4O4WA

Crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-gly mutant (tvag_497370)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
RTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFGFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering mutants with altered dimer-monomer equilibrium reveal the existence of stable monomeric Triosephosphate isomerases
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 88
structure length 250
sequence length 250
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o4wA00
4MFDA 2ATSA 1UUMA 3QM3A 4LV9A 1TTQA 3W1RA 3ZR4A 1EUAA 3THQA 3T4CA 4UIOA 4QIUA 1DBTA 3BLFA 2B7PA 3MI3A 5C55A 3NGJA 3OG3A 3UYCA 6ALDA 4O16A 1W56A 1UUOA 3NQFA 4AEOA 3W1PA 2A7PA 1GVFA 5LNSA 1IIGA 4GXMA 4FEZA 3OA3A 5I3GA 3EWZA 1UCWA 3P62A 2C19A 5K9XA 4LRSA 4Z1AA 1OYCA 3L21A 1RR2A 1UB3A 3O6DA 4HKPA 1TPH1 1GQNA 3GB6A 2BWGA 3H54A 5CSSA 1NEYA 1I2PA 3USBA 1PS9A 3KOFA 1A5AA 2DZXA 4UCGA 4MKNA 1QPNA 1GPWA 1H60A 2J9ZA 3W7DA 1P4CA 1FBAA 5IM51 2P0OA 4UTKA 4Y8FA 4ZZ9A 1DV7A 4A2RA 3E96A 5D09A 1JUEA 4IMEA 3STEA 2WV8A 3DBPA 2QEZA 1XXXA 2FJKA 2TMDA 2ZRVA 2WSRA 3CQ0A 1RQEA 4FIRA 4FNUA 3HGSA 3NM3A 5A8GA 1TTJA 1VHNA 3C2RA 1EA0A 3GDRA 5CZJA 3LCFA 4I7WA 4N6FA 1C8VA 4Y90A 4QSHA 1QR7A 1T99A 2VEMA 3IEBA 2WOQA 1YXYA 3L9CA 4WY0F 1HO4A 3W7MA 2ZRZA 3UPBA 2O7SA 2ZTJA 4WUIA 5FESA 4MY9A 3TCEA 4E0CA 2OT0A 1JVNA 4ONVA 1Z44A 1TQXA 3NL2A 1BEUA 2H90A 2A21A 3L2IA 4R7JA 3NG3A 4FX8A 1J2WA 4JTSA 1DQXA 5AB3A 1F5ZA 3S1VA 3TQKA 3EWYA 3G1AA 3TX9A 4ADTA 1X7FA 1OX4B 2C0AA 3UD6A 1XC4A 1VLIA 1QO5A 4IX2A 4M7SA 3A21A 3HPZA 4ORIA 2WNQA 3DFOA 1LOSA 3IVSA 4RV8A 1N55A 4UNKA 1W3NA 4JX6A 1LRTA 4LC8A 4TX9A 3L5MA 4GUIA 3MI2A 3CC1A 3RMJA 1PV8A 2GQ8A 1EEPA 3RFAA 4MJMA 2YFNA 3GX9A 5FF7A 3TJLA 4AHQA 1VYPX 5KMYA 2E5BA 4UC5A 4JYEA 3A5VA 4O52A 3TMQA 1ICQA 1M7OA 3DAQA 1IXQA 5I3HA 2E1DA 3QFEA 4IMFA 1B9BA 3VE9A 1ZENA 1NSJA 2YYUA 4HNUA 2YCEA 1T0OA 5L9FA 3TXZA 3W7HA 5BRBA 2QCEA 3STGA 3NQ6A 3NOEA 1KTNA 1KA9F 3F1QA 3NL6A 1A50A 4GUJA 1QFEA 3PY2A 3M0ZA 3SECA 3TW6A 3UQNA 4A22A 1VH7A 2NUYA 3EEGA 4ZL1A 4JYDA 4JICA 2ZZ3A 4JS3A 3PB2A 1G7UA 1KM6A 3O16A 4O10A 3Q37A 4DEFA 3TQ0A 1G4PA 4NNAA 1L6WA 3NYZA 2Z2UA 5KINA 1GVQA 2Y63A 3TFXA 1VPXA 2ZTKA 2NXIA 3S0CA 2V2HA 3MUXA 3OHIA 5HNRA 5CPMA 3W1XA 3SR7A 4XKYB 1RQHA 4O1DA 3W71A 2ZQ0A 3C2EA 4IXXA 3W1UA 4IPIA 1XUUA 3GLCA 2QDGA 3M5YA 4Q33A 2Y7EA 3A24A 4ZQNA 3DH7A 4Z08A 4E2BA 1TV7A 1L6SA 3EWXA 1N8FA 3PSVA 2G97A 4O28A 5KZMA 3LDVA 1VHCA 5G1TA 1I2QA 3P5ZA 3IV3A 4CCCA 2CZDA 4DPQA 4FNQA 1LP6A 1W37A 3MP5A 1H7OA 1GYNA 1KM5A 4PL2A 1OX5A 4P61A 3C61A 4QJ1A 4UTIA 2A6NA 1JUBA 5CSRA 4O1CA 1VC4A 5F2IA 1MEHA 1ZJIA 1OF6A 3LHZA 2C1HA 1CX9A 1SO3A 3R5EA 1EWEA 1GWJA 2PC4A 1ZNNA 2VFGA 3W1QA 3MYPA 5AC8A 3LBMA 3LERA 3W7OA 1VS1A 3LTSA 3W6YA 4QNEA 1TCDA 5EA9A 4UTTC 2DORA 3PSWA 4BFAA 4O12A 2I14A 3DZ1A 4BWLC 5MHBA 3NPXA 2FB2A 1G67A 1L6YA 3O05A 4KFNA 3I68A 1EP2A 4NZFA 4QM1A 4O1BA 5HUOA 2CWNA 1VLWA 3KFTA 4PFMA 3E49A 4XQ6A 1I2RA 2NX3A 1VR6A 1TJPA 5FI8A 4FNRA 1TPDA 3O6CA 2H3BA 4RKAA 4JXCA 1NFBA 1J5TA 2QCHA 3NVTA 4RJEA 3SJ3A 1JULA 3W7GA 5T26A 3U2OA 1W3IA 4H4IA 3NZ1A 4UFHA 4LS0A 3QPYA 3LRMA 4N02A 4GUFA 1Q6QA 2OJPA 3MHUA 4HN4A 2QCFA 1HFBA 3BV4A 5AC7A 6TIMA 3MBDA 3WJYA 1LBMA 3H53A 3W86A 4LVGA 1ZHAA 3RLUA 4UR7A 4C1LA 4UTLA 2FIQA 2VFFA 1LRNA 4EWND 3W72A 3V75A 4AHOA 2NWSA 5BNKA 2BZNA 2XN1A 4I9AA 1SZFA 2A7RA 3IIVA 5BMXA 3MP3A 1KV8A 3PWAA 4YXGA 5D33A 3TROA 3TSMA 3E02A 1H7PA 4LW7A 1DL3A 2NUWA 2OT1A 4N4PA 2CLKA 4O0KA 1KFEA 3L67A 3O07A 4BI7A 3PUOA 1YPFA 5G4WA 2ZZ4A 5D02A 4MYXA 3LXAA 1TMHA 3IIZA 1F2JA 2O7QA 1ALDA 2RDUA 5F4SA 4MPQA 3A23A 3NQVA 1ME8A 3RK8A 2GJLA 3DFNA 4OWGA 5G1YA 1WXJA 1W5MA 3VE7A 3R8RA 3N2XA 2YPIA 3ZS4A 2CLHA 1HUVA 1LYXA 1JR1A 3N3MA 3C2VA 4MZYA 5KTLA 4XTIA 3TIMA 3CEUA 2J24A 3BG3A 3W22A 3HG3A 1FQ0A 3BPWA 3CIWA 2VEPA 3G1YA 2YDAA 3HBLA 3GDKA 1I2NA 1H7XA 1F73A 2ZZ1A 3L5LA 5LKYA 3LCLA 1SSDA 3UZJA 3A9IA 3GXTA 2Y7GA 4PH6A 4ZQPA 3TSDA 1PL9A 4C1KA 4E2DA 4AB4A 2V9DA 5D03A 4JNMA 1D9EA 2VOMA 1PIIA 3S5OA 3NQ7A 2I9EA 3G18A 3LCIA 2WO5A 4K6AA 2JKEA 3QSRA 1AG1O 5AC6A 2QJHA 1I8JA 3G1SA 4JIQA 2ISSA 5LNRA 1LLZA 3ABRA 4MVAA 1DKWA 3M5VA 2EF9A 4XZ9A 2H8XA 2B7QA 3R2GA 3JS3A 1TSIA 5BMWA 1ZAJA 1E51A 3U8GA 3EXSA 4OHQA 3G22A 5HWNA 4NQ1A 3KVKA 2BTMA 5D32A 1J4EA 2B7OA 3FLUA 1VQTA 3CT7A 3G0XA 3I65A 3NAVA 4MY1A 1UASA 4MJZA 1TPFA 4FXRA 5AN7A 4QISA 2E6DA 1FWTA 1JCLA 3LHVA 1FXQA 3DI1A 2UV8G 2QJIA 2VC6A 3W2KA 1GEQA 5KITA 4NX5A 2QF7A 2C16A 1SFJA 3TNOA 5FF2A 1A5SA 1D3HA 4GUHA 4WOZA 1EIXA 3GKFA 3LCHA 3C56A 5CZTA 3PS7A 3CB8A 3HO8A 3EX1A 1SW0A 1A5CA 3DKJA 1H62A 3W85A 4KWVA 4N2YA 3NDOA 1G4EA 2BXVA 3SY5A 1LM1A 3R13A 3NL3A 3ZWTA 4J9JA 2ZFAA 3PUEA 4ML9A 1IXNA 2AQWA 1OHLA 1O95A 1SZNA 3IIOA 3LM7A 3W1MA 1TO3A 4OV9A 1QPRA 3W7QA 1ADOA 4WY0B 1QMLA 4MUZA 4TIMA 1L9WA 1TPUA 3M9YA 1LRQA 4CCDA 4AF0B 2OCZA 3H55A 2QUVA 1OFPA 2WKJA 4KWWA 4O4WA 1MEIA 1W31A 3O15A 4TU1A 4EOUA 4XUGA 4XWUA 3P84A 4NJHA 5J5RA 1MXSA 4R34A 3UZ5A 2X1SA 1XL9A 1FCQA 3HPXA 3W75A 2D73A 5K4XA 2WSYA 2QUUA 5CZSA 1ZALA 2FPVA 3M6YA 3B0UX 4TO8A 3SFKA 3FYPA 1OX4A 1YTEA 1YTDA 3B05A 