB8A 3SUWA 4L5ZA 1I1WA 2VFHA 2YOCA 2DZXA 2OO6A 3MV11 1TVLA 2DDXA 1DJGA 1HT6A 2F6UA 2NUXA 3EMZA 1VBRA 2QDDA 4K8EA 4NU7A 4PTVA 1GCYA 4GCAA 1UA7A 4ACZB 1TQXA 4A2RA 2QAFA 1WQ5A 3LTYA 3CEUA 3UERA 3RRAA 3C2FA 4ORIA 3SIZA 3HFYA 2PDCA 4AY8A 3LI0A 4ILSA 4XO7A 4JZ5A 3T8QA 3UF9A 4ZCWA 2WMIB 4ZB0A 4KIRA 2DFAA 1UZ4A 2RGMA 2WJDA 4RDWA 3S2NA 4Y6GA 1I6NA 3AAMA 4PE8A 3S9YA 1KC7A 1R3TA 4K1GA 3AHYA 1OF8A 1FWNA 1DBTA 1QTWA 1SW0A 4Y9OA 3C6CA 4YIWA 3QMRA 2WM0A 3W72A 1QK0A 1J18A 4XZHA 2DSWA 4I6VA 4YWIA 1LBMA 4PBGA 5EGRA 3W1NA 3IK2A 2DZAA 2HV5A 2WBKA 1QATA 2HTMA 5C7HA 1KRMA 2PDFA 2AL2B 4H8VA 3B0UX 1L6SA 2W91A 3D3FA 3RF9A 1D8WA 2E40A 2IPJA 3E49A 1Q6GA 2UY3A 1UB3A 2BP1A 1RY0A 3FYOA 4RE0A 1Z41A 4RDZA 1JGIA 5L6UA 2GSEA 1D3HA 1A5AA 2NX3A 4L80A 1H50A 3PBWA 3GC2A 1N55A 4I90A 1IIHA 2Y5SA 3O6YX 3GTFA 1ADOA 1K9TA 4A3HA 1DIEA 5A6TC 3RFAA 4PMOA 3JR2A 3EWZA 3K8KA 4NAEB 5AHEA 3WD3A 3KLLA 3W86A 4LS2A 4JHOA 3FA4A 3E5BA 1NWRA 3F5KA 2Y8UA 3WLSA 1O66A 2V30A 3LXBA 3UU0A 5G2WA 3W1RA 1E5NA 4UQBA 4N6FA 2C14A 2QUTA 1IXQA 4TO8A 2PDMA 1YDYA 2IKJA 3KTXA 1YDNA 1JPIA 4FNQA 1Q8JA 4L4OA 1XH0A 4B92A 4UFMA 4GY7A 4QTGA 3DKJA 3W1UA 3VD7A 1LCOA 3WQVA 3RIKA 1ONRA 2F61A 3ES8A 2JQXA 4FSAA 2PDLA 4Q4QA 1E55A 2PDXA 1MUMA 3TFCA 1WBHA 2G95A 1W17A 2NSOA 3BMWA 2X2GA 4N9CA 5ABHA 1P0BA 3WNMA 2ZFAA 3WQPA 4ACYA 3QZAA 2GJNA 1QU4A 1TWSA 3HV9A 1J5TA 3GBDA 4L61A 3A13A 3KFTA 5IDZA 1QNVA 1NH6A 2GOUA 1X7FA 2PF0A 3PM6A 2I5QA 1D9EA 4LBUA 4IL0A 5GNZA 1R2RA 3LPGA 1P4CA 3MSYA 1S1RA 4Z2IA 4JTUA 4YN5A 1HO1A 3QZEA 4G1KA 3NL2A 1MO0A 5H8UA 2XN1A 1FP9A 2J79A 3NQVA 4GGBA 4YU1A 1KCLA 3V0UA 4PCTA 2ADAA 4LU0A 4F40A 1NDYA 4S3EA 4NKCA 2Z28A 4DBSA 3P5YA 5CC6A 3PJXA 1YIXA 2OZ8A 3CMJA 4MTVA 1OK4A 1OFRA 4F48A 3STEA 4AVFA 1S2CA 5AY7A 3VOCA 2QXWA 1W9DM 3LSBA 4ZENA 4URIA 3D6NA 2VZOA 4QDPA 2CESA 3H8AA 2DGAA 2IPFA 1E3ZA 3BQ5A 3NXFA 