4O5EA

Structure of human dna polymerase complexed with n7mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5eA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5eA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5eA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5eA03
3PR5B 4PGYA 3PNCA 4RNOA 2AQ0A 1S0NA 5KFLA 4YVZA 1KLNA 4K4GA 2ZUDA 1SL1A 4R8UA 1A76A 3BQ2A 1S0MA 5KFKA 2W8KA 2C22A 2BE3A 3ISDA 4QZEA 4J9NA 4NLNA 4RU9A 7ICMA 2MUTB 4FO6A 3AQMA 3QEBZ 9ICIA 4DSEA 2V4RA 1S0VA 1D9DA 1TAQA 4KN4A 5KFDA 7ICSA 2XC9A 4MF8A 4EYIB 4LT6A 5F9NA 2DRAA 4Q43A 2W9CA 2RDJA 4FBUA 4TQRA 3NTUA 3NGDA 4EBDA 1U48A 1L3UA 1KSPA 3C5GA 3MR2A 2PXIA 4F5PA 4IRCA 4QWDA 5DLGA 2W9MA 5DG8A 1MSWD 4PGXA 3MGIA 4WC3A 1B22A 2Y1JA 2IBKA 2ATLA 2ZHAA 4NKUA 8ICYA 2J6TA 5KFXA 5KFHA 4DL2A 4DSFA 5EOZA 4J9SA 4J9PA 2H5XA 1JX4A 4RQ6A 2JEGA 3ZDBA 3JPNA 3ZD8A 4KLLA 3M9MB 2NRTA 2W9BA 4I2AA 4IQVA 4ECYA 3N97B 1QSYA 4M47A 2MAXA 4PHPA 7ICGA 3T5HA 2Q0ZX 4DL3A 1S0OA 1NJXA 4NXZA 4B9VA 4LZDA 2ISOA 3T5KA 1ZQUA 7ICIA 5J2EA 2C2RA 1L5UA 4RWNA 4RWQA 4EBJA 1ZQIA 3V6JA 1CUKA 5BOLA 4IQTA 3HX0A 3KHGA 4BXOA 4M04A 1TAUA 9ICTA 3V72A 2KZMA 3SV4A 1HJPA 5KG1A 2I9GA 4Q45A 3H3AA 2BCQA 3MDAA 4M9JA 2UVRA 1TKDA 4BXOB 2M2WA 4KLEA 1Z00B 3EZ5A 1XS9D 4M9NA 5J0PA 4QZGA 1ZQHA 4RWOA 2ZJ5A 5HMMA 4ECUA 4X4OA 2ISPA 2M2UA 1NKBA 1B43A 4RNNA 3MR6A 4F4WA 1V9PA 5KG6A 4K4IA 2DR8A 4QWBA 1V4AA 4PH5A 4FS2A 4M0AA 3RH6A 4AT8B 1MC8A 4WCWA 1JMSA 1RXVA 4YG2A 4F5QA 4O3RA 5KG4A 3Q8QB 5CR0A 1X2IA 2BHNA 4I2GA 2DPIA 2DR5A 3QZ7A 3H4BA 1ZJMA 1UEVA 3V6KA 4G3IA 1BNOA 4QZIA 3C1ZA 2ALZA 8ICGA 3HIYA 3G6YA 3WFRE 1ZQZA 8ICFA 2A1JB 8ICUA 4P2HA 9ICVA 5IIMA 5KG5A 4KLDA 4E80A 5J2GA 2KP7A 4DS4A 2A1JA 4QZDA 8ICQA 8ICEA 4JV0A 9ICSA 4TQSA 4M6WA 4DQRA 3GV7B 3MBYA 3M8RA 4LZGA 4EBEA 2JZBB 3RJHA 9ICWA 1SL0A 2VA2A 4BGDA 3C5FA 3GIJA 4YP3A 4FHWA 3AU2A 3G6XA 2ASLA 4I27A 5HRLA 3PX6A 1MQ2A 4I2IA 5HNKA 2FLLA 4O9MA 4UB3A 5KFFA 4R64A 3Q8KA 3PW4A 1HUZA 3BQ1A 3KTQA 5J2BA 3T5JA 3EYZA 3GQCA 5IIKA 4X4RA 3JPPA 2HHTA 4F2RA 4FHVA 3OV7A 8ICZA 7ICPA 4RPZA 3RB4A 3H4DA 3M9OB 1EXNA 4UD4A 1L3SA 4I2FA 5L1LA 2IHMA 4CCHA 3PW2A 2AGOA 4DS5A 5J0YA 2XCAA 3L9DA 3PMNA 3C2LA 1JN3A 5DBBA 3QEAZ 3PY8A 2HW3A 3WFSC 7ICUA 4JUZA 1JIHA 4JWNA 9ICXA 3JPQA 5DBCA 4J9LA 2W8LA 4B9NA 4UAYA 4ECSA 1ZQFA 4B9LA 1UT8A 4IQWA 1MIWA 1UA1A 4X4VA 1ZQTA 3LDAA 4ELTA 1KTQA 3WFOA 4AT9A 3OUYA 2P66A 1WCNA 3TFSA 1BPBA 2NRXA 4ED8A 1ZQAA 1MIVA 4F5OA 9ICRA 5KT4A 4I2DA 2M2TA 3GIKA 3WFQE 1ZQCA 7ICHA 7ICQA 4KLQA 4ED6A 1QTMA 4YXJA 3N4MB 2JEIA 5HHIA 2Y1IA 4PHEA 4IR1A 5J0UA 2XY6A 4RT2A 1QLNA 3H8WA 4WBYA 4EZ6A 4DSLA 1ZQWA 4O0IA 1NOMA 2GWSA 5DDYA 4MFAA 4X4SA 4UAZA 5C5JA 4O5EA 4KLHA 4DL4A 4ECTA 5F2VO 3UPQA 1ZQMA 4GLXA 4I2BA 2JEFA 3EPIA 2BQUA 4R63A 3MGHA 4NY8A 4QWAA 9ICPA 5DECA 3UPSA 4IR9A 4E7XA 4YMOA 7ICNA 4DFMA 2PFNA 1BGXT 4C8MA 2M2VA 3UXNA 3UXOA 2XGQA 1TVAA 2UVVA 3C66A 4F93B 3MFHA 1RPLA 1PZNA 5J2DA 1X9SA 1ZQDA 3PO5A 4C8LA 4RQ1A 4J9OA 2BCUA 2R8JA 1BPEA 4ED0A 2V9WA 9ICHA 1KFDA 8ICXA 4DOBA 1ZQQA 9ICCA 3ORYA 4GC7A 2ZTDA 1RYRA 5BOMA 1L3TA 4RUAA 2BCRA 4DQPA 2HHPA 4B9SA 3EPGA 7ICJA 1NKEA 2XO7A 3PV8A 3RH4A 1SL2A 1C7YA 2PFPA 4J9QA 1SKSA 8ICHA 4DF8A 4I2HA 9ICNA 1NZPA 1NJYA 2ZH9A 2BKEA 5F9LA 1NK7A 2KN7A 3GDXA 2UVUA 1S10A 5HR9A 4I28A 8ICIA 3PR4A 3OJUA 5J2FA 1F5AA 2XGPA 4KLTA 4KMUA 3AQLA 4DFJA 5BPCA 4RQ8A 4HYKA 3QE9Y 4ATBB 1KEJA 1ZQNA 4JV2A 5KG3A 3UQ2A 2V4QA 3RH5A 5DB8A 3JPRA 8ICMA 5HRKA 5DBAA 1X9WA 1SZPA 1LV5A 4ECWA 4JWMA 2XCPA 4O5CA 3ISCA 1NK5A 3OJSA 8ICBA 3PVXA 4K4HA 3HWTA 2C2DA 1KFTA 4RNMA 7ICOA 3RRGA 3AU6A 8ICKA 1D8LA 5CB1A 5KFPA 1JAJA 4FS1A 1U4BA 1MQ3A 9ICBA 3RB6A 5DGAA 3GFKB 4TUPA 1UA0A 4YD2A 3AQKA 4R8UB 1ZQLA 3ZDDA 1AROP 2P6UA 5IILA 1XSLA 2P6RA 2BCVA 3C23A 1WOTA 5EWFA 3PW0A 4X4NA 4DSJA 4P4MA 4TURA 5KFRA 5J0QA 5J0XA 4O3SA 9ICEA 3JYYA 5KFYA 1XO1A 5J29A 5D49A 9ICLA 4ECQA 1LB2B 4KLSA 4UAWA 3GIIA 3PX0A 2Q66A 4UBBA 1UT5A 4I2CA 4RQ5A 3E2EA 8ICSA 2VANA 2J6UA 3TAPA 5KG7A 9ICAA 3B0XA 1Y88A 5HRDA 3OVBA 7ICEA 4M9GA 5KFCA 4RPXA 4QZBA 3Q8SB 4J9KA 4RQ0A 5HMLA 2OWOA 3RR8A 2C28A 2BCSA 5L1IA 3V7KA 5J2JA 4RPYA 2W9BB 4NLGA 3H37A 1NK6A 2FLPA 2I1QA 3K4GA 4M9LA 2KZZA 1TK5A 4F92B 1SKRA 8ICRA 1ZQJA 4B9MA 1DK2A 4YD1A 3PX4A 2R8GA 9ICKA 1R8AA 1UETA 1JXEA 4S3NA 3JZ0A 4UB1A 3OHAA 3RBEA 1YLQA 4R66A 4DFKA 3RJEA 1R8CA 3KHLA 3TARA 2ZUCA 1QSSA 3RJKA 4MEXA 2DR7A 1T3NA 3HT3A 4RT3A 2FMQA 2JEJA 4JK1A 3C2MA 3RBDA 1XC9A 5IIJA 2HHWA 4KLUA 4WC5A 3HW8A 4QWEA 1KFSA 5KG0A 5KFWA 4Q44A 4Q8EA 8ICTA 4WC0A 1TFYA 3H38A 3H8JA 1DK3A 4MEYA 4QZFA 4DWIA 1T7PA 4KLOA 4DSKA 4WC4A 1S76D 3H40A 3SV3A 5KT3A 4M6WB 4YQWA 7ICLA 1T4GA 5KFMA 5DG7A 2F1IA 4QZCA 4F2SA 4YXMA 3THVA 1NK4A 5EWGA 3OHBA 3RRHA 4DQIA 3RJIA 4RQ7A 5DG9A 4FHXA 2NRWA 3Q8PB 1ZQYA 4GXIA 1DOQA 3HP6A 9ICQA 5DEDA 1L3VA 4IG8A 5EWEA 4F5NA 2ZH4A 3MR3A 2KZ3A 4QZ9A 3RR7A 4KTQA 5IIIA 4YMMA 5DGBA 9ICUA 4F50A 5KFNA 4MFFA 3RJJA 3SZ2A 7ICRA 4RQ2A 4P4OA 3C1YA 2BQ3A 4I2EA 4X0BA 2WTFA 1TK8A 4MF2A 3MABA 4PGQA 4F4ZA 4ED7A 1K1SA 4FHPA 2ZHBA 4UQGA 2XY7A 3MR5A 3BQ0A 4DO9A 1NKCA 2R8KA 4EYHB 3FYHA 4KLGA 7ICTA 3KHRA 4Z6FA 5L9XA 3B0YA 5KFGA 4DEZA 2BPFA 4F4KA 7ICVA 5KT2A 4RWPA 2IMWP 3ZD9A 2HHUA 2FPMA 4ECZA 4C8OA 5HRBA 4YFKA 5J0WA 4NKTA 1Q78A 2ZH7A 1KNYA 4O3OA 4XRHA 2FPKA 3TFRA 4DLGA 1U49A 4ELVA 2BDPA 4XQ8A 3PW5A 2C2EA 1T8EA 2ASJA 2HVHA 5KFTA 1NO5A 9ICJA 3OVAA 2AGPA 4ECXA 3RJGA 3LQCB 4TUSA 5JUMA 4XQ7A 1ZQBA 1ZQSA 3GILA 3LWLA 5CA7A 3TI0A 1HUOA 3PW7A 1ZQPA 1NK0A 1JXLA 2W9CB 2O1PA 3EWAA 3RB0A 4O3NA 4QZAA 5HP4A 3EW9A 1SKWA 3RB3A 4DFPA 4PPXA 3HJ1A 5L1JA 4PHDA 1H38A 2ZTEA 4YCXA 1S97A 1S9FA 9ICOA 2MUTA 2LYHA 4EBCA 5IINA 3Q8RB 4P4PA 4IRKA 4JV1A 3BJYA 1X9MA 5KFQA 5DB6A 5J2AA 2ASDA 2AQ4A 2KFZA 4BWMA 2RFFA 3ETLA 3H8SA 4NM1A 2ZH2A 3LK9A 1TK0A 4Q8FA 3QZ8A 7ICFA 9ICMA 4WC1A 3V7JA 2ZTCA 4ECRA 3C21A 4UBCA 3SYZA 4FH5A 4X4PA 5KFOA 4E0DA 4GXJA 1RXWA 1ZQVA 5DKWA 1Z00A 4ECVA 2O5AA 4KLIA 4ED1A 3G6VA 4F3OA 3MDCA 1S77D 1MIYA 3PO4A 1ZQKA 1JQRA 4YR0A 1ZQRA 4B9UA 4ATBA 1N48A 2FMSA 1BPZA 4X4UA 4ED3A 5KT7A 4YMNA 5DQIA 1TFWA 4QW9A 4ELUA 3JPTA 4MFCA 4DQSA 4DF4A 5J2CA 3Q8LA 5CJ7A 4WC2A 9ICFA 4AT7A 1R8BA 2ZJAA 3ZDAA 4F5RA 9ICGA 1RYSA 