4GUGA 2HS8A 5F2GA 4UTWC 1M5WA 1H51A 1OFRA 2NWRA 2ZRWA 1G4TA 1IIHA 1GVOA 1R30A 2Y85A 1WYIA 1PCKA 4K8EA 2VENA 1WBJA 3NNTA 3ANYA 4EIVA 2JKAA 4GJ1A 3OIXA 1LROA 3SGZA 4JX5A 4GE8A 1WDWA 4XBSA 1WX0A 1K7EA 1G4SA 4K7YA 2F7FA 1SO6A 2DZUA 4RXFA 1WOBA 1LBLA 3QMSA 3P8IA 1SZEA 4MLRA 3M5XA 1JCXA 3ABSA 4NJGA 4Z1BA 3S8HA 2KZHA 2YR1A 2PRMA 3S5YA 4LRTA 3PB0A 2ZCGA 3G1DA 1B3OA 2OZ0A 3EWUA 5D2YA 5U4NA 4WXZA 3UWQA 5AYYA 1KM3A 1NF0A 4O15A 3LV6A 1XFBA 2H3DA 1HG3A 1TPC1 3MHGA 1P0NA 4ZQOA 3WK2A 5AHLA 3G0SA 3GZ3A 3F4WA 5E1QA 2QCNA 5DLCA 4O54A 1MEWA 5EL1A 5I3IA 1VGAA 4Z0JA 3TH6A 1TPVA 1QAPA 1ZFJA 3KRSA 1XDMA 1RZMA 1AL7A 1VYRA 3NO5A 4N9EA 1AW5A 4NT0A 1SO4A 3HIJA 2CZEA 1VJIA 2A5HA 2YW3A 4YL2A 3P81A 1RV8A 3FYOA 1FWNA 2NV2A 4WX2A 1LCOA 2CLIA 4BI5A 3IIPA 4GBUA 4LUJA 1TTPA 4GNJA 3MBFA 3QW3A 3S9YA 7TIMA 5DY2A 3GIYA 1AL8A 1SUXA 1GJPA 3GDMA 4DXVA 5U7SA 5E93A 2ZZ5A 5HWJA 1K7FA 4PL1A 4Q4KA 1X6UA 4BWLA 3W7KA 4K38A 3GXNA 3KXQA 4NXSA 4Y6GA 4DO6A 3LB0A 2FLIA 5IBXA 3NL5A 1KFCA 4O18A 2CLMA 3GVGA 2BLEA 5EPDA 4O0ZA 5H91A 3TQVA 3UWUA 4U28A 3LHTA 2GVGA 4OV4A 5HWMA 4K39A 3I7RA 5D05A 1DJNA 1U83A 2J27A 4X2RA 4AWTA 2V8ZA 2Z1BA 1GVRA 4WZHA 3ZFHA 5LHFA 4PODA 3G8EA 2WNNA 3G1XA 3NR0A 3MJYA 1Q6LA 1OYBA 4HNTA 1S5TA 1QCWA 5GVJA 5I3FA 1GG0A 4UTMA 3M47A 1QOQA 2GQ9A 1O60A 4O14A 1W5NA 1WQ5A 1DQWA 1KM2A 4DO5A 3M41A 1ME9A 3ELFA 3EX3A 2FPYA 5CZ0A 3TMLA 2GUUA 5EYWA 1W5PA 1H63A 4CNNA 1JCJA 1TB3A 4H6KA 4WY0A 3QQ0A 5F4WA 5C6MA 1YDOA 5E0KA 4IJBA 4YCPA 4O8RA 2WQPA 3TJXA 5FEZA 3GNDA 3TKFA 3QW4B 2ZA2A 3S5NA 4O13A 3MW7A 4DELA 2IQTA 4LV4A 3MWAA 4GC4A 4AH7A 4RCXA 5A5WA 3NQGA 4N9BA 3W88A 1TJRA 3G1HA 2QAFA 2ALDA 1THFD 3QMTA 3TFCA 1GG1A 3GR8A 3KX6A 4K7VA 3P60A 1X8FA 1LZOA 3TSBA 3TC7A 5CPLA 1PCWA 4X3ZA 2JGQA 5DXXA 2B0MA 2VKZG 3FOKA 4JYFA 1NF7A 1FCVA 1XBVA 4UTJA 3W70A 3W7EA 3QC3A 3VFLA 2FB3A 1K8YA 4LS2A 3O06A 5CPNA 1W3TA 3HMJG 1F76A 3OVPA 2BSLA 3ATZA 3SI9A 1G6CA 3W2LA 3CLMA 1WBHA 3HF3A 4HPJA 4DBEA 4E38A 4FB7A 3QRHA 5KZEA 1M7PA 3NQDA 4ALDA 5LNVA 1JCYA 4IMGA 2C14A 4M7TA 3GNNA 1FX6A 2W0UA 3T55A 1S5VA 1TRIA 2Y7FA 3W7IA 2BX7A 2YXGA 4QITA 2OX1A 2B7NA 2C15A 5DELA 3G8RA 1OF8A 3VCRA 2QJGA 1OFOA 3O63A 4JN6A 3BO9A 3NQ2A 2EKCA 4LWWA 2V0TA 1DHPA 5HINA 5C54A 4TR9A 1F6KA 3U6WA 4LVAA 2DU2A 1VZWA 4XBKA 5AHIA 1F05A 1Y0EA 2ZYFA 1B57A 2CZ5A 2GQAA 4UTWA 3W7LA 1W54A 5AOUA 5AYXA 2RH9A 3WK1A 1KBJA 3BLIA 1IF2A 4IOTA 5LNUA 3LHWA 2C6QA 3JR2A 3WFAA 3EKLA 1EP1A 5CG7A 1D3GA 1FCBA 4OBTA 4JDBA 3SW6A 1B4KA 1KM0A 5D2VA 3DGRA 3QYQA 2HTMA 1C9DA 2X1TA 2Y6ZA 2HS6A 1JJKA 2RDTA 2V2DA 4O17A 4NUWA 3WJXA 3C8FA 1UBSA 1Q3NA 3MP4A 1PHWA 2CLOA 2CLLA 5IBXC 3LI1A 4M5PA 4HNNA 3TDFA 3LTPA 4XKYA 1K3UA 5F1VA 3DFQA 4AHPA 3DU0A 1FXPA 1O5XA 2Y61A 1GOXA 3DFSA 4EF8A 1R2RA 2GVLA 1H7NA 1C29A 2ZDRA 3CM4A 2Q8ZA 1QOPA 1NAL1 3IRDA 4XTDA 4K8HA 4X22A 3S1XA 1SW3A 4FF7A 3PBYA 4JY9A 4O50A 4WOQA 5FEPA 1AMKA 3Q58A 2DJLA 3LRKA 5D2WA 1H1YA 4DF1A 1SR9A 1R47A 3G1VA 4WJEA 1I4NA 5ABTA 1KV5A 4FHAA 1YPIA 4P2VA 1KBIA 3WK3A 4UTTA 1FWRA 1R2TA 1BTMA 1P5BA 3MHFA 4CQAA 1SPQA 4DF0A 3N9RA 2EGZA 2C13A 3P7YA 5D2TA 3DHFA 1GVSA 2A1YA 2X2GA 3TW7A 2I1OA 1OFBA 1AK5A 1S3HA 2Z6JA 1OX6A 4NZJA 3C3NA 1RQBA 1OFQA 1ZAHA 3KHJA 5HR7A 2CFFA 3TR2A 4K36A 3PR2A 5F4XA 4OQVA 5F1UA 4LOCA 2XN0A 5D38A 3TAOA 5KSWA 2VFHA 4IGHA 2TRSA 4I7UA 1IXPA 1KM1A 4YCOA 2J9XA 4S2BA 4A3UA 4O1AA 1VCGA 3EB2A 1TV5A 2AGKA 2GPTA 4UFMA 3SIZA 1RD5A 3NQ8A 4HSNA 4NX0A 4Z1DA 4RZ4A 3GKAA 1WOAA 1Q6RA 1SO5A 4DF2A 4HSOA 3N34A 2QCCA 2PRHA 4NVTA 3KVMA 2G95A 1TQJA 5AYZA 1FY6A 1WA3A 3NQAA 3WJSA 4Y9AA 1I45A 3DXIA 3NA8A 1TTIA 3G0UA 3T78A 2XFWA 5FF3A 1TIMA 2RHGA 3E9AA 3N73A 1Z48A 1MZHA 2E5DA 3S5ZA 3W2NA 3W9ZA 4MFEA 4A21A 5G2WA 2ZZ6A 2V5BA 3GXPA 3LCGA 3STFA 4NNCA 4H3DA 4Z0SA 1X1OA 3B04A 4I7VA 2Q3OA 3W3OA 5C2XA 1XKYA 4G1KA 4LTSA 4NJKA 2ZZ7A 1W5QA 2RKXA 3A5FA 2VEIA 4OU1A 3I7QA 3W1NA 2DP3A 1ICPA 3N2MA 1SSGA 5K3VA 1NVMA 3S6DA 4OE7A 1OJXA 3L65A 2J88A 4M6PA 3W1TA 2P10A 5DCEA 2FPTA 3RF9A 1KFLA 2HMCA 1R46A 2NZLA 4UMCA 3PUDA 1R2SA 1TV8A 1KLZA 4HT3A 5LHEA 1ME7A 1OFDA 3N14A 1W0MA 4UFJA 8TIMA 3CWNA 3SZ8A 2E5CA 3FEMA 4LVFA 2YZRA 3L0KA 3KRUA 4IUOA 5AHFA 4JTKA 1AW2A 1OFEA 2PE4A 3IGXA 5D2XA 2PCQA 3W2UA 4JTJA 3E0IA 3QSTA 3QEZA 2QUTA 4NJJA 1ZAIA 3WJZA 4UTUA 3LBCA 4N4QA 3C6CA 5DCDA 4O19A 2QR6A 4FX7A 4GRSA 1K02A 1DJQA 3PG8A 4CCEA 4JGDA 4YLWA 1H50A 2Z6IA 2Y88A 3G3DA 4PEKA 3LRLA 3G1FA 4JR5A 1FWWA 3G3MA 3BLEA 2XN2A 2YW4A 4IPJA 4O57A 2TYSA 1G7VA 4AXKA 1H1ZA 2WSQA 3B4UA 2YX0A 3TA6A 3FKKA 2VEKA 1WAUA 1GZGA 4JEQA 1K8ZA 2YYTA 3BGGA 4JY8A 1BKSA 2R91A 3P74A 3PAJA 3QH2A 4YMZA 3HOJA 4ORMA 3DI0A 2JK2A 2PRLA 1KTBA 3W87A 3N9SA 1HO1A 3CIXA 3GYEA 4OGZA 1SFLA 4JTFA 3UNDA 2ISWA 2WPBA 2QDHA 3SGUA 3HPSA 2PURA 3KVLA 4AVFA 2NXHA 1BWLA 1LOLA 2ZRUA 3F03K 2Z0IA 3HJZA 3UXAA 4MOZA 5I3JA 4UR8A 3MMTA 1FDJA 3LV5A 5SWUA 1F74A 3UWWA 5K2ZA 3W7JA 3R89A 5TQLA 1V5XA 2QKFA 4PTNA 2C18A 4MLJA 5K9CA 5LNWA 3O1NA 4FIQA 1YLVA 2DZSA 4FNPA 2E09A 3PBVA 1WV2A 1JUKA 3VNDA 1OABA 3BK0A 3EX6A 5BW6A 5TBOA 2V5LA 1F7BA 3W76A 3GDLA 1FDZA 3W7RA 4ZMGA 5CPOA 4AWSA 4UMAA 5FF4A 3EX2A 1T96A 1FWSA 1SQ7A 3CU2A 1KM4A 2YSWA 1SZGA 1T8XA 4IX0A 