4O5EA

Structure of human dna polymerase complexed with n7mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 103
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5eA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5eA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5eA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5eA03
1NKCA 2I1QA 3BJYA 5KT6A 1LV5A 1BPXA 2C28A 4I28A 4Z6CA 4IG8A 2PBEA 1JIHA 4CCHA 3MABA 4WC2A 4WC4A 4NM1A 2RFFA 4KLJA 4ECZA 4M0AA 7ICNA 4EBJA 1L5UA 2ZHAA 4KLQA 3MFIA 1DK2A 4RQ7A 5KG7A 2JEFA 5J0UA 3TI0A 3RAQA 9ICHA 5J29A 3RH6A 2BCQA 2FMSA 4RWNA 8ICUA 3EZ5A 4F5RA 1KSPA 7ICFA 8ICTA 3JPOA 8ICFA 9ICBA 1Z00B 4FHVA 4O3NA 1ZJMA 4F4XA 1KFSA 3JZ0A 5HRIA 4ZH4A 8ICHA 5KFKA 1NK0A 4J9MA 3T3FA 4DO9A 3UQ0A 3RJIA 3QEBZ 4QWEA 5KFGA 5HHHA 4O3QA 5DQGA 2GWSA 2R8JA 4DQIA 3SI8A 2BCRA 4X4OA 2FMQA 4UB3A 4F8RA 8ICMA 2HVHA 5KFFA 4PHPA 1Z00A 5J0RA 4RQ8A 2KN7A 2W9BB 4ECSA 2BR0A 2Q66A 3RB4A 1L3UA 1QSYA 2JEJA 4RUCA 3B0YA 2VANA 2ZJ8A 3N4MB 5KFLA 2ZUBA 2DR8A 9ICQA 5TZVA 8ICNA 4YFKA 4QW9A 4GLXA 5D4BA 2AGOA 1NJYA 1JXLA 3AQNA 4KTQA 2W9BA 3GIMA 5HRBA 4C8OA 4RUAA 1XWLA 3Q8MA 5KG6A 3C2LA 1HUZA 4X4UA 4JV2A 1NKBA 2AGPA 1S9FA 4I2GA 4R8UB 4I2AA 2ZH2A 1ZYQA 2H5XA 4FBUA 2PI5A 4X0BA 1SKRA 3M9OB 2J6UA 8ICGA 1ZQGA 1ZQRA 2IHNA 3BDPA 2HHVA 4RWPA 4PHAA 2PXIA 4TQSA 4FHXA 4UB4A 4QZCA 4ECVA 3OVAA 4R8UA 3C21A 4ED3A 5F9LA 3TAPA 2DVIA 3RH4A 5J2EA 1NJXA 8ICSA 2AQ4A 4DQSA 4X4RA 3GDXA 3Q8RB 3TQ1A 3PX0A 3PR4A 5J0PA 3KHHA 4KITB 3Q8KA 1U45A 8ICKA 4J9LA 4E8FA 4DS4A 4FS2A 1ZQOA 2WTFA 3H38A 2ZH1A 4I2IA 4DQQA 4NY8A 3H8WA 4YR2A 7ICOA 4YCXA 3G6YA 3C2MA 2BGWA 5HMMA 9ICUA 4QZBA 2F1HA 3RRGA 7ICVA 3RB0A 5J2DA 3JPSA 5DBAA 4E7XA 7ICIA 3SV4A 3HT3A 2BPFA 2P66A 1L3VA 8ICVA 8ICLA 4KLFA 3UPSA 4O5KA 4YQWA 3MR2A 5DB6A 3AUOA 2ISPA 2M2VA 3NTUA 4UAYA 3GILA 4ED6A 5IIJA 2BCVA 4I27A 3OSNA 4JWNA 8ICYA 1UETA 4Z6DA 1IXRA 9ICTA 3EPIA 2BQ3A 5KFXA 4RU9A 3QZ8A 4PGYA 4MFFA 9ICVA 5CP2A 1JQRA 3PY8A 2W9CA 4C8MA 3JPRA 3T5LA 4B9SA 3JYYA 1JMSA 4KLUA 4YMMA 7ICUA 5EWFA 2Q0ZX 1K1QA 5J2AA 5IIIA 2JZBB 4J9OA 4O3RA 3RJFA 1IM4A 8ICRA 4AT9B 3ZD8A 5KT3A 3MGIA 1MIWA 4Q8FA 9ICAA 3JPTA 2ZUDA 4NXZA 3UXOA 3OGUA 4F2RA 4IRKA 3TFRA 1NK6A 3EYZA 4K4IA 2ZHBA 3HIYA 1U48A 5KTQA 2FLLA 3B0XA 2P6RA 2JZBA 4UD5A 4O3OA 4AT9A 1WCLA 2ZH5A 4IQVA 3ZD9A 4B9UA 4WC6A 4MEYA 1ZQAA 4YD2A 1DGSA 5KFNA 3PW2A 2AGQA 1NK8A 2HHXA 7ICQA 3IM1A 4QZIA 1QLNA 5F2VO 1Y88A 5L1IA 2FLNA 2ZH9A 4EBCA 1JX4A 4P4PA 4EYIB 2UVUA 5KFBA 4O9MA 4YG2A 5IIKA 5KT5A 1R8CA 4PHEA 5CR0A 3NGDA 4RNMA 3BQ0A 4XA5A 3NYBA 1U49A 1RXWA 5J2KA 2HHPA 5HR9A 3PMNA 4QZ9A 4NM2A 3V6JA 1N56A 9ICKA 9ICPA 1B22A 8ICPA 2VA8A 4DSEA 4EEYA 3V72A 1DK3A 1VFGA 1RYRA 5DB8A 2KZZA 4WC3A 3GFKB 3MFHA 1BPYA 4B9VA 1X9MA 3OUYB 5DBCA 2PI4A 4KLEA 1NKEA 2HVIA 3HPOA 2AU0A 3MBYA 5CJ7A 5D49A 4BWJA 4FO6A 1NOMA 3H40A 5KG4A 3PR5B 2ZH8A 1N48A 1KDHA 2LYHA 3SZ2A 4BXOB 3ZDCA 1FA0A 1ZQIA 4IRCA 3OUYA 4J9KA 1ZQUA 4PHDA 1D9DA 4ECXA 4C8KA 4ED7A 4RQ3A 4TUPA 3HX0A 4NLGA 4ED1A 2HHWA 5HNKA 2IA6A 1TFWA 4FH3A 1ZQKA 4BXOA 4O3PA 2UVRA 3PX4A 2PFQA 2VA2A 1UEUA 2DR9A 5BOMA 4MEXA 1ZQJA 4BGDA 3UXNA 4R65A 3JPNA 1XO1A 4KLMA 2W8LA 3M8RA 4DEZA 5KFRA 4LZDA 2DPJA 2BDPA 4P2HA 2JEGA 3RR8A 3PW0A 4B9LA 4RPZA 4KLIA 4QZHA 4Q45A 7ICTA 4X4NA 5J2HA 2HHSA 4DL4A 4JK1A 5JUMA 5CWRA 4J9SA 9ICCA 5DLFA 3LK9A 4RPXA 3PNCA 3PX6A 4UBCA 1V9PA 4DSLA 3H39A 5DEDA 5KG0A 4J9RA 4KLOA 5HMLA 4C8NA 4S3NA 4UAZA 4AT8B 4XUSA 2V4RA 1UEVA 3V6HA 1PZNA 4O3SA 4F2SA 2J6TA 1XSNA 2XCPA 4F92B 5DGBA 2RDIA 1B43A 3M9MB 2F1JA 5KFWA 3EPGA 5DG7A 4YD1A 5DECA 2PFPA 5DB9A 1TAUA 1TFYA 3THVA 3ZDDA 7ICEA 4AT8A 2ZTEA 5CA7A 4QZAA 2FMPA 5KG1A 4F5NA 9ICLA 1ZQDA 1UT5A 3T5JA 5KFJA 3OJSA 5EOZA 4QWDA 1S0MA 1KLNA 4O0IA 4IQUA 4DL6A 1NO5A 3C18A 4X0AA 4B9TA 4KN4A 3BQTA 4RQ6A 4Z6FA 9ICOA 4NKUA 1U9LA 4XQ8A 2ZTDA 4E80A 3RRHA 1BVSA 2NRVA 4YMNA 4MFAA 3GIKA 3H4BA 3LDAA 3V7LA 1NK4A 1TV9A 4M9HA 1C7YA 1T7PA 4XQ7A 5J0YA 3RAXA 4RWQA 5DLGA 4UB2A 2M2TA 5HRGA 2M9NA 3RTVA 4ECUA 1CEZA 2DR5A 5DDMA 2BPCA 5KFVA 1NK9A 4MF2A 2BQRA 3PO5A 4M9LA 4F4ZA 4M6WB 4DL5A 4KLGA 8ICCA 4RQ0A 4P4MA 8ICWA 1S97A 3E2EA 9ICRA 4Q44A 1ZJNA 1ZQBA 4QZGA 1HUOA 1D8YA 3TARA 1NK7A 1NK5A 5KFMA 3BQ2A 4LVSA 2XY5A 4K4GA 4WC0A 3GQCA 9ICJA 4YMOA 4M5DA 2AQ0A 2UVVA 4WBZA 2DPIA 3WFSC 4M6WA 4FH5A 4NLKA 4B9MA 1ZQVA 3TANA 1X2IA 1BPDA 3RBEA 1RYSA 4AT7B 4RQ5A 4M47A 2HHTA 3RB6A 3PV8A 8ICAA 5HRFA 5KG2A 3MR3A 5F9NA 9ICIA 5L1JA 5J2BA 1MSWD 3OV7A 4X4PA 2KFZA 5EWGA 3Q8QB 2R8KA 1YLQA 3AQMA 1XU4A 3H37A 1KFDA 1KTQA 2HHQA 4AT7A 1SL1A 3TFSA 3WFQE 4I2DA 4ELUA 4DL2A 4R66A 5J2IA 1K1SA 1T4GA 4Q43A 5HP4A 1Z3EB 4QZ8A 4PPXA 2O5AA 5J2FA 1UA1A 5KFTA 2XO7A 1TKDA 3H3AA 2ZJ5A 1LB2B 8ICEA 1ZQNA 4IR9A 1S77D 3ORYA 1NJZA 7ICMA 2FPLA 3ISBA 2KZ3A 2NRTA 4DOAA 3C1ZA 5IILA 1MQ2A 2ZH7A 3KHRA 3GV7B 3V7KA 4DOBA 2KFNA 2MUTB 3C66A 3TAQA 4UBBA 5L1LA 4G3IA 3OVBA 3Q8LA 2XCAA 5D46A 4F50A 4YN4A 3FDSA 4DFMA 5IIMA 3AQLA 9ICGA 1KRPA 3K75D 3M9NB 4C8LA 2HW3A 3OHAA 1JXEA 2BPGA 1ZQEA 2DFLA 4I2JA 4F4YA 4KLSA 4ELVA 2ID1A 4I2BA 1TAQA 4IQTA 4I2FA 1R89A 3KTQA 3MDCA 5HHIA 1A76A 4KN7A 4I2CA 4F3OA 5KFDA 4RWOA 1KFTA 3UPQA 3C23A 3ISCA 2O1PA 2FPKA 5DKWA 4EBKA 5KT2A 1TK8A 1QTMA 5J0XA 4DQRA 2Y1IA 4IR1A 4FBTA 4IQWA 3PW7A 4M04A 4Q8EA 3IHQB 4RT2A 2M2WA 1MIYA 3T5HA 4EBDA 4LT6A 5KFAA 4K4HA 3ZDAA 4M9JA 4KLHA 4QZFA 4RT3A 5EWEA 3RJGA 4IRDA 2ZJAA 8ICOA 8ICXA 1ZQWA 1HJPA 1X9SA 3V6KA 4GXIA 1ZQLA 4P4OA 5L9XA 2J6SA 3MR6A 3BQ1A 4ECYA 4KMUA 4EYHB 3N97B 5IIOA 5HREA 5DQHA 4JWMA 4DSFA 4F5OA 2Y1JA 4TURA 1EXNA 4GC7A 3MR5A 2W8KA 1X9WA 1D8LA 3GV5B 2XY6A 4KLTA 3PO4A 3EW9A 4QWAA 3Q8PB 2I9GA 2V9WA 2DRAA 2ATLA 5J0OA 4NKTA 2IMWP 5KFIA 2DRBA 4KLDA 4R64A 4DFKA 3C5FA 9ICMA 8ICQA 4KLLA 5J0WA 4YR0A 4ED2A 2BKEA 5DQIA 5J0TA 3LWMA 1KEJA 3V7JA 2AJQA 7ICPA 7ICLA 4FHWA 3H4DA 2ISOA 1QSLA 2IBKA 4O5EA 5DGAA 1WCNA 5BOLA 4PGQA 4DSKA 2HHUA 7ICHA 1A77A 1BGXT 5KT7A 1XS9D 1JAJA 3HJ4A 1ZQTA 2OWOA 4XRHA 1WOTA 8ICZA 5DBBA 2B21A 3OHBA 4BDPA 4F4KA 9ICWA 1PX5A 3UQ2A 5KG3A 4MF8A 3JPPA 5KFZA 1RPLA 2F1IA 4J9QA 2DR7A 1MIVA 1VJ7A 2R8GA 1QSSA 1BPEA 1ZQSA 3RJKA 5HRDA 3RR7A 3GIIA 3SYZA 1TVAA 7ICKA 3PW4A 1R8BA 1UA0A 5BPCA 3MDAA 4F5PA 4DWIA 4YP3A 3KHGA 1OU5A 5J0SA 3ISDA 1SKSA 3ZDBA 5KFEA 2RDJA 1F5AA 4DQPA 4MFCA 8ICIA 4DF8A 4ELTA 5CB1A 5C5JA 5HRHA 4TUQA 4TQRA 4NLNA 2BCSA 1ZETA 1ZQMA 4ECQA 1ZQPA 4FHPA 2M2UA 2IHMA 5DG9A 4LZGA 1NZPA 2BE3A 5J2GA 3AU2A 5CHGA 1TK5A 5KFSA 2BCUA 4WC1A 2UVWA 1SKWA 1TFRA 2ZH3A 2C22A 2C2RA 4UB5A 3GIJA 3FYHA 2BHNA 2NRZA 4Z6EA 3JPQA 5HRLA 1RZTA 4I2HA 1H38A 2KTQA 1Q78A 4UD4A 3RBDA 2MAXA 4RQ4A 3KHLA 1L3SA 4DFPA 4M9NA 4RPYA 4F93B 4X4SA 4GXJA 3GV8B 4ECRA 1S10A 2KP7A 3WFRE 1ZQYA 2ZUCA 3K4GA 3HP6A 4EBEA 2BQUA 9ICSA 3HW8A 1R8AA 1UT8A 1COOA 1CUKA 4I2EA 1ZQHA 2ZH4A 3WFPA 2JEIA 4ED8A 4ATBB 4DLEA 4JV0A 5IINA 9ICXA 3MGHA 3ZDEA 4GC6A 4F91B 4RQ2A 3OSPA 4PH5A 2R8HA 4QZEA 3H8JA 4PGXA 4DL3A 3PW5A 1BNOA 9ICNA 5KFOA 4F4WA 1U4BA 3H8SA 4BWMA 3HJ1A 3M8SA 2P6UA 4ATBA 3T5KA 4UAWA 4QWBA 4DL7A 1SL2A 5DDYA 2C2EA 4X5VA 2PFOA 4QZDA 1ZQCA 4WCWA 3ETLA 2W9CB 1Q79A 4UB1A 4GXKA 3RJHA 2C2DA 4EZ9A 5J2CA 4ED0A 5L1KA 1T3NA 1ZQQA 4M9GA 3RJJA 2W9AA 4NLZA 4WBYA 3HWTA 3C1YA 3C5GA 2PFNA 1V4AA 2XGPA 2XY7A 3C2KA 3QZ7A 1RXVA 4J9NA 4RNNA 2ASLA 5KT4A 4QW8A 1SL0A 4DOCA 4DFJA 5J0QA 4ECWA 4E0DA 4WC5A 4F5QA 1XSPA 4DLGA 3OJUA 4ECTA 3RH5A 1MC8A 3L9DA 5KFCA 2FPMA 5KFQA 2MUTA 7ICSA 3RJEA 3WFOA 4YVZA 1DOQA 5HRKA 4QWCA 4FHYA 1BNPA 2KZMA 5KFHA 4RZRA 4TUSA 1U47A 4B9NA 3OVSA 3Q8SB 1XC9A 9ICFA 4X4QA 1L3TA 4HYKA 4EZ6A 4M2YA 4WC7A 7ICJA 2R8IA 5KFYA 1ZQFA 2ZTCA 2NRKA 1SZPA 3AU6A 3QE9Y 4DSJA 1TK0A 1JN3A 2ASJA 2NRWA 1XSLA 4YR3A 2XGQA 3G6XA 4FS1A 2VA3A 5DB7A 3RB3A 7ICGA 5KG5A 4YXMA 1ZQZA 1S0VA 8ICBA 4EP7A 1S0NA 4RNOA 1ZQXA 4RQ1A 1S76D 4X4VA 4R63A 3SV3A 1BPZA 3PMLA 2FLPA 4O5CA 4YXJA 2ASDA 1AROP 5J2JA 4JUZA 1T8EA 7ICRA 5KFUA 5KFPA 5DG8A 3H7IA 1KNYA 2ZH6A 4J9PA 2A1JB 2ALZA 1BPBA 2V4QA 4I29A 2W9MA 1MQ3A 3LWLA 2XC9A 3LQCB 4DF4A 9ICEA 3EWAA 3QEAZ 1S0OA 4UQGA 2NRXA 1NJWA 1D9FA 3UXPA 4JV1A 8ICJA 5HC9A 4DSIA 2A1JA 3G6VA 4X4TA 4DS5A 3AQKA 3PVXA
chains in the Genus database with same CATH superfamily