2XIMA 3N2OA 1FWIC 4DEFA 3UG8A 1VFHA 2VZSA 3B8TA 2J7CA 1JQXA 4D8ZA 3B8IA 4WDUA 2JK2A 3PPGA 2YBUA 1J0ZA 1OX5A 4A8IA 1HTIA 1CGWA 1SPQA 3SSZA 4O16A 2V5LA 1JAKA 4JX4A 2XIOA 4KWOA 2HXUA 4GISA 4E0CA 1GONA 5HNUA 5HJYA 1IXOA 1VYPX 2PRHA 3FEMA 4XB3A 2OZ3A 1W3NA 3ZT6A 4DN1A 4LWWA 4EPBC 3LCXA 3VIOA 1OEPA 2P53A 3T0AA 4RNJA 3KRUA 3WBEA 3GHTA 3VK5A 1OX6A 1I0BA 4HMCA 1JFHA 3CQHA 1EWEA 3ITTA 3A5FA 5A6AA 2NWRA 3UZJA 9XIMA 1BQGA 4TR9A 1TR1A 4AEFA 4AMCA 1LJYA 2ZZ3A 3QM3A 4FNUA 1JCTA 3TH6A 3ALGA 3NQEA 5JQ9A 1S2TA 3MMWA 4IP7A 3PUDA 1ZALA 4AZ5A 1AMYA 3B8DA 3VX1A 2GDUA 1OG0A 3Q4DA 2JGQA 2CBJA 1QDSA 4QEHA 4XO6A 4LAUA 5LNVA 1OX4B 4KCWA 2DPEA 5EMJA 3UXDA 3VM7A 3IIPA 1G4PA 3MB9A 3FKKA 3FHAA 3NXLA 3EKGA 4J2MA 4KS0A 3WLJA 5DX7A 3G1AA 3TWBA 5REQB 4CQDA 4HTBA 2VWSA 3FOKA 2H8XA 3OP2A 4HU3A 4AY1A 1GOIA 1GQIA 3QTGA 3A6OA 4M82A 2CLFA 3F1QA 2UY4A 5PTDA 5G1TA 3SURA 3SFKA 1XD1A 2E8ZA 1OYBA 3DXIA 4I5UA 1K4GA 1AJZA 3ES7A 4O0QA 5U4NA 5DRIA 3GHRA 5BMXA 2EGZA 3I7SA 2I57A 2Y0FA 1VFTA 3VA8A 4ZSUA 4PUWA 5K9XA 4L4LA 2QJHA 1PCWA 1ZAHA 1A5SA 2P3EA 2Z00A 4E2OA 1KXQA 4OU1A 3VE9A 2QJIA 1F6YA 3IJ8A 1L6WA 4UQEA 2BGNE 3S2CA 2GVLA 4RR4A 2WVVB 1SR9A 2Y4SA 4C6NA 3VTRA 4DIAA 3R0UA 1UMYA 1OFEA 3WMLA 4XQ6A 4HCHA 2WQDA 5LNSA 4PSRA 1ZBCA 3USZA 4GO8A 1ITQA 3K13A 2AQOA 1LBFA 4JEQA 4HPXA 2VC7A 2EKCA 4MYXA 4ZQPA 2VUYA 3I3BA 1K8CA 5AFDA 1U22A 1WDQA 4PL2A 3K2GA 4FOKA 1MFVA 5BROA 1K6WA 2VL4A 2WNNA 1XJBA 5BU6A 4OT7A 7REQB 1JZ8A 2E6YA 3UZYA 3WK1A 3M07A 4DYEA 1IEWA 5T9CE 3AOFA 1DWGM 3GZAA 1E73M 4I9AA 1H62A 1QI2A 1W8GA 5A8NA 4OTKA 3LQLA 5KEZA 3GKFA 1PKLA 2ZUVA 3NL5A 1FX6A 4RXFA 1R38A 1P1XA 1KA9F 3AYSA 2GL5A 1ZAJA 4Z0JA 1YXYA 3AIEA 2PWVA 4XIMA 4X0NA 4LVDA 2OT0A 1JL8A 2Z2BA 4D1IA 3GX9A 4O15A 1E6XM 1W1VA 1ZFJA 4HA4A 1R3SA 1LOLA 4W7UA 5IM51 2J27A 3PULA 3GO2A 4JN6A 4DRSA 1JYWA 1KTNA 4C6JA 4ASTA 2CYGA 3N6QA 