4O53A 1OFAA 4CQ8A 3S42A 1CW2A 2QCMA 2A4AA 3LXCA 5AHMA 2VELA 3W2JA 3PM6A 4QNWA 1W5OA 5DN1A 2QCGA 1KFKA 3LHUA 4CQ9A 3LI0A 2A85A 5EMUA 4JTTA 4AF0A 4X9SA 2W6RA 3KVJA 4A2SA 2FFCA 2R14A 4O4VA 2CU0A 3QF0A 1H7WA 3KAOA 2NV1A 3IIXA 1OK6A 4JD4A 1SW7A 2A2IA 1ONRA 3UY7A 3GAYA 1QDSA 3PG9A 4ZQMA 5G2HA 2QCLA 3S1WA 2FTPA 1LBFA 3EXTA 4JTHA 5F2LA 4N9CA 2Y89A 3L68A 3T40A 3FJ6A 5D30A 4IQLA 3AJXA 1FDYA 5FF0A 5AHNA 4AWUA 3TUUA 2Q3RA 3W2MA 1XBXA 2JBMA 3EWBX 1YTKA 2EAWA 2CZFA 2R94A 2X16A 3I6RA 3QPZA 4LU0A 1JRCA 3BW3A 3FA5A 2CLEA 2W79A 2V30A 4O11A 3M1ZA 4ZQRA 3B06A 2OMAA 3BW2A 2P1FA 2NUXA 3FFSA 2CW6A 3W1LA 1SU5A 3FJLA 3P67A 1DOSA 2A6LA 1W8SA 4UXDA 1N7KA 4MYAA 3UWVA 2DZPA 3GDTA 2QCDA 1TYGA 1JQVA 1JCNA 1V7YA 3PULA 4POCA 5D37A 2JKPA 2E6AA 4N9DA 1LOQA 1M6JA 1ZCOA 4ZQCA 1KLYA 1BWKA 1KW1A 4EF9A 2EHHA 3ABOA 4S1FA 4UMBA 2GJNA 3G24A 4KKXA 4FNTA 2ATMA 1GT8A 5FEXA 4RZ6A 1XM3A 1H5YA 3M43A 4UFIA 1TREA 4FX6M 3W7NA 3FS2A 3NEVA 3D0CA 4W9TA 3T7VA 4CLMA 4MY8A 3A22A 3B8DA 3PVFA 4FXSA 4R33A 3PBWA 4GFSA 3IVUA 2YFOA 4KFOA 5J5DA 3Q94A 4FNSA 3MO7A 3W1AA 3LXBA 4PC8A 3FIGA 3NQEA 3HGRA 3LCXA 4AAJA 3P82A 3CWOX 4UNLA 5AHEA 4HIBA 4PCFA 3DKLA 2YGYA 3S1UA 1F6PA 4ADUA 3V1PA 5BOOA 2AAMA 3L0GA 1XCFA 3CTLA 2Y7DA 4U4MA 2B4GA 3TE9A 4RX0A 4IWWA 3SSJA 3AO0A 4EVZA 1O5KA 3L0NA 4R53A 1OVDA 4JTGA 3NQMA 3IVTA 3RNDA 4HNVA 2V82A 1AW1A 5KZDA 4JIPA 2QAPA 1YXDA 1JQXA 1QPOA 2ZA1A 1Q45A 1CI1A 4JTLA 3BG9A 3FKRA 1TPB1 3EXRA 5LSMA 4MIMA 4LT9A 3W23A 2JGYA 3P61A 4GWEA 4YWIA 4LC6A 3C2FA 2E6YA 3QMRA 3B0PA 3STCA 2WJZA 3RLVA 3VI2A 3W7PA 4BI6A 3BGJA 1I2OA 2GOUA 3OVRA 1VYSX 1EB3A 3HG4A 4N6EA 3UXDA 3MYOA 1A5BA 1XBZA 3B0VC 1TPWA 4RK8A 4L4LA 3B03A 4IMDA 1QPQA 3UWZA 3UWYA 3MI6A 3C0JA 1EUNA 4TMBA 1H61A 2NLIA 2Q8LA 5K9DA 1P0KA 1KTCA 4HPXA 2TSYA 3DENA 3I7SA 3NPWA 3W83A 3O8AA 5DBTA 5DXYA 1L2UA 2ZRXA 5G5IA 3ZWSA 1Q6OA 2X1RA 3INPA 3LOTA 4Q32A 2DZWA 1TPEA 3TXVA 4CNOA 3PC0A 4M6QA 3NM1A 1VCVA 1PVNA 2GVJA 5HUPA 1K8XA 4OT7A 4BR1A 3BARA 5LZLA 2G96A 5FEWA 1YADA 2H6RA 4ICNA 3N19B 4WQ6A 2TPSA 5K7JA 1LDCA 4JX4A 1QNVA 1UJPA 3M16A 3W7CA 1QWGA 5AFDA 1VRDA 2DJXA 3HGOA 1QO2A 3BW4A 4KFPA 4RZ5A 5LGZA 3DFPA 3QJAA 2J6XA 3GR7A 5LGXA 3LLFA 4DQWA 4MZ1A 3WK0A 4L4MA 4D2JA 1IXOA 1HTIA 1RPXA 4JTUA 4CNPA 5D04C 4LVDA 1FCUA 3HQ1A 3P5YA 4LY8A 2WNZA 2HSAA 1RVGA 5HJLA 2ISVA 4ZVJA 1A53A 5CKSA 5DY3A 1HL2A 3WJWA 4QQ3A 3ABQA 3W07A 4MZ8A 4DO4A 2E6FA 5G2IA 1YXCA 2LLEA 1FUYA 3M5ZA 3LX9A 3TV8A 5EKYA 1EX5A 3QZEA 4NNBA 3W84A 1EP3A 3M44A 3NXFA 2A0NA 3F4NA 5CGQA 3T44A 2V81A 2NX9A 2DZTA 3OVQA 3IGUA 1VCFA 1GTEA 4DBDA 4IXHA 5L6UA 2Y62A 1XBYA 4JTEA 4JDYA 3GAKA 2VFIA 3LHYA 4LS1A 3O6YX 4S2CA 3HB9A 4BK9A 4HHPA 4JTIA 2R8WA 3P8JA 5G4EA 3LGEA 4RLIA 5HULA 4BF9A 2ZA3A 4UFLA 3VKJA 3HG5A 2X1UA 1IGSA 5EBUA 1O4UA 4A29A 3L5AA 1XI3A 5I3KA 2F84A 3PBUA 4LNYA 1OK4A 1JCMP 1X1ZA 3UPWA 3YPIA 5DBUA 1W1ZA 2ZBTA 2FQIA 3M7WA 1U5JA 4Z1CA 3KRZA 1TRDA 4WXYA 3LTYA 1P1XA 2DZVA 3TU9A 5HMSA 4UTHA 2RDWA 3RU6A 2RFGA 5HQEA 3BG5A 1YDVA 3DFTA 5H2ZA 4RR4A 3EX4A 1ML1A 1Z41A 3TC6A 1O94A 4TMCA 2EPHA 3C52A 2Y70A 3P80A 1G69A 3CHVA 3CPRA 2CLFA 4DPPA 3NQCA 1GTHA 4PA8A 1LLWA 1YDNA 1MSSA 5TIMA 4WD0A 2C3ZA 5C5YA 4M6VA 4UUIA 1ZY9A 4NXKA 4LUIA 3HGJA 1B4EA 1JRBA 1S5WA 1K7XA 3K30A 1EWDA 1XDLA 1YYAA 4QAIA 3TAKA 3NPUA 4NJIA 1LTDA 2ZRYA 5K4ZA 3NZRA 3EWWA 4AMAA 1ICSA 2G5WA 3BVJA 3C2OA 2ABAA 2A7NA 4B5NA 4LVBA 5HR6A 1KFJA 2V2CA 1PHQA 3OBKA 1OYAA 2E68A 3LLDA 3JRKA 1LORA 3NPVA 3LCWA 2J9YA 2NX1A 4UFKA 3EKZA 2QCDB 4K37A 3Q2DA 1MO0A 4FO4A 1OG0A 3R12A 3L66A 1Z42A 2VFDA 2E77A 1KFBA 3OEXA 2FDSA 5EY5A 3E12A 3CEPA 3QQ1A 3DHDA 2ZZ2A 3TK7A 1DORA 4IMCA 2NXGA 2VFEA 3ATYA 4M19A 3PF3A 3W74A 2VXNA 4Y96A 1H7RA 1PE1A 5DCBA 4ADSA 4RXGA 3W73A 2ABBA 5F2MA 3HG2A 4NU7A 2H8ZA 2X30A 1K03A 1DVJA 3GK0A 1GYLA 3UY8A 1EPXA 3THAA 3C4UA 3IGSA 1XUZA
chains in the Genus database with same CATH superfamily
3RX2A 3SURA 1L0PA 1UUMA 2OSXA 3QM3A 1TTQA 1EHAA 1KRBC 1ONWA 4M1BA 5BXPA 1KR1A 3JZUA 1RK6A 3N6HA 5EMKA 5BU9A 2VR5A 4F66A 5C55A 4JIEA 3OG3A 3UYCA 4CUCA 3A4AA 4RNIA 1I75A 3T09A 1UUOA 4GISA 2A7PA 1GVFA 5CPQA 1CPUA 2YL8A 5LIWX 3OA3A 3P62A 3RJYA 3B0XA 1U2YA 4QLJA 3MUIA 2R1LA 4RDVA 4Z1AA 3W37A 3L21A 2XH0A 1UB3A 3O6DA 2NT1A 4HKPA 1GQNA 3H54A 5CSSA 1I2PA 3USBA 2BHYA 4DX3A 4LYPA 2DW7A 4PMYA 2BXZA 1GPWA 3W7DA 2OSYA 2P0OA 1PZ3A 4S3CA 3CZEA 1JFXA 1XPYA 3GHTA 3DBPA 2QEZA 2FJKA 3RM4A 2WSRA 2VP8A 3CQ0A 4GXWA 4HA0A 3HGSA 3ABXA 1TTJA 2WCGA 2XPKA 1FH8A 1W2PA 2OEMA 4QSHA 1T99A 2W3ZA 1WUEA 2WOQA 3KCLA 1Q5MA 3B8UA 3L9CA 4WY0F 5E0CA 3W7MA 3W02A 3VKDA 3BLKA 9XIMA 3EDFA 1IE7C 1KO0A 2A21A 1AZ1A 4FX8A 4JTSA 5AB3A 4F8XA 3JZEA 1JYWA 3S1VA 2OOGA 3SUSA 4GCXA 2Z00A 4JN7A 1BYDA 2C0AA 1XC4A 4ACZA 2VUNA 3WLMA 4AX7A 1UH4A 1QO5A 4C6FA 3DFOA 1LOSA 4RV8A 4E2VA 1W3NA 1QNPA 2EG8A 3MI2A 1A5MC 3CUXA 1PKLA 1I9CB 3CC1A 3HZ3A 3RMJA 1YIXA 3N6JA 1A5KC 1EYWA 1FFQA 3GX9A 5HA7A 3REQA 1VYPX 3MV01 3TLLA 1ICQA 3QOMA 2E1DA 1CXKA 4ATDA 4WLCA 4HNUA 4LB3A 1Q7ZA 1E6RA 2Z2BA 3AWOA 1KTNA 2A3LA 1KA9F 3TVAA 3AYTA 3VZXA 1QFEA 5REQA 4UB9A 4YJ5A 4A22A 4E4PA 1PKYA 3QV8A 1D8WA 3IJ6A 1K9TA 3PHAA 4JS3A 3PB2A 1KM6A 5XIAA 5HPCA 