5D4BA 4UB5A 3RJFA 2R8IA 8ICPA 5DQHA 4EP7A 2J6SA 1FA0A 2HHSA 2M9NA 3GV5B 3TQ1A 4YR3A 5DQGA 2PFQA 4F4YA 3K75D 4UB2A 5KG2A 3JPSA 5HRFA 1NJZA 2ID1A 4WC7A 4FH3A 3OUYB 1COOA 3KHHA 3Q8MA 2RDIA 3UQ0A 4C8NA 5IIOA 2ZH3A 4DOCA 4QW8A 4AT8A 1VJ7A 2KFNA 4WBZA 3GIMA 4J9RA 4O3QA 2W9AA 1ZETA 3LWMA 2HHQA 5KFBA 1DGSA 5L1KA 4M5DA 4I2JA 4X4TA 1U47A 1OU5A 3RTVA 2PI4A 5KFEA 2BPCA 3ZDEA 4X5VA 4DOAA 4J9MA 5HHHA 1ZQEA 2HHVA 2DRBA 2JZBA 3IHQB 4QZHA 3AQNA 1IM4A 1U45A 3JPOA 4RQ3A 2ZH6A 1A77A 5J0OA 4I29A 4WC6A 4TUQA 3M9NB 8ICJA 5KT6A 4E8FA 2BQRA 1BVSA 4DL7A 4FHYA 4Z6CA 1ZJNA 1D9FA 2PFOA 3ISBA 5KT5A 1XU4A 4NM2A 4EEYA 1NK9A 5KTQA 4DSIA 3UXPA 4RQ4A 4GC6A 4F8RA 1BNPA 5CP2A 4F91B 4RUCA 8ICLA 4KLFA 5DLFA 4M9HA 1IXRA 2XY5A 3HPOA 3IM1A 2AU0A 1ZYQA 5HREA 5KFJA 4Z6EA 2ZH5A 2FPLA 5D46A 3T5LA 2FMPA 4C8KA 4EZ9A 4F4XA 1BPYA 3OVSA 2IHNA 3FDSA 8ICVA 5HRGA 4DLEA 4X4QA 3V7LA 4EBKA 4M2YA 2AJQA 1XWLA 2F1JA 8ICOA 3OGUA 4ED2A 2HVIA 4UD5A 2BPGA 1U9LA 2VA8A 4B9TA 2DPJA 5HRHA 1NK8A 1QSLA 5J0RA 4R65A 1BPXA 3AUOA 4UB4A 4AT7B 1KRPA 2PBEA 2BR0A 2PI5A 1PX5A 4LVSA 2ZH8A 5HC9A 5CHGA 4Z6DA 2AGQA 2ZJ8A 1BPDA 2UVWA 3MFIA 3BDPA 4NLZA 4AT9B 1Z3EB 1RZTA 1CEZA 1ZQXA 4BWJA 5KFSA 5KFUA 5TZVA 1XSPA 3ZDCA 4FBTA 3C18A 4XA5A 5J0SA 3PMLA 2ZH1A 2BGWA 4BDPA 5KFIA 4YN4A 5DB7A 5J2HA 8ICNA 2ZUBA 5CWRA 1R89A 4RZRA 4IRDA 4KLJA 5DB9A 2NRVA 1TFRA 4O3PA 4DL6A 1TV9A 3TANA 4O5KA 3HJ4A 4X0AA 4XUSA 1KDHA 4PHAA 4QWCA 3T3FA 2IA6A 5J2KA 5J0TA 2VA3A 4KLMA 1VFGA 2B21A 4QZ8A 3BQTA 5KFAA 1K1QA 3M8SA 3RAXA 1D8YA 1ZQOA 1UEUA 4NLKA 2KTQA 4DQQA 8ICWA 4KN7A 1NJWA 4ZH4A 3RAQA 5HRIA 4IQUA 2R8HA 2FLNA 7ICKA 3H7IA 2HHXA 2DVIA 2DFLA 1ZQGA 4KITB 3SI8A 2NRKA 2DR9A 8ICAA 2NRZA 3OSPA 3C2KA 3NYBA 2F1HA 4DL5A 3WFPA 3H39A 8ICCA 4GXKA 1Q79A 1WCLA 3V6HA 5KFVA 5DDMA 3OSNA 3GV8B 1XSNA 5J2IA 5KFZA 4YR2A 3TAQA 1N56A
chains in the Genus database with same CATH superfamily
3PNCA 2AQ0A 2BDUA 1SL1A 2E8OA 2JGAA 4QZEA 3AQMA 9ICIA 4DSEA 5CRXA 3NS1A 5ALWA 3AEVA 2XC9A 4LT6A 2W9CA 3E58A 4TQRA 3NTUA 4EBDA 1U48A 2IOFK 4IRCA 2LKYA 5DLGA 5DG8A 3MGIA 2FE9A 2IBKA 4NKUA 4DL2A 4J03A 5AK6A 4OJ6A 3WK5A 5EE9A 3M9MB 2NRTA 3WK6A 4ECYA 7ICGA 1QH9A 2XICA 1SV0A 3KKAA 1NJXA 4NXZA 4B9VA 2KIVA 3T5KA 5J2EA 4RWQA 4EBJA 3KHGA 1F0MA 4NL9C 3V72A 1XO0A 2WAQF 5AKXA 3H3AA 5ALMA 4GFJA 2UVRA 4M9JA 1TKDA 4KLEA 4NJ8A 1XS9D 2DUYA 1MA7A 2WF9A 1A0PA 4ECUA 2ISPA 2M2UA 1RM6C 5KG6A 4FS2A 3RH6A 4JLXA 4YG2A 4FFDA 4F5QA 1GPJA 2NYVA 2DR5A 2EZXA 1ZJMA 1UEVA 3V6KA 5AKYA 2IOFA 3TADA 3HIYA 1LKYB 1L6NA 4FO1A 5KG5A 4E80A 2HSZA 2KNJA 4DS4A 3IN5A 8ICQA 8ICEA 2KMDA 4TQSA 1HIWA 4M6WA 1QQ7A 4PZOA 4LZGA 2EAMA 1SL0A 2VA2A 3C5FA 3AU2A 3G6XA 4I27A 2E8PA 4I2IA 3NVYA 5KFFA 4UB3A 4LEZA 2HHTA 1VJ5A 2H3ZA 3RB4A 1L3SA 2IHMA 1N60A 4CGZA 4DS5A 2XCAA 3L9DA 3C2LA 3PY8A 3OTQA 1LVHA 2ZIXA 4OAHA 1JIHA 3JPQA 2OH2A 2W8LA 1J2MA 1Q3UA 3D6JA 1UA1A 3WK8A 3QUBA 2P66A 3TFSA 1K5OA 2M2TA 3GIKA 2WF8A 4KLQA 1QTMA 4YXJA 3QU2A 2Y1IA 1PK1B 4MKPA 3H8WA 4WBYA 3IV6A 1RQNA 1NOMA 2GWSA 1Z19A 4KLHA 3L4PA 5FP0A 1ZQMA 3TKAA 3EPIA 2LPEA 5KL1B 7ICNA 1TVAA 2XGQA 3MFHA 1BPEA 4ED0A 2V9WA 4QIWC 3AN1A 1L3TA 4DQPA 4B9SA 3IRUA 1SL2A 4DF8A 4I2HA 4I0UA 1Q8KA 1DXSA 2BKEA 2EDUA 2JV3A 2KN7A 5HR9A 5A0LA 1M6YA 2XGPA 4DFJA 4RQ8A 4ATBB 1KEJA 8ICMA 5HRKA 5KG3A 2QB0A 3UQ2A 5DB8A 3JPRA 2IUBA 3QXGA 3EUB2 4K4HA 3HWTA 2I5HA 7ICOA 4CNQA 8ICKA 1D8LA 4FS1A 1SB3C 3GFKB 4TUPA 1UA0A 1IG6A 3JCFA 5G5GA 3KBBA 1ZD2P 1AROP 5IILA 2P6RA 1XSLA 4NXVA 1KBUA 4JLZA 5J0XA 4O3SA 3JYYA 1UPHA 5J29A 2AXTU 4ECQA 2LM1A 4RQMA 1UT5A 4I2CA 9ICAA 2KV2A 3SAGA 1DRGA 5HRDA 3AQFA 3FAHA 4QZBA 1F5SA 2W9BB 1ZD4A 5AKKA 1ZQJA 3PX4A 4O67A 3C29A 1CRXA 1T3QA 1YLQA 3RJEA 4WQLA 3I28A 1R8CA 3KHLA 3TARA 1QSSA 3RJKA 1ZRMA 4RT3A 4JK1A 1JRPA 1KFSA 5KG0A 4Q8EA 1TFYA 3QU4A 5ALLA 1DK3A 4QZFA 4DSKA 2KSOA 2Q4TA 5KT3A 1PVPA 4LEVA 3SAFA 1X6JA 4YXMA 1NK4A 5EWGA 3OHBA 5G5HA 1ZQYA 4B6JA 1DOQA 3HP6A 4GXIA 3ALRA 2LHTA 1SV0C 1L3VA 5DEDA 2W03A 4F5NA 2KZ3A 4QZ9A 4C4SA 4YMMA 1Q46A 5KFNA 3SZ2A 3C1YA 2BQ3A 4X0BA 2ZIUB 2A3VA 1PK1A 1WUDA 4UQGA 3BQ0A 3DDHA 4DO9A 4EYHB 7ICTA 2HDOA 2ZIUA 3KHRA 1FEZA 2IMWP 3ZD9A 2FPMA 3KZIU 4YFKA 5CHEA 4DCCA 3PW5A 1T8EA 3QUQA 1P7DA 2EWRA 4ECXA 3RJGA 3LQCB 5CA7A 1ZQPA 2GLEA 4BJQA 1NK0A 4EELA 4EV6A 2O1PA 5HP4A 4QZAA 2HBJA 5AI6A 3RB3A 4PHDA 1AQ6A 4YCXA 3Q8RB 3BJYA 2KFZA 5J2AA 2RRDA 2BBJA 4Y2VA 4WC1A 3V7JA 4ECRA 4X4PA 1JUDA 3OPXA 5KFOA 4NLBA 2CN1A 4ECVA 2O5AA 4KLIA 4ED1A 2HI0A 3G6VA 1MIYA 3PO4A 4B9UA 2B56A 4US9A 5KT7A 4MFCA 2QKQA 4WC2A 9ICFA 2JHDA 2ZJAA 9ICGA 3BZKA 2WF5A 5D4BA 4OO1J 3OWGA 1RDFA 2G06A 3H0MB 5EE1A 5DQGA 5HRFA 3JPSA 5KG2A 5ALVA 2ID1A 4WC7A 1V97A 1COOA 3KHHA 2MA1A 5AKEA 3UQ0A 2ZH3A 4DOCA 4AT8A 1VJ7A 4J9RA 2HHQA 2W9AA 1ZETA 2DGZA 4IS7A 5KFBA 4X4TA 1OU5A 2E1EA 2PI4A 3ZDEA 2HBLA 4X5VA 4UAUA 1S5LU 2IHOA 3L3FX 2ESEA 1IM4A 3JPOA 4RQ3A 5J0OA 5EE0A 8ICJA 4DL7A 4HAIA 3H0RB 3ISBA 4EEYA 3CP8A 4KX3A 3UXPA 3VC8A 2OHFA 4M9HA 3N7RC 5HREA 5KFJA 5D46A 3T5LA 2FMPA 4F4XA 1BPYA 4DLEA 3V7LA 3B9JA 1XWLA 2HVIA 1U9LA 5HRHA 2EZYA 4LEWA 1KRPA 2BR0A 5CHGA 2DKXA 1BPDA 1Z1BA 1CEZA 4BWJA 2Z7JA 5J0SA 2BGWA 4YN4A 4Y2YA 3BS7A 4RZRA 2JXJA 2NRVA 1TFRA 2KK0A 3UMGA 3T79A 1FO4A 2N1RA 4PHAA 4QWCA 3T3FA 2IA6A 4MHVA 2RLTA 2PMZF 4KN7A 5EE3A 1ZQGA 3D2QA 2NRZA 3NYBA 5AI9A 5KFVA 3GV8B 5J2IA 3HILA 3TAQA 1S0NA 5KFLA 1OXJA 4K4GA 3ZI4A 4R8UA 1S0MA 5KFKA 3ISDA 2JR5A 3K1ZA 4J9NA 4NLNA 2FCLA 7ICMA 1S0VA 1NNLA 5GTIU 3O0FA 7ICSA 4Q43A 2RDJA 4QWDA 2W9MA 1B22A 2ZG6A 2B51A 3SQIA 2K4HA 3MGVA 1ZD5A 4DSFA 5AK5A 2H5XA 1JX4A 2JEGA 3SD7A 2W9BA 3N97B 2MAXA 4PHPA 2Q0ZX 3NVWA 4LZDA 2ISOA 1ZQUA 7ICIA 2H3QA 4RWNA 3AMZA 1ZQIA 4BXOA 4IQTA 4EX7A 1TAUA 1WYGA 1HJPA 1WWUA 4Y2RA 5KG1A 4Q45A 1LKYA 2O6KA 3MDAA 4BXOB 1Z00B 2XI9A 3EZ5A 1URJA 4M9NA 5J0PA 1A6SA 3QU9A 4RWOA 5HMMA 4C7ZA 4CRXA 2BZFA 4K4IA 3MR6A 1V9PA 1V4AA 4PH5A 2VKQA 3E0FA 4AT8B 2KKVA 1SXEA 1JMSA 5JRTA 2BHNA 1PUZA 2DPIA 1BNOA 3MCRA 3C1ZA 4UASA 2K60A 3EF2A 2R18A 3WFRE 1ZQZA 8ICUA 3A0HU 4K99A 4KLDA 5ALNA 4DQRA 4EBEA 2JZBB 4FHWA 1OW5A 5ALDA 3SAHA 2AH5A 1MN8A 3KTQA 3PW4A 3BQ1A 3T5JA 1N63A 4UARA 3OV7A 4OJ5A 2EANA 3H4DA 4UD4A 4I2FA 5L1LA 4CCHA 3PW2A 1L7OA 2JH1A 