5FA5A 5A6SA 1C7SA 4GX9A 2WZEA 3NTYA 4RL3A 3ZJ6A 1UOZA 2ZWZA 5DF0A 1XBXA 4B5TA 3GDLA 5I78A 5HULA 4JYDA 4Z2JA 3CPUA 1YE6A 4TU1A 3BOXA 3CB3A 1DE6A 4JR5A 1BSLA 2DQXA 3UESA 2A79A 2GDVA 3PTDA 4CQAA 3E0LA 4NL1A 4DXKA 1SVDA 2BSLA 1GQNA 3VOIA 3W75A 1TMHA 3WFLA 5FF3A 4HN4A 4B2DD 5AHIA 5EBUA 4H04A 1YTKA 2Y7FA 5E6YA 3OLGA 1HO4A 2R1MA 4HA3A 4QG6A 1B3XA 4HZ8A 4E4PA 5DCBA 1LQAA 2C18A 4ML4A 6A3HA 3ZLGA 1JVNA 3TAOA 1BD0A 4IG2A 1S38A 2GJRA 2EPLX 4GA8A 2IMRA 2CLOA 3PN8A 5CPLA 1O68A 1UW9A 3W73A 1CXIA 5CZKA 4O1AA 3GTIA 3BLDA 1TPB1 4LUIA 1Q6FA 4N9BA 3VZZA 4PB5A 1M3UA 4GY0A 4EPEC 1T5AA 3EGJA 2HROA 1XPGA 1KW1A 1OADA 1WV2A 2NT1A 3OLDA 6TAAA 3WQ4A 4O11A 2WNWA 1WB0A 4H9UA 3HFTA 5DRCA 3U2CA 2BODX 1XCWA 3NPUA 1UWUA 4AVOA 3U3HA 2PZ0A 1PVNA 3AWOA 1W6TA 3GH5A 3PVFA 2XVLA 3WF0A 2D0HA 3UZZA 3CASA 5DBUA 2ZZ5A 3WH8A 5C9WA 4M7TA 3U8GA 1TRIA 1TZ9A 2ANUA 3V3WA 4D6JA 3TYUA 3O16A 3OW1A 4A3UA 1EC7A 3ITYA 4WF7A 1KM5A 4IJCA 3AI0A 1PEZA 3WLHA 2WPBA 2DVUA 3KBSA 1NARA 3TN6A 5T9BG 5GJPA 5CC7A 5A6MA 1KWKA 3O9NA 1XLKA 4I7WA 3OGSA 1XLDA 3SCQA 2NXGA 3FAWA 3R5EA 1QW7A 2OEKA 3C8FA 3L65A 3MJMA 4CQ9A 3G5EA 4GJ1A 5A6BA 3THDA 5C6MA 1BWLA 2EG7A 3KL3A 4Z08A 4K6AA 5E70A 1A5BA 4HJFA 3RCNA 3M5VA 2PP3A 3MCOA 1R9XA 1VS1A 3S2MA 1XLGA 4GVFA 1BTCA 2ACQA 3AXXA 2VVSA 4DJDA 4ADTA 1JDCA 8CGTA 1RCXB 1E1EA 4KWUA 1QPRA 1LLOA 1MYRA 1W5PA 2OT1A 2J7GA 3VOJA 1G9HA 3VIIA 4Z2LA 3UG3A 2GK1B 1FDJA 1WKEA 3C0SA 4DO7A 3P2VA 1Z89A 3LV6A 4DYJA 2PZNA 3VILA 1B4EA 4AX6A 1H61A 2OYLA 1YNYA 1RP8A 3G1HA 3TMLA 4FR6A 4JTSA 1IXNA 3MYPA 3A22A 3LZ3A 5JUVA 3T08A 3SADA 1R46A 4AZCA 3MKKA 4IGNA 3A4WA 4MVAA 2VFFA 3G1RA 3QYSA 1S2WA 3KL5A 4Z2HA 2ZX8A 2PP0A 4LX4A 5E0FA 4DBUA 1F3WA 5BXRA 1V3JA 1VFLA 2Z6JA 1J0YA 4AB4A 3TVAA 2FB2A 1NDVA 4E2DA 1RA5A 1KXHA 4O1CA 2CZEA 4IMGA 1J0KA 1K03A 3M0LA 3MWAA 4LYKA 4RV8A 2GYIA 2QCEA 4HOZA 1VBGA 3AFBA 