4DJDA 1H0IA 2ZE0A 3WO8A 1L6WA 2ZUUA 3NDYA 3EA2A 3M0JA 3N4EA 4ZGYA 1GVQA 2QF8A 4L64A 1LUCA 9XIAA 2J7FA 3QOKA 4IL2A 4HTYA 2ZQ0A 3BCDA 3C2EA 3W1UA 1XUUA 2QDGA 2HV5A 2Y7EA 4GKTA 4Z08A 4E2BA 1U5VA 1L6SA 3T0TA 3K1GA 3B9EA 1JCTA 3VU2A 4O28A 3VOHA 1KGUA 1V3IA 3BOXA 2V3EA 4MHBA 3R8GA 4DBWA 4CCCA 3OQ8A 3G77A 3CZ8A 1R3RA 1GYNA 4PL2A 3H12A 1JZ7A 1OX5A 1H49A 5CSRA 2BB0A 4O1CA 4XZMX 3EDKA 2VUYA 4HU0A 4H7VA 3AWNA 3LHZA 1GWJA 1ZNNA 1DEDA 1IGWA 4LXFA 2WMJA 3W6YA 3CO8A 3PSWA 4O12A 2OYLA 1EL3A 1QPKA 2O9PA 3IWPA 4BWLC 2FB2A 3EDDA 1L6YA 4QM1A 2P3EA 4O1BA 2CWNA 3ZQ9A 1VLWA 4R3UA 2GDUA 3E49A 1I2RA 1VR6A 4LQ1A 2YKKA 3AISA 4H2CA 1TPDA 3AS1A 1NFBA 3PJXA 1J5TA 3NVTA 2PF0A 5KEZA 2EJ1A 4BQ5A 5T26A 1W3IA 3QGKC 4UFHA 1Q4WA 2REQB 3SBFA 4GUFA 1Q6QA 3BZJA 3MHUA 3D6NA 1HKIA 1FRBA 3WLOA 1XIIA 1GEHA 2J78A 3W86A 4DY1A 1Y7VA 4TXEA 4K8GA 4PTDA 4XZNX 3LY0A 3ECQA 1CDGA 1E9LA 5A8PA 1RH9A 4QS5A 3WLPA 3UGRA 2HZGA 3NDZA 2FIQA 3VIGA 4QBXA 5I7GA 1EJWC 2EEXA 4DUVA 4AHOA 3B8IA 2BZNA 5BNKA 3AXXA 4I9AA 2Q71A 3UJSA 4ERAA 4YXGA 3EOOA 3WF3A 2JF6A 5KETA 1LT7A 4KEZA 4O0KA 3RYSA 3G6MA 3EAUA 1ALDA 1QT1A 5F4SA 3TYCA 1QUMA 4MPQA 4LAMA 3DFNA 4AU0A 3PNZA 2EKGA 3WLKX 1W5MA 1ITUA 4WJXA 3S2LA 4S3AA 2J24A 3S5SA 4GZIA 2YDAA 4D8ZA 1V02E 4UZUA 1UYQA 4JIIX 2CXGA 4LCSA 5LKYA 4W8BA 4HD5A 3UZJA 5DFAA 3WYZA 4PH6A 1PL9A 1UKOA 4E2DA 4WHBA 4AB4A 3T08A 1Q8AA 2Y8UA 4WGXA 3R1ZA 2V3FA 2QIIA 3URBA 3LCIA 2JIEA 1BYCA 1AG1O 4PB5A 3TWBA 4KF1A 3G1SA 2CYGA 2ISSA 1AJZA 2CBVA 3A64A 3U8GA 1E51A 2X7VA 3KVKA 4F9JA 2BTMA 1F3XA 2E28A 2W62A 1H2JA 1VQTA 2WZTA 1EKOA 6XIMA 1P6BA 1O1HA 3OLGA 3QKEA 4AQLA 1EA9C 1UASA 2E6DA 1HKKA 3DI1A 3ZVHA 5H8MA 3W2KA 1GEQA 1LT8A 4HHLA 1GK8A 3BURA 3TNOA 3T2QA 2QS8A 3IV8A 1TVLA 1R6WA 3CV7A 3C56A 3OA5A 3PS7A 3HO8A 1SW0A 3DKJA 2BNJA 3GXMA 1WB0A 1H62A 3VMOA 4KWVA 3VC5A 5M2FX 3F5KA 2VX6A 2V6AA 3TA9A 2OTDA 2E67A 2AQWA 1V0KA 1XPGA 1ADOA 2QT3A 4TIMA 1GUVA 4AF0B 3H6OA 2QUVA 1OFPA 3WMSA 4O4WA 3CK5A 3I6TA 3O15A 4TU1A 4XWUA 2E9MA 1RA5A 3UZ5A 4R34A 4Z2LA 5EFDA 4IH3A 4HZMA 1QK2A 7CGTA 3CAVA 3UJRA 1A49A 1ZALA 4D6DA 3KOYA 1YTDA 3U57A 1M01A 4JTAA 4WIWA 1OFRA 4ZE4A 1W8GA 1IIHA 1GVOA 2Y85A 3ITTA 1PCKA 4EIVA 2O56A 1LROA 4GO8A 4CGTA 4JX5A 1X8CA 1SO6A 4Q4OA 4GQQA 3RITA 3OIHA 2NSOA 3QMSA 1HT6A 4OJYA 4KPLA 1XV8A 3P8IA 4IP5A 2CERA 1TVPA 4PMQA 2KZHA 2OELA 4L6HA 3M0KA 3EWUA 3UG4A 4IFKA 5U4NA 4HTBA 2FTYA 5AYYA 1T41A 1F9CA 1KM3A 3E2SA 5I5RA 1TVNA 4E4UA 1TPC1 4YVXA 4ZXOA 1Q13A 3AMDA 4B16A 4ZQOA 2WZEA 1EZ2A 1YQ2A 3QFWA 1MEWA 4INFA 2ZWZA 2PDFA 3KRSA 1KXTA 1VYRA 3ALGA 5JVLA 2V68A 4IQEA 3ITLA 3HIJA 2CZEA 3BMVA 1VPYA 2A5HA 2YW3A 1PTAA 5FSEC 3L2MA 3FYOA 3UCCA 3GQYA 3VM5A 4GC3A 4D71A 5I06A 2G0WA 3IIPA 4GBUA 1TTPA 3S9YA 3QW3A 1JI2A 1ZRQA 5E0FA 3GIYA 1AL8A 1V02A 3UG8A 2B81A 3FSUA 1DJXA 3AXHA 3OGVA 3ICJA 5HWJA 1IV8A 3KXQA 1E0TA 3TLQA 3KCJA 4DM1A 5HJXA 5KZ6A 2VD9A 2D22A 1KFCA 4DJED 3K8KA 3GVGA 3WD1A 3ZOAA 4ECLA 5A8QA 5C9UA 5EPDA 2ACRA 3ES7A 5D9NA 1GJUA 2DV0A 2QPUA 3LHTA 1GJWA 4PUJA 2I56A 4HMEA 4H9YA 4X2RA 4JCLA 4AWTA 2Z1BA 1GVRA 4PODA 4GZJA 1Q6LA 1Z32X 1X97A 1JNDA 4HNTA 4E3VA 2GVEA 3ITCA 1GG0A 4S23A 2YA2A 3JW7A 2PWVA 4UTMA 3M47A 2GQ9A 1O60A 1C3FA 3T2OA 1WQ5A 1DQWA 1KM2A 2QIWA 1TE6A 5HMDA 2FPYA 5CZ0A 2I7GA 3IGHX 3ZVIA 4CNNA 1TB3A 4WY0A 5DQPA 5AYIA 3WN6A 1IZJA 1A0EA 4O8RA 2WQPA 3TJXA 4C91A 4ES4A 3WBEA 4GACA 3QW4B 3S5NA 4H8HA 1SJCA 3ZJ8A 4IP4A 1XG3A 5AZ1A 3NQGA 5HK4A 2ALDA 3QMTA 1GG1A 4YVPA 4AD5A 1MFVA 3KX6A 4XK2A 1LZOA 4URIA 5CPLA 1PCWA 4S3JA 3M4HA 3PPCA 4X3ZA 3IS4A 1WZLA 3WNNA 5DXXA 2B0MA 4JYFA 1NF7A 3WUBA 1XH0A 1XBVA 3QC3A 1K8YA 3O06A 5CPNA 3HMJG 4BHYA 1UP3A 3RRAA 2OZ3A 3ATZA 3CLMA 3HF3A 4DBEA 1PTDA 2PLMA 1M7PA 1A0DA 4ALDA 1LQAA 3GG0A 2C14A 3CHDA 3CMGA 1VBHA 2W0UA 3SCUA 3T55A 1S5VA 3KE0A 1TRIA 2QJJA 4A4AA 4TVUA 3BJTA 2OX1A 3GUWA 1ENUA 3PZIA 3PZQA 1K6WA 3G8RA 5ECUA 2QJGA 4QCEA 3E74A 3UF9A 1BSLA 2WMHA 4PMRA 2DVTA 2R1PA 5C54A 3QZ6A 2PTYA 1XRTA 5CC6A 1H41A 3KTXA 1KRCC 3RILA 3ANVA 3JU2A 1B57A 2GQAA 1S38A 3OU8A 1SZRA 5AYXA 3CMJA 1VBRA 2R1KA 2J7DA 3CH0A 3MPGA 4IOTA 1S2AA 3LHWA 4Y9PA 3CYVA 1T8QA 2PWUA 2C1IA 4AWEA 4JDBA 4W4QA 4KEMA 1KM0A 3BUVA 2HTMA 3L23A 2RDTA 1OG6A 3FYYA 3DOPA 3ERPA 1UBSA 1Q3NA 1EGVA 5IBXC 2CETA 4NYUA 3MUY1 2Z7GA 3O7UA 3GHSA 2YXOA 1K3UA 2J62A 4UOZA 4AHPA 4WDUA 4FLOA 5B7YA 2GJXA 3O6AA 4OUEA 1IEIA 4FMVA 1R2RA 1IR2A 2ZDRA 3CM4A 4O0QA 1QOPA 4GY0A 4PRTA 4JIHA 4YNGA 1AD1A 3W01A 1SW3A 3M0VA 3PBYA 4O50A 5FEPA 4I90A 3AUOA 2DJLA 5D2WA 4E5TA 1RP9A 1R47A 1ADSA 4Q8PA 4QLLA 4P8XA 3OZYA 4OFCA 2PZNA 1FWRA 4W7VA 2WCAA 5A8OA 1R2TA 2HPMA 3AMKA 3MHFA 4J3UA 3N12A 4CQAA 2EGZA 4ZO6A 1KCZA 5HXMA 3N6QA 2ONEA 3SEPA 4IIHA 3DERA 3F2CA 3TW7A 2QPXA 1OX6A 2VZUA 3NSNA 2VDHA 3C3NA 4IL0A 2WKGA 1OFQA 3KHJA 5HR7A 4M80A 3TR2A 3PR2A 3SY1A 3GNPA 2Q01A 5F4XA 4C6OA 1RSCA 4JL1A 4LOCA 4C6CA 5JUVA 2VZTA 4IGHA 3LQGA 4WKFA 4KMQA 4YCOA 2J9XA 2ODOA 2XVNA 7PTDA 1TV5A 2DUXA 5CSUA 3NQ8A 2XGZA 4RZ4A 1NWSA 1E55A 1WOAA 4AD4A 4DF2A 1IT8A 4B3LA 2PRHA 4NVTA 3KVMA 2XIJA 2G95A 3GXDA 2HBXA 4XIMA 3TN4A 1ZU8A 4DZIA 4ILSA 4Y9AA 2X40A 3DXIA 2TODA 1TTIA 3T1GA 3T78A 6ENLA 3KWXA 3PANA 4D6FA 