1J97A 5KT6A 1LV5A 4LEZA 4Z6CA 5AKHA 3WKEA 4UB8U 4WC2A 4NM1A 2RFFA 4ECZA 4M0AA 4EBJA 4KLQA 1DK2A 4RQ7A 3TI0A 4DFDA 3EZ5A 1KSPA 8ICFA 3ZI4A 1ZJMA 1KFSA 2Z7JA 3JZ0A 5HRIA 4ZH4A 1NK0A 3F5AA 4DO9A 4QWEA 2NO4A 2R8JA 3SI8A 8ICMA 2HVHA 5J0RA 2KN7A 2XIDA 1L3UA 4RUCA 5JTIA 2ZJ8A 2DR8A 2DQNB 4NJ8A 8ICNA 4QW9A 4N7RA 4RUAA 1LKYB 1SXDA 4I0UA 8ICGA 2OHFA 3BDPA 1ZXIA 2DVIA 5F9LA 5J8YA 2IOHA 4IC9A 2WF5A 3TQ1A 2K4HA 4KITB 3M6ZA 2ZH1A 4NY8A 3D2NA 4YR2A 2BGWA 3RB0A 4E7XA 3SV4A 4KLFA 4YQWA 5DB6A 2M2VA 4UAYA 1UETA 4I27A 4Z6DA 3EPIA 3QZ8A 2WF9A 4PGYA 4MFFA 3PY8A 4C8MA 1JMSA 4KLUA 7ICUA 2Q0ZX 2VKQA 1K1QA 4J9OA 1MIWA 5KT3A 3MGIA 1DRGA 2KD1A 4FZMA 9ICAA 3JPTA 3UMGA 1LVHA 4IRKA 2P6RA 4O3OA 1NK8A 2HHXA 7ICQA 5F2VO 2MA1A 4EV6A 1JX4A 3DV9A 5ALPA 2XI9A 4PHEA 2DGZA 3BQ0A 3NYBA 1RXWA 5J2KA 4QNLA 3PMNA 1ZOLA 2YB1A 2HN2A 2VA8A 2JHDA 5DBCA 1KQQA 2W7OA 5D49A 1NOMA 2ZH8A 2LYHA 3KD3A 3SZ2A 4BXOB 4P0QB 4OD0A 4J9KA 2QB1A 4ECXA 4C8KA 4TUPA 2DBYA 4ED1A 1TFWA 4FH3A 4BXOA 2UVRA 4P0QA 2DR9A 5AKEA 5KL1B 4AP9A 2KJ8A 3DDHA 1Z1VA 2EWRA 1XO1A 1RYUA 2B6GA 4DEZA 2YTUA 3OTQA 3RR8A 4RPZA 3M7DA 4QZHA 4X4NA 4JK1A 1V9PA 4DSLA 1QQ7A 4AT8B 1UEVA 1IV8A 2HOIA 4RQNA 1XSNA 2J6TA 4YD1A 3THVA 4AT8A 5ALJA 5CA7A 2I6XA 4F5NA 3C18A 1KLNA 3BS7A 2GAFD 4PJ0U 4RQ6A 4NKUA 1U9LA 2BZFA 4MFAA 2KKPA 4NXTA 3LDAA 3V7LA 1NK4A 1VLBA 5AKIA 5CEHA 3A0HU 2DR5A 4O67A 4ECUA 2BPCA 2OCEA 5KFVA 2BQRA 3SAHA 4DL5A 2G0AA 8ICWA 1FFVA 1L8LA 1ZJNA 1HUOA 5B3QA 2W03A 2W11A 2XY5A 4YMOA 4OJOA 5G5HA 4FH5A 3C29A 4B9MA 2E8PA 3TANA 1X2IA 1RG6A 5AK5A 3RB6A 3K1ZA 4J03A 5L1JA 5J2BA 1PK1B 2N1RA 1SZHA 3H37A 2HHQA 4I2DA 4Q43A 1SV4A 1JROA 2O5AA 1PK1A 1UA1A 2XO7A 2K4IA 1ZQNA 3SD7A 3ORYA 7ICMA 2FPLA 3ISBA 2KJ9A 2NRTA 4DOAA 3C1ZA 5IILA 3IG8A 2K8AA 5H2FU 4BJQA 4DOBA 2KFNA 4Y2RA 3TAQA 4UBBA 4G3IA 5D61A 2HW3A 3MC1A 4C8LA 1JXEA 2BPGA 1X66A 2QARB 2DFLA 2ID1A 5AM1A 3MDCA 1QQ5A 2DUYA 4F3OA 4K9AA 3UPQA 3ISCA 4EBKA 2QARA 3BZCA 2LYBA 1X9XA 2F2AB 3QUBA 2DKXA 5KFAA 4US8A 3RJGA 2ZJAA 8ICOA 3QNMA 1RQLA 3LVWA 1HJPA 3QUCA 2J6SA 4GXIA 3TADA 5AM2A 3BQ1A 5IIOA 4UB6U 2F76X 1F5SA 3MR5A 1X9WA 1N63A 4QWAA 2B4VA 5D62A 5J0OA 4NKTA 2LI6A 9ICMA 5ALMA 4FHWA 7ICLA 3H4DA 1QSLA 2W3SA 1XS9D 3N28A 5GTIU 4NL9C 1WOTA 8ICZA 2B21A 3OHBA 4BDPA 2K8BB 1GPJA 1RPLA 2DR7A 4IL6U 5HRDA 2YMLA 7ICKA 1Z19A 1UA0A 3ISDA 3ZDBA 2RDJA 8ICIA 4LEWA 1JALA 4EEBA 3H0LB 5DG9A 4LZGA 1NZPA 2F8KA 4WC1A 1TFRA 2C2RA 3FYHA 3QU9A 2GH1A 4RPYA 4F93B 3GV8B 2WFAA 3H0MB 2JEIA 4ED8A 4DLEA 4JV0A 9ICXA 3MGHA 3ZDEA 2R8HA 4PGXA 2ZIUB 3PW5A 4DL3A 5KFOA 3C28A 1COKA 4UAWA 1SL2A 2C2EA 1ZQCA 1PVRA 2ZIUA 3ETLA 3PHZA 4EZ9A 5J2CA 3N7SC 5L1KA 4NLCA 3T79A 3C1YA 2QLTA 4J9NA 2HCFA 4DFJA 4E0DA 2OEHA 3OJUA 1MC8A 2YQEA 4YVZA 4C4RA 2ODGA 5GTHU 4TUSA 1XC9A 4M2YA 7ICJA 5KFYA 2ZTCA 2ZIXB 1JN3A 2NRWA 2G07A 4FS1A 2KVSA 4PZOA 4R63A 2ZIXA 1BPZA 4YXJA 5KFUA 1B0XA 1N60A 3H7IA 4OO1J 3IV6A 1L6NA 2F3NA 5AK6A 3QEAZ 2KOBA 2NRXA 5EE1A 1Q8KA 4JV1A 8ICJA 4X4TA 2EZXA 4I28A 4IG8A 2PBEA 3AQEA 4WC4A 4C7YA 7ICNA 2WHEA 1V97A 1L5UA 5KG7A 2K89A 5ALNA 2H3VA 5J0UA 1NZBA 3RH6A 2BCQA 2FMSA 4F5RA 4WOYA 4FHVA 2K8CB 5AI4A 4O68A 4F4XA 5KFKA 2PMZF 3UQ0A 2GWSA 4DQIA 4X4OA 4ECSA 1FIQA 1HEKA 2JEJA 2G06A 2VANA 4PZNA 2ZUBA 9ICQA 1NJYA 2H3QA 4C8OA 2ZIWB 1XWLA 2HI0A 3C2LA 2XICA 4R8UB 4OCZA 4FBUA 2PI5A 3RF9A 4Y2YA 4X0BA 1ZQGA 2IHNA 2HHVA 2ZIWA 4WJ3B 3KKAA 3CW2C 1ZRMA 4QZCA 3OVAA 4R8UA 3C21A 4ED3A 3TAPA 2R18A 2AQ4A 4DQSA 3GDXA 3Q8RB 2Y9TA 5AM5A 4DS4A 4FS2A 1ZQOA 2WTFA 3H38A 2H3IA 3C2MA 2RLTA 3JPSA 5DBAA 7ICIA 5CHEA 2MSNA 2ISPA 1Z4NA 5IIJA 3OSNA 2KMDA 5ALRA 1YZ7A 5ALZA 9ICTA 2BQ3A 4RU9A 5ALUA 4NXUA 2W9CA 1PVPA 3GU3A 3LVVA 4WH5A 2JZBB 3RJFA 3ZD8A 2LHTA 4NXZA 4K9BA 3WK5A 1D8BA 2F77X 2ZHBA 1U48A 2FLLA 3NVWA 2JZBA 1N5WA 4B9UA 4MEYA 4YD2A 3PW2A 3TADC 2W43A 5KFNA 2AGQA 2IHOA 2FLNA 2ZH9A 2GO7A 4EYIB 2YMPA 2UVUA 3BS5B 2BBJA 5KT5A 4O3MA 5CR0A 3NGDA 4RNMA 4XA5A 5HR9A 4QZ9A 1N56A 1B22A 3F5EA 4OAIZ 3QX7A 2AXTU 4HX0A 2W7PA 4EEYA 3BS5A 4WC3A 4EEDA 3WFSC 3GFKB 2PI4A 4CF5A 2HVIA 3HPOA 3CP8A 3MBYA 2AU0A 5EE0A 4BWJA 3F2DA 1N48A 1ZD3A 2MRLA 3ZDCA 1FA0A 1ZQIA 1QQ6A 1IIPA 2E1FA 1D9DA 4WQKA 3CK6A 3NVOA 4ED7A 4RQ3A 3HX0A 2HHWA 2IA6A 1X42A 3HKZF 1ZQKA 4O3PA 2PFQA 5BOMA 1ZQJA 3N7PD 3JPNA 2E1EA 2BDPA 3PW0A 4OAGA 4KLIA 4Q45A 4DL4A 4KLOA 4S3NA 2V4RA 1PZNA 4O3SA 5AIBA 5E79U 5DG7A 2PFPA 3ZDDA 1X6JA 2ZTEA 1L7NA 3L5KA 2FMPA 5KG1A 1UT5A 5EOZA 1S0MA 4DL6A 1NO5A 1S8OA 4X0AA 4KN4A 9ICOA 1TE2A 4Z6FA 4Y2UA 3ER8C 4XQ8A 2ZTDA 3QU4A 2CPRA 1LKYA 2BDUA 3EUB2 2NRVA 4YMNA 4M9HA 1L7PA 2ES6A 1T7PA 4RWQA 3RAXA 5ALWA 5DLGA 4UB2A 4WQLA 1PUZA 2M9NA 2E8OA 5A0LA 5DDMA 1NK9A 4MF2A 1VDVA 4M9LA 4F4ZA 3QU7A 4RQ0A 4P4MA 9ICRA 1A6SA 1OW5A 1D8YA 4LVSA 4WC0A 1KN5A 4AYBF 1SV0C 2WF8A 3IDWA 1XNSA 4M47A 3MR3A 5F9NA 4X4PA 5EWGA 3AQMA 2JXJA 1O03A 2RP5A 1SXEA 3NS1A 2D6FC 3WFQE 3AQFA 5J2IA 1T4GA 4PPXA 5KFTA 1TKDA 3H3AA 2ZJ5A 1UPHA 2KZ3A 3QXGA 3K7DA 5L1LA 3OVBA 2XCAA 5D46A 4YN4A 2GLEA 1KRPA 3K75D 3OHAA 4EENA 3SMVA 4I2JA 4F4YA 4KLSA 4ELVA 4I2BA 4IQTA 4I2FA 3KZIU 5EE9A 1A76A 4KN7A 2JRZA 1KFTA 3KFUF 3EF2A 5KT2A 1TK8A 4M04A 5J0XA 4IQWA 4FBTA 3TKAA 4RT2A 3T5HA 4M9JA 2L5YA 4RT3A 1ZQLA 4P4OA 5L9XA 5JU5A 1N5XA 4ECYA 5DQHA 4JWMA 1M6YA 2I5HA 4PL2A 4GC7A 2W8KA 1D8LA 2HSZA 2EANA 3WK4A 2DRBA 4R64A 5J0WA 2IBKA 2LPEA 1WCNA 5BOLA 4PGQA 5KT7A 3IP4B 2KEYA 4F4KA 2IOFK 9ICWA 3OWGA 5KG3A 4MF8A 4CF3A 4C80A 1MIVA 3KKAC 4C4SA 4IS7A 5AICA 3SYZA 1R8BA 4JMUA 1JUDA 2P35A 5BPCA 4DWIA 4F5PA 3NWIA 3KHGA 2M0NA 4MHVA 2IOFA 1F5AA 4DQPA 4NLNA 2HDOA 4FHPA 1ZQPA 2F8LA 4ECQA 1HIWA 2QKQA 2BE3A 5KAFU 4OAFA 1YT3A 3OPXA 5J2GA 1SKWA 2ZH3A 1KL9A 1YZ6A 3GIJA 3JPQA 4Z6EA 4I2HA 2KTQA 1Q78A 3RBDA 3KHLA 1L3SA 4M9NA 4X4SA 4GXJA 1SGGA 3ETRA 1OXJA 2ZUCA 3HP6A 3RFAA 1CUKA 1ZQHA 4GFJA 2K4PA 2HBJA 2ZH4A 3ERCC 4F72A 4Y2QA 2VIXA 3VC8A 2GOLA 3H8JA 4QZEA 4O6AA 3HJ1A 3M8SA 4QWBA 4DL7A 2EAMA 5DDYA 2PMZC 4WCWA 4P0PB 3RJHA 4JB3A 4UATA 1L8OA 5AM4A 3RJJA 2W9AA 4NLZA 3C5GA 5G5GA 5AKLA 2ASLA 1SL0A 4P0PA 4ICAA 2KHQA 2HMXA 4DLGA 4ECTA 3L9DA 7ICSA 3S6JA 4C4TA 1IG6A 4X4QA 4HYKA 2R8IA 1ZQFA 2NRKA 1SZPA 3QE9Y 2G09A 4LEVA 2OM6A 4YR3A 2XGQA 1MA7A 2EAPA 3FM9A 1ZQZA 4EP7A 5ALFA 2GA9D 2NO5A 4O5CA 3ALRA 2OYYA 2ASDA 5J2JA 1T8EA 5KFPA 5DG8A 1KNYA 2A1JB 3H0RB 4I29A 2W9MA 4NWIA 3L3FX 3CRXA 3LWLA 1TAMA 4DF4A 3EWAA 1D9FA 1ZD4A 5HC9A 2A1JA 1WYGA 3G6VA 2YB4A 2ESEA 1L3TA 1NKCA 3AL0B 2ZXHA 3BJYA 2VJ4A 3SAFA 1GO3F 1O08A 3MABA 3UM9A 4KLJA 5AM3A 3M1YA 2ZHAA 2JEFA 9ICHA 3RAQA 4RWNA 8ICUA 8ICTA 5J8YC 8ICHA 2JV3A 3T3FA 2M2TA 3HRDD 5KFGA 5HHHA 5DQGA 2HBKA 4UB3A 2FI1A 4F8RA 1RM6C 4PHPA 4RQ8A 2Q66A 4K97A 1QSYA 3B0YA 4FZLA 3N4MB 4GLXA 2HN1A 3E0FA 1JXLA 4KTQA 3AQNA 5AI8A 3GIMA 4X4UA 1HUZA 5KG6A 4JV2A 1A0PA 4I2AA 4I2GA 5HR7A 1ZYQA 3SAGA 1SKRA 2J6UA 1ECWA 3I28A 1ZQRA 1P7DA 4PHAA 1T94A 3HKZC 1NJXA 1MN8A 4X4RA 3F2BA 3PX0A 3PR4A 3Q8KA 3KHHA 4E8FA 1JI7A 4I2IA 4DQQA 3H8WA 4OJ5A 4YCXA 3G6YA 1F44A 2F1HA 5J2DA 2E3TA 4OJ6A 2KSOB 2P66A 8ICVA 3MR2A 1V85A 4ED6A 5KAIU 8ICYA 5B66U 1KW4A 1IXRA 2KK0A 4K98A 5KFXA 9ICVA 5AKXA 3T5LA 3JPRA 2KHVA 4B9SA 3JYYA 3SR6A 4YMMA 5EWFA 5J2AA 4O3RA 8ICRA 4Q8FA 2JR5A 4EX6A 3OGUA 4ACOA 3K1RB 3EYZA 3GZFA 3HIYA 5KTQA 3B0XA 1WCLA 2ZH5A 3ZD9A 4F71A 1ZQAA 5B3PA 1DGSA 5ALVA 1Y88A 2NYVA 4EBCA 2YX8A 4O9MA 3FC4A 4YG2A 5IIKA 2HHPA 9ICPA 3V6JA 2PKEA 8ICPA 4DSEA 1DK3A 1VFGA 4AYBC 3QYPA 1X9MA 4KLEA 5CJ7A 4FO6A 3H40A 5KG4A 5EE3A 1ZQUA 4NLGA 3PX4A 2VA2A 1UEUA 4MEXA 3PSIA 4BGDA 2KE7A 3UXNA 4KLMA 2W8LA 3M8RA 2JEGA 4KM5A 1Q3VA 3CNHA 7ICTA 2HHSA 4UASA 5JUMA 5CWRA 4J9SA 3LK9A 4RPXA 3PX6A 4CGZA 4UBCA 3AM9A 3H39A 5DEDA 5KG0A 2D8CA 4FZNA 3D2SA 2G5IB 4BX9C 4F2SA 2XCPA 2KNJA 3M9MB 2F1JA 5DECA 5DB9A 1TAUA 7ICEA 4DCCA 1RQNA 1ZQDA 3OJSA 4QWDA 4A8EA 1WWVA 2WF7A 1VJ5A 4E80A 3RRHA 1UCVA 3WK6A 5AKZA 5J0YA 1X40A 5HRGA 3RTVA 1CEZA 1AQ6A 3PO5A 5ALOA 8ICCA 1S97A 4QZGA 3TARA 3AN1A 1NK7A 5CRXA 5KFMA 3BQ2A 3MCRA 2DF4B 3GQCA 2FDRA 2JH1A 4NLKA 1ZQVA 1J2NA 3RBEA 1RYSA 8ICAA 5HRFA 5KG2A 3OV7A 1MSWD 3SENA 2KFZA 1YLQA 5KL8B 4EEKA 3TFSA 3LYSA 1SL1A 5ALEA 2LMRA 4R66A 4DL2A 4B6JA 4QZ8A 5J2FA 1LB2B 1S77D 3QU5A 3UMBA 2ZH7A 3GV7B 3V7KA 2KICA 3NRWA 2MUTB 4OJPA 3C66A 3FDSA 4DFMA 9ICGA 5ALHA 4CDGA 3M9NB 4NLBA 4CRXA 3ER9B 3O0FA 3NVVA 1TAQA 1R89A 4I2CA 5KFDA 4PL1A 3C23A 3PZPA 2O1PA 5DKWA 1S5LU 1QTMA 4IR1A 4DQRA 2Y1IA 2M2WA 1MIYA 2O6KA 5ALQA 4Q8EA 3IHQB 3ZDAA 4KLHA 5EWEA 4IRDA 2H3ZA 4KMUA 4EYHB 5HREA 1Q46A 1QCKA 1URJA 4KMOB 4DSFA 2E8NA 3I76A 3GV5B 4KLTA 3Q8PB 5AI6A 2I9GA 2V9WA 2DRAA 2ATLA 5D63A 2IMWP 4KLDA 8ICQA 4KLLA 5B5EU 4YR0A 2BKEA 5J0TA 2AJQA 3V7JA 1KEJA 7ICPA 7ICHA 5ALIA 1A77A 5AK4A 1JAJA 3HJ4A 1ZQTA 2QB0B 2HOFA 2OWOA 3ED5A 3N7RC 3JPPA 2F1IA 5ALDA 4J9QA 1ZQSA 3RR7A 3GIIA 2K60A 1TVAA 2QB0A 3MDAA 4LJXA 4YP3A 5J0SA 1SKSA 5KFEA 4MFCA 4EGWA 4DF8A 5CB1A 2OXOA 2W54A 4TQRA 2BCSA 1ZETA 2M2UA 2BCUA 4BUGA 2LKYA 4UB5A 1F0MA 3WK7A 1RZTA 4NL9A 5AI9A 1H38A 3NASA 2MAXA 4RQ4A 4DFPA 4ZOHC 4U7CA 2YY6A 2KP7A 4ECRA 2ZXIA 1S10A 1KKXA 3K4GA 1Z4OA 3HW8A 1COOA 4EELA 3PSPA 3WFPA 4ATBB 2B51A 4RQ2A 3OSPA 5AI0A 9ICNA 1CRXA 4C0ZA 4ATBA 4Y2JA 5AK3A 2PFOA 2YMQA 2JGAA 4UAVA 4GXKA 4M9GA 3HWTA 1V4AA 2XY7A 3WKAA 3C2KA 4RNNA 4C7ZA 4WC5A 2KVCA 1XSPA 3VCBA 2CXYA 3IRUA 2DL0A 2FCLA 5CFUA 3RH5A 5HRKA 4FHYA 3OVSA 4RZRA 4B9NA 1U47A 3Q8SB 4XJEA 4EZ6A 1K5OA 3KZXA 4DSJA 4LEYA 1JRPA 1TK0A 2Y9UA 2ASJA 3KBBA 4CNQA 3G6XA 7ICGA 5DB7A 3RB3A 5KG5A 4YXMA 3QUQA 1ZQXA 4RQ1A 1S76D 4X4VA 1T3QA 4Y2SA 2FLPA 1AROP 3SQIA 2ZH6A 2EQYA 4J9PA 2ALZA 1BPBA 5ALGA 2LM1A 4OJLA 3LQCB 2LM4A 3D2QA 1PK3A 4OAHA 2B56A 5ALKA 4DSIA 4DS5A 5AKKA 3PVXA 2I1QA 4QIWC 2C28A 1BPXA 3U26A 3F2CA 1JIHA 4CCHA 2HBMA 4U6PA 2G08A 4US9A 3MFIA 2A19A 1KBUA 5J29A 9ICBA 7ICFA 2YN4A 2ZG6A 3JPOA 1Z00B 4O3NA 3IN5A 3ONNA 1N62A 4J9MA 3QEBZ 3RJIA 4O3QA 2KV2A 2BCRA 2FMQA 