1UD5A 4KESA 1RBAA 2O9TA 2WLZA 1A80A 1E70M 5F7UA 1LG1A 4C5YA 3HQ1A 1OGBA 2PC4A 1A5CA 5K9CA 1FHLA 2EO7A 3TC7A 4A8NA 5GVJA 3EWBX 1OHLA 1PXGA 3AZRA 3HA1A 1YHTA 3VKDA 4CD6A 4LANA 2I9EA 2ZUNA 4NXKA 1TPEA 1GJPA 2X1TA 3GDTA 3VKAA 1BVNP 9CGTA 1BG4A 2FKPA 2W0UA 1K7EA 3A4AA 1RJQA 3TU9A 1ODUA 4F0RA 1SJDA 2EG8A 1UZ1A 3WL1A 2PD9A 2JFEX 1W31A 3KVKA 3UEQA 3LGDA 4GXWA 4WOQA 4E8GA 4R9XA 3ARZA 4HB7A 1MQPA 3AS2A 4RJEA 3M7SA 2J74A 2X1UA 3L12A 2ZTJA 1JYNA 3E0FA 4JQ4A 2GGGA 4W89A 3AHVA 2WJFA 3L9CA 4C91A 1FXQA 2R1KA 2ALRA 5D2YA 4KERA 2E25A 3DGBA 2A1YA 2YCLB 3UGVA 1H7NA 3N18A 4ATDA 4G7EB 3L4YA 3N3TA 3ALFA 4UQDA 3W24A 1P6BA 2VQUA 2EPKX 3WSUA 4H7CA 6REQB 3O6CA 4GKLA 1I75A 3DN5A 4B4FA 4RNFA 4XZLX 2H6RA 3THAA 4Y7EA 4HSNA 4A29A 1KLYA 1FWSA 3TOPA 4UTWA 2ZA3A 3W1TA 2OJPA 3W2LA 2FJUB 6PTDA 3S2JA 1EDTA 4NT0A 1AZ2A 1CLKA 1J10A 4H6QA 3AMKA 3LRLA 3GNRA 3NYDA 5JBFA 3CHCA 1UWSA 3LGGA 2XFWA 4WRHA 3W3OA 5KZDA 1TPUA 1DJXA 3RX4A 2Z2AA 3UQNA 2A3CA 3LXAA 3T0BA 1U1HA 5FL0A 3QGKC 3KP1A 3TQPA 3CZJA 1CYGA 3DERA 2G4JA 1UP2A 4S3DA 2QR6A 1QW8A 3VCRA 4LB4A 3BJSA 3Q67A 2BOEX 1WKYA 4WY0A 1NP2A 2RH9A 3IUDA 4PUDA 3UYIA 1XYLA 3N04A 1BXCA 4L9ZA 1GVFA 4QLLA 1RR2A 4WSJA 5CPQA 2FZ8A 1F8MA 2OWXA 4WQ6A 4L65A 4QS6A 3FA3A 2YBVA 1L8PA 4DWSB 5C54A 3VD9A 1B9ZA 1UKPA 2FJKA 2J8GA 2JEQA 4MYAA 2UV8G 5BNKA 4O1FA 2WPGA 1ZJAA 3AIWA 5FEWA 2EJAA 4MJMA 3CS2A 5KETA 5F4XA 1UUOA 3W84A 5BMWA 4HT3A 4GQGA 3OQ8A 2NQ5A 4AMAA 4MADA 4AYSA 5J8LA 3RG6A 1AW5A 1OFBA 2W92A 4W7WA 1Z32X 3W7RA 1TB3A 2OTDA 2Y24A 2OR2A 3FX4A 1XIIA 2QUUA 4UNLA 3S5YA 1I8JA 4NZ5A 5HK4A 4A8RA 4Q4PA 4X9YA 3IGSA 3WNPA 2D3LA 5AYYA 3KM8A 2XHYA 5E09A 1K9FA 3CUIA 4NX0A 4LPCA 4UTTC 1I2QA 4DZIA 4ZOBA 2V2HA 2E9BA 1R9YA 3QHOA 5CPTA 4XWUA 4I9TA 1RY8A 1GOQA 5HPOA 3ABQA 2PGRA 4W5UA 5DMLA 2D2OA 3GWQA 1F8IA 1NTHA 2ATMA 4ERIA 3DHDA 2ZE3A 2QQ6A 1A5OC 5BOEA 1JXKA 