3WU2U 1X40A 4JWNA 3M1YA 5AIAA 4UAYA 4ECSA 1ZQFA 1MIWA 1L8OA 5D61A 4X4VA 1UQVA 2B0CA 3WFOA 3OUYA 5ALEA 4ED8A 5AI0A 2YB4A 9ICRA 1ZQCA 7ICHA 3N4MB 2JEIA 5HHIA 4PHEA 4RT2A 1SWVA 2KIWA 3M6ZA 5DDYA 5J8YC 5C5JA 4UAZA 4WJ3B 4DL4A 1CI4A 3KOOA 2BQUA 3MGHA 4NY8A 9ICPA 2YQEA 3KZXA 4YMOA 3IDWA 3UXOA 2UVVA 3C66A 2KJ5A 4J9OA 2BCUA 1ZQQA 1VLBA 2ZTDA 1X9XA 2BCRA 7ICJA 2XO7A 3RH4A 1C7YA 3HJEA 2PFPA 4J9QA 8ICHA 1TAMA 1NJYA 5F9LA 2KICA 5J2FA 4FE3A 2DQNB 4KLTA 3AQLA 2DKZA 4Y2SA 2K8AA 4JV2A 5DBAA 4KMOB 1LV5A 2DL0A 4JWMA 1SXDA 1ZRNA 1KFTA 4RNMA 2HOFA 2OYYA 4YD2A 1ZQLA 2AHOB 4KM5A 2BCVA 4F71A 4CF5A 1V85A 5EWFA 5CEHA 4P4MA 4TURA 4PZNA 5D49A 9ICLA 1LB2B 4UAWA 2KHQA 3PX0A 4RQ5A 7ICEA 4M9GA 5ALQA 4A8EA 4RQ0A 2YMPA 2ZXHA 5J2JA 2JMGA 2I1QA 4M9LA 1TK5A 3L5KA 1DK2A 1UETA 9ICKA 1R8AA 1JXEA 2YTUA 1UCVA 3BS5A 4PL1A 4UB1A 4WQKA 3RBEA 4DFKA 4NXUA 2FMQA 4OCZA 2HHWA 1O08A 2YX8A 1Q3VA 5KFWA 3R9KA 3H38A 4MEYA 3SR6A 2W3RA 1T7PA 1S76D 3SV3A 1T4GA 5KFMA 5DG7A 4F2SA 3RRHA 4DQIA 5B3PA 2NRWA 9ICQA 3N7SC 3RR7A 5IIIA 3SENA 5DGBA 4F50A 5AI5A 7ICRA 4RQ2A 4CDGA 2W55A 3MABA 4PGQA 2GOLA 1K1SA 4FHPA 3IG5A 2XY7A 2DWQA 4KLGA 4WH5A 4C80A 4ECZA 3K1RB 5J0WA 5AKHA 1U49A 2BDPA 4XQ8A 2HVHA 1RYUA 2K89A 1NO5A 9ICJA 4EGWA 5JUMA 1ZQSA 3GILA 5KAIU 3LWLA 2B4VA 3EWAA 4O3NA 3I76A 3SMVA 4PPXA 5L1JA 1H38A 2VJ4A 1S9FA 3CW2C 5AK4A 5DB6A 2AQ4A 4BWMA 3ETLA 3LK9A 1TK0A 2P35A 4FH5A 3C21A 4UBCA 4GXJA 2RQ5A 1JI7A 3HRDD 1RXWA 1ZQVA 5DKWA 1Z00A 4F3OA 3MDCA 1NZBA 4GIBA 5HR6A 4YR0A 4EEDA 2LMRA 2H3FA 2KJ9A 4YMNA 4QW9A 1N5WA 4DF4A 1XNSA 4HX0A 3I1YA 2EH9A 1FFUA 1R8BA 3ZDAA 2H3VA 4Y2TA 3ER9B 1RYSA 2HHSA 2M9NA 2PFQA 4YR3A 1N2XA 3K75D 4UB2A 1SGGA 5IIOA 2QB1A 2KFNA 3GIMA 4M5DA 4O3QA 3LWMA 2HCFA 1DGSA 5L1KA 1U47A 3VCBA 2BPCA 4JB3A 1COKA 4J9MA 5HHHA 1ZQEA 2JZBA 4O6AA 4TUQA 3M9NB 4E8FA 5KT6A 2KEYA 4Z6CA 2E1FA 5KT5A 5KTQA 4DSIA 1VDVA 1PK3A 4GC6A 5CP2A 3WK7A 4KLFA 5DLFA 3HPOA 5AIBA 2E3TA 1FIQA 2ZH5A 4EZ9A 4C8KA 4K98A 2HMXA 5HRGA 1F44A 4M2YA 2VA8A 1L7NA 5J0RA 4UB4A 2PBEA 2W43A 2PI5A 2ZH8A 5E79U 2HBKA 2ZJ8A 3MFIA 4NLZA 1Z3EB 1RZTA 4NXXA 1ZQXA 5KFSA 3ZDCA 4XA5A 4OJLA 4BDPA 4ICAA 5J2HA 2ZUBA 5CWRA 4O3PA 4O5KA 4X0AA 1KDHA 2VA3A 1Z1VA 1K1QA 1UEUA 4NLKA 2KTQA 4ZH4A 3RAQA 5HRIA 4IQUA 3H7IA 2DVIA 2NRKA 1ED1A 3C2KA 2LM4A 4DL5A 4CF4A 8ICCA 1XSNA 3NRZA 4FZLA 3PR5B 4PGYA 3U26A 4EX6A 2W8KA 5AM2A 4RU9A 3BZCA 5B5EU 4FO6A 4PJ0U 2KD1A 2KG5A 1D9DA 4KN4A 5AHXA 4MF8A 3KFUF 3FM9A 3S6JA 5ALGA 3C5GA 3MR2A 2PXIA 4F5PA 1MSWD 2Y1JA 5H2FU 2J6TA 5KFXA 5KFHA 2K4IA 4J9SA 4J9PA 4RQ6A 3ZDBA 2GAFD 3JPNA 3N28A 4KLLA 3CRXA 4M47A 1ZXIA 3T5HA 4DL3A 1S0OA 2KSOB 1C20A 2OM6A 2F3NA 1L5UA 4M04A 1CUKA 5BOLA 3RF9A 2BCQA 2M2WA 2E8NA 1SZHA 4QZGA 1ZQHA 2D8CA 2HBMA 1B43A 2W7OA 4F4WA 2K8BB 5D62A 3F2BA 1X2IA 4I2GA 5TISU 3QZ7A 3H4BA 3NASA 8ICGA 8ICFA 3DV9A 2Y9UA 2FDRA 4P2HA 4JMUA 2KP7A 2HOQA 4Y2PA 3ICXA 3MBYA 2WFAA 2KVCA 3GU3A 4YP3A 2ASLA 2FLLA 5HNKA 4O9MA 3Q8KA 1HUZA 3CK6A 1QQ6A 5J2BA 4Y2QA 5AKLA 3EYZA 4X4RA 3JPPA 3PSFA 4F2RA 7ICPA 5AKZA 1ECWA 3M9OB 2AGOA 5J0YA 2MSNA 1JN3A 2XVTA 5DBBA 2HW3A 3WFSC 1S8OA 7ICUA 2F77X 4J9LA 4B9LA 1OUQA 2DBYA 3DEEA 1WCNA 3KD3A 1BPBA 1ZQAA 2W7PA 4I2DA 3WFQE 4ED6A 3AQKA 5J0UA 2XY6A 2ES6A 3WKCA 1QLNA 4DSLA 1ZD3A 1ZQWA 4O5EA 4NXTA 5F2VO 4E7XA 1QQ5A 4IR9A 2YY6A 4DFMA 2PFNA 2M2VA 4C8MA 4F93B 2Y0SF 1PZNA 1RPLA 5J2DA 4RQ1A 3ORYA 4GC7A 1RYRA 4RUAA 2Y0SC 5B3QA 1SKSA 1NI3A 2ZH9A 2UVUA 3GDXA 5J8YA 1S10A 4I28A 8ICIA 3OJUA 5CFTA 4KMUA 4HYKA 2ZIWB 3QE9Y 4NLCA 4QJFB 1ZQNA 3RH5A 1X9WA 1SZPA 3ISCA 3OJSA 2ZIWA 2C2DA 1WG8A 3BQ7A 5ALOA 3RRGA 5KFPA 3QYPA 5KL8B 3RB6A 5DGAA 5JU5A 5JTGA 2WAQC 4R8UB 1KKXA 3M6KA 4X4NA 4DSJA 1O03A 5KFRA 5J0QA 4OAGA 1XO1A 2EAOA 5C0YA 4KLSA 4OJPA 5KG7A 3B0XA 1Y88A 1X66A 1ZOLA 3OVBA 4UB8U 3RR8A 2C28A 3K7DA 3F2CA 3V7KA 2RP5A 4RPYA 3H37A 2LBOA 1NK6A 2FLPA 3K4GA 2KZZA 2VJ5A 1SKRA 8ICRA 3NKUA 4S3NA 1ZQ1C 5ALJA 4P0QA 2ZUCA 2YN4A 4MEXA 1TE2A 5AM5A 1T3NA 4WOYA 3D2SA 3RBDA 5IIJA 1J2NA 4KLUA 4WC5A 3HW8A 4QWEA 4Q44A 8ICTA 4WC0A 3H8JA 4OJOA 4DWIA 4KLOA 2G09A 3H40A 4LJXA 4M6WB 2F1IA 3THVA 5DG9A 4FHXA 1JROA 1YT3A 5EWEA 2ZH4A 3MR3A 4KTQA 2E5SA 4N7RA 2A19A 4I2EA 2WTFA 1TK8A 4ED7A 4OAIZ 1JALA 3MR5A 1NKCA 2R8KA 3FYHA 1D8BA 5KFGA 5L9XA 3B0YA 5KT2A 3WK9A 2KVSA 4C8OA 5HRBA 1Q78A 1KNYA 4XRHA 4DLGA 4ELVA 4U6PA 4O69A 2C2EA 3NVVA 4TUSA 1ZQBA 1HUOA 3PW7A 3RB0A 1B0XA 1SKWA 2ZTEA 5CFUA 5IINA 2F44A 4NV0A 4P4PA 4JV1A 5KFQA 3J81j 2G5IB 2H3IA 3H8SA 2RFFA 2ZH2A 4Q8FA 3SEIA 3QZ8A 4NL9A 2ZTCA 2W11A 3SYZA 1T94A 4BUGA 5ALUA 2M0NA 1S77D 1ZQKA 1JQRA 2ZXIA 1ZQRA 1N48A 1BPZA 1TFWA 5CJ7A 4AT7A 4F5RA 4UB5A 3RJFA 2R8IA 4EP7A 5DQHA 2J6SA 2YMLA 3TQ1A 1YZ7A 1NJZA 2YMQA 3TACB 4FH3A 2RDIA 5ALFA 5GTHU 4C8NA 4LEYA 3NUQA 4WBZA 2KOBA 2JH7A 3BS5B 2FI1A 3ONNA 4I2JA 2ZIVA 5KFEA 1KN5A 4FZNA 4DOAA 1Z4OA 2DRBA 2ZH6A 3AQNA 2QARA 1U45A 2G0AA 3ERCC 3A0BU 1A77A 4WC6A 2WB1F 4FHYA 3WK4A 1NK9A 4NM2A 3QNMA 4RQ4A 4F8RA 2F76X 4F91B 4RUCA 1IXRA 5HR7A 2AU0A 3KKAC 2NO5A 2K8CB 2MRLA 3NVZA 3FDSA 8ICVA 5AKGA 2QLTA 5ALPA 2F1JA 3OGUA 4ED2A 2BPGA 2DPJA 3NRWA 2JRZA 1NK8A 1QSLA 1BPXA 3AUOA 1PX5A 4LVSA 4Z6DA 2AGQA 2UVWA 4KX5A 3HKZC 5KFUA 1XSPA 3C18A 3PMLA 2ZH1A 5K4LA 5KFIA 8ICNA 1R89A 4IRDA 4KLJA 3TANA 4XUSA 4QZ8A 3BQTA 3OVSA 3RAXA 1ZQOA 4DQQA 3F5AA 4EEBA 2R8HA 1SWWA 4C4TA 1SV4A 3QU7A 3OSPA 2F1HA 4K9AA 3CYMA 3H39A 4GXKA 1Q79A 1WCLA 3V6HA 5DDMA 5ALHA 4YR2A 1N56A 2KE7A 4RNOA 4USAA 4YVZA 1KLNA 2ZUDA 2MU2A 1A76A 1SIJA 3BQ2A 2BE3A 4UATA 2C22A 3AQEA 2MUTB 3QEBZ 2V4RA 1TAQA 1X6IA 3F5EA 5KFDA 4EYIB 2RHFA 5F9NA 2DRAA 4FBUA 3NGDA 1L3UA 1KSPA 3PHZA 4G9BA 4WC3A 1QCKA 4PGXA 2ATLA 3ETRA 8ICYA 5EOZA 3ZD8A 2ZIXB 2GO7A 4I2AA 4IQVA 1QSYA 5ALSA 4F72A 2FJ6A 2C2RA 3QUTA 4O3MA 4CE6A 4AYBC 3V6JA 5ALKA 2G5HB 3HX0A 2F8KA 9ICTA 4Y2UA 2KZMA 3SV4A 5AI8A 2I9GA 3NWIA 3GZFA 4QNLA 3IG8A 4ZOHC 4US8A 3N7PD 2QARB 1YZ6A 2ZJ5A 3LYSA 3UMBA 3PZPA 4X4OA 1NKBA 4P0PB 4RNNA 4OAFA 2DR8A 4QWBA 3RFAA 4M0AA 1MC8A 4WCWA 1RXVA 4O3RA 5KG4A 3Q8QB 5CR0A 4ACOA 4G3IA 4QZIA 2ALZA 3G6YA 2A1JB 4U7CA 3TADC 4NWIA 2HOIA 9ICVA 1PVRA 5IIMA 3F2DA 5J2GA 1B4FA 1X42A 2A1JA 4QZDA 4JV0A 9ICSA 3M7DA 3GV7B 3M8RA 3PSTA 3RJHA 9ICWA 4BGDA 3GIJA 