5KFFA 2W9BB 1Z00A 2BR0A 5ALXA 3RB4A 1N2XA 1SB3C 3HILA 5KFLA 1SWVA 5TZVA 4YFKA 5D4BA 2AGOA 2W9BA 5HRBA 4HAIA 3Q8MA 5FP0A 1NKBA 2AGPA 1S9FA 2ZH2A 2H5XA 3M9OB 5K4LA 4RWPA 2PXIA 2WB1F 4TQSA 4FHXA 4UB4A 2LYAA 4ECVA 4G9BA 3RH4A 5J2EA 8ICSA 3HJEA 3H8MA 5J0PA 8ICKA 1U45A 4J9LA 1QH9A 2D3DA 5JTGA 4GIBA 7ICOA 5HMMA 9ICUA 4QZBA 3RRGA 7ICVA 8ICLA 3HT3A 2BPFA 1NNLA 1L3VA 4NXVA 3UPSA 4O5KA 3AUOA 2DWQA 3NTUA 1Z1BA 3GILA 2ZIVB 2BCVA 4JWNA 3R9KA 1JQRA 5CP2A 5F3XB 2ZIVA 4FE3A 5IIIA 4AT9B 1IM4A 1WUDA 5JRTA 2ZUDA 3UXOA 4F2RA 3TFRA 1NK6A 4K4IA 2Y0SC 2KIVA 4UD5A 4AT9A 3WK9A 2W55A 5ALTA 4IQVA 2BBHA 2Q4TA 1FO4A 3IM1A 4QZIA 1QLNA 5L1IA 2W3RA 2H3FA 4NV0A 4P4PA 3QU2A 5KFBA 2OH2A 4KX5A 1R8CA 1U49A 1B4FA 2RQ5A 5HR6A 5C0YA 2IUBA 4NM2A 9ICKA 3V72A 1RYRA 5DB8A 2KZZA 3QUTA 3A0BU 3MFHA 1BPYA 4B9VA 3OUYB 2CRXA 1NKEA 2JH7A 1C20A 1UHUA 3PR5B 1KDHA 4IRCA 3OUYA 3SEIA 4PHDA 3IG5A 5HNKA 1ZRNA 4R65A 3NVZA 5AM0A 5KFRA 4LZDA 2DPJA 4P2HA 4KB6A 3FAHA 4B9LA 5J2HA 3PSTA 9ICCA 5DLFA 3PNCA 4J9RA 5HMLA 3MGVA 4C8NA 2WAQC 4UAZA 4XUSA 3V6HA 3CYMA 4F92B 5DGBA 2RDIA 1B43A 4WC6A 5KFWA 3EPGA 1TFYA 4QZAA 2K4EA 9ICLA 3T5JA 5KFJA 4NXWA 1DXSA 2B0CA 3J81j 4O0IA 4IQUA 4B9TA 1RDFA 1SIJA 3BQTA 3I1YA 4FFDA 2KG5A 1BVSA 3GIKA 3H4BA 1ZD2P 1TV9A 1C7YA 2W04A 4EX7A 4XQ7A 4NXXA 4O69A 4FO1A 4KLGA 4M6WB 1ZD5A 3E2EA 2F44A 4Q44A 1ZQBA 4KX3A 1NK5A 5CFSA 4K4GA 2KIWA 9ICJA 4M5DA 2WF6A 2AQ0A 2UVVA 4WBZA 2DPIA 4M6WA 1BPDA 4AT7B 4RQ5A 2HHTA 3PV8A 2MU2A 2KSOA 9ICIA 3Q8QB 2R8KA 1X6IA 1XU4A 3KOOA 1KFDA 1KTQA 1N61A 5AKJA 4AT7A 4QIWF 4ELUA 1K1SA 4Y2XA 5HP4A 3DEEA 1Z3EB 2KJ5A 3WU2U 1FFUA 8ICEA 4USAA 4IR9A 5CFTA 1NJZA 1MQ2A 3KHRA 1Q3UA 2EZZA 4UAUA 2LBOA 2KKVA 1SV0A 3Q8LA 4F50A 5IIMA 3AQLA 5ALLA 1ZQEA 4JLXA 3F53A 4UARA 3AMZA 3KTQA 5HHIA 5AI5A 4RWOA 2FPKA 2FE9A 1S0VA 3PW7A 4LT6A 4EBDA 4K4HA 2FJ6A 4QZFA 8ICXA 1ZQWA 1X9SA 3V6KA 3L4PA 3MR6A 5AIAA 3N97B 3NUQA 4MKPA 1PVQA 3NVYA 4F5OA 2Y1JA 4TURA 4CE6A 1EXNA 3NKUA 2RHFA 2XY6A 5T14A 3PO4A 3E58A 3EW9A 5AKYA 2E5SA 5KFIA 2NV3A 4DFKA 2HBLA 3C5FA 4ED2A 3LWMA 5DQIA 4O5EA 2ISOA 4K99A 5DGAA 2HHUA 4DSKA 1BGXT 1WWUA 4XRHA 5DBBA 1PX5A 3UQ2A 2XVTA 4CF4A 5KFZA 1VJ7A 3D6JA 1QSSA 1BPEA 2R8GA 3RJKA 5ALSA 3PW4A 2HOQA 1OU5A 5AKGA 2EAOA 4ELTA 5HRHA 5C5JA 4TUQA 2Y0SF 4K8VA 2AH5A 2RRDA 1ZQMA 5TISU 3AEVA 2IHMA 3AU2A 5CHGA 1TK5A 5KFSA 2UVWA 1NI3A 3BZKA 2C22A 2JMGA 5HRLA 2BHNA 2NRZA 3WKCA 4JLZA 4UD4A 3PSFA 3BQ7A 1UQVA 2AHOB 3M6KA 3WFRE 1ZQYA 4EBEA 9ICSA 2BQUA 2G5HB 1R8AA 1UT8A 5KNIA 4I2EA 2A3VA 4Y2VA 5IINA 4GC6A 4F91B 4QJFB 4PH5A 1BNOA 1WG8A 3WKBA 1L7OA 4F4WA 1U4BA 3H8SA 3NRZA 4BWMA 2VJ5A 1OUQA 2P6UA 3T5KA 2DKZA 4X5VA 4QZDA 1XO0A 3B9JA 2W9CB 1Q79A 4UB1A 4RQMA 4Y2TA 2C2DA 4ED0A 1T3NA 1ZQQA 1J2MA 4WBYA 2PFNA 2XGPA 3QZ7A 1RXVA 5KT4A 4QW8A 4DOCA 5J0QA 4ECWA 1FEZA 4F5QA 2EZYA 3JCFA 2WAQF 4K96A 2FPMA 5KFQA 5KFCA 2MUTA 3WFOA 3RJEA 4Y2PA 1DOQA 4QWCA 4UW9A 1BNPA 2EH9A 2KZMA 3WK8A 1CI4A 2WB1C 3WKDA 5L1MA 5KFHA 9ICFA 4WC7A 5AHXA 2A1AA 3AU6A 1V38A 1XSLA 1ZQ1C 2VA3A 8ICBA 1S0NA 2CN1A 4RNOA 3TACB 3SV3A 3PMLA 1ED1A 4JUZA 7ICRA 3UMCA 5ALYA 1L7MA 2YMMA 2V4QA 1DGJA 1MQ3A 1SWWA 2XC9A 9ICEA 2E8MA 1S0OA 4UQGA 1NJWA 2EDUA 3UXPA 3ICXA 3AQKA
chains in the Genus database with same CATH topology
1NKCA 2I1QA 3BJYA 5KT6A 1LV5A 1BPXA 2C28A 4I28A 4Z6CA 4IG8A 2PBEA 1JIHA 4CCHA 3MABA 4WC2A 4WC4A 4NM1A 2RFFA 4KLJA 4ECZA 4M0AA 7ICNA 4EBJA 1L5UA 2ZHAA 4KLQA 3MFIA 1DK2A 4RQ7A 5KG7A 2JEFA 5J0UA 3TI0A 3RAQA 9ICHA 5J29A 3RH6A 2BCQA 2FMSA 4RWNA 8ICUA 3EZ5A 4F5RA 1KSPA 7ICFA 8ICTA 3JPOA 8ICFA 9ICBA 1Z00B 4FHVA 4O3NA 1ZJMA 4F4XA 1KFSA 3JZ0A 5HRIA 4ZH4A 8ICHA 5KFKA 1NK0A 4J9MA 3T3FA 4DO9A 3UQ0A 3RJIA 3QEBZ 4QWEA 5KFGA 5HHHA 4O3QA 5DQGA 2GWSA 2R8JA 4DQIA 3SI8A 2BCRA 4X4OA 2FMQA 4UB3A 4F8RA 8ICMA 2HVHA 5KFFA 4PHPA 1Z00A 5J0RA 4RQ8A 2KN7A 2W9BB 4ECSA 2BR0A 2Q66A 3RB4A 1L3UA 1QSYA 2JEJA 4RUCA 3B0YA 2VANA 2ZJ8A 3N4MB 5KFLA 2ZUBA 2DR8A 9ICQA 5TZVA 8ICNA 4YFKA 4QW9A 4GLXA 5D4BA 2AGOA 1NJYA 1JXLA 3AQNA 4KTQA 2W9BA 3GIMA 5HRBA 4C8OA 4RUAA 1XWLA 3Q8MA 5KG6A 3C2LA 1HUZA 4X4UA 4JV2A 1NKBA 2AGPA 1S9FA 4I2GA 4R8UB 4I2AA 2ZH2A 1ZYQA 2H5XA 4FBUA 2PI5A 4X0BA 1SKRA 3M9OB 2J6UA 8ICGA 1ZQGA 1ZQRA 2IHNA 3BDPA 2HHVA 4RWPA 4PHAA 2PXIA 4TQSA 4FHXA 4UB4A 4QZCA 4ECVA 3OVAA 4R8UA 3C21A 4ED3A 5F9LA 3TAPA 2DVIA 3RH4A 5J2EA 1NJXA 8ICSA 2AQ4A 4DQSA 4X4RA 3GDXA 3Q8RB 3TQ1A 3PX0A 3PR4A 5J0PA 3KHHA 4KITB 3Q8KA 1U45A 8ICKA 4J9LA 4E8FA 4DS4A 4FS2A 1ZQOA 2WTFA 3H38A 2ZH1A 4I2IA 4DQQA 4NY8A 3H8WA 4YR2A 7ICOA 4YCXA 3G6YA 3C2MA 2BGWA 5HMMA 9ICUA 4QZBA 2F1HA 3RRGA 7ICVA 3RB0A 5J2DA 3JPSA 5DBAA 4E7XA 7ICIA 3SV4A 3HT3A 2BPFA 2P66A 1L3VA 8ICVA 8ICLA 4KLFA 3UPSA 4O5KA 4YQWA 3MR2A 5DB6A 3AUOA 2ISPA 2M2VA 3NTUA 4UAYA 3GILA 4ED6A 5IIJA 2BCVA 4I27A 3OSNA 4JWNA 8ICYA 1UETA 4Z6DA 1IXRA 9ICTA 3EPIA 2BQ3A 5KFXA 4RU9A 3QZ8A 4PGYA 4MFFA 9ICVA 5CP2A 1JQRA 3PY8A 2W9CA 4C8MA 3JPRA 3T5LA 4B9SA 3JYYA 1JMSA 4KLUA 4YMMA 7ICUA 5EWFA 2Q0ZX 1K1QA 5J2AA 5IIIA 2JZBB 4J9OA 4O3RA 3RJFA 1IM4A 8ICRA 4AT9B 3ZD8A 5KT3A 3MGIA 1MIWA 4Q8FA 9ICAA 3JPTA 2ZUDA 4NXZA 3UXOA 3OGUA 4F2RA 4IRKA 3TFRA 1NK6A 3EYZA 4K4IA 2ZHBA 3HIYA 1U48A 5KTQA 2FLLA 3B0XA 2P6RA 2JZBA 4UD5A 4O3OA 4AT9A 1WCLA 2ZH5A 4IQVA 3ZD9A 4B9UA 4WC6A 4MEYA 1ZQAA 4YD2A 1DGSA 5KFNA 3PW2A 2AGQA 1NK8A 2HHXA 7ICQA 3IM1A 4QZIA 1QLNA 5F2VO 1Y88A 5L1IA 2FLNA 2ZH9A 4EBCA 1JX4A 4P4PA 4EYIB 2UVUA 5KFBA 4O9MA 4YG2A 5IIKA 5KT5A 1R8CA 4PHEA 5CR0A 3NGDA 4RNMA 3BQ0A 4XA5A 3NYBA 1U49A 1RXWA 5J2KA 2HHPA 5HR9A 3PMNA 4QZ9A 4NM2A 3V6JA 1N56A 9ICKA 9ICPA 1B22A 8ICPA 2VA8A 4DSEA 4EEYA 3V72A 1DK3A 1VFGA 1RYRA 5DB8A 2KZZA 4WC3A 3GFKB 3MFHA 1BPYA 4B9VA 1X9MA 3OUYB 5DBCA 2PI4A 4KLEA 1NKEA 2HVIA 3HPOA 2AU0A 3MBYA 5CJ7A 5D49A 4BWJA 4FO6A 1NOMA 3H40A 5KG4A 3PR5B 2ZH8A 1N48A 1KDHA 2LYHA 3SZ2A 4BXOB 3ZDCA 1FA0A 1ZQIA 4IRCA 3OUYA 4J9KA 1ZQUA 4PHDA 1D9DA 4ECXA 4C8KA 4ED7A 4RQ3A 4TUPA 3HX0A 4NLGA 4ED1A 2HHWA 5HNKA 2IA6A 1TFWA 4FH3A 1ZQKA 4BXOA 4O3PA 2UVRA 3PX4A 2PFQA 2VA2A 1UEUA 2DR9A 5BOMA 4MEXA 1ZQJA 4BGDA 3UXNA 4R65A 3JPNA 1XO1A 4KLMA 2W8LA 3M8RA 4DEZA 5KFRA 4LZDA 2DPJA 2BDPA 4P2HA 2JEGA 3RR8A 3PW0A 4B9LA 4RPZA 4KLIA 4QZHA 4Q45A 7ICTA 4X4NA 5J2HA 2HHSA 4DL4A 4JK1A 5JUMA 5CWRA 4J9SA 9ICCA 5DLFA 3LK9A 4RPXA 3PNCA 3PX6A 4UBCA 1V9PA 4DSLA 3H39A 5DEDA 5KG0A 4J9RA 4KLOA 5HMLA 4C8NA 4S3NA 4UAZA 4AT8B 4XUSA 2V4RA 1UEVA 3V6HA 1PZNA 4O3SA 4F2SA 2J6TA 1XSNA 2XCPA 4F92B 5DGBA 2RDIA 1B43A 3M9MB 2F1JA 5KFWA 3EPGA 5DG7A 4YD1A 5DECA 2PFPA 5DB9A 1TAUA 1TFYA 3THVA 3ZDDA 7ICEA 4AT8A 2ZTEA 5CA7A 4QZAA 2FMPA 5KG1A 4F5NA 9ICLA 1ZQDA 1UT5A 3T5JA 5KFJA 3OJSA 5EOZA 4QWDA 1S0MA 1KLNA 4O0IA 4IQUA 4DL6A 1NO5A 3C18A 4X0AA 4B9TA 4KN4A 3BQTA 4RQ6A 4Z6FA 9ICOA 4NKUA 1U9LA 4XQ8A 2ZTDA 4E80A 3RRHA 1BVSA 2NRVA 4YMNA 4MFAA 3GIKA 3H4BA 3LDAA 3V7LA 1NK4A 1TV9A 4M9HA 1C7YA 1T7PA 4XQ7A 5J0YA 3RAXA 4RWQA 5DLGA 4UB2A 2M2TA 5HRGA 2M9NA 3RTVA 4ECUA 1CEZA 2DR5A 5DDMA 2BPCA 5KFVA 1NK9A 4MF2A 2BQRA 3PO5A 4M9LA 4F4ZA 4M6WB 4DL5A 4KLGA 8ICCA 4RQ0A 4P4MA 8ICWA 1S97A 3E2EA 9ICRA 4Q44A 1ZJNA 1ZQBA 4QZGA 1HUOA 1D8YA 3TARA 1NK7A 1NK5A 5KFMA 3BQ2A 4LVSA 2XY5A 4K4GA 4WC0A 3GQCA 9ICJA 4YMOA 4M5DA 2AQ0A 2UVVA 4WBZA 2DPIA 3WFSC 4M6WA 4FH5A 4NLKA 4B9MA 1ZQVA 3TANA 1X2IA 1BPDA 3RBEA 1RYSA 4AT7B 4RQ5A 4M47A 2HHTA 3RB6A 3PV8A 8ICAA 5HRFA 5KG2A 3MR3A 5F9NA 9ICIA 5L1JA 5J2BA 1MSWD 3OV7A 4X4PA 2KFZA 5EWGA 3Q8QB 2R8KA 1YLQA 3AQMA 1XU4A 3H37A 1KFDA 1KTQA 2HHQA 4AT7A 1SL1A 3TFSA 3WFQE 4I2DA 4ELUA 4DL2A 4R66A 5J2IA 1K1SA 1T4GA 4Q43A 5HP4A 1Z3EB 4QZ8A 4PPXA 2O5AA 5J2FA 1UA1A 5KFTA 2XO7A 1TKDA 3H3AA 2ZJ5A 1LB2B 8ICEA 1ZQNA 4IR9A 1S77D 3ORYA 1NJZA 7ICMA 2FPLA 3ISBA 2KZ3A 2NRTA 4DOAA 3C1ZA 5IILA 1MQ2A 2ZH7A 3KHRA 3GV7B 3V7KA 4DOBA 2KFNA 2MUTB 3C66A 3TAQA 4UBBA 5L1LA 4G3IA 3OVBA 3Q8LA 2XCAA 5D46A 4F50A 4YN4A 3FDSA 4DFMA 5IIMA 3AQLA 9ICGA 1KRPA 3K75D 3M9NB 4C8LA 2HW3A 3OHAA 1JXEA 2BPGA 1ZQEA 2DFLA 4I2JA 4F4YA 4KLSA 4ELVA 2ID1A 4I2BA 1TAQA 4IQTA 4I2FA 1R89A 3KTQA 3MDCA 5HHIA 1A76A 4KN7A 4I2CA 4F3OA 5KFDA 4RWOA 1KFTA 3UPQA 3C23A 3ISCA 2O1PA 2FPKA 5DKWA 4EBKA 5KT2A 1TK8A 1QTMA 5J0XA 4DQRA 2Y1IA 4IR1A 4FBTA 4IQWA 3PW7A 4M04A 4Q8EA 3IHQB 4RT2A 2M2WA 1MIYA 3T5HA 4EBDA 4LT6A 5KFAA 4K4HA 3ZDAA 4M9JA 4KLHA 4QZFA 4RT3A 5EWEA 3RJGA 4IRDA 2ZJAA 8ICOA 8ICXA 1ZQWA 1HJPA 1X9SA 3V6KA 4GXIA 1ZQLA 4P4OA 5L9XA 2J6SA 3MR6A 3BQ1A 4ECYA 4KMUA 4EYHB 3N97B 5IIOA 5HREA 5DQHA 4JWMA 4DSFA 4F5OA 2Y1JA 4TURA 1EXNA 4GC7A 3MR5A 2W8KA 1X9WA 1D8LA 3GV5B 2XY6A 4KLTA 3PO4A 3EW9A 4QWAA 3Q8PB 2I9GA 2V9WA 2DRAA 2ATLA 5J0OA 4NKTA 2IMWP 5KFIA 2DRBA 4KLDA 4R64A 4DFKA 3C5FA 9ICMA 8ICQA 4KLLA 5J0WA 4YR0A 4ED2A 2BKEA 5DQIA 5J0TA 3LWMA 1KEJA 3V7JA 2AJQA 7ICPA 7ICLA 4FHWA 3H4DA 2ISOA 1QSLA 2IBKA 4O5EA 5DGAA 1WCNA 5BOLA 4PGQA 4DSKA 2HHUA 7ICHA 1A77A 1BGXT 5KT7A 1XS9D 1JAJA 3HJ4A 1ZQTA 2OWOA 4XRHA 1WOTA 8ICZA 5DBBA 2B21A 3OHBA 4BDPA 4F4KA 9ICWA 1PX5A 3UQ2A 5KG3A 4MF8A 3JPPA 5KFZA 1RPLA 2F1IA 4J9QA 2DR7A 1MIVA 1VJ7A 2R8GA 1QSSA 1BPEA 