3VMPA 2D24A 4BQ3A 5E9AA 4EP8C 2WSKA 2ZC1A 1Z48A 2ZX9A 1MZHA 2DSKA 3W2NA 4MFEA 2CKRA 3STFA 3N29A 4W7WA 3NO1A 3CL7A 4G1KA 2CWXA 4NJKA 2NLYA 2RKXA 3A5FA 2PDCA 4EXBA 3I7QA 1ICPA 3N2MA 2PI6A 5ABEA 5DRIA 1OJXA 3VFCA 2OYKA 4DYJA 2J88A 3RIKA 3RGTA 4M6PA 1ISXA 4B4FA 1KFLA 4Z17A 3PUDA 3VZZA 1OB0A 2FHCA 4HT3A 2VZVA 4KS0A 5LHEA 1OFDA 1V3MA 1HVQA 3FEMA 1NDZA 2PDQA 2YZRA 5AHFA 4MMWA 1OFEA 1GQLA 1E6PA 4UTUA 3LBCA 3THDA 1MDLA 3RX4A 3GU1A 1K02A 1AUSL 3BE7A 2Y88A 1QW7A 3H2OA 4PBEA 5EU9A 1BXCA 5I09A 1C91A 7REQB 1JZ8A 4O57A 2TYSA 1QNSA 2WSQA 3TA6A 1WAUA 3KOZA 5C7HA 4HNLA 4ZO8A 4PBGA 2F6XA 2HNEA 5XINA 1M9HA 2PWGA 2JK2A 2UZ9A 1GCYA 4KRUA 1QI3A 1JZ2A 2V69A 4JTFA 3UNDA 1FHUA 2EBNA 4B5WA 4TTUA 5A6SA 1J0ZA 1IR1A 1BD0A 1RAKA 4H7CA 3A3HA 1FDJA 3NCOA 1F74A 5K2ZA 3L4WA 3UERA 1QNQA 1V5XA 3BMWA 5IDIA 4PGLA 3VDCA 1FHVA 3UA4A 4KEVA 1X1NA 3O1NA 4EANA 4QS6A 4DJFA 2E09A 1WV2A 1JUKA 2WZHA 3VNDA 4WK9A 4MSSA 3FY1A 1WCGA 4F0KA 1F7BA 4JKKA 3GDLA 3W7RA 4UMAA 1FHLA 1EPVA 1ZUAX 3CU2A 4JFSA 2NW0A 1YE4A 3KBSA 4IX0A 4O53A 3UA3A 4HYWA 3VX1A 1XF0A 1Y8BA 1BRLB 4B3ZA 3W2JA 3PM6A 1QTWA 4QNWA 4C6DA 3SQLA 2P50A 3LI0A 3ITVA 2VOTA 5EMUA 3KVJA 3QHNA 3V36A 3AHXA 2Z1VA 4O4VA 4L6OA 4F0RA 1S2CA 2PAJA 3IUHA 1SW7A 3V1HA 1J6OA 2A3HA 1QDSA 3PG9A 4ICCX 2QCLA 3EXTA 1PJ9A 3LPPA 3AMCA 3WH7A 5DX7A 3L68A 4U5IA 3T40A 2DY3A 3FJ6A 4J5NA 4LUYA 5BXRA 1OC6A 3AJXA 2HVNA 2BY0A 1V51A 5AHNA 1YMYA 2Q3RA 2XJ7A 1XBXA 2JBMA 3EWBX 3E1F1 3LQLA 3PK7A 4RNHA 2X16A 1K8CA 2AQVA 3I6RA 3GC4A 4LYRA 1JRCA 2E25A 2V30A 3M1ZA 2OMAA 2BGSA 2AAAA 1N7KA 2PDYA 4CN1A 1XQLA 4GVHA 3FXYA 4FLQA 3GDTA 2QCDA 1B3YA 1ONEA 4XIAA 1V7YA 4POCA 2JKPA 4Q8OA 5FL0A 5A6TC 4ATLA 3MJMA 4EF9A 3LD5A 5TNVA 2GJNA 1BWVA 3G24A 3N17A 4KKXA 2WZMA 4FNTA 1GT8A 3QKZA 1AQ0A 3W7NA 3FS2A 3T7VA 4CLMA 4MY8A 4AZIA 5J8LA 4KFOA 3QY8A 1EDGA 3W1AA 4REQB 4LAUA 3FIGA 3NQEA 3HGRA 1E15A 1XISA 1KRMA 1E6NA 3P82A 5FKYA 5AHEA 2Y4SA 4PCFA 1BG4A 3V7PA 5FOOA 3S1UA 3MA8A 1DWGM 1VIWA 4U31A 2QNEA 2FH6A 2WHKA 4PRWA 1QASA 1FP9A 1Z69A 4PUDA 3KP0A 1JF6A 1XIFA 1A5UA 2GGGA 3AO0A 3ITOA 4EE9A 2BOFX 3L0NA 4F0HA 3SRFA 3RAOA 4GYPA 2QZRA 3IVTA 2PDHA 1ITQA 1ZS2A 1AW1A 2DPEA 3MMWA 1PO9A 4X61A 1ZP4A 4KBXA 2XM2A 1YXDA 2ZA1A 1U30A 3ZM8A 1TPB1 4L5ZA 1YHTA 4MIMA 3MC5A 1UWSA 1TFVA 2J8FA 4Y8EA 2JGYA 3LM3A 4PMOA 3KLLA 1T6MA 3B0PA 3STCA 2QHAA 3QBUA 1X7IA 3VI2A 1TV3A 3BGJA 2GOUA 1KCLA 3GBEA 3HG4A 4N6EA 3MYOA 1A5BA 2J6VA 4L4LA 3Q65A 4F48A 1EQPA 2ZX8A 4HA4A 5JBEA 1KBBA 1FWHC 1E5NA 1H61A 1P0KA 3T05A 2O92A 3H22A 3LEPA 4HPHA 2ZWYA 5DBTA 1UWUA 1BF6A 1IEQA 3TTOA 2OZTA 4Q32A 2DZWA 4OBSA 1WDSA 4BZYA 2BHZA 1B3ZA 1XLMA 4P7QA 2IQ0A 1U1JA 2WMGA 3GU2A 4ICNA 3SRHA 4LB4A 3PJUA 3H4XA 2J7EA 1XH1A 1EJUC 3M16A 1MRQA 4K1WA 1QO2A 1EEXA 2J6XA 3GR7A 3DGBA 2J66A 3WK0A 4D2JA 1QVBA 1W3LA 1HTIA 1CGWA 4JTUA 3SQMA 3VCNA 4LVDA 3UR7A 3HQ1A 2WNZA 2IPFA 2ISVA 4ZVJA 1A53A 3ABQA 4MZ8A 1UJQA 2LLEA 3O0FA 1FUYA 2DH3A 3M5ZA 4MDOA 1ZJAA 3WBAA 5EKYA 2J47A 1EP3A 4GI4A 1H1NA 4C1NB 3HQNA 3T44A 2NX9A 2DZTA 1N8IA 4O8AA 3WDRA 2O55A 3GAKA 1UWTA 3LHYA 2IUZA 4IGMA 4HCDA 4P8VA 3O6YX 4S2CA 1ZP3A 1ONXA 4BK9A 4BF5A 3CUFA 4JTIA 5HULA 3U9IA 2ZA3A 1EYEA 1EC7A 1IGSA 4BS0A 1AJ2A 3L5AA 3S6OA 1XI3A 2PF8A 2OQYA 2F84A 3PBUA 5CPSA 2QV4A 4AUBA 1W1ZA 1Q4NX 2ZBTA 2FQIA 4CD6A 4Z1CA 3VNIA 1E43A 2RDWA 2RFGA 5HQEA 2POTA 4YHEA 1FWEC 3BG5A 3DFTA 1ML1A 1Z41A 3TC6A 1W9DM 4J1OA 2P3ZA 2EPHA 1KFWA 3P80A 1R85A 5BOFA 3CHVA 1Q2RA 3NQCA 1GTHA 3MUZ1 1BVNP 2EPNA 4BQ2A 5C5YA 2XSXA 4QJ5B 1ZY9A 4GPNA 2ZOXA 3HFTA 1MQQA 1JRBA 3PPHA 3K30A 1EWDA 1XDLA 5DRCA 4QCFA 2IPWA 3N1AA 4G7EA 5C7VA 3NZRA 3EWWA 2PGRA 1J0YA 1E4LA 1XWYA 2DSUA 4LVBA 5HR6A 4JKLA 1J11A 2V2CA 1PHQA 2E68A 2WKLA 4ZODA 3WUFA 1TJ2A 5F7UA 3ONCA 3JRKA 1LORA 3NPVA 3N25A 4NZ4A 4P8UA 3IJ8A 1VJZA 4B91A 1ADDA 2QCDB 3L4XA 1GNXA 2ZVIA 3UJEA 1IT7A 4F40A 1FVPA 3UT0A 4Q8QA 5FACA 4QDPA 3LPOA 4I8DA 5ENLA 3S83A 5DMLA 1OY0A 1UWQA 1Q2SA 4LAOA 2FDSA 3E12A 3CEPA 3VDAA 3QQ1A 3DHDA 1XIMA 2ZZ2A 3M0HA 3KL5A 2CCRA 3WH6A 3WQDA 4CNUA 3AHTA 4KCUA 4M19A 3PF3A 3VNYA 3IJQA 4Y96A 3UBPC 3ZO9A 1AD4A 1XX1A 5IOBA 4JNYA 1TZZA 3RPMA 4TVCA 1XIBA 1DQUA 2X30A 4EAYA 3QLDA 1DPMA 3C4UA 3HMCA 1XUZA 4Y7EA 4J4KA 3SCTA 4MFDA 4QR6A 4JTQA 3E5PA 4S3KA 3ZR4A 5CEWA 3I3BA 2YCLB 1WXZA 3BLFA 4GI9A 3VD4A 3NGJA 1H4PA 1DWFM 6ALDA 4L1GA 5CJMA 4QDWA 4GJJA 3W1PA 2R24A 4FEZA 3SCOA 5MKGA 4LRSA 1Q85A 3RCYA 1V6VA 3NSMA 1DHKA 4GY1A 2OO6A 5IDZA 1NU5A 1C9WA 1H60A 5CXPA 2F6UA 5IM51 4UTKA 4C6JA 1S5NA 2Y1HA 5D09A 4L4OA 1YNPA 4IMEA 1P48A 1XXXA 2ZRVA 3H8AA 3NM3A 1KKRA 4V1XA 2UY3A 1HP4A 4NHVA 3LCFA 4N6FA 2RUSA 4QG6A 5I03A 5TD4A 4R7OA 2OB3A 4XAZA 4AC7C 3VGHA 1CEOA 1YXYA 3RG6A 1E1EA 1HO4A 4H6EA 2ZRZA 1E1CA 2O7SA 4WUIA 4KGJA 3TCEA 1HVXA 1E0XA 4ONVA 1GZ1A 1KQYA 3GS6A 2ADAA 3GUGA 3THUA 1HL8A 3BAYA 4OKDA 3MB9A 4PYSA 3NG3A 1RY0A 3HV9A 4AY7A 1O68A 4A35A 3TQKA 3EWYA 5GPRA 2Y8KA 1O7AA 4ADTA 1OX4B 3CHCA 3GNOA 4KIEA 3RUBL 3UD6A 2GSJA 3QHMA 4YVVA 1VLIA 4IQDA 1IQ8A 5HANA 1XLCA 3HPZA 3IJIA 4ORIA 2OODA 2J7HA 2X0HA 2WNQA 4PTXA 4JX6A 1LRTA 4LC8A 3OLIA 1Y5VA 5FJJA 3DC0A 5CJNA 2YZ5A 4Z2IA 3BLDA 1EEPA 3VIHA 3ZSTA 1Q6EA 3TN5A 4YU1A 3FJ4A 