5HRLA 3PX6A 1MQ2A 4K96A 4R64A 2NV3A 4EENA 3GQCA 5IIKA 4FZMA 2Y9TA 2XIDA 4FHVA 8ICZA 2GH1A 4RPZA 2K4PA 1EXNA 5AI4A 2HN2A 4QIWF 3PMNA 3QEAZ 2LYAA 4JUZA 9ICXA 2QB0B 5DBCA 4B9NA 1UT8A 4IQWA 1ZQTA 3LDAA 3QX7A 1KTQA 4ELTA 2IOHA 4AT9A 2NRXA 1MIVA 4F5OA 3WKBA 5KT4A 2OXOA 7ICQA 4IR1A 4EZ6A 2W3SA 4O0IA 4MFAA 4X4SA 4ECTA 3UPQA 4GLXA 4I2BA 2JEFA 4AYBF 4R63A 5DECA 3UPSA 4QWAA 1J97A 5AM1A 2ZHAA 1BGXT 2BBHA 3UXNA 3PO5A 1X9SA 1ZQDA 4C8LA 2R8JA 4P0PA 9ICHA 8ICXA 1KFDA 4DOBA 9ICCA 5BOMA 4UW9A 2I6XA 2F8LA 2HHPA 1L7PA 3EPGA 1NKEA 3PV8A 2K4EA 1RQLA 1NZPA 9ICNA 1NK7A 2L5YA 2KKPA 3PR4A 3LVVA 1F5AA 3PSPA 4IC9A 1Z4NA 5ALZA 4EEKA 5BPCA 1UHUA 2V4QA 2D6FC 1IIPA 4ECWA 4O5CA 2XCPA 1NK5A 4Y2XA 8ICBA 3PVXA 4O68A 5AKJA 3AU6A 2D3DA 5CB1A 1JAJA 1U4BA 1MQ3A 9ICBA 5JTIA 2HN1A 1RG6A 3NVOA 3ZDDA 2OCEA 4K97A 2P6UA 3C23A 1WOTA 3PW0A 9ICEA 5KFYA 4XJEA 3GIIA 2Q66A 4UBBA 3E2EA 3LVWA 8ICSA 2VANA 2J6UA 3TAPA 3F53A 5KNIA 5KFCA 4RPXA 3Q8SB 1PVQA 4J9KA 2OWOA 5HMLA 1N61A 2BCSA 2F2AB 5L1IA 4NLGA 3WKDA 4F92B 4B9MA 4YD1A 3C28A 2R8GA 3JZ0A 3OHAA 4R66A 4BX9C 1IV8A 2DR7A 3HT3A 2JEJA 1N5XA 1XC9A 3C2MA 5D63A 2E8MA 1KQQA 4WC4A 4YQWA 7ICLA 4QZCA 2VIXA 5AK3A 3RJIA 4RQ7A 3Q8PB 2DF4B 4IG8A 2KJ8A 9ICUA 5ALYA 2YB1A 4MFFA 4OD0A 3RJJA 4P4OA 2W04A 4MF2A 4F4ZA 2ZHBA 2W54A 4UB6U 3WKEA 4RQNA 2KHVA 4Z6FA 4F4KA 4DEZA 2BPFA 3UM9A 7ICVA 4RWPA 2HHUA 2LI6A 2A1AA 4NKTA 2ZH7A 4O3OA 3TFRA 2FPKA 3ER8C 1V38A 3HKZF 2ASJA 5KFTA 3OVAA 3QUCA 2AGPA 4XQ7A 2WF6A 3TI0A 1N62A 4C7YA 4C4RA 1JXLA 2W9CB 2EAPA 3D2NA 5ALXA 3EW9A 4DFPA 3HJ1A 2ODGA 3ED5A 2B6GA 1S97A 2WF7A 9ICOA 4K9BA 2MUTA 4EBCA 2LYHA 4IRKA 1HEKA 5F3XB 1X9MA 2ASDA 4IL6U 4NM1A 2GA9D 7ICFA 3H8MA 5ALTA 9ICMA 4E0DA 4NXWA 2PKEA 2EQYA 2WB1C 2ZIVB 4ATBA 2FMSA 4X4UA 2LYBA 4ED3A 1L8LA 5DQIA 4ELUA 3JPTA 4DQSA 1GO3F 5J2CA 3Q8LA 3WKAA 1WWVA 1L7MA 2EZZA 3CNHA 8ICPA 1FA0A 4KB6A 4AP9A 3GV5B 4F4YA 5AM4A 2G08A 1KW4A 3OUYB 3Q8MA 3QU5A 4PL2A 4QW8A 2WHEA 2PMZC 5ALIA 4P0QB 5T14A 4UAVA 2CPRA 3RTVA 2HHVA 3IHQB 4QZHA 2G07A 4I29A 5KAFU 2BQRA 1BVSA 2NO4A 2PFOA 1ZJNA 1D9FA 1XU4A 2OEHA 1BNPA 8ICLA 2XY5A 3IM1A 5AKIA 1ZYQA 1KL9A 4Z6EA 2FPLA 2IHNA 4X4QA 4EBKA 3IP4B 2AJQA 8ICOA 4DFDA 4UD5A 4B9TA 4CF3A 4R65A 4AT7B 3MC1A 1DGJA 5HC9A 3PSIA 4AT9B 3BDPA 2CRXA 5AICA 5AM0A 5TZVA 4FBTA 1FFVA 3AM9A 3UMCA 5DB7A 2CXYA 5DB9A 5CFSA 4DL6A 1TV9A 3HJ4A 3AL0B 5J2KA 5J0TA 4KLMA 1VFGA 3FC4A 2B21A 5KFAA 5L1MA 3M8SA 1D8YA 8ICWA 1NJWA 4Y2JA 5AM3A 2FLNA 7ICKA 2HHXA 2DFLA 4KITB 3SI8A 2DR9A 8ICAA 3H0LB 3WFPA 4C0ZA 4K8VA 2YMMA 5B66U 3OSNA 5ALRA 5KFZA
chains in the Genus database with same CATH topology
3PR5B 4PGYA 3PNCA 4RNOA 2AQ0A 1S0NA 5KFLA 4YVZA 1KLNA 4K4GA 2ZUDA 1SL1A 4R8UA 1A76A 3BQ2A 1S0MA 5KFKA 2W8KA 2C22A 2BE3A 3ISDA 4QZEA 4J9NA 4NLNA 4RU9A 7ICMA 2MUTB 4FO6A 3AQMA 3QEBZ 9ICIA 4DSEA 2V4RA 1S0VA 1D9DA 1TAQA 4KN4A 5KFDA 7ICSA 2XC9A 4MF8A 4EYIB 4LT6A 5F9NA 2DRAA 4Q43A 2W9CA 2RDJA 4FBUA 4TQRA 3NTUA 3NGDA 4EBDA 1U48A 1L3UA 1KSPA 3C5GA 3MR2A 2PXIA 4F5PA 4IRCA 4QWDA 5DLGA 2W9MA 5DG8A 1MSWD 4PGXA 3MGIA 4WC3A 1B22A 2Y1JA 2IBKA 2ATLA 2ZHAA 4NKUA 8ICYA 2J6TA 5KFXA 5KFHA 4DL2A 4DSFA 5EOZA 4J9SA 4J9PA 2H5XA 1JX4A 4RQ6A 2JEGA 3ZDBA 3JPNA 3ZD8A 4KLLA 3M9MB 2NRTA 2W9BA 4I2AA 4IQVA 4ECYA 3N97B 1QSYA 4M47A 2MAXA 4PHPA 7ICGA 3T5HA 2Q0ZX 4DL3A 1S0OA 1NJXA 4NXZA 4B9VA 4LZDA 2ISOA 3T5KA 1ZQUA 7ICIA 5J2EA 2C2RA 1L5UA 4RWNA 4RWQA 4EBJA 1ZQIA 3V6JA 1CUKA 5BOLA 4IQTA 3HX0A 3KHGA 4BXOA 4M04A 1TAUA 9ICTA 3V72A 2KZMA 3SV4A 1HJPA 5KG1A 2I9GA 4Q45A 3H3AA 2BCQA 3MDAA 4M9JA 2UVRA 1TKDA 4BXOB 2M2WA 4KLEA 1Z00B 3EZ5A 1XS9D 4M9NA 5J0PA 4QZGA 1ZQHA 4RWOA 2ZJ5A 5HMMA 4ECUA 4X4OA 2ISPA 2M2UA 1NKBA 1B43A 4RNNA 3MR6A 4F4WA 1V9PA 5KG6A 4K4IA 2DR8A 4QWBA 1V4AA 4PH5A 4FS2A 4M0AA 3RH6A 4AT8B 1MC8A 4WCWA 1JMSA 1RXVA 4YG2A 4F5QA 4O3RA 5KG4A 3Q8QB 5CR0A 1X2IA 2BHNA 4I2GA 2DPIA 2DR5A 3QZ7A 3H4BA 1ZJMA 1UEVA 3V6KA 4G3IA 1BNOA 4QZIA 3C1ZA 2ALZA 8ICGA 3HIYA 3G6YA 3WFRE 1ZQZA 8ICFA 2A1JB 8ICUA 4P2HA 9ICVA 5IIMA 5KG5A 4KLDA 4E80A 5J2GA 2KP7A 4DS4A 2A1JA 4QZDA 8ICQA 8ICEA 4JV0A 9ICSA 4TQSA 4M6WA 4DQRA 3GV7B 3MBYA 3M8RA 4LZGA 4EBEA 2JZBB 3RJHA 9ICWA 1SL0A 2VA2A 4BGDA 3C5FA 3GIJA 4YP3A 4FHWA 3AU2A 3G6XA 2ASLA 4I27A 5HRLA 3PX6A 1MQ2A 4I2IA 5HNKA 2FLLA 4O9MA 4UB3A 5KFFA 4R64A 3Q8KA 3PW4A 1HUZA 3BQ1A 3KTQA 5J2BA 3T5JA 3EYZA 3GQCA 5IIKA 4X4RA 3JPPA 2HHTA 4F2RA 4FHVA 3OV7A 8ICZA 7ICPA 4RPZA 3RB4A 3H4DA 3M9OB 1EXNA 4UD4A 1L3SA 4I2FA 5L1LA 2IHMA 4CCHA 3PW2A 2AGOA 4DS5A 5J0YA 2XCAA 3L9DA 3PMNA 3C2LA 1JN3A 5DBBA 3QEAZ 3PY8A 2HW3A 3WFSC 7ICUA 4JUZA 1JIHA 4JWNA 9ICXA 3JPQA 5DBCA 4J9LA 2W8LA 4B9NA 4UAYA 4ECSA 1ZQFA 4B9LA 1UT8A 4IQWA 1MIWA 1UA1A 4X4VA 1ZQTA 3LDAA 4ELTA 1KTQA 3WFOA 4AT9A 3OUYA 2P66A 1WCNA 3TFSA 1BPBA 2NRXA 4ED8A 1ZQAA 1MIVA 4F5OA 9ICRA 5KT4A 4I2DA 2M2TA 3GIKA 3WFQE 1ZQCA 7ICHA 7ICQA 4KLQA 4ED6A 1QTMA 4YXJA 3N4MB 2JEIA 5HHIA 2Y1IA 4PHEA 4IR1A 5J0UA 2XY6A 4RT2A 1QLNA 3H8WA 4WBYA 4EZ6A 4DSLA 1ZQWA 4O0IA 1NOMA 2GWSA 5DDYA 4MFAA 4X4SA 4UAZA 5C5JA 4O5EA 4KLHA 4DL4A 4ECTA 5F2VO 3UPQA 1ZQMA 4GLXA 4I2BA 2JEFA 3EPIA 2BQUA 4R63A 3MGHA 4NY8A 4QWAA 9ICPA 5DECA 3UPSA 4IR9A 4E7XA 4YMOA 7ICNA 4DFMA 2PFNA 1BGXT 4C8MA 2M2VA 3UXNA 3UXOA 2XGQA 1TVAA 2UVVA 3C66A 4F93B 3MFHA 1RPLA 1PZNA 5J2DA 1X9SA 1ZQDA 3PO5A 4C8LA 4RQ1A 4J9OA 2BCUA 2R8JA 1BPEA 4ED0A 2V9WA 9ICHA 1KFDA 8ICXA 4DOBA 1ZQQA 9ICCA 3ORYA 4GC7A 2ZTDA 1RYRA 5BOMA 1L3TA 4RUAA 2BCRA 4DQPA 2HHPA 4B9SA 3EPGA 7ICJA 1NKEA 2XO7A 3PV8A 3RH4A 1SL2A 1C7YA 2PFPA 4J9QA 1SKSA 8ICHA 4DF8A 4I2HA 9ICNA 1NZPA 1NJYA 2ZH9A 2BKEA 5F9LA 1NK7A 2KN7A 3GDXA 2UVUA 1S10A 5HR9A 4I28A 8ICIA 3PR4A 3OJUA 5J2FA 1F5AA 2XGPA 4KLTA 4KMUA 3AQLA 4DFJA 5BPCA 4RQ8A 4HYKA 3QE9Y 4ATBB 1KEJA 1ZQNA 4JV2A 5KG3A 3UQ2A 2V4QA 3RH5A 5DB8A 3JPRA 8ICMA 5HRKA 5DBAA 1X9WA 1SZPA 1LV5A 4ECWA 4JWMA 2XCPA 4O5CA 3ISCA 1NK5A 3OJSA 8ICBA 3PVXA 4K4HA 3HWTA 2C2DA 1KFTA 4RNMA 7ICOA 3RRGA 3AU6A 8ICKA 1D8LA 5CB1A 5KFPA 1JAJA 4FS1A 1U4BA 1MQ3A 9ICBA 3RB6A 5DGAA 3GFKB 4TUPA 1UA0A 4YD2A 3AQKA 4R8UB 1ZQLA 3ZDDA 1AROP 2P6UA 5IILA 1XSLA 2P6RA 2BCVA 3C23A 1WOTA 5EWFA 3PW0A 4X4NA 4DSJA 4P4MA 4TURA 5KFRA 5J0QA 5J0XA 4O3SA 9ICEA 3JYYA 5KFYA 