1ZQSA 3RJKA 5HRDA 3RR7A 3GIIA 3SYZA 1TVAA 7ICKA 3PW4A 1R8BA 1UA0A 5BPCA 3MDAA 4F5PA 4DWIA 4YP3A 3KHGA 1OU5A 5J0SA 3ISDA 1SKSA 3ZDBA 5KFEA 2RDJA 1F5AA 4DQPA 4MFCA 8ICIA 4DF8A 4ELTA 5CB1A 5C5JA 5HRHA 4TUQA 4TQRA 4NLNA 2BCSA 1ZETA 1ZQMA 4ECQA 1ZQPA 4FHPA 2M2UA 2IHMA 5DG9A 4LZGA 1NZPA 2BE3A 5J2GA 3AU2A 5CHGA 1TK5A 5KFSA 2BCUA 4WC1A 2UVWA 1SKWA 1TFRA 2ZH3A 2C22A 2C2RA 4UB5A 3GIJA 3FYHA 2BHNA 2NRZA 4Z6EA 3JPQA 5HRLA 1RZTA 4I2HA 1H38A 2KTQA 1Q78A 4UD4A 3RBDA 2MAXA 4RQ4A 3KHLA 1L3SA 4DFPA 4M9NA 4RPYA 4F93B 4X4SA 4GXJA 3GV8B 4ECRA 1S10A 2KP7A 3WFRE 1ZQYA 2ZUCA 3K4GA 3HP6A 4EBEA 2BQUA 9ICSA 3HW8A 1R8AA 1UT8A 1COOA 1CUKA 4I2EA 1ZQHA 2ZH4A 3WFPA 2JEIA 4ED8A 4ATBB 4DLEA 4JV0A 5IINA 9ICXA 3MGHA 3ZDEA 4GC6A 4F91B 4RQ2A 3OSPA 4PH5A 2R8HA 4QZEA 3H8JA 4PGXA 4DL3A 3PW5A 1BNOA 9ICNA 5KFOA 4F4WA 1U4BA 3H8SA 4BWMA 3HJ1A 3M8SA 2P6UA 4ATBA 3T5KA 4UAWA 4QWBA 4DL7A 1SL2A 5DDYA 2C2EA 4X5VA 2PFOA 4QZDA 1ZQCA 4WCWA 3ETLA 2W9CB 1Q79A 4UB1A 4GXKA 3RJHA 2C2DA 4EZ9A 5J2CA 4ED0A 5L1KA 1T3NA 1ZQQA 4M9GA 3RJJA 2W9AA 4NLZA 4WBYA 3HWTA 3C1YA 3C5GA 2PFNA 1V4AA 2XGPA 2XY7A 3C2KA 3QZ7A 1RXVA 4J9NA 4RNNA 2ASLA 5KT4A 4QW8A 1SL0A 4DOCA 4DFJA 5J0QA 4ECWA 4E0DA 4WC5A 4F5QA 1XSPA 4DLGA 3OJUA 4ECTA 3RH5A 1MC8A 3L9DA 5KFCA 2FPMA 5KFQA 2MUTA 7ICSA 3RJEA 3WFOA 4YVZA 1DOQA 5HRKA 4QWCA 4FHYA 1BNPA 2KZMA 5KFHA 4RZRA 4TUSA 1U47A 4B9NA 3OVSA 3Q8SB 1XC9A 9ICFA 4X4QA 1L3TA 4HYKA 4EZ6A 4M2YA 4WC7A 7ICJA 2R8IA 5KFYA 1ZQFA 2ZTCA 2NRKA 1SZPA 3AU6A 3QE9Y 4DSJA 1TK0A 1JN3A 2ASJA 2NRWA 1XSLA 4YR3A 2XGQA 3G6XA 4FS1A 2VA3A 5DB7A 3RB3A 7ICGA 5KG5A 4YXMA 1ZQZA 1S0VA 8ICBA 4EP7A 1S0NA 4RNOA 1ZQXA 4RQ1A 1S76D 4X4VA 4R63A 3SV3A 1BPZA 3PMLA 2FLPA 4O5CA 4YXJA 2ASDA 1AROP 5J2JA 4JUZA 1T8EA 7ICRA 5KFUA 5KFPA 5DG8A 3H7IA 1KNYA 2ZH6A 4J9PA 2A1JB 2ALZA 1BPBA 2V4QA 4I29A 2W9MA 1MQ3A 3LWLA 2XC9A 3LQCB 4DF4A 9ICEA 3EWAA 3QEAZ 1S0OA 4UQGA 2NRXA 1NJWA 1D9FA 3UXPA 4JV1A 8ICJA 5HC9A 4DSIA 2A1JA 3G6VA 4X4TA 4DS5A 3AQKA 3PVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKC A;  2I1Q A;  3BJY A;  5KT6 A;  1LV5 A;  1BPX A;  2C28 A;  4I28 A;  4Z6C A;  4IG8 A;  2PBE A;  1JIH A;  4CCH A;  3MAB A;  4WC2 A;  4WC4 A;  4NM1 A;  2RFF A;  4KLJ A;  4ECZ A;  4M0A A;  7ICN A;  4EBJ A;  1L5U A;  2ZHA A;  4KLQ A;  3MFI A;  1DK2 A;  4RQ7 A;  5KG7 A;  2JEF A;  5J0U A;  3TI0 A;  3RAQ A;  9ICH A;  5J29 A;  3RH6 A;  2BCQ A;  2FMS A;  4RWN A;  8ICU A;  3EZ5 A;  4F5R A;  1KSP A;  7ICF A;  8ICT A;  3JPO A;  8ICF A;  9ICB A;  1Z00 B;  4FHV A;  4O3N A;  1ZJM A;  4F4X A;  1KFS A;  3JZ0 A;  5HRI A;  4ZH4 A;  8ICH A;  5KFK A;  1NK0 A;  4J9M A;  3T3F A;  4DO9 A;  3UQ0 A;  3RJI A;  3QEB Z;  4QWE A;  5KFG A;  5HHH A;  4O3Q A;  5DQG A;  2GWS A;  2R8J A;  4DQI A;  3SI8 A;  2BCR A;  4X4O A;  2FMQ A;  4UB3 A;  4F8R A;  8ICM A;  2HVH A;  5KFF A;  4PHP A;  1Z00 A;  5J0R A;  4RQ8 A;  2KN7 A;  2W9B B;  4ECS A;  2BR0 A;  2Q66 A;  3RB4 A;  1L3U A;  1QSY A;  2JEJ A;  4RUC A;  3B0Y A;  2VAN A;  2ZJ8 A;  3N4M B;  5KFL A;  2ZUB A;  2DR8 A;  9ICQ A;  5TZV A;  8ICN A;  4YFK A;  4QW9 A;  4GLX A;  5D4B A;  2AGO A;  1NJY A;  1JXL A;  3AQN A;  4KTQ A;  2W9B A;  3GIM A;  5HRB A;  4C8O A;  4RUA A;  1XWL A;  3Q8M A;  5KG6 A;  3C2L A;  1HUZ A;  4X4U A;  4JV2 A;  1NKB A;  2AGP A;  1S9F A;  4I2G A;  4R8U B;  4I2A A;  2ZH2 A;  1ZYQ A;  2H5X A;  4FBU A;  2PI5 A;  4X0B A;  1SKR A;  3M9O B;  2J6U A;  8ICG A;  1ZQG A;  1ZQR A;  2IHN A;  3BDP A;  2HHV A;  4RWP A;  4PHA A;  2PXI A;  4TQS A;  4FHX A;  4UB4 A;  4QZC A;  4ECV A;  3OVA A;  4R8U A;  3C21 A;  4ED3 A;  5F9L A;  3TAP A;  2DVI A;  3RH4 A;  5J2E A;  1NJX A;  8ICS A;  2AQ4 A;  4DQS A;  4X4R A;  3GDX A;  3Q8R B;  3TQ1 A;  3PX0 A;  3PR4 A;  5J0P A;  3KHH A;  4KIT B;  3Q8K A;  1U45 A;  8ICK A;  4J9L A;  4E8F A;  4DS4 A;  4FS2 A;  1ZQO A;  2WTF A;  3H38 A;  2ZH1 A;  4I2I A;  4DQQ A;  4NY8 A;  3H8W A;  4YR2 A;  7ICO A;  4YCX A;  3G6Y A;  3C2M A;  2BGW A;  5HMM A;  9ICU A;  4QZB A;  2F1H A;  3RRG A;  7ICV A;  3RB0 A;  5J2D A;  3JPS A;  5DBA A;  4E7X A;  7ICI A;  3SV4 A;  3HT3 A;  2BPF A;  2P66 A;  1L3V A;  8ICV A;  8ICL A;  4KLF A;  3UPS A;  4O5K A;  4YQW A;  3MR2 A;  5DB6 A;  3AUO A;  2ISP A;  2M2V A;  3NTU A;  4UAY A;  3GIL A;  4ED6 A;  5IIJ A;  2BCV A;  4I27 A;  3OSN A;  4JWN A;  8ICY A;  1UET A;  4Z6D A;  1IXR A;  9ICT A;  3EPI A;  2BQ3 A;  5KFX A;  4RU9 A;  3QZ8 A;  4PGY A;  4MFF A;  9ICV A;  5CP2 A;  1JQR A;  3PY8 A;  2W9C A;  4C8M A;  3JPR A;  3T5L A;  4B9S A;  3JYY A;  1JMS A;  4KLU A;  4YMM A;  7ICU A;  5EWF A;  2Q0Z X;  1K1Q A;  5J2A A;  5III A;  2JZB B;  4J9O A;  4O3R A;  3RJF A;  1IM4 A;  8ICR A;  4AT9 B;  3ZD8 A;  5KT3 A;  3MGI A;  1MIW A;  4Q8F A;  9ICA A;  3JPT A;  2ZUD A;  4NXZ A;  3UXO A;  3OGU A;  4F2R A;  4IRK A;  3TFR A;  1NK6 A;  3EYZ A;  4K4I A;  2ZHB A;  3HIY A;  1U48 A;  5KTQ A;  2FLL A;  3B0X A;  2P6R A;  2JZB A;  4UD5 A;  4O3O A;  4AT9 A;  1WCL A;  2ZH5 A;  4IQV A;  3ZD9 A;  4B9U A;  4WC6 A;  4MEY A;  1ZQA A;  4YD2 A;  1DGS A;  5KFN A;  3PW2 A;  2AGQ A;  1NK8 A;  2HHX A;  7ICQ A;  3IM1 A;  4QZI A;  1QLN A;  5F2V O;  1Y88 A;  5L1I A;  2FLN A;  2ZH9 A;  4EBC A;  1JX4 A;  4P4P A;  4EYI B;  2UVU A;  5KFB A;  4O9M A;  4YG2 A;  5IIK A;  5KT5 A;  1R8C A;  4PHE A;  5CR0 A;  3NGD A;  4RNM A;  3BQ0 A;  4XA5 A;  3NYB A;  1U49 A;  1RXW A;  5J2K A;  2HHP A;  5HR9 A;  3PMN A;  4QZ9 A;  4NM2 A;  3V6J A;  1N56 A;  9ICK A;  9ICP A;  1B22 A;  8ICP A;  2VA8 A;  4DSE A;  4EEY A;  3V72 A;  1DK3 A;  1VFG A;  1RYR A;  5DB8 A;  2KZZ A;  4WC3 A;  3GFK B;  3MFH A;  1BPY A;  4B9V A;  1X9M A;  3OUY B;  5DBC A;  2PI4 A;  4KLE A;  1NKE A;  2HVI A;  3HPO A;  2AU0 A;  3MBY A;  5CJ7 A;  5D49 A;  4BWJ A;  4FO6 A;  1NOM A;  3H40 A;  5KG4 A;  3PR5 B;  2ZH8 A;  1N48 A;  1KDH A;  2LYH A;  3SZ2 A;  4BXO B;  3ZDC A;  1FA0 A;  1ZQI A;  4IRC A;  3OUY A;  4J9K A;  1ZQU A;  4PHD A;  1D9D A;  4ECX A;  4C8K A;  4ED7 A;  4RQ3 A;  4TUP A;  3HX0 A;  4NLG A;  4ED1 A;  2HHW A;  5HNK A;  2IA6 A;  1TFW A;  4FH3 A;  1ZQK A;  4BXO A;  4O3P A;  2UVR A;  3PX4 A;  2PFQ A;  2VA2 A;  1UEU A;  2DR9 A;  5BOM A;  4MEX A;  1ZQJ A;  4BGD A;  3UXN A;  4R65 A;  3JPN A;  1XO1 A;  4KLM A;  2W8L A;  3M8R A;  4DEZ A;  5KFR A;  4LZD A;  2DPJ A;  2BDP A;  4P2H A;  2JEG A;  3RR8 A;  3PW0 A;  4B9L A;  4RPZ A;  4KLI A;  4QZH A;  4Q45 A;  7ICT A;  4X4N A;  5J2H A;  2HHS A;  4DL4 A;  4JK1 A;  5JUM A;  5CWR A;  4J9S A;  9ICC A;  5DLF A;  3LK9 A;  4RPX A;  3PNC A;  3PX6 A;  4UBC A;  1V9P A;  4DSL A;  3H39 A;  5DED A;  5KG0 A;  4J9R A;  4KLO A;  5HML A;  4C8N A;  4S3N A;  4UAZ A;  4AT8 B;  4XUS A;  2V4R A;  1UEV A;  3V6H A;  1PZN A;  4O3S A;  4F2S A;  2J6T A;  1XSN A;  2XCP A;  4F92 B;  5DGB A;  2RDI A;  1B43 A;  3M9M B;  2F1J A;  5KFW A;  3EPG A;  5DG7 A;  4YD1 A;  5DEC A;  2PFP A;  5DB9 A;  1TAU A;  1TFY A;  3THV A;  3ZDD A;  7ICE A;  4AT8 A;  2ZTE A;  5CA7 A;  4QZA A;  2FMP A;  5KG1 A;  4F5N A;  9ICL A;  1ZQD A;  1UT5 A;  3T5J A;  5KFJ A;  3OJS A;  5EOZ A;  4QWD A;  1S0M A;  1KLN A;  4O0I A;  4IQU A;  4DL6 A;  1NO5 A;  3C18 A;  4X0A A;  4B9T A;  4KN4 A;  3BQT A;  4RQ6 A;  4Z6F A;  9ICO A;  4NKU A;  1U9L A;  4XQ8 A;  2ZTD A;  4E80 A;  3RRH A;  1BVS A;  2NRV A;  4YMN A;  4MFA A;  3GIK A;  3H4B A;  3LDA A;  3V7L A;  1NK4 A;  1TV9 A;  4M9H A;  1C7Y A;  1T7P A;  4XQ7 A;  5J0Y A;  3RAX A;  4RWQ A;  5DLG A;  4UB2 A;  2M2T A;  5HRG A;  2M9N A;  3RTV A;  4ECU A;  1CEZ A;  2DR5 A;  5DDM A;  2BPC A;  5KFV A;  1NK9 A;  4MF2 A;  2BQR A;  3PO5 A;  4M9L A;  4F4Z A;  4M6W B;  4DL5 A;  4KLG A;  8ICC A;  4RQ0 A;  4P4M A;  8ICW A;  1S97 A;  3E2E A;  9ICR A;  4Q44 A;  1ZJN A;  1ZQB A;  4QZG A;  1HUO A;  1D8Y A;  3TAR A;  1NK7 A;  1NK5 A;  5KFM A;  3BQ2 A;  4LVS A;  2XY5 A;  4K4G A;  4WC0 A;  3GQC A;  9ICJ A;  4YMO A;  4M5D A;  2AQ0 A;  2UVV A;  4WBZ A;  2DPI A;  3WFS C;  4M6W A;  4FH5 A;  4NLK A;  4B9M A;  1ZQV A;  3TAN A;  1X2I A;  1BPD A;  3RBE A;  1RYS A;  4AT7 B;  4RQ5 A;  4M47 A;  2HHT A;  3RB6 A;  3PV8 A;  8ICA A;  5HRF A;  5KG2 A;  3MR3 A;  5F9N A;  9ICI A;  5L1J A;  5J2B A;  1MSW D;  3OV7 A;  4X4P A;  2KFZ A;  5EWG A;  3Q8Q B;  2R8K A;  1YLQ A;  3AQM A;  1XU4 A;  3H37 A;  1KFD A;  1KTQ A;  2HHQ A;  4AT7 A;  1SL1 A;  3TFS A;  3WFQ E;  4I2D A;  4ELU A;  4DL2 A;  4R66 A;  5J2I A;  1K1S A;  1T4G A;  4Q43 A;  5HP4 A;  1Z3E B;  4QZ8 A;  4PPX A;  2O5A A;  5J2F A;  1UA1 A;  5KFT A;  2XO7 A;  1TKD A;  3H3A A;  2ZJ5 A;  1LB2 B;  8ICE A;  1ZQN A;  4IR9 A;  1S77 D;  3ORY A;  1NJZ A;  7ICM A;  2FPL A;  3ISB A;  2KZ3 A;  2NRT A;  4DOA A;  3C1Z A;  5IIL A;  1MQ2 A;  2ZH7 A;  3KHR A;  3GV7 B;  3V7K A;  4DOB A;  2KFN A;  2MUT B;  3C66 A;  3TAQ A;  4UBB A;  5L1L A;  4G3I A;  3OVB A;  3Q8L A;  2XCA A;  5D46 A;  4F50 A;  4YN4 A;  3FDS A;  4DFM A;  5IIM A;  3AQL A;  9ICG A;  1KRP A;  3K75 D;  3M9N B;  4C8L A;  2HW3 A;  3OHA A;  1JXE