4JTCA 1XSIA 3TJLA 4AHQA 4UC5A 4DWSB 3A5VA 2XHYA 1WDQA 2FJUB 1UD5A 4DLFA 5I3HA 1TCMA 3QFEA 4NAEB 4RNJA 3WEOA 4TV6A 1XCWA 1NSJA 2YCEA 3EGJA 1T0OA 2E3ZA 3TXZA 4IZGA 3W7HA 1IEXA 3W53A 2QCEA 3T2PA 2CEQA 3M0MA 3NQ6A 2FZ9A 1LL4A 3NL6A 1A50A 4GUJA 5AC5A 1PSCA 4FPSA 4JFVA 3SECA 2NUYA 4XZLX 5FIPA 4DVOA 3EEGA 3BTNA 4JICA 3RO6A 2ZUSA 3EPOA 4DN1A 3KBNA 2OQHA 3NYZA 2Z2UA 3PZUA 1XLGA 2JQXA 3TTYA 5JH2A 5LIKX 1VPXA 2NXIA 3VIKA 2QV5A 5HNRA 5CPMA 3FX4A 3SR7A 1ITXA 1RQHA 4O1DA 4HZ8A 1T5AA 2VGBA 1R9YA 4AFYA 4IPIA 2FH8A 4ZQNA 4HK5A 4NSBA 1FP8A 1TV7A 1CGYA 1UMYA 2G97A 4FS9A 4UQCA 4NP7A 1VHCA 1TG7A 1I2QA 3A13A 3P5ZA 1F07A 4DPQA 2JIWA 4AIBA 3MP5A 4N42A 3PBMA 1KM5A 2INFA 1VFFA 2FHBA 4UQEA 4QHRA 3FXGA 1PXGA 1GZJA 3WNLA 3T0CA 3BAXA 5T8GA 4QJ1A 2A6NA 1JUBA 1HJWA 4MB3A 1JZ4A 5F2IA 4DO7A 2PDJA 1A5NC 4F2BA 3NOYA 2VFGA 2PC4A 3MYPA 3LBMA 3LERA 3UWEA 5LIYX 3VIPA 2FFIA 3LLXA 4QNEA 3WKZA 2NQLA 1UQYA 2DORA 3WENA 1XGZA 2G41A 4F79A 2PS2A 1EP2A 5EMMA 3ID7A 4HNCA 5HUOA 1XLJA 3KRBA 3OGSA 1FWAC 3C0LA 3EYPA 4PFMA 4XQ6A 3AHVA 4GX8A 4FNRA 2H3BA 2G3JA 3A4XA 1Y5WA 1TR9A 1EJXC 4MTVA 2QCHA 4ZSTA 1QOXA 3SJ3A 3AHZA 3W7GA 4H4IA 3IUDA 4H8VA 2D2HA 2Z28A 4LS0A 4TQTA 2INZA 1YNYA 2OJPA 4K1GA 3GG1A 4US5D 3MBDA 3GSMA 3VUSA 2YL5A 3LNPA 4KEUA 1NDYA 2CZVA 3H53A 1C7TA 3HURA 3GIPA 3W6LA 4FALA 4E4FA 4LVGA 1W9UA 4C1LA 3K5XA 1CWYA 2VFFA 3FA3A 1IHIA 3B9AA 3EMZA 4F3HA 3EOSA 1SZFA 5BMXA 3MP3A 4XX6A 3K8LA 1YNQA 3E02A 1H7PA 2HRWA 3VKAA 4LW7A 4HJWA 2NUWA 4AD2A 2BY1A 3CZLA 2WHLA 4DYKA 3PUOA 1YPFA 1GOQA 2ZZ4A 4MYXA 3FAWA 3ZIZA 3OG2A 2RDUA 1ME8A 3RK8A 2GJLA 3WF2A 2VCCA 3FJNA 1SFSA 1G01A 2YPIA 3BAJA 3VILA 4LUSB 4TUFA 1JR1A 3VAVA 4MZYA 2BASA 4XTIA 4G8TA 2XIOA 3UP8A 3BPWA 3CO4A 1H7XA 3TOPA 3L5LA 5BCAA 3CYJA 1SSDA 2WHMA 2Y7GA 2V38A 1FWCC 2WPGA 3N11A 4JNMA 1EJVC 1H3GA 2VOMA 3W29A 1YBQB 1O5QA 3NQ7A 2I9EA 4K6AA 2JKEA 3QSRA 5AC6A 4L7ZA 1E4MM 3CQJA 4JIQA 4Z2HA 2DIEA 1LLZA 2QLYA 1GOIA 4IJCA 3M5VA 2H8XA 3R2GA 3KDNA 1IEVA 1TSIA 1ZAJA 2G50A 5G4HC 3EXSA 1XC6A 4NQ1A 4PFHA 1KXHA 1N82A 5GNZA 5D32A 3CAKA 1J4EA 2B7OA 2QPSA 2Z24A 3AS0A 2Y5SA 3I65A 3NAVA 3IJDA 4MY1A 1A47A 1W2VA 1TPFA 5AN7A 1M1BA 1ZL1A 3BOFA 4QJ3B 1ZJBA 1MUWA 2QMJA 4JPGA 3DBNA 4YYFA 2QJIA 4NZ5A 4Q6XA 2QF7A 1HZYA 3WH9A 1D3HA 2ZICA 1P6WA 3BQ5A 1Q7QA 4CD4A 2AQOA 2QJNA 3ZMRA 5DT5A 2RGMA 4GYKA 3S9ZA 2BXVA 5AY7A 2EPKX 4FXFA 1JDFA 3WLJA 1E5JA 1ZBVA 3PUEA 1OHLA 1O95A 1W9XA 3WUEA 1SZNA 2WC7A 3IIOA 3LM7A 3M0IA 1XYCA 3W7QA 1S2WA 4ERGA 3GDBA 3F5JA 3AROA 4GABA 1MEIA 4ZO9A 1HJVA 4PRRA 3WQ6A 4EACA 1EX1A 6REQB 2PLJA 1S1PA 4E8DA 3GXIA 3DIPA 1XL9A 4C6EA 2D73A 4XD3A 1B3XA 2DT1A 2WSYA 4Q4QA 4FP1A 1EC9A 2QUUA 1JZ3A 3B0UX 1G1YA 2I17A 1UH2A 5EFFA 2HS8A 3QV6A 2WNWA 1KCXA 1W9VA 1WYIA 4B5TA 4DWDA 2NQ5A 5HJYA 4K8EA 1XIGA 3QTGA 2VENA 1PX8A 2YBVA 3AIUA 3OIXA 1Q63A 1WDWA 1WX0A 1K7EA 1G4SA 4K7YA 3BXWA 1CECA 2DZUA 1WOBA 3H2NA 1HGYA 2R1MA 1JCXA 3E0VA 4NJGA 1XHGA 3S8HA 2AKMA 5DO8A 2PRMA 3S5YA 4LRTA 5TAOA 3PB0A 3G1DA 3WZ0E 1B3OA 2A3BA 2OZ0A 4I9TA 3WX7A 2J25A 4WXZA 4HSHA 4EKJA 2ASHA 2FVLA 4PCNA 2ZXBA 4O15A 3WD0A 2P8BA 1P0NA 4GZ7A 5AHLA 3G0SA 1S2TA 3F4WA 5C2CA 5DLCA 5EL1A 5I3IA 1ZFJA 4DJFD 7XIMA 1CB2A 3NO5A 1XLIA 1POKA 1VJIA 1N2VA 1PIGA 4YL2A 4NZ3A 1RV8A 4DI9A 5BZAA 4H9XA 2YL6A 1A3HA 2CLIA 2PDWA 1QHOA 4DNHA 4LUJA 2VO5A 2Z29A 1XG4A 1GJPA 2QW5A 3GDMA 2WYSA 4HCLA 4ZOEA 3CIVA 4P7NA 1K7FA 4Q4KA 4KQNA 1X6UA 3GTIA 3VKCA 3UCQA 3GXNA 4QTGA 4IICA 4DO6A 1CXLA 3WDPP 3UYIA 2HVOA 2E0PA 2VDIA 1GVYA 1WUFA 2W5FA 2GJRA 1UOKA 2GVGA 4LBUA 4OV4A 4K39A 3I7RA 1TZ9A 2GOKA 5D05A 4MM1A 2J27A 1V77A 3ZFHA 5LHFA 3WQWA 5A6BD 3MJYA 1QCWA 2WJEA 3CXOA 6REQA 2PU1A 3ORWA 2F6KA 4O14A 2O4MA 2I5QA 4R27A 4DO5A 1ME9A 2C1GA 3EX3A 4MADA 3UZZA 3SCSA 1VAHA 2GYIA 5EYWA 2OXNA 1H63A 4TTGA 5A8NA 1V0MA 4H6KA 4ZB2A 1YDOA 5E0KA 4EK7A 3CV2A 1H0GA 4I5RA 1DE5A 4XUYA 3GNDA 1OT2A 2PPGA 4O13A 4DELA 2DEPA 2IQTA 4JHOA 5CH9A 1C7SA 3MWAA 4GC4A 4P7LA 2XVLA 5A5WA 1V03A 2V5CA 3G1HA 4KCWA 3H26A 1NIUA 1THFD 4J3TA 4M81A 3TZNA 3TSBA 3TC7A 2ZIDA 3E38A 3PZNA 2R6OA 3LPFA 1Q6GA 2JGQA 2X0YA 3FOKA 3WQGA 2R82A 1GONA 1JYVA 3W7EA 3VFLA 3ZVHB 2FB3A 4LS2A 4QLKA 4AZ6A 1W3TA 1AZ2A 4OVXA 3SI9A 1YEYA 4E38A 4HPJA 1UHVA 3QRHA 3AIRA 4NRSA 2PA6A 2VX4A 5LNVA 1BHGA 1QATA 3GBDA 1WAWA 3VKBA 3M64A 1XSJA 4A3QA 3ISIX 2DT2A 2BX7A 2G4JA 2GQ3A 4QITA 2B7NA 5DELA 3EBVA 3VCRA 1F6YA 3U5UA 4JN6A 1E6ZA 3N2OA 1K70A 1YBQA 3TOYA 3WNPA 3NQ2A 4OIFA 4LWWA 5HINA 4TR9A 1F6KA 3U6WA 1TV2A 1V6YA 4QXIA 2DU2A 3NUKA 2ZUNA 1DE6A 1F05A 1UIPA 2ZYFA 3DG7A 4HVXA 1PX4A 2CZ5A 2DQXA 3W7LA 3WK1A 2PTZA 2DSVA 3BLIA 3GTHA 1BLIA 4C5ZA 4ZENA 5CG7A 1FCBA 3MQTA 3PBGA 3WLIA 3SW6A 3QYQA 5BWFA 1C9DA 1HKWA 1JJKA 4OZOA 5CQ1A 1JPIA 2V2DA 4NUWA 1J18A 1CXIA 1PHWA 4OBRA 5IFTA 1CNVA 1UQZA 3LI1A 3APGA 4W8LA 3LTPA 4XKYA 1W1TA 3GHUA 5D4YA 1V3JA 3DFQA 1I0DA 2PDIA 2IMRA 3ES8A 1PAMA 1UP2A 2MANA 4XG1A 4LSBA 4EF8A 2J75A 1V6TA 4LNCA 2SFPA 2ACSA 4XTDA 1KCKA 4K8HA 3AIQA 2ICSA 3EA3A 1W1B1 2BMBA 3S1XA 1B1YA 2DZBA 4FF7A 1PDZA 2VC7A 4B4HA 5I00A 4H9UA 1EZWA 1XIJA 4UBPC 4F0SA 3WMCA 3AOFA 3CAWA 3VO0A 3OBAA 3MTWA 1E56A 2FGZA 1VRXA 5ABTA 4P2VA 1KBIA 3D3AA 