1XO1A 5J29A 5D49A 9ICLA 4ECQA 1LB2B 4KLSA 4UAWA 3GIIA 3PX0A 2Q66A 4UBBA 1UT5A 4I2CA 4RQ5A 3E2EA 8ICSA 2VANA 2J6UA 3TAPA 5KG7A 9ICAA 3B0XA 1Y88A 5HRDA 3OVBA 7ICEA 4M9GA 5KFCA 4RPXA 4QZBA 3Q8SB 4J9KA 4RQ0A 5HMLA 2OWOA 3RR8A 2C28A 2BCSA 5L1IA 3V7KA 5J2JA 4RPYA 2W9BB 4NLGA 3H37A 1NK6A 2FLPA 2I1QA 3K4GA 4M9LA 2KZZA 1TK5A 4F92B 1SKRA 8ICRA 1ZQJA 4B9MA 1DK2A 4YD1A 3PX4A 2R8GA 9ICKA 1R8AA 1UETA 1JXEA 4S3NA 3JZ0A 4UB1A 3OHAA 3RBEA 1YLQA 4R66A 4DFKA 3RJEA 1R8CA 3KHLA 3TARA 2ZUCA 1QSSA 3RJKA 4MEXA 2DR7A 1T3NA 3HT3A 4RT3A 2FMQA 2JEJA 4JK1A 3C2MA 3RBDA 1XC9A 5IIJA 2HHWA 4KLUA 4WC5A 3HW8A 4QWEA 1KFSA 5KG0A 5KFWA 4Q44A 4Q8EA 8ICTA 4WC0A 1TFYA 3H38A 3H8JA 1DK3A 4MEYA 4QZFA 4DWIA 1T7PA 4KLOA 4DSKA 4WC4A 1S76D 3H40A 3SV3A 5KT3A 4M6WB 4YQWA 7ICLA 1T4GA 5KFMA 5DG7A 2F1IA 4QZCA 4F2SA 4YXMA 3THVA 1NK4A 5EWGA 3OHBA 3RRHA 4DQIA 3RJIA 4RQ7A 5DG9A 4FHXA 2NRWA 3Q8PB 1ZQYA 4GXIA 1DOQA 3HP6A 9ICQA 5DEDA 1L3VA 4IG8A 5EWEA 4F5NA 2ZH4A 3MR3A 2KZ3A 4QZ9A 3RR7A 4KTQA 5IIIA 4YMMA 5DGBA 9ICUA 4F50A 5KFNA 4MFFA 3RJJA 3SZ2A 7ICRA 4RQ2A 4P4OA 3C1YA 2BQ3A 4I2EA 4X0BA 2WTFA 1TK8A 4MF2A 3MABA 4PGQA 4F4ZA 4ED7A 1K1SA 4FHPA 2ZHBA 4UQGA 2XY7A 3MR5A 3BQ0A 4DO9A 1NKCA 2R8KA 4EYHB 3FYHA 4KLGA 7ICTA 3KHRA 4Z6FA 5L9XA 3B0YA 5KFGA 4DEZA 2BPFA 4F4KA 7ICVA 5KT2A 4RWPA 2IMWP 3ZD9A 2HHUA 2FPMA 4ECZA 4C8OA 5HRBA 4YFKA 5J0WA 4NKTA 1Q78A 2ZH7A 1KNYA 4O3OA 4XRHA 2FPKA 3TFRA 4DLGA 1U49A 4ELVA 2BDPA 4XQ8A 3PW5A 2C2EA 1T8EA 2ASJA 2HVHA 5KFTA 1NO5A 9ICJA 3OVAA 2AGPA 4ECXA 3RJGA 3LQCB 4TUSA 5JUMA 4XQ7A 1ZQBA 1ZQSA 3GILA 3LWLA 5CA7A 3TI0A 1HUOA 3PW7A 1ZQPA 1NK0A 1JXLA 2W9CB 2O1PA 3EWAA 3RB0A 4O3NA 4QZAA 5HP4A 3EW9A 1SKWA 3RB3A 4DFPA 4PPXA 3HJ1A 5L1JA 4PHDA 1H38A 2ZTEA 4YCXA 1S97A 1S9FA 9ICOA 2MUTA 2LYHA 4EBCA 5IINA 3Q8RB 4P4PA 4IRKA 4JV1A 3BJYA 1X9MA 5KFQA 5DB6A 5J2AA 2ASDA 2AQ4A 2KFZA 4BWMA 2RFFA 3ETLA 3H8SA 4NM1A 2ZH2A 3LK9A 1TK0A 4Q8FA 3QZ8A 7ICFA 9ICMA 4WC1A 3V7JA 2ZTCA 4ECRA 3C21A 4UBCA 3SYZA 4FH5A 4X4PA 5KFOA 4E0DA 4GXJA 1RXWA 1ZQVA 5DKWA 1Z00A 4ECVA 2O5AA 4KLIA 4ED1A 3G6VA 4F3OA 3MDCA 1S77D 1MIYA 3PO4A 1ZQKA 1JQRA 4YR0A 1ZQRA 4B9UA 4ATBA 1N48A 2FMSA 1BPZA 4X4UA 4ED3A 5KT7A 4YMNA 5DQIA 1TFWA 4QW9A 4ELUA 3JPTA 4MFCA 4DQSA 4DF4A 5J2CA 3Q8LA 5CJ7A 4WC2A 9ICFA 4AT7A 1R8BA 2ZJAA 3ZDAA 4F5RA 9ICGA 1RYSA 5D4BA 4UB5A 3RJFA 2R8IA 8ICPA 5DQHA 4EP7A 2J6SA 1FA0A 2HHSA 2M9NA 3GV5B 3TQ1A 4YR3A 5DQGA 2PFQA 4F4YA 3K75D 4UB2A 5KG2A 3JPSA 5HRFA 1NJZA 2ID1A 4WC7A 4FH3A 3OUYB 1COOA 3KHHA 3Q8MA 2RDIA 3UQ0A 4C8NA 5IIOA 2ZH3A 4DOCA 4QW8A 4AT8A 1VJ7A 2KFNA 4WBZA 3GIMA 4J9RA 4O3QA 2W9AA 1ZETA 3LWMA 2HHQA 5KFBA 1DGSA 5L1KA 4M5DA 4I2JA 4X4TA 1U47A 1OU5A 3RTVA 2PI4A 5KFEA 2BPCA 3ZDEA 4X5VA 4DOAA 4J9MA 5HHHA 1ZQEA 2HHVA 2DRBA 2JZBA 3IHQB 4QZHA 3AQNA 1IM4A 1U45A 3JPOA 4RQ3A 2ZH6A 1A77A 5J0OA 4I29A 4WC6A 4TUQA 3M9NB 8ICJA 5KT6A 4E8FA 2BQRA 1BVSA 4DL7A 4FHYA 4Z6CA 1ZJNA 1D9FA 2PFOA 3ISBA 5KT5A 1XU4A 4NM2A 4EEYA 1NK9A 5KTQA 4DSIA 3UXPA 4RQ4A 4GC6A 4F8RA 1BNPA 5CP2A 4F91B 4RUCA 8ICLA 4KLFA 5DLFA 4M9HA 1IXRA 2XY5A 3HPOA 3IM1A 2AU0A 1ZYQA 5HREA 5KFJA 4Z6EA 2ZH5A 2FPLA 5D46A 3T5LA 2FMPA 4C8KA 4EZ9A 4F4XA 1BPYA 3OVSA 2IHNA 3FDSA 8ICVA 5HRGA 4DLEA 4X4QA 3V7LA 4EBKA 4M2YA 2AJQA 1XWLA 2F1JA 8ICOA 3OGUA 4ED2A 2HVIA 4UD5A 2BPGA 1U9LA 2VA8A 4B9TA 2DPJA 5HRHA 1NK8A 1QSLA 5J0RA 4R65A 1BPXA 3AUOA 4UB4A 4AT7B 1KRPA 2PBEA 2BR0A 2PI5A 1PX5A 4LVSA 2ZH8A 5HC9A 5CHGA 4Z6DA 2AGQA 2ZJ8A 1BPDA 2UVWA 3MFIA 3BDPA 4NLZA 4AT9B 1Z3EB 1RZTA 1CEZA 1ZQXA 4BWJA 5KFSA 5KFUA 5TZVA 1XSPA 3ZDCA 4FBTA 3C18A 4XA5A 5J0SA 3PMLA 2ZH1A 2BGWA 4BDPA 5KFIA 4YN4A 5DB7A 5J2HA 8ICNA 2ZUBA 5CWRA 1R89A 4RZRA 4IRDA 4KLJA 5DB9A 2NRVA 1TFRA 4O3PA 4DL6A 1TV9A 3TANA 4O5KA 3HJ4A 4X0AA 4XUSA 1KDHA 4PHAA 4QWCA 3T3FA 2IA6A 5J2KA 5J0TA 2VA3A 4KLMA 1VFGA 2B21A 4QZ8A 3BQTA 5KFAA 1K1QA 3M8SA 3RAXA 1D8YA 1ZQOA 1UEUA 4NLKA 2KTQA 4DQQA 8ICWA 4KN7A 1NJWA 4ZH4A 3RAQA 5HRIA 4IQUA 2R8HA 2FLNA 7ICKA 3H7IA 2HHXA 2DVIA 2DFLA 1ZQGA 4KITB 3SI8A 2NRKA 2DR9A 8ICAA 2NRZA 3OSPA 3C2KA 3NYBA 2F1HA 4DL5A 3WFPA 3H39A 8ICCA 4GXKA 1Q79A 1WCLA 3V6HA 5KFVA 5DDMA 3OSNA 3GV8B 1XSNA 5J2IA 5KFZA 4YR2A 3TAQA 1N56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PR5 B;  4PGY A;  3PNC A;  4RNO A;  2AQ0 A;  1S0N A;  5KFL A;  4YVZ A;  1KLN A;  4K4G A;  2ZUD A;  1SL1 A;  4R8U A;  1A76 A;  3BQ2 A;  1S0M A;  5KFK A;  2W8K A;  2C22 A;  2BE3 A;  3ISD A;  4QZE A;  4J9N A;  4NLN A;  4RU9 A;  7ICM A;  2MUT B;  4FO6 A;  3AQM A;  3QEB Z;  9ICI A;  4DSE A;  2V4R A;  1S0V A;  1D9D A;  1TAQ A;  4KN4 A;  5KFD A;  7ICS A;  2XC9 A;  4MF8 A;  4EYI B;  4LT6 A;  5F9N A;  2DRA A;  4Q43 A;  2W9C A;  2RDJ A;  4FBU A;  4TQR A;  3NTU A;  3NGD A;  4EBD A;  1U48 A;  1L3U A;  1KSP A;  3C5G A;  3MR2 A;  2PXI A;  4F5P A;  4IRC A;  4QWD A;  5DLG A;  2W9M A;  5DG8 A;  1MSW D;  4PGX A;  3MGI A;  4WC3 A;  1B22 A;  2Y1J A;  2IBK A;  2ATL A;  2ZHA A;  4NKU A;  8ICY A;  2J6T A;  5KFX A;  5KFH A;  4DL2 A;  4DSF A;  5EOZ A;  4J9S A;  4J9P A;  2H5X A;  1JX4 A;  4RQ6 A;  2JEG A;  3ZDB A;  3JPN A;  3ZD8 A;  4KLL A;  3M9M B;  2NRT A;  2W9B A;  4I2A A;  4IQV A;  4ECY A;  3N97 B;  1QSY A;  4M47 A;  2MAX A;  4PHP A;  7ICG A;  3T5H A;  2Q0Z X;  4DL3 A;  1S0O A;  1NJX A;  4NXZ A;  4B9V A;  4LZD A;  2ISO A;  3T5K A;  1ZQU A;  7ICI A;  5J2E A;  2C2R A;  1L5U A;  4RWN A;  4RWQ A;  4EBJ A;  1ZQI A;  3V6J A;  1CUK A;  5BOL A;  4IQT A;  3HX0 A;  3KHG A;  4BXO A;  4M04 A;  1TAU A;  9ICT A;  3V72 A;  2KZM A;  3SV4 A;  1HJP A;  5KG1 A;  2I9G A;  4Q45 A;  3H3A A;  2BCQ A;  3MDA A;  4M9J A;  2UVR A;  1TKD A;  4BXO B;  2M2W A;  4KLE A;  1Z00 B;  3EZ5 A;  1XS9 D;  4M9N A;  5J0P A;  4QZG A;  1ZQH A;  4RWO A;  2ZJ5 A;  5HMM A;  4ECU A;  4X4O A;  2ISP A;  2M2U A;  1NKB A;  1B43 A;  4RNN A;  3MR6 A;  4F4W A;  1V9P A;  5KG6 A;  4K4I A;  2DR8 A;  4QWB A;  1V4A A;  4PH5 A;  4FS2 A;  4M0A A;  3RH6 A;  4AT8 B;  1MC8 A;  4WCW A;  1JMS A;  1RXV A;  4YG2 A;  4F5Q A;  4O3R A;  5KG4 A;  3Q8Q B;  5CR0 A;  1X2I A;  2BHN A;  4I2G A;  2DPI A;  2DR5 A;  3QZ7 A;  3H4B A;  1ZJM A;  1UEV A;  3V6K A;  4G3I A;  1BNO A;  4QZI A;  3C1Z A;  