A;  2BPG A;  1ZQE A;  2DFL A;  4I2J A;  4F4Y A;  4KLS A;  4ELV A;  2ID1 A;  4I2B A;  1TAQ A;  4IQT A;  4I2F A;  1R89 A;  3KTQ A;  3MDC A;  5HHI A;  1A76 A;  4KN7 A;  4I2C A;  4F3O A;  5KFD A;  4RWO A;  1KFT A;  3UPQ A;  3C23 A;  3ISC A;  2O1P A;  2FPK A;  5DKW A;  4EBK A;  5KT2 A;  1TK8 A;  1QTM A;  5J0X A;  4DQR A;  2Y1I A;  4IR1 A;  4FBT A;  4IQW A;  3PW7 A;  4M04 A;  4Q8E A;  3IHQ B;  4RT2 A;  2M2W A;  1MIY A;  3T5H A;  4EBD A;  4LT6 A;  5KFA A;  4K4H A;  3ZDA A;  4M9J A;  4KLH A;  4QZF A;  4RT3 A;  5EWE A;  3RJG A;  4IRD A;  2ZJA A;  8ICO A;  8ICX A;  1ZQW A;  1HJP A;  1X9S A;  3V6K A;  4GXI A;  1ZQL A;  4P4O A;  5L9X A;  2J6S A;  3MR6 A;  3BQ1 A;  4ECY A;  4KMU A;  4EYH B;  3N97 B;  5IIO A;  5HRE A;  5DQH A;  4JWM A;  4DSF A;  4F5O A;  2Y1J A;  4TUR A;  1EXN A;  4GC7 A;  3MR5 A;  2W8K A;  1X9W A;  1D8L A;  3GV5 B;  2XY6 A;  4KLT A;  3PO4 A;  3EW9 A;  4QWA A;  3Q8P B;  2I9G A;  2V9W A;  2DRA A;  2ATL A;  5J0O A;  4NKT A;  2IMW P;  5KFI A;  2DRB A;  4KLD A;  4R64 A;  4DFK A;  3C5F A;  9ICM A;  8ICQ A;  4KLL A;  5J0W A;  4YR0 A;  4ED2 A;  2BKE A;  5DQI A;  5J0T A;  3LWM A;  1KEJ A;  3V7J A;  2AJQ A;  7ICP A;  7ICL A;  4FHW A;  3H4D A;  2ISO A;  1QSL A;  2IBK A;  4O5E A;  5DGA A;  1WCN A;  5BOL A;  4PGQ A;  4DSK A;  2HHU A;  7ICH A;  1A77 A;  1BGX T;  5KT7 A;  1XS9 D;  1JAJ A;  3HJ4 A;  1ZQT A;  2OWO A;  4XRH A;  1WOT A;  8ICZ A;  5DBB A;  2B21 A;  3OHB A;  4BDP A;  4F4K A;  9ICW A;  1PX5 A;  3UQ2 A;  5KG3 A;  4MF8 A;  3JPP A;  5KFZ A;  1RPL A;  2F1I A;  4J9Q A;  2DR7 A;  1MIV A;  1VJ7 A;  2R8G A;  1QSS A;  1BPE A;  1ZQS A;  3RJK A;  5HRD A;  3RR7 A;  3GII A;  3SYZ A;  1TVA A;  7ICK A;  3PW4 A;  1R8B A;  1UA0 A;  5BPC A;  3MDA A;  4F5P A;  4DWI A;  4YP3 A;  3KHG A;  1OU5 A;  5J0S A;  3ISD A;  1SKS A;  3ZDB A;  5KFE A;  2RDJ A;  1F5A A;  4DQP A;  4MFC A;  8ICI A;  4DF8 A;  4ELT A;  5CB1 A;  5C5J A;  5HRH A;  4TUQ A;  4TQR A;  4NLN A;  2BCS A;  1ZET A;  1ZQM A;  4ECQ A;  1ZQP A;  4FHP A;  2M2U A;  2IHM A;  5DG9 A;  4LZG A;  1NZP A;  2BE3 A;  5J2G A;  3AU2 A;  5CHG A;  1TK5 A;  5KFS A;  2BCU A;  4WC1 A;  2UVW A;  1SKW A;  1TFR A;  2ZH3 A;  2C22 A;  2C2R A;  4UB5 A;  3GIJ A;  3FYH A;  2BHN A;  2NRZ A;  4Z6E A;  3JPQ A;  5HRL A;  1RZT A;  4I2H A;  1H38 A;  2KTQ A;  1Q78 A;  4UD4 A;  3RBD A;  2MAX A;  4RQ4 A;  3KHL A;  1L3S A;  4DFP A;  4M9N A;  4RPY A;  4F93 B;  4X4S A;  4GXJ A;  3GV8 B;  4ECR A;  1S10 A;  2KP7 A;  3WFR E;  1ZQY A;  2ZUC A;  3K4G A;  3HP6 A;  4EBE A;  2BQU A;  9ICS A;  3HW8 A;  1R8A A;  1UT8 A;  1COO A;  1CUK A;  4I2E A;  1ZQH A;  2ZH4 A;  3WFP A;  2JEI A;  4ED8 A;  4ATB B;  4DLE A;  4JV0 A;  5IIN A;  9ICX A;  3MGH A;  3ZDE A;  4GC6 A;  4F91 B;  4RQ2 A;  3OSP A;  4PH5 A;  2R8H A;  4QZE A;  3H8J A;  4PGX A;  4DL3 A;  3PW5 A;  1BNO A;  9ICN A;  5KFO A;  4F4W A;  1U4B A;  3H8S A;  4BWM A;  3HJ1 A;  3M8S A;  2P6U A;  4ATB A;  3T5K A;  4UAW A;  4QWB A;  4DL7 A;  1SL2 A;  5DDY A;  2C2E A;  4X5V A;  2PFO A;  4QZD A;  1ZQC A;  4WCW A;  3ETL A;  2W9C B;  1Q79 A;  4UB1 A;  4GXK A;  3RJH A;  2C2D A;  4EZ9 A;  5J2C A;  4ED0 A;  5L1K A;  1T3N A;  1ZQQ A;  4M9G A;  3RJJ A;  2W9A A;  4NLZ A;  4WBY A;  3HWT A;  3C1Y A;  3C5G A;  2PFN A;  1V4A A;  2XGP A;  2XY7 A;  3C2K A;  3QZ7 A;  1RXV A;  4J9N A;  4RNN A;  2ASL A;  5KT4 A;  4QW8 A;  1SL0 A;  4DOC A;  4DFJ A;  5J0Q A;  4ECW A;  4E0D A;  4WC5 A;  4F5Q A;  1XSP A;  4DLG A;  3OJU A;  4ECT A;  3RH5 A;  1MC8 A;  3L9D A;  5KFC A;  2FPM A;  5KFQ A;  2MUT A;  7ICS A;  3RJE A;  3WFO A;  4YVZ A;  1DOQ A;  5HRK A;  4QWC A;  4FHY A;  1BNP A;  2KZM A;  5KFH A;  4RZR A;  4TUS A;  1U47 A;  4B9N A;  3OVS A;  3Q8S B;  1XC9 A;  9ICF A;  4X4Q A;  1L3T A;  4HYK A;  4EZ6 A;  4M2Y A;  4WC7 A;  7ICJ A;  2R8I A;  5KFY A;  1ZQF A;  2ZTC A;  2NRK A;  1SZP A;  3AU6 A;  3QE9 Y;  4DSJ A;  1TK0 A;  1JN3 A;  2ASJ A;  2NRW A;  1XSL A;  4YR3 A;  2XGQ A;  3G6X A;  4FS1 A;  2VA3 A;  5DB7 A;  3RB3 A;  7ICG A;  5KG5 A;  4YXM A;  1ZQZ A;  1S0V A;  8ICB A;  4EP7 A;  1S0N A;  4RNO A;  1ZQX A;  4RQ1 A;  1S76 D;  4X4V A;  4R63 A;  3SV3 A;  1BPZ A;  3PML A;  2FLP A;  4O5C A;  4YXJ A;  2ASD A;  1ARO P;  5J2J A;  4JUZ A;  1T8E A;  7ICR A;  5KFU A;  5KFP A;  5DG8 A;  3H7I A;  1KNY A;  2ZH6 A;  4J9P A;  2A1J B;  2ALZ A;  1BPB A;  2V4Q A;  4I29 A;  2W9M A;  1MQ3 A;  3LWL A;  2XC9 A;  3LQC B;  4DF4 A;  9ICE A;  3EWA A;  3QEA Z;  1S0O A;  4UQG A;  2NRX A;  1NJW A;  1D9F A;  3UXP A;  4JV1 A;  8ICJ A;  5HC9 A;  4DSI A;  2A1J A;  3G6V A;  4X4T A;  4DS5 A;  3AQK A;  3PVX A; 
#chains in the Genus database with same CATH topology
 1J97 A;  5KT6 A;  1LV5 A;  4LEZ A;  4Z6C A;  5AKH A;  3WKE A;  4UB8 U;  4WC2 A;  4NM1 A;  2RFF A;  4ECZ A;  4M0A A;  4EBJ A;  4KLQ A;  1DK2 A;  4RQ7 A;  3TI0 A;  4DFD A;  3EZ5 A;  1KSP A;  8ICF A;  3ZI4 A;  1ZJM A;  1KFS A;  2Z7J A;  3JZ0 A;  5HRI A;  4ZH4 A;  1NK0 A;  3F5A A;  4DO9 A;  4QWE A;  2NO4 A;  2R8J A;  3SI8 A;  8ICM A;  2HVH A;  5J0R A;  2KN7 A;  2XID A;  1L3U A;  4RUC A;  5JTI A;  2ZJ8 A;  2DR8 A;  2DQN B;  4NJ8 A;  8ICN A;  4QW9 A;  4N7R A;  4RUA A;  1LKY B;  1SXD A;  4I0U A;  8ICG A;  2OHF A;  3BDP A;  1ZXI A;  2DVI A;  5F9L A;  5J8Y A;  2IOH A;  4IC9 A;  2WF5 A;  3TQ1 A;  2K4H A;  4KIT B;  3M6Z A;  2ZH1 A;  4NY8 A;  3D2N A;  4YR2 A;  2BGW A;  3RB0 A;  4E7X A;  3SV4 A;  4KLF A;  4YQW A;  5DB6 A;  2M2V A;  4UAY A;  1UET A;  4I27 A;  4Z6D A;  3EPI A;  3QZ8 A;  2WF9 A;  4PGY A;  4MFF A;  3PY8 A;  4C8M A;  1JMS A;  4KLU A;  7ICU A;  2Q0Z X;  2VKQ A;  1K1Q A;  4J9O A;  1MIW A;  5KT3 A;  3MGI A;  1DRG A;  2KD1 A;  4FZM A;  9ICA A;  3JPT A;  3UMG A;  1LVH A;  4IRK A;  2P6R A;  4O3O A;  1NK8 A;  2HHX A;  7ICQ A;  5F2V O;  2MA1 A;  4EV6 A;  1JX4 A;  3DV9 A;  5ALP A;  2XI9 A;  4PHE A;  2DGZ A;  3BQ0 A;  3NYB A;  1RXW A;  5J2K A;  4QNL A;  3PMN A;  1ZOL A;  2YB1 A;  2HN2 A;  2VA8 A;  2JHD A;  5DBC A;  1KQQ A;  2W7O A;  5D49 A;  1NOM A;  2ZH8 A;  2LYH A;  3KD3 A;  3SZ2 A;  4BXO B;  4P0Q B;  4OD0 A;  4J9K A;  2QB1 A;  4ECX A;  4C8K A;  4TUP A;  2DBY A;  4ED1 A;  1TFW A;  4FH3 A;  4BXO A;  2UVR A;  4P0Q A;  2DR9 A;  5AKE A;  5KL1 B;  4AP9 A;  2KJ8 A;  3DDH A;  1Z1V A;  2EWR A;  1XO1 A;  1RYU A;  2B6G A;  4DEZ A;  2YTU A;  3OTQ A;  3RR8 A;  4RPZ A;  3M7D A;  4QZH A;  4X4N A;  4JK1 A;  1V9P A;  4DSL A;  1QQ7 A;  4AT8 B;  1UEV A;  1IV8 A;  2HOI A;  4RQN A;  1XSN A;  2J6T A;  4YD1 A;  3THV A;  4AT8 A;  5ALJ A;  5CA7 A;  2I6X A;  4F5N A;  3C18 A;  1KLN A;  3BS7 A;  2GAF D;  4PJ0 U;  4RQ6 A;  4NKU A;  1U9L A;  2BZF A;  4MFA A;  2KKP A;  4NXT A;  3LDA A;  3V7L A;  1NK4 A;  1VLB A;  5AKI A;  5CEH A;  3A0H U;  2DR5 A;  4O67 A;  4ECU A;  2BPC A;  2OCE A;  5KFV A;  2BQR A;  3SAH A;  4DL5 A;  2G0A A;  8ICW A;  1FFV A;  1L8L A;  1ZJN A;  1HUO A;  5B3Q A;  2W03 A;  2W11 A;  2XY5 A;  4YMO A;  4OJO A;  5G5H A;  4FH5 A;  3C29 A;  4B9M A;  2E8P A;  3TAN A;  1X2I A;  1RG6 A;  5AK5 A;  3RB6 A;  3K1Z A;  4J03 A;  5L1J A;  5J2B A;  1PK1 B;  2N1R A;  1SZH A;  3H37 A;  2HHQ A;  4I2D A;  4Q43 A;  1SV4 A;  1JRO A;  2O5A A;  1PK1 A;  1UA1 A;  2XO7 A;  2K4I A;  1ZQN A;  3SD7 A;  3ORY A;  7ICM A;  2FPL A;  3ISB A;  2KJ9 A;  2NRT A;  4DOA A;  3C1Z A;  5IIL A;  3IG8 A;  2K8A A;  5H2F U;  4BJQ A;  4DOB A;  2KFN A;  4Y2R A;  3TAQ A;  4UBB A;  4G3I A;  5D61 A;  2HW3 A;  3MC1 A;  4C8L A;  1JXE A;  2BPG A;  1X66 A;  2QAR B;  2DFL A;  2ID1 A;  5AM1 A;  3MDC A;  1QQ5 A;  2DUY A;  4F3O A;  4K9A A;  3UPQ A;  3ISC A;  4EBK A;  2QAR A;  3BZC A;  2LYB A;  1X9X A;  2F2A B;  3QUB A;  2DKX A;  5KFA A;  4US8 A;  3RJG A;  2ZJA A;  8ICO A;  3QNM A;  1RQL A;  3LVW A;  1HJP A;  3QUC A;  2J6S A;  4GXI A;  3TAD A;  5AM2 A;  3BQ1 A;  5IIO A;  4UB6 U;  2F76 X;  1F5S A;  3MR5 A;  1X9W A;  1N63 A;  4QWA A;  2B4V A;  5D62 A;  5J0O A;  4NKT A;  2LI6 A;  9ICM A;  5ALM A;  4FHW A;  7ICL A;  3H4D A;  1QSL A;  2W3S A;  1XS9 D;  3N28 A;  5GTI U;  4NL9 C;  1WOT A;  8ICZ A;  2B21 A;  3OHB A;  4BDP A;  2K8B B;  1GPJ A;  1RPL A;  2DR7 A;  4IL6 U;  5HRD A;  2YML A;  7ICK A;  1Z19 A;  1UA0 A;  3ISD A;  3ZDB A;  2RDJ A;  8ICI A;  4LEW A;  1JAL A;  4EEB A;  3H0L B;  5DG9 A;  4LZG A;  1NZP A;  2F8K A;  4WC1 A;  1TFR A;  2C2R A;  3FYH A;  3QU9 A;  2GH1 A;  4RPY A;  4F93 B;  3GV8 B;  2WFA A;  3H0M B;  2JEI A;  4ED8 A;  4DLE A;  4JV0 A;  9ICX A;  3MGH A;  3ZDE A;  2R8H A;  4PGX A;  2ZIU B;  3PW5 A;  4DL3 A;  5KFO A;  3C28 A;  1COK A;  4UAW A;  1SL2 A;  2C2E A;  1ZQC A;  1PVR A;  2ZIU A;  3ETL A;  3PHZ A;  4EZ9 A;  5J2C A;  3N7S C;  5L1K A;  4NLC A;  3T79 A;  3C1Y A;  2QLT A;  4J9N A;  2HCF A;  4DFJ A;  4E0D A;  2OEH A;  3OJU A;  1MC8 A;  2YQE A;  4YVZ A;  4C4R A;  2ODG A;  5GTH U;  4TUS A;  1XC9 A;  4M2Y A;  7ICJ A;  5KFY A;  2ZTC A;  2ZIX B;  1JN3 A;  2NRW A;  2G07 A;  4FS1 A;  2KVS A;  4PZO A;  4R63 A;  