3AZTA 4UR9A 1K9EA 3T9PA 1SPQA 2C13A 5D2TA 1V8EA 1V3HA 3FDKA 4DUOA 5AVHA 1TX2A 2A1YA 2X2GA 3MUAA 1S3HA 2Z6JA 3CQHA 4NZJA 2D2GA 4UCFA 1DWJM 4IPPA 1BFNA 3MKKA 4C90A 2VHLA 1IT0A 1CGXA 4JQ2A 3TYUA 4D6GA 5F1UA 5KSWA 4NYYA 2VFHA 2TRSA 3WLTA 4XZIA 4A3UA 4O1AA 1VCGA 3EB2A 4HSNA 4NX0A 2X8RA 1D7FA 1Q6RA 1SO5A 4KIRA 3WH5A 1VFHA 3N34A 5AYZA 5CGTA 3OHMB 5FSDC 3WJSA 4PSRA 1BXNA 4MJ2A 3WQCA 3G0UA 2XFWA 3LNMA 3GR4A 3BAKA 2XWEA 3FGCA 1E72M 3E9AA 4A6GA 2VX5A 5BROA 5JIWA 3CQKA 5CLWA 4DJEC 2CBJA 3S5ZA 4M3PA 5CG0A 4W88A 4A21A 2ZZ6A 2V5BA 3GXPA 5CBBA 1KXQA 2RDXA 3LCGA 4CU8A 4H3DA 2BVYA 8A3HA 3B04A 4G2DA 4HU4A 2OWXA 4DRSA 5FAGA 2BOGX 2R9RA 2BG5A 4NZ1A 4EPKA 1ZBWA 4LAKA 2VM8A 4FLRA 3W1NA 2DP3A 4W87A 3SDOA 3WQPA 5K3VA 3AIVA 1NVMA 1MFUA 1XRVA 4OE7A 4XD6A 1J8VA 4JN8A 1UW9A 4PUWA 1LUCB 5JU6A 3RF9A 1KQZA 1K77A 3ENLA 2HMCA 5H6HA 2CHNA 2NZLA 1KWKA 3GH5A 2V67A 3OTRA 1KLZA 3I4EA 4CQDA 5A95A 4W86A 4I5UA 4DYEA 3IK2A 3VMNA 4KW2A 1VPQA 3CZGA 4P5UA 2WBGA 3KRUA 3SFWA 2DW6A 3OOQA 4JTJA 3GHRA 3WQOA 3QSTA 2XIBA 1UR4A 4XKMA 1YRRA 1V79A 3GE7A 4XV0A 3K2GA 4JGDA 4HMNA 1RK5A 4YLWA 3WDQA 2GK1A 3LRLA 3PZTA 5BXTA 1QNOA 3ARTA 4DI8A 3G3MA 1JDEA 2XN2A 2WAGA 1R86A 5ABGA 3REQB 3B4UA 2YX0A 3FKKA 1B31A 1OZMA 2H9AB 1K8ZA 3BGGA 3P74A 3PAJA 2WHJA 4YMZA 1JDCA 4PTMA 3URAA 3DI0A 2PRLA 1KTBA 1UD2A 3N9SA 3CIXA 3LZ3A 5J04A 1NH6A 2YBTA 3VGGA 3VUPA 3WCZA 3BGAA 3DYPA 3SGUA 3MS8A 2NXHA 4C7GA 3HJZA 3S2JA 5I3JA 3K46A 3LV5A 2HK0A 3RRXA 4MWAE 3RPDA 1CXHA 1GVEA 2PWFA 4UZSA 3GVWA 3UWWA 3W7JA 4MPKA 3R89A 2L5HA 4NAEA 4ZFCA 4PTNA 2C18A 4MLJA 1REQA 3A4JA 1FWJC 5LNWA 4R5EA 2D3NA 3SGGA 1BVZA 5BRQA 3PBVA 1KNWA 1X98A 4RV3A 2ZDSA 1P7TA 3EX6A 5BW6A 2V5LA 4IIGA 3NWRA 2PDXA 4AWSA 4FR1A 5FF4A 5JH1A 2UWFA 3EPNA 1L8NA 2XWDA 4L80A 3OZPA 2QUNA 2VZSA 1CW2A 1MQRA 4WSKA 5AHMA 2BV9A 2ZUMA 5DN1A 1WKYA 2A85A 2IS7A 1AQMA 4X9SA 1H11A 2WM1A 5M5DA 4JFTA 4QE4A 2FFCA 2R14A 1AODA 2E9BA 2J13A 3BAWA 1H7WA 3KAOA 3USZA 2PTWA 3Q67A 4JD4A 3UY7A 4W85A 1HNYA 3S1WA 1LBFA 4JTHA 1V0NA 4BF7A 2H9AA 3GH7A 1J0KA 1MI3A 4N9CA 2Y89A 4LYQA 3ITYA 1HJUA 5D30A 2BODX 4IQLA 3WL0A 4U3CA 1RVKA 1I0BA 4LUTA 3CJPA 3F4DA 3N4FA 1AMYA 3SUVA 1XLAA 5IXEA 1OGBA 1GPFA 1QBBA 2X09A 4LU0A 4UNIA 3BW3A 3AHYA 1U5HA 4ZQRA 3V16A 3FFSA 1WE5A 2A79A 3BSHA 3FJLA 3IK4A 5HOSA 1DOSA 4ASTA 2A6LA 2XG9A 3JUGA 3UWVA 3EA1A 1JL8A 4W7UA 3A47A 2V3DA 3UG3A 3PFMA 4CD8A 4A8RA 1BRLA 1BWKA 3ABOA 4UMBA 4G7EB 3AC0A 1XKJA 2BVDA 1GOWA 1H5YA 4UFIA 1UP0A 4W9TA 3MDUA 2CESA 4Q8TA 2VWSA 1DWAM 1J01A 3DUGA 2YFOA 4M1RA 2HE5A 2HJPA 5J5DA 1N8WA 2WQDA 4FNSA 3MO7A 3LXBA 2PU0A 4A8NA 1LQ0A 3XISA 1MDRA 2D2JA 3TTQA 2FGLA 3CWOX 1NQ6A 4UNLA 2HVMA 2YGYA 5GJNA 3VGDA 4ADUA 3CUGA 1TKKA 1RCOB 6TAAA 2WSPA 3FK4A 1XCFA 4FR6A 4H6QA 2J7BA 3CTLA 2Y7DA 4U4MA 3UNTA 4RX0A 4EVZA 2PDGA 4QE1A 4R53A 2OYMA 4GH1A 3N2TA 1IWPA 4JTGA 3NQMA 4HPGA 3URNA 1XD0A 1CGVA 5KZDA 5C9ZA 1JQXA 1QPOA 4XVEA 1OIFA 1CI1A 1E3XA 1IZCA 4JQAA 3R58A 3RHGA 3P0WA 3DX5A 3QMRA 1UKTA 4E8GA 3W7PA 4BKNA 5M3WA 4BI6A 1I2OA 3OVRA 1VYSX 3SN4A 1BVWA 3B0VC 4LEFA 4IIEA 3PZMA 3UWYA 1LWHA 1JAEA 1KGXA 4TMBA 2NLIA 1OSEA 1KTCA 3DENA 3FVDA 3I7SA 3AXMA 4IFOA 3NPWA 1J0JA 2QJMA 3W83A 5DXYA 1L2UA 1HGWA 1Q6OA 3ARSA 3ALFA 3VK5A 1VJSA 3P2VA 3APYA 3TXVA 1T7LA 4H9VA 3W28A 3BSGA 1QI4A 3NM1A 1TELA 2GVJA 3B8WA 5HUPA 1MW0A 4HA1A 1K8XA 4OOZA 1SMAA 2VRKA 5FEWA 1YADA 3QLLA 3BLLA 4WQ6A 1YKWA 2TPSA 1LDCA 4JX4A 3W7CA 5AFDA 4U3AA 1PTGA 3BW4A 5D9MA 5LGXA 1U1UA 3TJIA 2W91A 4L4MA 4GI6A 1IXOA 4PR4A 3U3HA 1XYBA 4CNPA 4H00A 4LY8A 3ZYZA 4DUXA 1RVGA 2CHRA 4H41A 1DWHM 2MNRA 5CKSA 3NURA 1RPKA 1HL2A 3BWWA 1DJIA 4AEFA 5T91A 4DO4A 3PFRA 3DDMA 4ZOBA 3MDWA 1EDTA 3PWIA 3SN1A 4KGLA 3TV8A 1E71M 1LG1A 1CLXA 2QVHA 3H7UA 3NXFA 3ZT5A 2A0NA 1QXLA 3OVQA 4WRHA 1VCFA 4W84A 1FTXA 2Y62A 3RPTA 4JDYA 4XZWA 4F2UA 4H9MA 1BAGA 4HU3A 4DJEA 3CLWA 4GKLA 4PBFA 3HB9A 4HJFA 3LGEA 4RLIA 3L4UA 4GGHA 4A29A 1XQKA 3WDHA 4AZCA 2XYLA 3PJWA 4TVDA 4L65A 3YPIA 3KTSA 2QVNA 5DBUA 3TP4A 2NQHA 3VGFA 2Y8VA 2KX9A 3KRZA 3GYCA 1NARA 1BSIA 1HQTA 2DZVA 3TU9A 5HMSA 4UTHA 3MU7A 5H2ZA 3VZYA 3EX4A 4NAFB 4TMCA 4M8UA 1DXEA 1PZ1A 1IZKA 2WXDM 4FOJA 1UZ4A 4GIRA 1XYFA 4PA8A 3HJEA 2EG7A 4M6VA 3U0HA 4NXKA 3HGJA 1B4EA 3V0SA 1KRAC 4QAIA 3TAKA 3NPUA 3ANUA 3ABZA 2XIMA 5CCZA 4NJIA 1LTDA 2CBIA 2ZRYA 4HK6A 5K4ZA 3TW9A 2Y0FA 1ICSA 3C2OA 2A7NA 4A8IA 4B5NA 3VD3A 4AY8A 2I9UA 3SO7A 1J6PA 3OODA 3OJGA 1IEWA 1M68A 3LCWA 3N2CA 3U48A 3J7HA 4ROQA 4NI3A 4UFKA 1US3A 4K37A 3Q2DA 5LXXA 4FO4A 1OG0A 1S3TC 3LZ5A 1B3VA 3SM0A 3A3XA 3POHA 1Z42A 2VFDA 3SIMA 1KFBA 5EB8A 2D69A 3B8SA 3OEXA 3WFZA 5I23A 1JXJA 3OLDA 4IMCA 2X0SA 5HQMA 1J0IA 4X0VA 3W74A 1BYBA 1PE1A 3SADA 5DCBA 4PUNA 5DEZA 3W73A 5F2MA 4IMAA 4GYFA 4IG2A 3HG2A 4NU7A 4Q4MA 3IGSA 3ZJ7A 2ATSA 4J2MA 3TC3A 5EBAA 3W1RA 2WLYA 5I2UA 2AL2B 2QQ6A 3T4CA 2HE8A 1QRQA 1NDVA 3APTA 2B7PA 4C6IA 2P0IA 4FXJA 1FKWA 1W56A 3VOFA 4BY3A 3ARZA 3VABA 5LNSA 4Q4RA 5HMEA 5I3GA 4A3RA 2C19A 1DIKA 5K9XA 2YB1A 1XDJA 4M51A 5EMLA 2PMQA 1RR2A 3CASA 3VGBA 5CJ5A 1FWFC 1PS9A 2X05A 3KOFA 1A5AA 2DZXA 4MKNA 1QPNA 2J9ZA 2AOSA 4MG4A 1UKPA 1ZSXA 1FBAA 1XR2A 4Y8FA 1MXDA 1DV7A 3GWQA 4ZZ9A 