2ALZ A;  8ICG A;  3HIY A;  3G6Y A;  3WFR E;  1ZQZ A;  8ICF A;  2A1J B;  8ICU A;  4P2H A;  9ICV A;  5IIM A;  5KG5 A;  4KLD A;  4E80 A;  5J2G A;  2KP7 A;  4DS4 A;  2A1J A;  4QZD A;  8ICQ A;  8ICE A;  4JV0 A;  9ICS A;  4TQS A;  4M6W A;  4DQR A;  3GV7 B;  3MBY A;  3M8R A;  4LZG A;  4EBE A;  2JZB B;  3RJH A;  9ICW A;  1SL0 A;  2VA2 A;  4BGD A;  3C5F A;  3GIJ A;  4YP3 A;  4FHW A;  3AU2 A;  3G6X A;  2ASL A;  4I27 A;  5HRL A;  3PX6 A;  1MQ2 A;  4I2I A;  5HNK A;  2FLL A;  4O9M A;  4UB3 A;  5KFF A;  4R64 A;  3Q8K A;  3PW4 A;  1HUZ A;  3BQ1 A;  3KTQ A;  5J2B A;  3T5J A;  3EYZ A;  3GQC A;  5IIK A;  4X4R A;  3JPP A;  2HHT A;  4F2R A;  4FHV A;  3OV7 A;  8ICZ A;  7ICP A;  4RPZ A;  3RB4 A;  3H4D A;  3M9O B;  1EXN A;  4UD4 A;  1L3S A;  4I2F A;  5L1L A;  2IHM A;  4CCH A;  3PW2 A;  2AGO A;  4DS5 A;  5J0Y A;  2XCA A;  3L9D A;  3PMN A;  3C2L A;  1JN3 A;  5DBB A;  3QEA Z;  3PY8 A;  2HW3 A;  3WFS C;  7ICU A;  4JUZ A;  1JIH A;  4JWN A;  9ICX A;  3JPQ A;  5DBC A;  4J9L A;  2W8L A;  4B9N A;  4UAY A;  4ECS A;  1ZQF A;  4B9L A;  1UT8 A;  4IQW A;  1MIW A;  1UA1 A;  4X4V A;  1ZQT A;  3LDA A;  4ELT A;  1KTQ A;  3WFO A;  4AT9 A;  3OUY A;  2P66 A;  1WCN A;  3TFS A;  1BPB A;  2NRX A;  4ED8 A;  1ZQA A;  1MIV A;  4F5O A;  9ICR A;  5KT4 A;  4I2D A;  2M2T A;  3GIK A;  3WFQ E;  1ZQC A;  7ICH A;  7ICQ A;  4KLQ A;  4ED6 A;  1QTM A;  4YXJ A;  3N4M B;  2JEI A;  5HHI A;  2Y1I A;  4PHE A;  4IR1 A;  5J0U A;  2XY6 A;  4RT2 A;  1QLN A;  3H8W A;  4WBY A;  4EZ6 A;  4DSL A;  1ZQW A;  4O0I A;  1NOM A;  2GWS A;  5DDY A;  4MFA A;  4X4S A;  4UAZ A;  5C5J A;  4O5E A;  4KLH A;  4DL4 A;  4ECT A;  5F2V O;  3UPQ A;  1ZQM A;  4GLX A;  4I2B A;  2JEF A;  3EPI A;  2BQU A;  4R63 A;  3MGH A;  4NY8 A;  4QWA A;  9ICP A;  5DEC A;  3UPS A;  4IR9 A;  4E7X A;  4YMO A;  7ICN A;  4DFM A;  2PFN A;  1BGX T;  4C8M A;  2M2V A;  3UXN A;  3UXO A;  2XGQ A;  1TVA A;  2UVV A;  3C66 A;  4F93 B;  3MFH A;  1RPL A;  1PZN A;  5J2D A;  1X9S A;  1ZQD A;  3PO5 A;  4C8L A;  4RQ1 A;  4J9O A;  2BCU A;  2R8J A;  1BPE A;  4ED0 A;  2V9W A;  9ICH A;  1KFD A;  8ICX A;  4DOB A;  1ZQQ A;  9ICC A;  3ORY A;  4GC7 A;  2ZTD A;  1RYR A;  5BOM A;  1L3T A;  4RUA A;  2BCR A;  4DQP A;  2HHP A;  4B9S A;  3EPG A;  7ICJ A;  1NKE A;  2XO7 A;  3PV8 A;  3RH4 A;  1SL2 A;  1C7Y A;  2PFP A;  4J9Q A;  1SKS A;  8ICH A;  4DF8 A;  4I2H A;  9ICN A;  1NZP A;  1NJY A;  2ZH9 A;  2BKE A;  5F9L A;  1NK7 A;  2KN7 A;  3GDX A;  2UVU A;  1S10 A;  5HR9 A;  4I28 A;  8ICI A;  3PR4 A;  3OJU A;  5J2F A;  1F5A A;  2XGP A;  4KLT A;  4KMU A;  3AQL A;  4DFJ A;  5BPC A;  4RQ8 A;  4HYK A;  3QE9 Y;  4ATB B;  1KEJ A;  1ZQN A;  4JV2 A;  5KG3 A;  3UQ2 A;  2V4Q A;  3RH5 A;  5DB8 A;  3JPR A;  8ICM A;  5HRK A;  5DBA A;  1X9W A;  1SZP A;  1LV5 A;  4ECW A;  4JWM A;  2XCP A;  4O5C A;  3ISC A;  1NK5 A;  3OJS A;  8ICB A;  3PVX A;  4K4H A;  3HWT A;  2C2D A;  1KFT A;  4RNM A;  7ICO A;  3RRG A;  3AU6 A;  8ICK A;  1D8L A;  5CB1 A;  5KFP A;  1JAJ A;  4FS1 A;  1U4B A;  1MQ3 A;  9ICB A;  3RB6 A;  5DGA A;  3GFK B;  4TUP A;  1UA0 A;  4YD2 A;  3AQK A;  4R8U B;  1ZQL A;  3ZDD A;  1ARO P;  2P6U A;  5IIL A;  1XSL A;  2P6R A;  2BCV A;  3C23 A;  1WOT A;  5EWF A;  3PW0 A;  4X4N A;  4DSJ A;  4P4M A;  4TUR A;  5KFR A;  5J0Q A;  5J0X A;  4O3S A;  9ICE A;  3JYY A;  5KFY A;  1XO1 A;  5J29 A;  5D49 A;  9ICL A;  4ECQ A;  1LB2 B;  4KLS A;  4UAW A;  3GII A;  3PX0 A;  2Q66 A;  4UBB A;  1UT5 A;  4I2C A;  4RQ5 A;  3E2E A;  8ICS A;  2VAN A;  2J6U A;  3TAP A;  5KG7 A;  9ICA A;  3B0X A;  1Y88 A;  5HRD A;  3OVB A;  7ICE A;  4M9G A;  5KFC A;  4RPX A;  4QZB A;  3Q8S B;  4J9K A;  4RQ0 A;  5HML A;  2OWO A;  3RR8 A;  2C28 A;  2BCS A;  5L1I A;  3V7K A;  5J2J A;  4RPY A;  2W9B B;  4NLG A;  3H37 A;  1NK6 A;  2FLP A;  2I1Q A;  3K4G A;  4M9L A;  2KZZ A;  1TK5 A;  4F92 B;  1SKR A;  8ICR A;  1ZQJ A;  4B9M A;  1DK2 A;  4YD1 A;  3PX4 A;  2R8G A;  9ICK A;  1R8A A;  1UET A;  1JXE A;  4S3N A;  3JZ0 A;  4UB1 A;  3OHA A;  3RBE A;  1YLQ A;  4R66 A;  4DFK A;  3RJE A;  1R8C A;  3KHL A;  3TAR A;  2ZUC A;  1QSS A;  3RJK A;  4MEX A;  2DR7 A;  1T3N A;  3HT3 A;  4RT3 A;  2FMQ A;  2JEJ A;  4JK1 A;  3C2M A;  3RBD A;  1XC9 A;  5IIJ A;  2HHW A;  4KLU A;  4WC5 A;  3HW8 A;  4QWE A;  1KFS A;  5KG0 A;  5KFW A;  4Q44 A;  4Q8E A;  8ICT A;  4WC0 A;  1TFY A;  3H38 A;  3H8J A;  1DK3 A;  4MEY A;  4QZF A;  4DWI A;  1T7P A;  4KLO A;  4DSK A;  4WC4 A;  1S76 D;  3H40 A;  3SV3 A;  5KT3 A;  4M6W B;  4YQW A;  7ICL A;  1T4G A;  5KFM A;  5DG7 A;  2F1I A;  4QZC A;  4F2S A;  4YXM A;  3THV A;  1NK4 A;  5EWG A;  3OHB A;  3RRH A;  4DQI A;  3RJI A;  4RQ7 A;  5DG9 A;  4FHX A;  2NRW A;  3Q8P B;  1ZQY A;  4GXI A;  1DOQ A;  3HP6 A;  9ICQ A;  5DED A;  1L3V A;  4IG8 A;  5EWE A;  4F5N A;  2ZH4 A;  3MR3 A;  2KZ3 A;  4QZ9 A;  3RR7 A;  4KTQ A;  5III A;  4YMM A;  5DGB A;  9ICU A;  4F50 A;  5KFN A;  4MFF A;  3RJJ A;  3SZ2 A;  7ICR A;  4RQ2 A;  4P4O A;  3C1Y A;  2BQ3 A;  4I2E A;  4X0B A;  2WTF A;  1TK8 A;  4MF2 A;  3MAB A;  4PGQ A;  4F4Z A;  4ED7 A;  1K1S A;  4FHP A;  2ZHB A;  4UQG A;  2XY7 A;  3MR5 A;  3BQ0 A;  4DO9 A;  1NKC A;  2R8K A;  4EYH B;  3FYH A;  4KLG A;  7ICT A;  3KHR A;  4Z6F A;  5L9X A;  3B0Y A;  5KFG A;  4DEZ A;  2BPF A;  4F4K A;  7ICV A;  5KT2 A;  4RWP A;  2IMW P;  3ZD9 A;  2HHU A;  2FPM A;  4ECZ A;  4C8O A;  5HRB A;  4YFK A;  5J0W A;  4NKT A;  1Q78 A;  2ZH7 A;  1KNY A;  4O3O A;  4XRH A;  2FPK A;  3TFR A;  4DLG A;  1U49 A;  4ELV A;  2BDP A;  4XQ8 A;  3PW5 A;  2C2E A;  1T8E A;  2ASJ A;  2HVH A;  5KFT A;  1NO5 A;  9ICJ A;  3OVA A;  2AGP A;  4ECX A;  3RJG A;  3LQC B;  4TUS A;  5JUM A;  4XQ7 A;  1ZQB A;  1ZQS A;  3GIL A;  3LWL A;  5CA7 A;  3TI0 A;  1HUO A;  3PW7 A;  1ZQP A;  1NK0 A;  1JXL A;  2W9C B;  2O1P A;  3EWA A;  3RB0 A;  4O3N A;  4QZA A;  5HP4 A;  3EW9 A;  1SKW A;  3RB3 A;  4DFP A;  4PPX A;  3HJ1 A;  5L1J A;  4PHD A;  1H38 A;  2ZTE A;  4YCX A;  1S97 A;  1S9F A;  9ICO A;  2MUT A;  2LYH A;  4EBC A;  5IIN A;  3Q8R B;  4P4P A;  4IRK A;  4JV1 A;  3BJY A;  1X9M A;  5KFQ A;  5DB6 A;  5J2A A;  2ASD A;  2AQ4 A;  2KFZ A;  