2ZIX A;  1BPZ A;  4YXJ A;  5KFU A;  1B0X A;  1N60 A;  3H7I A;  4OO1 J;  3IV6 A;  1L6N A;  2F3N A;  5AK6 A;  3QEA Z;  2KOB A;  2NRX A;  5EE1 A;  1Q8K A;  4JV1 A;  8ICJ A;  4X4T A;  2EZX A;  4I28 A;  4IG8 A;  2PBE A;  3AQE A;  4WC4 A;  4C7Y A;  7ICN A;  2WHE A;  1V97 A;  1L5U A;  5KG7 A;  2K89 A;  5ALN A;  2H3V A;  5J0U A;  1NZB A;  3RH6 A;  2BCQ A;  2FMS A;  4F5R A;  4WOY A;  4FHV A;  2K8C B;  5AI4 A;  4O68 A;  4F4X A;  5KFK A;  2PMZ F;  3UQ0 A;  2GWS A;  4DQI A;  4X4O A;  4ECS A;  1FIQ A;  1HEK A;  2JEJ A;  2G06 A;  2VAN A;  4PZN A;  2ZUB A;  9ICQ A;  1NJY A;  2H3Q A;  4C8O A;  2ZIW B;  1XWL A;  2HI0 A;  3C2L A;  2XIC A;  4R8U B;  4OCZ A;  4FBU A;  2PI5 A;  3RF9 A;  4Y2Y A;  4X0B A;  1ZQG A;  2IHN A;  2HHV A;  2ZIW A;  4WJ3 B;  3KKA A;  3CW2 C;  1ZRM A;  4QZC A;  3OVA A;  4R8U A;  3C21 A;  4ED3 A;  3TAP A;  2R18 A;  2AQ4 A;  4DQS A;  3GDX A;  3Q8R B;  2Y9T A;  5AM5 A;  4DS4 A;  4FS2 A;  1ZQO A;  2WTF A;  3H38 A;  2H3I A;  3C2M A;  2RLT A;  3JPS A;  5DBA A;  7ICI A;  5CHE A;  2MSN A;  2ISP A;  1Z4N A;  5IIJ A;  3OSN A;  2KMD A;  5ALR A;  1YZ7 A;  5ALZ A;  9ICT A;  2BQ3 A;  4RU9 A;  5ALU A;  4NXU A;  2W9C A;  1PVP A;  3GU3 A;  3LVV A;  4WH5 A;  2JZB B;  3RJF A;  3ZD8 A;  2LHT A;  4NXZ A;  4K9B A;  3WK5 A;  1D8B A;  2F77 X;  2ZHB A;  1U48 A;  2FLL A;  3NVW A;  2JZB A;  1N5W A;  4B9U A;  4MEY A;  4YD2 A;  3PW2 A;  3TAD C;  2W43 A;  5KFN A;  2AGQ A;  2IHO A;  2FLN A;  2ZH9 A;  2GO7 A;  4EYI B;  2YMP A;  2UVU A;  3BS5 B;  2BBJ A;  5KT5 A;  4O3M A;  5CR0 A;  3NGD A;  4RNM A;  4XA5 A;  5HR9 A;  4QZ9 A;  1N56 A;  1B22 A;  3F5E A;  4OAI Z;  3QX7 A;  2AXT U;  4HX0 A;  2W7P A;  4EEY A;  3BS5 A;  4WC3 A;  4EED A;  3WFS C;  3GFK B;  2PI4 A;  4CF5 A;  2HVI A;  3HPO A;  3CP8 A;  3MBY A;  2AU0 A;  5EE0 A;  4BWJ A;  3F2D A;  1N48 A;  1ZD3 A;  2MRL A;  3ZDC A;  1FA0 A;  1ZQI A;  1QQ6 A;  1IIP A;  2E1F A;  1D9D A;  4WQK A;  3CK6 A;  3NVO A;  4ED7 A;  4RQ3 A;  3HX0 A;  2HHW A;  2IA6 A;  1X42 A;  3HKZ F;  1ZQK A;  4O3P A;  2PFQ A;  5BOM A;  1ZQJ A;  3N7P D;  3JPN A;  2E1E A;  2BDP A;  3PW0 A;  4OAG A;  4KLI A;  4Q45 A;  4DL4 A;  4KLO A;  4S3N A;  2V4R A;  1PZN A;  4O3S A;  5AIB A;  5E79 U;  5DG7 A;  2PFP A;  3ZDD A;  1X6J A;  2ZTE A;  1L7N A;  3L5K A;  2FMP A;  5KG1 A;  1UT5 A;  5EOZ A;  1S0M A;  4DL6 A;  1NO5 A;  1S8O A;  4X0A A;  4KN4 A;  9ICO A;  1TE2 A;  4Z6F A;  4Y2U A;  3ER8 C;  4XQ8 A;  2ZTD A;  3QU4 A;  2CPR A;  1LKY A;  2BDU A;  3EUB 2;  2NRV A;  4YMN A;  4M9H A;  1L7P A;  2ES6 A;  1T7P A;  4RWQ A;  3RAX A;  5ALW A;  5DLG A;  4UB2 A;  4WQL A;  1PUZ A;  2M9N A;  2E8O A;  5A0L A;  5DDM A;  1NK9 A;  4MF2 A;  1VDV A;  4M9L A;  4F4Z A;  3QU7 A;  4RQ0 A;  4P4M A;  9ICR A;  1A6S A;  1OW5 A;  1D8Y A;  4LVS A;  4WC0 A;  1KN5 A;  4AYB F;  1SV0 C;  2WF8 A;  3IDW A;  1XNS A;  4M47 A;  3MR3 A;  5F9N A;  4X4P A;  5EWG A;  3AQM A;  2JXJ A;  1O03 A;  2RP5 A;  1SXE A;  3NS1 A;  2D6F C;  3WFQ E;  3AQF A;  5J2I A;  1T4G A;  4PPX A;  5KFT A;  1TKD A;  3H3A A;  2ZJ5 A;  1UPH A;  2KZ3 A;  3QXG A;  3K7D A;  5L1L A;  3OVB A;  2XCA A;  5D46 A;  4YN4 A;  2GLE A;  1KRP A;  3K75 D;  3OHA A;  4EEN A;  3SMV A;  4I2J A;  4F4Y A;  4KLS A;  4ELV A;  4I2B A;  4IQT A;  4I2F A;  3KZI U;  5EE9 A;  1A76 A;  4KN7 A;  2JRZ A;  1KFT A;  3KFU F;  3EF2 A;  5KT2 A;  1TK8 A;  4M04 A;  5J0X A;  4IQW A;  4FBT A;  3TKA A;  4RT2 A;  3T5H A;  4M9J A;  2L5Y A;  4RT3 A;  1ZQL A;  4P4O A;  5L9X A;  5JU5 A;  1N5X A;  4ECY A;  5DQH A;  4JWM A;  1M6Y A;  2I5H A;  4PL2 A;  4GC7 A;  2W8K A;  1D8L A;  2HSZ A;  2EAN A;  3WK4 A;  2DRB A;  4R64 A;  5J0W A;  2IBK A;  2LPE A;  1WCN A;  5BOL A;  4PGQ A;  5KT7 A;  3IP4 B;  2KEY A;  4F4K A;  2IOF K;  9ICW A;  3OWG A;  5KG3 A;  4MF8 A;  4CF3 A;  4C80 A;  1MIV A;  3KKA C;  4C4S A;  4IS7 A;  5AIC A;  3SYZ A;  1R8B A;  4JMU A;  1JUD A;  2P35 A;  5BPC A;  4DWI A;  4F5P A;  3NWI A;  3KHG A;  2M0N A;  4MHV A;  2IOF A;  1F5A A;  4DQP A;  4NLN A;  2HDO A;  4FHP A;  1ZQP A;  2F8L A;  4ECQ A;  1HIW A;  2QKQ A;  2BE3 A;  5KAF U;  4OAF A;  1YT3 A;  3OPX A;  5J2G A;  1SKW A;  2ZH3 A;  1KL9 A;  1YZ6 A;  3GIJ A;  3JPQ A;  4Z6E A;  4I2H A;  2KTQ A;  1Q78 A;  3RBD A;  3KHL A;  1L3S A;  4M9N A;  4X4S A;  4GXJ A;  1SGG A;  3ETR A;  1OXJ A;  2ZUC A;  3HP6 A;  3RFA A;  1CUK A;  1ZQH A;  4GFJ A;  2K4P A;  2HBJ A;  2ZH4 A;  3ERC C;  4F72 A;  4Y2Q A;  2VIX A;  3VC8 A;  2GOL A;  3H8J A;  4QZE A;  4O6A A;  3HJ1 A;  3M8S A;  4QWB A;  4DL7 A;  2EAM A;  5DDY A;  2PMZ C;  4WCW A;  4P0P B;  3RJH A;  4JB3 A;  4UAT A;  1L8O A;  5AM4 A;  3RJJ A;  2W9A A;  4NLZ A;  3C5G A;  5G5G A;  5AKL A;  2ASL A;  1SL0 A;  4P0P A;  4ICA A;  2KHQ A;  2HMX A;  4DLG A;  4ECT A;  3L9D A;  7ICS A;  3S6J A;  4C4T A;  1IG6 A;  4X4Q A;  4HYK A;  2R8I A;  1ZQF A;  2NRK A;  1SZP A;  3QE9 Y;  2G09 A;  4LEV A;  2OM6 A;  4YR3 A;  2XGQ A;  1MA7 A;  2EAP A;  3FM9 A;  1ZQZ A;  4EP7 A;  5ALF A;  2GA9 D;  2NO5 A;  4O5C A;  3ALR A;  2OYY A;  2ASD A;  5J2J A;  1T8E A;  5KFP A;  5DG8 A;  1KNY A;  2A1J B;  3H0R B;  4I29 A;  2W9M A;  4NWI A;  3L3F X;  3CRX A;  3LWL A;  1TAM A;  4DF4 A;  3EWA A;  1D9F A;  1ZD4 A;  5HC9 A;  2A1J A;  1WYG A;  3G6V A;  2YB4 A;  2ESE A;  1L3T A;  1NKC A;  3AL0 B;  2ZXH A;  3BJY A;  2VJ4 A;  3SAF A;  1GO3 F;  1O08 A;  3MAB A;  3UM9 A;  4KLJ A;  5AM3 A;  3M1Y A;  2ZHA A;  2JEF A;  9ICH A;  3RAQ A;  4RWN A;  8ICU A;  8ICT A;  5J8Y C;  8ICH A;  2JV3 A;  3T3F A;  2M2T A;  3HRD D;  5KFG A;  5HHH A;  5DQG A;  2HBK A;  4UB3 A;  2FI1 A;  4F8R A;  1RM6 C;  4PHP A;  4RQ8 A;  2Q66 A;  4K97 A;  1QSY A;  3B0Y A;  4FZL A;  3N4M B;  4GLX A;  2HN1 A;  3E0F A;  1JXL A;  4KTQ A;  3AQN A;  5AI8 A;  3GIM A;  4X4U A;  1HUZ A;  5KG6 A;  4JV2 A;  1A0P A;  4I2A A;  4I2G A;  5HR7 A;  1ZYQ A;  3SAG A;  1SKR A;  2J6U A;  1ECW A;  3I28 A;  1ZQR A;  1P7D A;  4PHA A;  1T94 A;  3HKZ C;  1NJX A;  1MN8 A;  4X4R A;  3F2B A;  3PX0 A;  3PR4 A;  3Q8K A;  3KHH A;  4E8F A;  1JI7 A;  4I2I A;  4DQQ A;  3H8W A;  4OJ5 A;  4YCX A;  3G6Y A;  1F44 A;  2F1H A;  5J2D A;  2E3T A;  4OJ6 A;  2KSO B;  2P66 A;  8ICV A;  3MR2 A;  1V85 A;  4ED6 A;  5KAI U;  8ICY A;  5B66 U;  1KW4 A;  1IXR A;  2KK0 A;  4K98 A;  5KFX A;  9ICV A;  5AKX A;  3T5L A;  3JPR A;  2KHV A;  4B9S A;  3JYY A;  3SR6 A;  4YMM A;  5EWF A;  5J2A A;  4O3R A;  8ICR A;  4Q8F A;  2JR5 A;  4EX6 A;  3OGU A;  4ACO A;  3K1R B;  3EYZ A;  3GZF A;  3HIY A;  5KTQ A;  3B0X A;  1WCL A;  2ZH5 A;  3ZD9 A;  4F71 A;  1ZQA A;  5B3P A;  1DGS A;  5ALV A;  1Y88 A;  2NYV A;  4EBC A;  2YX8 A;  4O9M A;  3FC4 A;  4YG2 A;  5IIK A;  2HHP A;  9ICP A;  3V6J A;  2PKE A;  8ICP A;  4DSE A;  1DK3 A;  1VFG A;  4AYB C;  3QYP A;  1X9M A;  4KLE A;  5CJ7 A;  4FO6 A;  3H40 A;  5KG4 A;  5EE3 A;  1ZQU A;  4NLG A;  3PX4 A;  2VA2 A;  1UEU A;  4MEX A;  3PSI A;  4BGD A;  2KE7 A;  3UXN A;  4KLM A;  2W8L A;  3M8R A;  2JEG A;  4KM5 A;  1Q3V A;  3CNH A;  7ICT A;  2HHS A;  4UAS A;  5JUM A;  5CWR A;  4J9S A;  3LK9 A;  4RPX A;  3PX6 A;  4CGZ A;  4UBC A;  3AM9 A;  3H39 A;  5DED A;  5KG0 A;  2D8C A;  4FZN A;  3D2S A;  2G5I B;  4BX9 C;  4F2S A;  2XCP A;  2KNJ A;  3M9M B;  2F1J A;  5DEC A;  5DB9 A;  1TAU A;  7ICE A;  4DCC A;  1RQN A;  1ZQD A;  3OJS A;  4QWD A;  4A8E A;  1WWV A;  2WF7 A;  1VJ5 A;  4E80 A;  3RRH A;  1UCV A;  3WK6 A;  5AKZ A;  5J0Y A;  1X40 A;  5HRG A;  3RTV A;  1CEZ A;  1AQ6 A;  3PO5 A;  5ALO A;  8ICC A;  1S97 A;  4QZG A;  3TAR A;  3AN1 A;  1NK7 A;  5CRX A;  5KFM A;  3BQ2 A;  3MCR A;  2DF4 B;  3GQC A;  2FDR A;  2JH1 A;  4NLK A;  1ZQV A;  1J2N A;  3RBE A;  1RYS A;  8ICA A;  5HRF A;  5KG2 A;  3OV7 A;  1MSW D;  3SEN A;  2KFZ A;  1YLQ A;  5KL8 B;  4EEK A;  3TFS A;  3LYS A;  1SL1 A;  5ALE A;  2LMR A;  4R66 A;  4DL2 A;  4B6J A;  4QZ8 A;  5J2F A;  1LB2 B;  1S77 D;  3QU5 A;  3UMB A;  2ZH7 A;  3GV7 B;  3V7K A;  2KIC A;  3NRW A;  2MUT B;  4OJP A;  3C66 A;  3FDS A;  4DFM A;  9ICG A;  5ALH A;  4CDG A;  3M9N B;  4NLB A;  4CRX A;  3ER9 B;  3O0F A;  3NVV A;  1TAQ A;  1R89 A;  4I2C A;  5KFD A;  4PL1 A;  3C23 A;  3PZP A;  2O1P A;  5DKW A;  1S5L U;  1QTM A;  4IR1 A;  4DQR A;  2Y1I A;  2M2W A;  1MIY A;  2O6K A;  5ALQ A;  4Q8E A;  3IHQ B;  3ZDA A;  4KLH A;  5EWE A;  4IRD A;  2H3Z A;  4KMU A;  4EYH B;  5HRE A;  1Q46 A;  1QCK A;  1URJ A;  4KMO B;  4DSF A;  2E8N A;  3I76 A;  3GV5 B;  4KLT A;  3Q8P B;  5AI6 A;  2I9G A;  2V9W A;  2DRA A;  2ATL A;  5D63 A;  2IMW P;  4KLD A;  8ICQ A;  4KLL A;  5B5E U;  4YR0 A;  2BKE A;  5J0T A;  2AJQ A;  3V7J A;  1KEJ A;  7ICP A;  7ICH A;  5ALI A;  1A77 A;  5AK4 A;  1JAJ A;  3HJ4 A;  1ZQT A;  2QB0 B;  2HOF A;  2OWO A;  3ED5 A;  3N7R C;  3JPP A;  2F1I A;  5ALD A;  4J9Q A;  1ZQS A;  3RR7 A;  3GII A;  2K60 A;  1TVA A;  2QB0 A;  3MDA A;  4LJX A;  4YP3 A;  5J0S A;  1SKS A;  5KFE A;  4MFC A;  4EGW A;  4DF8 A;  5CB1 A;  2OXO A;  2W54 A;  4TQR A;  2BCS