1JUEA 4AC1X 2WV8A 2WMFA 2TMDA 1E73M 3E3HA 1RQEA 1J5SA 1F3WA 1MUMA 4FIRA 5HATA 4FNUA 4QEHA 1OBAA 2JF7A 3KOWA 3OBEA 3C2RA 1EA0A 1W6TA 5CZJA 4NG3A 1C8VA 4Y90A 4YN5A 2XUCA 3F4CA 4JFUA 4YTSA 2VEMA 4PN2A 5A3HA 1R5YA 2DSZA 1E4NA 3L4YA 4DAFA 2ZTJA 4XZBA 3S2MA 4MY9A 4E0CA 3BJFA 2OT0A 4PUMA 4KRTA 2FMOA 1R9ZA 4G56A 2PODA 3NL2A 2H90A 1DYSA 3L2IA 1J2WA 1DQXA 3NZGA 1V3KA 1F5ZA 4PCSA 3G1AA 3S4TA 1CZ1A 3TX9A 1X7FA 3WMBA 4A8LA 4L4PA 2VCAA 1GW9A 3NXLA 2Y5JA 4M7SA 1FWBC 8XIAA 4LY4A 1XYAA 2VT0A 5AZ0A 4TX9A 1FOBA 2HXUA 3ZLHA 1DIDA 3A6OA 4WDWA 3AICA 3BQ6A 1PV8A 2GQ8A 1U33A 3RFAA 4MJMA 3WQ4A 4JTDA 1V7AA 2E8YA 4PUUA 2WC4A 1UC4A 3TMQA 1M7OA 3DAQA 3SCWA 1IXQA 5T9BG 3B8TA 2D0GA 4IMFA 9RUBA 1EGZA 3VE9A 1LLOA 3FGCB 1ZENA 4GVIA 5C9XA 3G1RA 2YYUA 5L9FA 4UQDA 2PD9A 2I5GA 5BRBA 3VTRA 3STGA 4AIOA 4ZEPA 2XM1A 3F1QA 1NWRA 5FJTA 3NVDA 3PY2A 4IJRA 3UZWA 3BC9A 5C0QA 1VH7A 1W1A1 3HPFA 1JPHA 4ZL1A 1A3WA 1G7UA 1S2UA 2OZ8A 3EB4A 1T40A 5CLTA 4DEFA 2WMIB 1Q7MA 1G4PA 4UOJA 2GZXA 3OB8A 4LJ3A 8XIMA 3TFXA 3QZAA 2VGGA 3MUXA 3OHIA 4XKYB 3MCMA 3W71A 2PDBA 4CD5A 5HQLA 1YW1A 1LQ2A 5TF0A 4JL2A 3E2QA 3DH7A 4J3ZA 2GUBA 3EWXA 3TTEA 3PSVA 4MKVA 2I16A 4D8LA 3PNUA 4UQAA 3T8QA 1QWKA 3FEQA 4BEUA 4YWSA 3F2DA 2CZDA 2AMXA 4E2OA 1W37A 4C65A 1H7OA 4OUIA 1V4YA 3U7BA 3CAQA 2PC8A 4W89A 1OWQA 2YDSA 4GA8A 4UTIA 4NI8A 2EPOA 4GO9A 1E9IA 2PD5A 1VC4A 2DH2A 3CGTA 3RR1A 2C1HA 2GGIA 1EWEA 3R5EA 5AC8A 3DFYA 4IM4A 4FOUA 3W7OA 5CSYA 1TCDA 3VIFA 5EA9A 4YYCA 4UTTC 1P1MA 4XBJA 2I14A 1XLEA 3N18A 4V1YA 3LMZA 4KFNA 1B2YA 4J3SA 1UOZA 3RU8X 2PWDA 1U1HA 5CAKA 4RW3A 1TJPA 5FI8A 4R88A 3O6CA 2G37A 5CC3A 5JBDA 4JXCA 4L6DA 1AH3A 4XAFA 1TA3A 1US2A 3R94A 4GQBA 4RJEA 3PTQA 2EQDA 3MMDA 1EJTC 1UD4A 2Z4GA 3QPYA 2OQLA 5AC7A 2E9LA 1ISVA 4GIEA 2XIQA 1SM9A 4GXPA 3B4YA 1HP5A 1ZHAA 3PTKA 1TUXA 4G9PA 4UR7A 5A6AA 4HGXA 1M65A 1JFHA 4EWND 4RE0A 3W72A 1ZTVA 3CNYA 3V75A 2NWSA 2XN1A 3L7RA 1EH9A 1KV8A 5D33A 3TROA 1L6GA 4TX8A 1AH0A 2F38A 2ZXAA 3TONA 2OT1A 4PMJA 4GFIA 3L67A 3O07A 3AZRA 3RDKA 5G4WA 1GHSA 5D02A 3IIZA 3VIJA 3DC8A 3TYBA 3A23A 1FWGC 3NQVA 1NY1A 2FZMA 3VE7A 1WZKA 3KZSA 2CLHA 1K4HA 3H23A 1F3EA 1HUVA 1LYXA 3N3MA 3C2VA 5KTLA 1P7TB 3TIMA 3W22A 3CIWA 2VEPA 3G1YA 1R7OA 3HBLA 1EOKA 1I2NA 1F73A 4M6UA 1PUDA 2YXXA 4H7ZA 4LX4A 4IQJA 4CN4A 1A4MA 5H8UA 3WLQA 3IACA 1CXFA 1VFMA 2V9DA 3T0DA 3QR3A 1WO2A 1D9EA 1PIIA 3S5OA 1EJSC 1CT5A 2WO5A 4C6NA 2VCBA 2QJHA 2IQDA 3TYDA 4CQBA 3K4WA 1JZ5A 4GIAA 4MVAA 1DKWA 3M0LA 3QGVA 4XZ9A 2B7QA 3JS3A 5BMWA 4KRZA 4DNMA 3LSCA 3G22A 5HWNA 1H5VA 2Y24A 4RNFA 4DWSD 4MB1A 3M7SA 4JQ3A 1JZ6A 3G0XA 2XINA 4J2PA 4X0NA 3BLPX 3BCJA 4MJZA 4F0LA 3M6DA 3JVAA 2VD8A 4PTWA 3WF0A 1MWOA 1JCLA 4FI4A 3C3UA 2YOCA 1FXQA 2KAUC 4Z2KA 2WLZA 1SFJA 5FF2A 3N4AA 3EPMA 4D8AA 4WOZA 3CPUA 5A1AA 1EIXA 5CZTA 3CBWA 3CB8A 3EX1A 5PTDA 3W85A 3AMLA 1RJRA 4KETA 1UD3A 4N2YA 3NDOA 3SY5A 3URQA 1LM1A 2G4FA 3R13A 4B9YA 3ZWTA 4ML9A 3V35A 2J8GA 4UQ9A 3BANA 3W1MA 4WY0B 1QMLA 1L9WA 1TPUA 3M9YA 1VFTA 3GG7A 3NO3A 3R7MA 1LRQA 4CCDA 4M82A 3LBOA 2Z1WA 3GTXA 4KWWA 2EXOA 4XUGA 1MMFA 5D8ZA 3P84A 3GH4A 4NJHA 1RUSA 1XICA 4IGNA 4GBDA 1J10A 2X1SA 2ANUA 3DHUA 3SRDA 3UR8A 1FCQA 3CZJA 2QDDA 5HNNA 2AMGA 5K4XA 4A3YA 3UW6A 3M6YA 1OGSA 4TO8A 3SFKA 1OX4A 1YTEA 5F2GA 4TV5A 1M5WA 1H51A 2NWRA 2ZRWA 3U2EA 2FVMA 1WPCA 3MSGA 1R30A 4MWAA 1UH3A 3GD6A 3ANYA 2JKAA 4GJ1A 1CGUA 3SGZA 3KBJA 3CV6A 4XBSA 1XCXA 1UPMB 2F7FA 1W91A 2EG6A 1ZZMA 3AQUA 3T0BA 1ESWA 1AVAA 1K4GA 3V0TA 3C0QA 3D46A 3XIMA 1TWWA 3IAPA 3E6EA 4Z1BA 4BJHA 1OD8A 2XGBA 1C8QA 2ZCGA 3GNXA 5D2YA 1V6WA 1W9PA 1NF0A 2H3DA 1HG3A 2I57A 3WD2A 2QCNA 3P3BA 3GO2A 4YHGA 2Z2AA 4Z0JA 3TH6A 3I3DA 5IHSA 3VD7A 1RZMA 3BJSA 4ZR8A 1NP2A 3N13A 4NT0A 2Y5EA 4H9TA 3B40A 3P81A 5DT7A 4K3ZA 3SRKA 2DT0A 3A12A 1PB0A 1JPMA 1LCOA 3FHAA 4BI5A 3GVQA 1ISYA 3SSZA 1V08A 5A6KA 1HN1A 3R10A 5DY2A 4DXKA 3O2LA 4U10A 4DXVA 1JYXA 1QU4A 1UG6A 5E93A 4GX9A 2G3FA 3NJ3A 4P7RA 4PL1A 4BWLA 1DJZA 5FL1A 3W7KA 4ZOCA 3R8HA 4Y6GA 3V5OA 3F2BA 2FLIA 1EC8A 4O18A 2CLMA 2BLEA 3VNJA 5H91A 3AI0A 3TQVA 1RD6A 4U28A 4MWAC 1BG9A 2C91A 1HJSA 5MF5A 1DJNA 3NGFA 5CBIA 4AZGA 3GW3A 2GGJA 3WEZA 3G2GA 1OYBA 2ZX5A 3MSYA 1S5TA 4LH8A 4WCJA 5I3FA 4HOZA 3CT2A 3GRIA 3H24A 4G6CA 3ELFA 3GM8A 2PWHA 1RP8A 2GUUA 3MWCA 4RDWA 4AEEA 3THCA 2XISA 1FFRA 4DHGA 3S1GA 3QQ0A 1B5TA 3COTA 1NTHA 3WF4A 1V3LA 4IJBA 4AZ5A 1XP3A 3EMQA 3ITGA 3ARQA 3TKFA 1XLKA 2ZA2A 1DJGA 3QY7A 4AH7A 2YA1A 3V3WA 4RCXA 1K6AA 3W88A 1TJRA 2OEKA 3FSTA 4QG9A 2QAFA 8RUCA 3MSRA 2XZ7A 3TFCA 1HJXA 4CN6A 3QXBA 3P60A 2QXWA 1X8FA 4Y9OA 3PZ9A 4PCTA 4HQVA 1WXYA 1R38A 3WQ8A 3CL6A 3T81A 1UKQA 3CZKA 1FCVA 3DYOA 4H8NA 1F76A 3OVPA 4RZBA 4C6LA 1UA7A 2VRQA 1NELA 5LA1A 1WBHA 4C7FA 3VM7A 4V33A 3ARWA 1DJWA 5GNYA 3GNNA 2E40A 4JOMA 4W5UA 2YXGA 2XFYA 3ARYA 4Q8VA 3VYLA 3U2ZA 3T07A 4M56A 1OF8A 3O63A 3BO9A 2EKCA 4MDPA 1VB9A 9CGTA 3SUUA 1DHPA 3VDGA 2VC9A 3CV1A 3MKVA 2HEJA 3VOGA 1S1RA 3TTSA 4C1NA 1Y0EA 5DMMA 3WLRA 4AG0A 5AOUA 2RH9A 3U7VA 2UY4A 4X9YA 5EMJA 5GJMA 2EPLX 3WLNA 1IF2A 5LNUA 2O9TA 1VP5A 3OZOA 3W6MA 5DANA 4RDYA 1WP6A 2C6QA 2EJAA 1EP1A 4GZEA 1D3GA 3IRSA 1EQCA 2GJXB 5D2VA 3DGRA 4UTFA