4BWM A;  2RFF A;  3ETL A;  3H8S A;  4NM1 A;  2ZH2 A;  3LK9 A;  1TK0 A;  4Q8F A;  3QZ8 A;  7ICF A;  9ICM A;  4WC1 A;  3V7J A;  2ZTC A;  4ECR A;  3C21 A;  4UBC A;  3SYZ A;  4FH5 A;  4X4P A;  5KFO A;  4E0D A;  4GXJ A;  1RXW A;  1ZQV A;  5DKW A;  1Z00 A;  4ECV A;  2O5A A;  4KLI A;  4ED1 A;  3G6V A;  4F3O A;  3MDC A;  1S77 D;  1MIY A;  3PO4 A;  1ZQK A;  1JQR A;  4YR0 A;  1ZQR A;  4B9U A;  4ATB A;  1N48 A;  2FMS A;  1BPZ A;  4X4U A;  4ED3 A;  5KT7 A;  4YMN A;  5DQI A;  1TFW A;  4QW9 A;  4ELU A;  3JPT A;  4MFC A;  4DQS A;  4DF4 A;  5J2C A;  3Q8L A;  5CJ7 A;  4WC2 A;  9ICF A;  4AT7 A;  1R8B A;  2ZJA A;  3ZDA A;  4F5R A;  9ICG A;  1RYS A;  5D4B A;  4UB5 A;  3RJF A;  2R8I A;  8ICP A;  5DQH A;  4EP7 A;  2J6S A;  1FA0 A;  2HHS A;  2M9N A;  3GV5 B;  3TQ1 A;  4YR3 A;  5DQG A;  2PFQ A;  4F4Y A;  3K75 D;  4UB2 A;  5KG2 A;  3JPS A;  5HRF A;  1NJZ A;  2ID1 A;  4WC7 A;  4FH3 A;  3OUY B;  1COO A;  3KHH A;  3Q8M A;  2RDI A;  3UQ0 A;  4C8N A;  5IIO A;  2ZH3 A;  4DOC A;  4QW8 A;  4AT8 A;  1VJ7 A;  2KFN A;  4WBZ A;  3GIM A;  4J9R A;  4O3Q A;  2W9A A;  1ZET A;  3LWM A;  2HHQ A;  5KFB A;  1DGS A;  5L1K A;  4M5D A;  4I2J A;  4X4T A;  1U47 A;  1OU5 A;  3RTV A;  2PI4 A;  5KFE A;  2BPC A;  3ZDE A;  4X5V A;  4DOA A;  4J9M A;  5HHH A;  1ZQE A;  2HHV A;  2DRB A;  2JZB A;  3IHQ B;  4QZH A;  3AQN A;  1IM4 A;  1U45 A;  3JPO A;  4RQ3 A;  2ZH6 A;  1A77 A;  5J0O A;  4I29 A;  4WC6 A;  4TUQ A;  3M9N B;  8ICJ A;  5KT6 A;  4E8F A;  2BQR A;  1BVS A;  4DL7 A;  4FHY A;  4Z6C A;  1ZJN A;  1D9F A;  2PFO A;  3ISB A;  5KT5 A;  1XU4 A;  4NM2 A;  4EEY A;  1NK9 A;  5KTQ A;  4DSI A;  3UXP A;  4RQ4 A;  4GC6 A;  4F8R A;  1BNP A;  5CP2 A;  4F91 B;  4RUC A;  8ICL A;  4KLF A;  5DLF A;  4M9H A;  1IXR A;  2XY5 A;  3HPO A;  3IM1 A;  2AU0 A;  1ZYQ A;  5HRE A;  5KFJ A;  4Z6E A;  2ZH5 A;  2FPL A;  5D46 A;  3T5L A;  2FMP A;  4C8K A;  4EZ9 A;  4F4X A;  1BPY A;  3OVS A;  2IHN A;  3FDS A;  8ICV A;  5HRG A;  4DLE A;  4X4Q A;  3V7L A;  4EBK A;  4M2Y A;  2AJQ A;  1XWL A;  2F1J A;  8ICO A;  3OGU A;  4ED2 A;  2HVI A;  4UD5 A;  2BPG A;  1U9L A;  2VA8 A;  4B9T A;  2DPJ A;  5HRH A;  1NK8 A;  1QSL A;  5J0R A;  4R65 A;  1BPX A;  3AUO A;  4UB4 A;  4AT7 B;  1KRP A;  2PBE A;  2BR0 A;  2PI5 A;  1PX5 A;  4LVS A;  2ZH8 A;  5HC9 A;  5CHG A;  4Z6D A;  2AGQ A;  2ZJ8 A;  1BPD A;  2UVW A;  3MFI A;  3BDP A;  4NLZ A;  4AT9 B;  1Z3E B;  1RZT A;  1CEZ A;  1ZQX A;  4BWJ A;  5KFS A;  5KFU A;  5TZV A;  1XSP A;  3ZDC A;  4FBT A;  3C18 A;  4XA5 A;  5J0S A;  3PML A;  2ZH1 A;  2BGW A;  4BDP A;  5KFI A;  4YN4 A;  5DB7 A;  5J2H A;  8ICN A;  2ZUB A;  5CWR A;  1R89 A;  4RZR A;  4IRD A;  4KLJ A;  5DB9 A;  2NRV A;  1TFR A;  4O3P A;  4DL6 A;  1TV9 A;  3TAN A;  4O5K A;  3HJ4 A;  4X0A A;  4XUS A;  1KDH A;  4PHA A;  4QWC A;  3T3F A;  2IA6 A;  5J2K A;  5J0T A;  2VA3 A;  4KLM A;  1VFG A;  2B21 A;  4QZ8 A;  3BQT A;  5KFA A;  1K1Q A;  3M8S A;  3RAX A;  1D8Y A;  1ZQO A;  1UEU A;  4NLK A;  2KTQ A;  4DQQ A;  8ICW A;  4KN7 A;  1NJW A;  4ZH4 A;  3RAQ A;  5HRI A;  4IQU A;  2R8H A;  2FLN A;  7ICK A;  3H7I A;  2HHX A;  2DVI A;  2DFL A;  1ZQG A;  4KIT B;  3SI8 A;  2NRK A;  2DR9 A;  8ICA A;  2NRZ A;  3OSP A;  3C2K A;  3NYB A;  2F1H A;  4DL5 A;  3WFP A;  3H39 A;  8ICC A;  4GXK A;  1Q79 A;  1WCL A;  3V6H A;  5KFV A;  5DDM A;  3OSN A;  3GV8 B;  1XSN A;  5J2I A;  5KFZ A;  4YR2 A;  3TAQ A;  1N56 A; 
#chains in the Genus database with same CATH topology
 3PNC A;  2AQ0 A;  2BDU A;  1SL1 A;  2E8O A;  2JGA A;  4QZE A;  3AQM A;  9ICI A;  4DSE A;  5CRX A;  3NS1 A;  5ALW A;  3AEV A;  2XC9 A;  4LT6 A;  2W9C A;  3E58 A;  4TQR A;  3NTU A;  4EBD A;  1U48 A;  2IOF K;  4IRC A;  2LKY A;  5DLG A;  5DG8 A;  3MGI A;  2FE9 A;  2IBK A;  4NKU A;  4DL2 A;  4J03 A;  5AK6 A;  4OJ6 A;  3WK5 A;  5EE9 A;  3M9M B;  2NRT A;  3WK6 A;  4ECY A;  7ICG A;  1QH9 A;  2XIC A;  1SV0 A;  3KKA A;  1NJX A;  4NXZ A;  4B9V A;  2KIV A;  3T5K A;  5J2E A;  4RWQ A;  4EBJ A;  3KHG A;  1F0M A;  4NL9 C;  3V72 A;  1XO0 A;  2WAQ F;  5AKX A;  3H3A A;  5ALM A;  4GFJ A;  2UVR A;  4M9J A;  1TKD A;  4KLE A;  4NJ8 A;  1XS9 D;  2DUY A;  1MA7 A;  2WF9 A;  1A0P A;  4ECU A;  2ISP A;  2M2U A;  1RM6 C;  5KG6 A;  4FS2 A;  3RH6 A;  4JLX A;  4YG2 A;  4FFD A;  4F5Q A;  1GPJ A;  2NYV A;  2DR5 A;  2EZX A;  1ZJM A;  1UEV A;  3V6K A;  5AKY A;  2IOF A;  3TAD A;  3HIY A;  1LKY B;  1L6N A;  4FO1 A;  5KG5 A;  4E80 A;  2HSZ A;  2KNJ A;  4DS4 A;  3IN5 A;  8ICQ A;  8ICE A;  2KMD A;  4TQS A;  1HIW A;  4M6W A;  1QQ7 A;  4PZO A;  4LZG A;  2EAM A;  1SL0 A;  2VA2 A;  3C5F A;  3AU2 A;  3G6X A;  4I27 A;  2E8P A;  4I2I A;  3NVY A;  5KFF A;  4UB3 A;  4LEZ A;  2HHT A;  1VJ5 A;  2H3Z A;  3RB4 A;  1L3S A;  2IHM A;  1N60 A;  4CGZ A;  4DS5 A;  2XCA A;  3L9D A;  3C2L A;  3PY8 A;  3OTQ A;  1LVH A;  2ZIX A;  4OAH A;  1JIH A;  3JPQ A;  2OH2 A;  2W8L A;  1J2M A;  1Q3U A;  3D6J A;  1UA1 A;  3WK8 A;  3QUB A;  2P66 A;  3TFS A;  1K5O A;  2M2T A;  3GIK A;  2WF8 A;  4KLQ A;  1QTM A;  4YXJ A;  3QU2 A;  2Y1I A;  1PK1 B;  4MKP A;  3H8W A;  4WBY A;  3IV6 A;  1RQN A;  1NOM A;  2GWS A;  1Z19 A;  4KLH A;  3L4P A;  5FP0 A;  1ZQM A;  3TKA A;  3EPI A;  2LPE A;  5KL1 B;  7ICN A;  1TVA A;  2XGQ A;  3MFH A;  1BPE A;  4ED0 A;  2V9W A;  4QIW C;  3AN1 A;  1L3T A;  4DQP A;  4B9S A;  3IRU A;  1SL2 A;  4DF8 A;  4I2H A;  4I0U A;  1Q8K A;  1DXS A;  2BKE A;  2EDU A;  2JV3 A;  2KN7 A;  5HR9 A;  5A0L A;  1M6Y A;  2XGP A;  4DFJ A;  4RQ8 A;  4ATB B;  1KEJ A;  8ICM A;  5HRK A;  5KG3 A;  2QB0 A;  3UQ2 A;  5DB8 A;  3JPR A;  2IUB A;  3QXG A;  3EUB 2;  4K4H A;  3HWT A;  2I5H A;  7ICO A;  4CNQ A;  8ICK A;  1D8L A;  4FS1 A;  1SB3 C;  3GFK B;  4TUP A;  1UA0 A;  1IG6 A;  3JCF A;  5G5G A;  3KBB A;  1ZD2 P;  1ARO P;  5IIL A;  2P6R A;  1XSL A;  4NXV A;  1KBU A;  4JLZ A;  5J0X A;  4O3S A;  3JYY A;  1UPH A;  5J29 A;  2AXT U;  4ECQ A;  2LM1 A;  4RQM A;  1UT5 A;  4I2C A;  9ICA A;  2KV2 A;  3SAG A;  1DRG A;  5HRD A;  3AQF A;  3FAH A;  4QZB A;  1F5S A;  2W9B B;  1ZD4 A;  5AKK A;  1ZQJ A;  3PX4 A;  4O67 A;  3C29 A;  1CRX A;  1T3Q A;  1YLQ A;  3RJE