A;  1ZET A;  2M2U A;  2BCU A;  4BUG A;  2LKY A;  4UB5 A;  1F0M A;  3WK7 A;  1RZT A;  4NL9 A;  5AI9 A;  1H38 A;  3NAS A;  2MAX A;  4RQ4 A;  4DFP A;  4ZOH C;  4U7C A;  2YY6 A;  2KP7 A;  4ECR A;  2ZXI A;  1S10 A;  1KKX A;  3K4G A;  1Z4O A;  3HW8 A;  1COO A;  4EEL A;  3PSP A;  3WFP A;  4ATB B;  2B51 A;  4RQ2 A;  3OSP A;  5AI0 A;  9ICN A;  1CRX A;  4C0Z A;  4ATB A;  4Y2J A;  5AK3 A;  2PFO A;  2YMQ A;  2JGA A;  4UAV A;  4GXK A;  4M9G A;  3HWT A;  1V4A A;  2XY7 A;  3WKA A;  3C2K A;  4RNN A;  4C7Z A;  4WC5 A;  2KVC A;  1XSP A;  3VCB A;  2CXY A;  3IRU A;  2DL0 A;  2FCL A;  5CFU A;  3RH5 A;  5HRK A;  4FHY A;  3OVS A;  4RZR A;  4B9N A;  1U47 A;  3Q8S B;  4XJE A;  4EZ6 A;  1K5O A;  3KZX A;  4DSJ A;  4LEY A;  1JRP A;  1TK0 A;  2Y9U A;  2ASJ A;  3KBB A;  4CNQ A;  3G6X A;  7ICG A;  5DB7 A;  3RB3 A;  5KG5 A;  4YXM A;  3QUQ A;  1ZQX A;  4RQ1 A;  1S76 D;  4X4V A;  1T3Q A;  4Y2S A;  2FLP A;  1ARO P;  3SQI A;  2ZH6 A;  2EQY A;  4J9P A;  2ALZ A;  1BPB A;  5ALG A;  2LM1 A;  4OJL A;  3LQC B;  2LM4 A;  3D2Q A;  1PK3 A;  4OAH A;  2B56 A;  5ALK A;  4DSI A;  4DS5 A;  5AKK A;  3PVX A;  2I1Q A;  4QIW C;  2C28 A;  1BPX A;  3U26 A;  3F2C A;  1JIH A;  4CCH A;  2HBM A;  4U6P A;  2G08 A;  4US9 A;  3MFI A;  2A19 A;  1KBU A;  5J29 A;  9ICB A;  7ICF A;  2YN4 A;  2ZG6 A;  3JPO A;  1Z00 B;  4O3N A;  3IN5 A;  3ONN A;  1N62 A;  4J9M A;  3QEB Z;  3RJI A;  4O3Q A;  2KV2 A;  2BCR A;  2FMQ A;  5KFF A;  2W9B B;  1Z00 A;  2BR0 A;  5ALX A;  3RB4 A;  1N2X A;  1SB3 C;  3HIL A;  5KFL A;  1SWV A;  5TZV A;  4YFK A;  5D4B A;  2AGO A;  2W9B A;  5HRB A;  4HAI A;  3Q8M A;  5FP0 A;  1NKB A;  2AGP A;  1S9F A;  2ZH2 A;  2H5X A;  3M9O B;  5K4L A;  4RWP A;  2PXI A;  2WB1 F;  4TQS A;  4FHX A;  4UB4 A;  2LYA A;  4ECV A;  4G9B A;  3RH4 A;  5J2E A;  8ICS A;  3HJE A;  3H8M A;  5J0P A;  8ICK A;  1U45 A;  4J9L A;  1QH9 A;  2D3D A;  5JTG A;  4GIB A;  7ICO A;  5HMM A;  9ICU A;  4QZB A;  3RRG A;  7ICV A;  8ICL A;  3HT3 A;  2BPF A;  1NNL A;  1L3V A;  4NXV A;  3UPS A;  4O5K A;  3AUO A;  2DWQ A;  3NTU A;  1Z1B A;  3GIL A;  2ZIV B;  2BCV A;  4JWN A;  3R9K A;  1JQR A;  5CP2 A;  5F3X B;  2ZIV A;  4FE3 A;  5III A;  4AT9 B;  1IM4 A;  1WUD A;  5JRT A;  2ZUD A;  3UXO A;  4F2R A;  3TFR A;  1NK6 A;  4K4I A;  2Y0S C;  2KIV A;  4UD5 A;  4AT9 A;  3WK9 A;  2W55 A;  5ALT A;  4IQV A;  2BBH A;  2Q4T A;  1FO4 A;  3IM1 A;  4QZI A;  1QLN A;  5L1I A;  2W3R A;  2H3F A;  4NV0 A;  4P4P A;  3QU2 A;  5KFB A;  2OH2 A;  4KX5 A;  1R8C A;  1U49 A;  1B4F A;  2RQ5 A;  5HR6 A;  5C0Y A;  2IUB A;  4NM2 A;  9ICK A;  3V72 A;  1RYR A;  5DB8 A;  2KZZ A;  3QUT A;  3A0B U;  3MFH A;  1BPY A;  4B9V A;  3OUY B;  2CRX A;  1NKE A;  2JH7 A;  1C20 A;  1UHU A;  3PR5 B;  1KDH A;  4IRC A;  3OUY A;  3SEI A;  4PHD A;  3IG5 A;  5HNK A;  1ZRN A;  4R65 A;  3NVZ A;  5AM0 A;  5KFR A;  4LZD A;  2DPJ A;  4P2H A;  4KB6 A;  3FAH A;  4B9L A;  5J2H A;  3PST A;  9ICC A;  5DLF A;  3PNC A;  4J9R A;  5HML A;  3MGV A;  4C8N A;  2WAQ C;  4UAZ A;  4XUS A;  3V6H A;  3CYM A;  4F92 B;  5DGB A;  2RDI A;  1B43 A;  4WC6 A;  5KFW A;  3EPG A;  1TFY A;  4QZA A;  2K4E A;  9ICL A;  3T5J A;  5KFJ A;  4NXW A;  1DXS A;  2B0C A;  3J81 j;  4O0I A;  4IQU A;  4B9T A;  1RDF A;  1SIJ A;  3BQT A;  3I1Y A;  4FFD A;  2KG5 A;  1BVS A;  3GIK A;  3H4B A;  1ZD2 P;  1TV9 A;  1C7Y A;  2W04 A;  4EX7 A;  4XQ7 A;  4NXX A;  4O69 A;  4FO1 A;  4KLG A;  4M6W B;  1ZD5 A;  3E2E A;  2F44 A;  4Q44 A;  1ZQB A;  4KX3 A;  1NK5 A;  5CFS A;  4K4G A;  2KIW A;  9ICJ A;  4M5D A;  2WF6 A;  2AQ0 A;  2UVV A;  4WBZ A;  2DPI A;  4M6W A;  1BPD A;  4AT7 B;  4RQ5 A;  2HHT A;  3PV8 A;  2MU2 A;  2KSO A;  9ICI A;  3Q8Q B;  2R8K A;  1X6I A;  1XU4 A;  3KOO A;  1KFD A;  1KTQ A;  1N61 A;  5AKJ A;  4AT7 A;  4QIW F;  4ELU A;  1K1S A;  4Y2X A;  5HP4 A;  3DEE A;  1Z3E B;  2KJ5 A;  3WU2 U;  1FFU A;  8ICE A;  4USA A;  4IR9 A;  5CFT A;  1NJZ A;  1MQ2 A;  3KHR A;  1Q3U A;  2EZZ A;  4UAU A;  2LBO A;  2KKV A;  1SV0 A;  3Q8L A;  4F50 A;  5IIM A;  3AQL A;  5ALL A;  1ZQE A;  4JLX A;  3F53 A;  4UAR A;  3AMZ A;  3KTQ A;  5HHI A;  5AI5 A;  4RWO A;  2FPK A;  2FE9 A;  1S0V A;  3PW7 A;  4LT6 A;  4EBD A;  4K4H A;  2FJ6 A;  4QZF A;  8ICX A;  1ZQW A;  1X9S A;  3V6K A;  3L4P A;  3MR6 A;  5AIA A;  3N97 B;  3NUQ A;  4MKP A;  1PVQ A;  3NVY A;  4F5O A;  2Y1J A;  4TUR A;  4CE6 A;  1EXN A;  3NKU A;  2RHF A;  2XY6 A;  5T14 A;  3PO4 A;  3E58 A;  3EW9 A;  5AKY A;  2E5S A;  5KFI A;  2NV3 A;  4DFK A;  2HBL A;  3C5F A;  4ED2 A;  3LWM A;  5DQI A;  4O5E A;  2ISO A;  4K99 A;  5DGA A;  2HHU A;  4DSK A;  1BGX T;  1WWU A;  4XRH A;  5DBB A;  1PX5 A;  3UQ2 A;  2XVT A;  4CF4 A;  5KFZ A;  1VJ7 A;  3D6J A;  1QSS A;  1BPE A;  2R8G A;  3RJK A;  5ALS A;  3PW4 A;  2HOQ A;  1OU5 A;  5AKG A;  2EAO A;  4ELT A;  5HRH A;  5C5J A;  4TUQ A;  2Y0S F;  4K8V A;  2AH5 A;  2RRD A;  1ZQM A;  5TIS U;  3AEV A;  2IHM A;  3AU2 A;  5CHG A;  1TK5 A;  5KFS A;  2UVW A;  1NI3 A;  3BZK A;  2C22 A;  2JMG A;  5HRL A;  2BHN A;  2NRZ A;  3WKC A;  4JLZ A;  4UD4 A;  3PSF A;  3BQ7 A;  1UQV A;  2AHO B;  3M6K A;  3WFR E;  1ZQY A;  4EBE A;  9ICS A;  2BQU A;  2G5H B;  1R8A A;  1UT8 A;  5KNI A;  4I2E A;  2A3V A;  4Y2V A;  5IIN A;  4GC6 A;  4F91 B;  4QJF B;  4PH5 A;  1BNO A;  1WG8 A;  3WKB A;  1L7O A;  4F4W A;  1U4B A;  3H8S A;  3NRZ A;  4BWM A;  2VJ5 A;  1OUQ A;  2P6U A;  3T5K A;  2DKZ A;  4X5V A;  4QZD A;  1XO0 A;  3B9J A;  2W9C B;  1Q79 A;  4UB1 A;  4RQM A;  4Y2T A;  2C2D A;  4ED0 A;  1T3N A;  1ZQQ A;  1J2M A;  4WBY A;  2PFN A;  2XGP A;  3QZ7 A;  1RXV A;  5KT4 A;  4QW8 A;  4DOC A;  5J0Q A;  4ECW A;  1FEZ A;  4F5Q A;  2EZY A;  3JCF A;  2WAQ F;  4K96 A;  2FPM A;  5KFQ A;  5KFC A;  2MUT A;  3WFO A;  3RJE A;  4Y2P A;  1DOQ A;  4QWC A;  4UW9 A;  1BNP A;  2EH9 A;  2KZM A;  3WK8 A;  1CI4 A;  2WB1 C;  3WKD A;  5L1M A;  5KFH A;  9ICF A;  4WC7 A;  5AHX A;  2A1A A;  3AU6 A;  1V38 A;  1XSL A;  1ZQ1 C;  2VA3 A;  8ICB A;  1S0N A;  2CN1 A;  4RNO A;  3TAC B;  3SV3 A;  3PML A;  1ED1 A;  4JUZ A;  7ICR A;  3UMC A;  5ALY A;  1L7M A;  2YMM A;  2V4Q A;  1DGJ A;  1MQ3 A;  1SWW A;  2XC9 A;  9ICE A;  2E8M A;  1S0O A;  4UQG A;  1NJW A;  2EDU A;  3UXP A;  3ICX A;  3AQK A; 
#chains in the Genus database with same CATH homology
 1NKC A;  2I1Q A;  3BJY A;  5KT6 A;  1LV5 A;  1BPX A;  2C28 A;  4I28 A;  4Z6C A;  4IG8 A;  2PBE A;  1JIH A;  4CCH A;  3MAB A;  4WC2 A;  4WC4 A;  4NM1 A;  2RFF A;  4KLJ A;  4ECZ A;  4M0A A;  7ICN A;  4EBJ A;  1L5U A;  2ZHA A;  4KLQ A;  3MFI A;  1DK2 A;  4RQ7 A;  5KG7 A;  2JEF A;  5J0U A;  3TI0 A;  3RAQ A;  9ICH A;  5J29 A;  3RH6 A;  2BCQ A;  2FMS A;  4RWN A;  8ICU A;  3EZ5 A;  4F5R A;  1KSP A;  7ICF A;  8ICT A;  3JPO A;  8ICF A;  9ICB A;  1Z00 B;  4FHV A;  4O3N A;  1ZJM A;  4F4X A;  1KFS A;  3JZ0 A;  5HRI A;  4ZH4 A;  8ICH A;  5KFK A;  1NK0 A;  4J9M A;  3T3F A;  4DO9 A;  3UQ0 A;  3RJI A;  3QEB Z;  4QWE A;  5KFG A;  5HHH A;  4O3Q A;  5DQG A;  2GWS A;  2R8J A;  4DQI A;  3SI8 A;  2BCR A;  4X4O A;  2FMQ A;  4UB3 A;  4F8R A;  8ICM A;  2HVH A;  5KFF A;  4PHP A;  1Z00 A;  5J0R A;  4RQ8 A;  2KN7 A;  2W9B B;  4ECS A;  2BR0 A;  2Q66 A;  3RB4 A;  1L3U A;  1QSY A;  2JEJ A;  4RUC A;  3B0Y A;  2VAN A;  2ZJ8 A;  3N4M B;  5KFL A;  2ZUB A;  2DR8 A;  9ICQ A;  5TZV A;  8ICN A;  4YFK A;  4QW9 A;  4GLX A;  5D4B A;  2AGO A;  1NJY A;  1JXL A;  3AQN A;  4KTQ A;  2W9B A;  3GIM A;  5HRB A;  4C8O A;  4RUA A;  1XWL A;  3Q8M A;  5KG6 A;  3C2L A;  1HUZ A;  4X4U A;  4JV2 A;  1NKB A;  2AGP A;  1S9F A;  4I2G A;  4R8U B;  4I2A A;  2ZH2 A;  1ZYQ A;  2H5X A;  4FBU A;  2PI5 A;  4X0B A;  1SKR A;  3M9O B;  2J6U A;  8ICG A;  1ZQG A;  1ZQR A;  2IHN A;  3BDP A;  2HHV A;  4RWP A;  4PHA A;  2PXI A;  4TQS A;  4FHX A;  4UB4 A;  4QZC A;  4ECV A;  3OVA A;  4R8U A;  3C21 A;  4ED3 A;  5F9L A;  3TAP A;  2DVI A;  3RH4 A;  5J2E A;  1NJX A;  8ICS A;  2AQ4 A;  4DQS A;  4X4R A;  3GDX A;  3Q8R B;  3TQ1 A;  3PX0 A;  3PR4 A;  5J0P A;  3KHH A;  4KIT B;  3Q8K A;  1U45 A;  8ICK A;  4J9L A;  4E8F A;  4DS4 A;  4FS2 A;  1ZQO A;  2WTF A;  3H38 A;  2ZH1 A;  4I2I A;  4DQQ A;  4NY8 A;  3H8W A;  4YR2 A;  7ICO A;  4YCX A;  3G6Y A;  3C2M A;  2BGW A;  5HMM A;  9ICU A;  4QZB A;  2F1H A;  3RRG A;  7ICV A;  3RB0 A;  5J2D A;  3JPS A;  5DBA A;  4E7X A;  7ICI A;  3SV4 A;  3HT3 A;  2BPF A;  2P66 A;  1L3V A;  8ICV A;  8ICL A;  4KLF A;  3UPS A;  4O5K A;  4YQW A;  3MR2 A;  5DB6 A;  3AUO A;  2ISP A;  2M2V A;  3NTU A;  4UAY A;  3GIL A;  4ED6 A;  5IIJ A;  2BCV A;  4I27 A;  3OSN A;  4JWN A;  8ICY A;  1UET A;  4Z6D A;  1IXR A;  9ICT A;  3EPI A;  2BQ3 A;  5KFX A;  4RU9 A;  3QZ8 A;  4PGY A;  4MFF A;  9ICV A;  5CP2 A;  1JQR A;  3PY8 A;  2W9C A;  4C8M A;  3JPR A;  3T5L A;  4B9S A;  3JYY A;  1JMS A;  4KLU A;  4YMM A;  7ICU A;  5EWF A;  2Q0Z X;  1K1Q A;  5J2A A;  5III A;  2JZB B;  4J9O A;  4O3R A;  3RJF A;  1IM4 A;  8ICR A;  4AT9 B;  