3NM1A 3GAYA 1UPPA 1UCWA 2QGHA 5FJRA 3IANA 4AWUA 4LVAA 1REQA 3PUEA 5A1AA 1MEWA 3TKFA 4QRNA 3EDEA 4XBJA 1DJIA 3PZTA 1TVNA 1UIPA 3USBA 2XVKA 3W26A 1VBUA 3BSHA 2P50A 1LYXA 4QBXA 2QMJA 5EL1A 1XDJA 3GQYA 2IKHA 7ODCA 5D03A 3G2GA 2GWGA 4ORMA 1KTBA 5A69A 1BKSA 2PTWA 2X05A 4IIBA 4MHBA 4C6BA 3B9DA 3CEPA 4A2SA 3S9IA 5HMFA 5A8MA 3TC3A 2IQ0A 1XX1A 5EKYA 3BO9A 1NDZA 1TJ0A 3U2ZA 5CJNA 3HN3A 2OX1A 1H60A 3OZMA 2DZSA 5C9UA 2WAGA 5H2ZA 1RBLA 4WJEA 1UQYA 1JDAA 3PZMA 3IUIA 3CLMA 3M1ZA 2HEJA 4LBRA 1HKJA 4ATLA 1DOSA 2GOKA 4MG4A 3VDCA 2BGQA 1DTUA 1B3VA 4QP0A 5XINA 3TLLA 2B7OA 3NQFA 3VNDA 4S2BA 3ERPA 1FWGC 2ZRWA 2VURA 3VNYA 3U4AA 2WMKA 5IHRA 3B9OA 2DSUA 3TV8A 3VKKA 1UJPA 2F9RA 1V6YA 1TV5A 3U7VA 4NYYA 1QI4A 4CQ8A 3FYPA 3PHAA 2VP8A 4UCFA 1IF2A 2WZTA 2XSXA 3M0IA 3CQKA 4PBEA 3QW3A 1TPVA 5CZ0A 4GJIA 2PE4A 1JGMA 1XIJA 1PZ0A 1ITUA 4YMZA 2A5HA 3QKZA 1EKOA 4NY2A 4JX5A 2AAAA 2QPXA 3O15A 2JBMA 3MSRA 4GZJA 4BF9A 2V63A 3H2CA 4W86A 2EPMX 4H9YA 4UFKA 1XI3A 2GJXB 3LCFA 3FVMA 2R1PA 4GNKB 3UWWA 4S23A 3SGZA 5H6HA 1Q6OA 4Q6XA 4WXZA 2PI6A 3U0HA 4EPKA 1MMFA 4CLMA 3ABSA 1VCFA 3BH4A 5CQ1A 4IPPA 1VENA 4IIEA 1HG3A 5FSDC 3G1FA 1ZP4A 1A5UA 2XVNA 3KRZA 5C55A 4OQVA 1EFZA 4ZA0A 3W01A 1M68A 3Q94A 4E2VA 3HGRA 5I3JA 5HR6A 1TWZA 3VGBA 1F6KA 3BURA 1E0XA 2WVSA 3TFXA 1NJJA 4DUVA 2OLHA 5A8OA 2R91A 1ZNNA 1GYMA 4BS0A 4DXXA 2ZICA 3R79A 1D3GA 4WD0A 3XIMA 5E9AA 3AMGA 1NQ6A 3BW3A 3STCA 3KDOA 3FHQA 4ZGYA 4HKPA 2QGYA 2ZUWA 4MM1A 1RQHA 4UOQA 2RHGA 3THQA 4X3ZA 1JIBA 4AXKA 1TJ1A 2J25A 1MW0A 4QE1A 1HW6A 3OGRA 5IXEA 1L9WA 1SMAA 5CJMA 1G01A 3HZ3A 4JKLA 4UZSA 5BXTA 2WNZA 3DENA 3BJFA 2PEVA 1D2KA 2TODA 1JZ4A 3MP3A 4D2JA 2VCBA 2G3FA 1U5HA 1B90A 5TF0A 2WZIA 4C7DA 3LHUA 5MKGB 3D0CA 4H7VA 3GIPA 4BK9A 2XU2A 1X1ZA 5FESA 1V3MA 4JNYA 3DFOA 4JIRA 3AMDA 3GUWA 4LCQA 4JEJA 4LNCA 3LHVA 7PTDA 3VU2A 4B3ZA 5AC8A 2YLLA 4Q8OA 4F3HA 2XDFA 4QCEA 3WDPP 2F7FA 4DBWA 3CHEA 3W53A 1H1YA 1TTIA 4V27A 1CPUA 1R3WA 5TNVA 3QTPA 4GH3A 4DJDC 1S2VA 4EWJA 2FH8A 5M2FX 4ECLA 4AD4A 3O2LA 4HYVA 3MUIA 1I9CB 3EDJA 1XRTA 4EX4A 2ZUSA 1UYQA 1R0MA 5RUBA 1GT8A 1YKWA 4AHOA 4NI3A 3TE9A 1V3LA 1CTNA 3C86A 4JFVA 4F2TA 1EJTC 3LV5A 4NRSA 4CCZA 4JBRA 3S1XA 5F2IA 3FKRA 1M6JA 4H6KA 3DOPA 1S3TC 5I5RA 1JUEA 3AS0A 5BOOA 3O63A 2BHUA 1VYRA 5EMLA 3RU8X 4BY3A 5LGXA 2XSAA 4Q7IA 4GO9A 5D9PA 1RVGA 2I7GA 3DG6A 3NAVA 1VBJA 3URQA 1MW3A 3E0VA 2IPWA 2CHOA 1IT0A 2XIIA 4YVXA 3DFHA 4XX6A 2QULA 1YPIA 4LUSB 1SMDA 3NCOA 1KGWA 3CJPA 4C6MA 5M1TA 3LHZA 1CXFA 2OFJA 4PCFA 3DX5A 2YL6A 2QCGA 2WNQA 4U4MA 4CD8A 1M04A 4O13A 2V82A 4FLSA 4INFA 4LT9A 5HXMA 1Q85A 3STPA 4AFYA 2FLIA 4YTQA 1R3RA 2QYGA 4H9XA 4OOZA 3RPDA 3LM3A 2NXHA 1XFBA 1W91A 5AKQA 2VR2A 3H7UA 4S3JA 3RMEA 1GJUA 2E28A 3B4UA 3QJAA 2VGGA 2ISWA 2ZVRA 4AYGA 1WZAA 1EHAA 3OEXA 3EWYA 1RLCL 3FXYA 1CXKA 3DYPA 3I3DA 3UW6A 1KR0A 3HQNA 1W3IA 3P8JA 4I3GA 3I6RA 4MLRA 5DANA 3L66A 3N1AA 1POJA 3N3MA 1KCXA 3GDKA 1XINA 3GTNA 4GIRA 5M17A 5LNRA 4A8LA 1EOKA 1EP1A 1OC6A 1N82A 4H9TA 2OODA 1TTQA 1TV4A 1LF1A 1YTDA 3WL0A 4ZZ9A 4J28A 2OEMA 4B3LA 1VBHA 4H9MA 2QMKA 3TCEA 4ZE5A 3A4JA 2XJ7A 1SSGA 1ODZA 3AISA 3UWEA 1G67A 4GXPA 1RVKA 1B1YA 1H7XA 4KW2A 3CTTA 2OOFA 3O6DA 3V7PA 2CLLA 4MWAB 1THFD 1ZQ5A 3IJ7A 3VNLA 2J7FA 3IS4A 3L21A 2VDHA 5XIMA 4PEKA 1U30A 3SRDA 2CBIA 1AL8A 4C6QA 2TRSA 4ZO7A 1T7LA 2CITA 4XZBA 2PMQA 4CN6A 1BKHA 5A2CA 3N25A 5I3HA 1ADSA 1DIOA 1DXFA 3TTSA 5ECVA 2A4AA 2PLKA 4R85A 1VFUA 4LFYA 4MF4A 3ZLFA 1OM0A 1YLVA 3VGFA 3EOUA 4ES4A 1PZ1A 1PV8A 4BEQA 1AJ0A 3LDVA 2DT2A 4OKDA 1HVXA 3NL3A 4DI9A 3KWSA 3SZ8A 3GR8A 1OK6A 1K9DA 2Q8LA 1GVIA 3HTWA 3RITA 4M24A 1JYXA 1LRQA 4I5XA 1M65A 1JEZA 4LVGA 6TIMA 2EPHA 3F4VA 2DW6A 2VOMA 4WGXA 5LHEA 1GVOA 4P8UA 3WUEA 3CHDA 4LEFA 3KP0A 3AIVA 2YYTA 2GQAA 3QOKA