3ZD8 A;  5KT3 A;  3MGI A;  1MIW A;  4Q8F A;  9ICA A;  3JPT A;  2ZUD A;  4NXZ A;  3UXO A;  3OGU A;  4F2R A;  4IRK A;  3TFR A;  1NK6 A;  3EYZ A;  4K4I A;  2ZHB A;  3HIY A;  1U48 A;  5KTQ A;  2FLL A;  3B0X A;  2P6R A;  2JZB A;  4UD5 A;  4O3O A;  4AT9 A;  1WCL A;  2ZH5 A;  4IQV A;  3ZD9 A;  4B9U A;  4WC6 A;  4MEY A;  1ZQA A;  4YD2 A;  1DGS A;  5KFN A;  3PW2 A;  2AGQ A;  1NK8 A;  2HHX A;  7ICQ A;  3IM1 A;  4QZI A;  1QLN A;  5F2V O;  1Y88 A;  5L1I A;  2FLN A;  2ZH9 A;  4EBC A;  1JX4 A;  4P4P A;  4EYI B;  2UVU A;  5KFB A;  4O9M A;  4YG2 A;  5IIK A;  5KT5 A;  1R8C A;  4PHE A;  5CR0 A;  3NGD A;  4RNM A;  3BQ0 A;  4XA5 A;  3NYB A;  1U49 A;  1RXW A;  5J2K A;  2HHP A;  5HR9 A;  3PMN A;  4QZ9 A;  4NM2 A;  3V6J A;  1N56 A;  9ICK A;  9ICP A;  1B22 A;  8ICP A;  2VA8 A;  4DSE A;  4EEY A;  3V72 A;  1DK3 A;  1VFG A;  1RYR A;  5DB8 A;  2KZZ A;  4WC3 A;  3GFK B;  3MFH A;  1BPY A;  4B9V A;  1X9M A;  3OUY B;  5DBC A;  2PI4 A;  4KLE A;  1NKE A;  2HVI A;  3HPO A;  2AU0 A;  3MBY A;  5CJ7 A;  5D49 A;  4BWJ A;  4FO6 A;  1NOM A;  3H40 A;  5KG4 A;  3PR5 B;  2ZH8 A;  1N48 A;  1KDH A;  2LYH A;  3SZ2 A;  4BXO B;  3ZDC A;  1FA0 A;  1ZQI A;  4IRC A;  3OUY A;  4J9K A;  1ZQU A;  4PHD A;  1D9D A;  4ECX A;  4C8K A;  4ED7 A;  4RQ3 A;  4TUP A;  3HX0 A;  4NLG A;  4ED1 A;  2HHW A;  5HNK A;  2IA6 A;  1TFW A;  4FH3 A;  1ZQK A;  4BXO A;  4O3P A;  2UVR A;  3PX4 A;  2PFQ A;  2VA2 A;  1UEU A;  2DR9 A;  5BOM A;  4MEX A;  1ZQJ A;  4BGD A;  3UXN A;  4R65 A;  3JPN A;  1XO1 A;  4KLM A;  2W8L A;  3M8R A;  4DEZ A;  5KFR A;  4LZD A;  2DPJ A;  2BDP A;  4P2H A;  2JEG A;  3RR8 A;  3PW0 A;  4B9L A;  4RPZ A;  4KLI A;  4QZH A;  4Q45 A;  7ICT A;  4X4N A;  5J2H A;  2HHS A;  4DL4 A;  4JK1 A;  5JUM A;  5CWR A;  4J9S A;  9ICC A;  5DLF A;  3LK9 A;  4RPX A;  3PNC A;  3PX6 A;  4UBC A;  1V9P A;  4DSL A;  3H39 A;  5DED A;  5KG0 A;  4J9R A;  4KLO A;  5HML A;  4C8N A;  4S3N A;  4UAZ A;  4AT8 B;  4XUS A;  2V4R A;  1UEV A;  3V6H A;  1PZN A;  4O3S A;  4F2S A;  2J6T A;  1XSN A;  2XCP A;  4F92 B;  5DGB A;  2RDI A;  1B43 A;  3M9M B;  2F1J A;  5KFW A;  3EPG A;  5DG7 A;  4YD1 A;  5DEC A;  2PFP A;  5DB9 A;  1TAU A;  1TFY A;  3THV A;  3ZDD A;  7ICE A;  4AT8 A;  2ZTE A;  5CA7 A;  4QZA A;  2FMP A;  5KG1 A;  4F5N A;  9ICL A;  1ZQD A;  1UT5 A;  3T5J A;  5KFJ A;  3OJS A;  5EOZ A;  4QWD A;  1S0M A;  1KLN A;  4O0I A;  4IQU A;  4DL6 A;  1NO5 A;  3C18 A;  4X0A A;  4B9T A;  4KN4 A;  3BQT A;  4RQ6 A;  4Z6F A;  9ICO A;  4NKU A;  1U9L A;  4XQ8 A;  2ZTD A;  4E80 A;  3RRH A;  1BVS A;  2NRV A;  4YMN A;  4MFA A;  3GIK A;  3H4B A;  3LDA A;  3V7L A;  1NK4 A;  1TV9 A;  4M9H A;  1C7Y A;  1T7P A;  4XQ7 A;  5J0Y A;  3RAX A;  4RWQ A;  5DLG A;  4UB2 A;  2M2T A;  5HRG A;  2M9N A;  3RTV A;  4ECU A;  1CEZ A;  2DR5 A;  5DDM A;  2BPC A;  5KFV A;  1NK9 A;  4MF2 A;  2BQR A;  3PO5 A;  4M9L A;  4F4Z A;  4M6W B;  4DL5 A;  4KLG A;  8ICC A;  4RQ0 A;  4P4M A;  8ICW A;  1S97 A;  3E2E A;  9ICR A;  4Q44 A;  1ZJN A;  1ZQB A;  4QZG A;  1HUO A;  1D8Y A;  3TAR A;  1NK7 A;  1NK5 A;  5KFM A;  3BQ2 A;  4LVS A;  2XY5 A;  4K4G A;  4WC0 A;  3GQC A;  9ICJ A;  4YMO A;  4M5D A;  2AQ0 A;  2UVV A;  4WBZ A;  2DPI A;  3WFS C;  4M6W A;  4FH5 A;  4NLK A;  4B9M A;  1ZQV A;  3TAN A;  1X2I A;  1BPD A;  3RBE A;  1RYS A;  4AT7 B;  4RQ5 A;  4M47 A;  2HHT A;  3RB6 A;  3PV8 A;  8ICA A;  5HRF A;  5KG2 A;  3MR3 A;  5F9N A;  9ICI A;  5L1J A;  5J2B A;  1MSW D;  3OV7 A;  4X4P A;  2KFZ A;  5EWG A;  3Q8Q B;  2R8K A;  1YLQ A;  3AQM A;  1XU4 A;  3H37 A;  1KFD A;  1KTQ A;  2HHQ A;  4AT7 A;  1SL1 A;  3TFS A;  3WFQ E;  4I2D A;  4ELU A;  4DL2 A;  4R66 A;  5J2I A;  1K1S A;  1T4G A;  4Q43 A;  5HP4 A;  1Z3E B;  4QZ8 A;  4PPX A;  2O5A A;  5J2F A;  1UA1 A;  5KFT A;  2XO7 A;  1TKD A;  3H3A A;  2ZJ5 A;  1LB2 B;  8ICE A;  1ZQN A;  4IR9 A;  1S77 D;  3ORY A;  1NJZ A;  7ICM A;  2FPL A;  3ISB A;  2KZ3 A;  2NRT A;  4DOA A;  3C1Z A;  5IIL A;  1MQ2 A;  2ZH7 A;  3KHR A;  3GV7 B;  3V7K A;  4DOB A;  2KFN A;  2MUT B;  3C66 A;  3TAQ A;  4UBB A;  5L1L A;  4G3I A;  3OVB A;  3Q8L A;  2XCA A;  5D46 A;  4F50 A;  4YN4 A;  3FDS A;  4DFM A;  5IIM A;  3AQL A;  9ICG A;  1KRP A;  3K75 D;  3M9N B;  4C8L A;  2HW3 A;  3OHA A;  1JXE A;  2BPG A;  1ZQE A;  2DFL A;  4I2J A;  4F4Y A;  4KLS A;  4ELV A;  2ID1 A;  4I2B A;  1TAQ A;  4IQT A;  4I2F A;  1R89 A;  3KTQ A;  3MDC A;  5HHI A;  1A76 A;  4KN7 A;  4I2C A;  4F3O A;  5KFD A;  4RWO A;  1KFT A;  3UPQ A;  3C23 A;  3ISC A;  2O1P A;  2FPK A;  5DKW A;  4EBK A;  5KT2 A;  1TK8 A;  1QTM A;  5J0X A;  4DQR A;  2Y1I A;  4IR1 A;  4FBT A;  4IQW A;  3PW7 A;  4M04 A;  4Q8E A;  3IHQ B;  4RT2 A;  2M2W A;  1MIY A;  3T5H A;  4EBD A;  4LT6 A;  5KFA A;  4K4H A;  3ZDA A;  4M9J A;  4KLH A;  4QZF A;  4RT3 A;  5EWE A;  3RJG A;  4IRD A;  2ZJA A;  8ICO A;  8ICX A;  1ZQW A;  1HJP A;  1X9S A;  3V6K A;  4GXI A;  1ZQL A;  4P4O A;  5L9X A;  2J6S A;  3MR6 A;  3BQ1 A;  4ECY A;  4KMU A;  4EYH B;  3N97 B;  5IIO A;  5HRE A;  5DQH A;  4JWM A;  4DSF A;  4F5O A;  2Y1J A;  4TUR A;  1EXN A;  4GC7 A;  3MR5 A;  2W8K A;  1X9W A;  1D8L A;  3GV5 B;  2XY6 A;  4KLT A;  3PO4 A;  3EW9 A;  4QWA A;  3Q8P B;  2I9G A;  2V9W A;  2DRA A;  2ATL A;  5J0O A;  4NKT A;  2IMW P;  5KFI A;  2DRB A;  4KLD A;  4R64 A;  4DFK A;  3C5F A;  9ICM A;  8ICQ A;  4KLL A;  5J0W A;  4YR0 A;  4ED2 A;  2BKE A;  5DQI A;  5J0T A;  3LWM A;  1KEJ A;  3V7J A;  2AJQ A;  7ICP A;  7ICL A;  4FHW A;  3H4D A;  2ISO A;  1QSL A;  2IBK A;  4O5E A;  5DGA A;  1WCN A;  5BOL A;  4PGQ A;  4DSK A;  2HHU A;  7ICH A;  1A77 A;  1BGX T;  5KT7 A;  1XS9 D;  1JAJ A;  3HJ4 A;  1ZQT A;  2OWO A;  4XRH A;  1WOT A;  8ICZ A;  5DBB A;  2B21 A;  3OHB A;  4BDP A;  4F4K A;  9ICW A;  1PX5 A;  3UQ2 A;  5KG3 A;  4MF8 A;  3JPP A;  5KFZ A;  1RPL A;  2F1I A;  4J9Q A;  2DR7 A;  1MIV A;  1VJ7 A;  2R8G A;  1QSS A;  1BPE A;  1ZQS A;  3RJK A;  5HRD A;  3RR7 A;  3GII A;  3SYZ A;  1TVA A;  7ICK A;  3PW4 A;  1R8B A;  1UA0 A;  5BPC A;  3MDA A;  4F5P A;  4DWI A;  4YP3 A;  3KHG A;  1OU5 A;  5J0S A;  3ISD A;  1SKS A;  3ZDB A;  5KFE A;  2RDJ A;  1F5A A;  4DQP A;  4MFC A;  8ICI A;  4DF8 A;  4ELT A;  5CB1 A;  5C5J A;  5HRH A;  4TUQ A;  4TQR A;  4NLN A;  2BCS A;  1ZET A;  1ZQM A;  4ECQ A;  1ZQP A;  4FHP A;  2M2U A;  2IHM A;  5DG9 A;  4LZG A;  1NZP A;  2BE3 A;  5J2G A;  3AU2 A;  5CHG A;  1TK5 A;  5KFS A;  2BCU A;  4WC1 A;  2UVW A;  1SKW A;  1TFR A;  2ZH3 A;  2C22 A;  2C2R A;  4UB5 A;  3GIJ A;  3FYH A;  2BHN A;  2NRZ A;  4Z6E A;  3JPQ A;  5HRL A;  1RZT A;  4I2H A;  1H38 A;  2KTQ A;  1Q78 A;  4UD4 A;  3RBD A;  2MAX A;  4RQ4 A;  3KHL A;  1L3S A;  4DFP A;  4M9N A;  4RPY A;  4F93 B;  4X4S A;  4GXJ A;  3GV8 B;  4ECR A;  1S10 A;  2KP7 A;  3WFR E;  1ZQY A;  2ZUC A;  3K4G A;  3HP6 A;  4EBE A;  2BQU A;  9ICS A;  3HW8 A;  1R8A A;  1UT8 A;  1COO A;  1CUK A;  4I2E A;  1ZQH A;  2ZH4 A;  3WFP A;  2JEI A;  4ED8 A;  4ATB B;  4DLE A;  4JV0 A;  5IIN A;  9ICX A;  3MGH A;  3ZDE A;  4GC6 A;  4F91 B;  4RQ2 A;  3OSP A;  4PH5 A;  2R8H A;  4QZE A;  3H8J A;  4PGX A;  4DL3 A;  3PW5 A;  1BNO A;  9ICN A;  5KFO A;  4F4W A;  1U4B A;  3H8S A;  4BWM A;  3HJ1 A;  3M8S A;  2P6U A;  4ATB A;  3T5K A;  4UAW A;  4QWB A;  4DL7 A;  1SL2 A;  5DDY A;  2C2E A;  4X5V A;  2PFO A;  4QZD A;  1ZQC A;  4WCW A;  3ETL A;  2W9C B;  1Q79 A;  4UB1 A;  4GXK A;  3RJH A;  2C2D A;  4EZ9 A;  5J2C A;  4ED0 A;  5L1K A;  1T3N A;  1ZQQ A;  4M9G A;  3RJJ A;  2W9A A;  4NLZ A;  4WBY A;  3HWT A;  3C1Y A;  3C5G A;  2PFN A;  1V4A A;  2XGP A;  2XY7 A;  3C2K A;  3QZ7 A;  1RXV A;  4J9N A;  4RNN A;  2ASL A;  5KT4 A;  4QW8 A;  1SL0 A;  4DOC A;  4DFJ A;  5J0Q A;  4ECW A;  4E0D A;  4WC5 A;  4F5Q A;  1XSP A;  4DLG A;  3OJU A;  4ECT A;  3RH5 A;  1MC8 A;  3L9D A;  5KFC A;  2FPM A;  5KFQ A;  2MUT A;  7ICS A;  3RJE A;  3WFO A;  4YVZ A;  1DOQ A;  5HRK A;  4QWC A;  4FHY A;  1BNP A;  2KZM A;  5KFH A;  4RZR A;  4TUS A;  1U47 A;  4B9N A;  3OVS A;  3Q8S B;  1XC9 A;  9ICF A;  4X4Q A;  1L3T A;  4HYK A;  4EZ6 A;  4M2Y A;  4WC7 A;  7ICJ A;  2R8I A;  5KFY A;  1ZQF A;  2ZTC A;  2NRK A;  1SZP A;  3AU6 A;  3QE9 Y;  4DSJ A;  1TK0 A;  1JN3 A;  2ASJ A;  2NRW A;  1XSL A;  4YR3 A;  2XGQ A;  3G6X A;  4FS1 A;  2VA3 A;  5DB7 A;  3RB3 A;  7ICG A;  5KG5 A;  4YXM A;  1ZQZ A;  1S0V A;  8ICB A;  4EP7 A;  1S0N A;  4RNO A;  1ZQX A;  4RQ1 A;  1S76 D;  4X4V A;  4R63 A;  3SV3 A;  1BPZ A;  3PML A;  2FLP A;  4O5C A;  4YXJ A;  2ASD A;  1ARO P;  5J2J A;  4JUZ A;  1T8E A;  7ICR A;  5KFU A;  5KFP A;  5DG8 A;  3H7I A;  1KNY A;  2ZH6 A;  4J9P A;  2A1J B;  2ALZ A;  1BPB A;  2V4Q A;  4I29 A;  2W9M A;  1MQ3 A;  3LWL A;  2XC9 A;  3LQC B;  4DF4 A;  9ICE A;  3EWA A;  3QEA Z;  1S0O A;  4UQG A;  2NRX A;  1NJW A;  1D9F A;  3UXP A;  4JV1 A;  8ICJ A;  5HC9 A;  4DSI A;  2A1J A;  3G6V A;  4X4T A;  4DS5 A;  3AQK A;  3PVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...