A;  4WQL A;  3I28 A;  1R8C A;  3KHL A;  3TAR A;  1QSS A;  3RJK A;  1ZRM A;  4RT3 A;  4JK1 A;  1JRP A;  1KFS A;  5KG0 A;  4Q8E A;  1TFY A;  3QU4 A;  5ALL A;  1DK3 A;  4QZF A;  4DSK A;  2KSO A;  2Q4T A;  5KT3 A;  1PVP A;  4LEV A;  3SAF A;  1X6J A;  4YXM A;  1NK4 A;  5EWG A;  3OHB A;  5G5H A;  1ZQY A;  4B6J A;  1DOQ A;  3HP6 A;  4GXI A;  3ALR A;  2LHT A;  1SV0 C;  1L3V A;  5DED A;  2W03 A;  4F5N A;  2KZ3 A;  4QZ9 A;  4C4S A;  4YMM A;  1Q46 A;  5KFN A;  3SZ2 A;  3C1Y A;  2BQ3 A;  4X0B A;  2ZIU B;  2A3V A;  1PK1 A;  1WUD A;  4UQG A;  3BQ0 A;  3DDH A;  4DO9 A;  4EYH B;  7ICT A;  2HDO A;  2ZIU A;  3KHR A;  1FEZ A;  2IMW P;  3ZD9 A;  2FPM A;  3KZI U;  4YFK A;  5CHE A;  4DCC A;  3PW5 A;  1T8E A;  3QUQ A;  1P7D A;  2EWR A;  4ECX A;  3RJG A;  3LQC B;  5CA7 A;  1ZQP A;  2GLE A;  4BJQ A;  1NK0 A;  4EEL A;  4EV6 A;  2O1P A;  5HP4 A;  4QZA A;  2HBJ A;  5AI6 A;  3RB3 A;  4PHD A;  1AQ6 A;  4YCX A;  3Q8R B;  3BJY A;  2KFZ A;  5J2A A;  2RRD A;  2BBJ A;  4Y2V A;  4WC1 A;  3V7J A;  4ECR A;  4X4P A;  1JUD A;  3OPX A;  5KFO A;  4NLB A;  2CN1 A;  4ECV A;  2O5A A;  4KLI A;  4ED1 A;  2HI0 A;  3G6V A;  1MIY A;  3PO4 A;  4B9U A;  2B56 A;  4US9 A;  5KT7 A;  4MFC A;  2QKQ A;  4WC2 A;  9ICF A;  2JHD A;  2ZJA A;  9ICG A;  3BZK A;  2WF5 A;  5D4B A;  4OO1 J;  3OWG A;  1RDF A;  2G06 A;  3H0M B;  5EE1 A;  5DQG A;  5HRF A;  3JPS A;  5KG2 A;  5ALV A;  2ID1 A;  4WC7 A;  1V97 A;  1COO A;  3KHH A;  2MA1 A;  5AKE A;  3UQ0 A;  2ZH3 A;  4DOC A;  4AT8 A;  1VJ7 A;  4J9R A;  2HHQ A;  2W9A A;  1ZET A;  2DGZ A;  4IS7 A;  5KFB A;  4X4T A;  1OU5 A;  2E1E A;  2PI4 A;  3ZDE A;  2HBL A;  4X5V A;  4UAU A;  1S5L U;  2IHO A;  3L3F X;  2ESE A;  1IM4 A;  3JPO A;  4RQ3 A;  5J0O A;  5EE0 A;  8ICJ A;  4DL7 A;  4HAI A;  3H0R B;  3ISB A;  4EEY A;  3CP8 A;  4KX3 A;  3UXP A;  3VC8 A;  2OHF A;  4M9H A;  3N7R C;  5HRE A;  5KFJ A;  5D46 A;  3T5L A;  2FMP A;  4F4X A;  1BPY A;  4DLE A;  3V7L A;  3B9J A;  1XWL A;  2HVI A;  1U9L A;  5HRH A;  2EZY A;  4LEW A;  1KRP A;  2BR0 A;  5CHG A;  2DKX A;  1BPD A;  1Z1B A;  1CEZ A;  4BWJ A;  2Z7J A;  5J0S A;  2BGW A;  4YN4 A;  4Y2Y A;  3BS7 A;  4RZR A;  2JXJ A;  2NRV A;  1TFR A;  2KK0 A;  3UMG A;  3T79 A;  1FO4 A;  2N1R A;  4PHA A;  4QWC A;  3T3F A;  2IA6 A;  4MHV A;  2RLT A;  2PMZ F;  4KN7 A;  5EE3 A;  1ZQG A;  3D2Q A;  2NRZ A;  3NYB A;  5AI9 A;  5KFV A;  3GV8 B;  5J2I A;  3HIL A;  3TAQ A;  1S0N A;  5KFL A;  1OXJ A;  4K4G A;  3ZI4 A;  4R8U A;  1S0M A;  5KFK A;  3ISD A;  2JR5 A;  3K1Z A;  4J9N A;  4NLN A;  2FCL A;  7ICM A;  1S0V A;  1NNL A;  5GTI U;  3O0F A;  7ICS A;  4Q43 A;  2RDJ A;  4QWD A;  2W9M A;  1B22 A;  2ZG6 A;  2B51 A;  3SQI A;  2K4H A;  3MGV A;  1ZD5 A;  4DSF A;  5AK5 A;  2H5X A;  1JX4 A;  2JEG A;  3SD7 A;  2W9B A;  3N97 B;  2MAX A;  4PHP A;  2Q0Z X;  3NVW A;  4LZD A;  2ISO A;  1ZQU A;  7ICI A;  2H3Q A;  4RWN A;  3AMZ A;  1ZQI A;  4BXO A;  4IQT A;  4EX7 A;  1TAU A;  1WYG A;  1HJP A;  1WWU A;  4Y2R A;  5KG1 A;  4Q45 A;  1LKY A;  2O6K A;  3MDA A;  4BXO B;  1Z00 B;  2XI9 A;  3EZ5 A;  1URJ A;  4M9N A;  5J0P A;  1A6S A;  3QU9 A;  4RWO A;  5HMM A;  4C7Z A;  4CRX A;  2BZF A;  4K4I A;  3MR6 A;  1V9P A;  1V4A A;  4PH5 A;  2VKQ A;  3E0F A;  4AT8 B;  2KKV A;  1SXE A;  1JMS A;  5JRT A;  2BHN A;  1PUZ A;  2DPI A;  1BNO A;  3MCR A;  3C1Z A;  4UAS A;  2K60 A;  3EF2 A;  2R18 A;  3WFR E;  1ZQZ A;  8ICU A;  3A0H U;  4K99 A;  4KLD A;  5ALN A;  4DQR A;  4EBE A;  2JZB B;  4FHW A;  1OW5 A;  5ALD A;  3SAH A;  2AH5 A;  1MN8 A;  3KTQ A;  3PW4 A;  3BQ1 A;  3T5J A;  1N63 A;  4UAR A;  3OV7 A;  4OJ5 A;  2EAN A;  3H4D A;  4UD4 A;  4I2F A;  5L1L A;  4CCH A;  3PW2 A;  1L7O A;  2JH1 A;  3WU2 U;  1X40 A;  4JWN A;  3M1Y A;  5AIA A;  4UAY A;  4ECS A;  1ZQF A;  1MIW A;  1L8O A;  5D61 A;  4X4V A;  1UQV A;  2B0C A;  3WFO A;  3OUY A;  5ALE A;  4ED8 A;  5AI0 A;  2YB4 A;  9ICR A;  1ZQC A;  7ICH A;  3N4M B;  2JEI A;  5HHI A;  4PHE A;  4RT2 A;  1SWV A;  2KIW A;  3M6Z A;  5DDY A;  5J8Y C;  5C5J A;  4UAZ A;  4WJ3 B;  4DL4 A;  1CI4 A;  3KOO A;  2BQU A;  3MGH A;  4NY8 A;  9ICP A;  2YQE A;  3KZX A;  4YMO A;  3IDW A;  3UXO A;  2UVV A;  3C66 A;  2KJ5 A;  4J9O A;  2BCU A;  1ZQQ A;  1VLB A;  2ZTD A;  1X9X A;  2BCR A;  7ICJ A;  2XO7 A;  3RH4 A;  1C7Y A;  3HJE A;  2PFP A;  4J9Q A;  8ICH A;  1TAM A;  1NJY A;  5F9L A;  2KIC A;  5J2F A;  4FE3 A;  2DQN B;  4KLT A;  3AQL A;  2DKZ A;  4Y2S A;  2K8A A;  4JV2 A;  5DBA A;  4KMO B;  1LV5 A;  2DL0 A;  4JWM A;  1SXD A;  1ZRN A;  1KFT A;  4RNM A;  2HOF A;  2OYY A;  4YD2 A;  1ZQL A;  2AHO B;  4KM5 A;  2BCV A;  4F71 A;  4CF5 A;  1V85 A;  5EWF A;  5CEH A;  4P4M A;  4TUR A;  4PZN A;  5D49 A;  9ICL A;  1LB2 B;  4UAW A;  2KHQ A;  3PX0 A;  4RQ5 A;  7ICE A;  4M9G A;  5ALQ A;  4A8E A;  4RQ0 A;  2YMP A;  2ZXH A;  5J2J A;  2JMG A;  2I1Q A;  4M9L A;  1TK5 A;  3L5K A;  1DK2 A;  1UET A;  9ICK A;  1R8A A;  1JXE A;  2YTU A;  1UCV A;  3BS5 A;  4PL1 A;  4UB1 A;  4WQK A;  3RBE A;  4DFK A;  4NXU A;  2FMQ A;  4OCZ A;  2HHW A;  1O08 A;  2YX8 A;  1Q3V A;  5KFW A;  3R9K A;  3H38 A;  4MEY A;  3SR6 A;  2W3R A;  1T7P A;  1S76 D;  3SV3 A;  1T4G A;  5KFM A;  5DG7 A;  4F2S A;  3RRH A;  4DQI A;  5B3P A;  2NRW A;  9ICQ A;  3N7S C;  3RR7 A;  5III A;  3SEN A;  5DGB A;  4F50 A;  5AI5 A;  7ICR A;  4RQ2 A;  4CDG A;  2W55 A;  3MAB A;  4PGQ A;  2GOL A;  1K1S A;  4FHP A;  3IG5 A;  2XY7 A;  2DWQ A;  4KLG A;  4WH5 A;  4C80 A;  4ECZ A;  3K1R B;  5J0W A;  5AKH A;  1U49 A;  2BDP A;  4XQ8 A;  2HVH A;  1RYU A;  2K89 A;  1NO5 A;  9ICJ A;  4EGW A;  5JUM A;  1ZQS A;  3GIL A;  5KAI U;  3LWL A;  2B4V A;  3EWA A;  4O3N A;  3I76 A;  3SMV A;  4PPX A;  5L1J A;  1H38 A;  2VJ4 A;  1S9F A;  3CW2 C;  5AK4 A;  5DB6 A;  2AQ4 A;  4BWM A;  3ETL A;  3LK9 A;  1TK0 A;  2P35 A;  4FH5 A;  3C21 A;  4UBC A;  4GXJ A;  2RQ5 A;  1JI7 A;  3HRD D;  1RXW A;  1ZQV A;  5DKW A;  1Z00 A;  4F3O A;  3MDC A;  1NZB A;  4GIB A;  5HR6 A;  4YR0 A;  4EED A;  2LMR A;  2H3F A;  2KJ9 A;  4YMN A;  4QW9 A;  1N5W A;  4DF4 A;  1XNS A;  4HX0 A;  3I1Y A;  2EH9 A;  1FFU A;  1R8B A;  3ZDA A;  2H3V A;  4Y2T A;  3ER9 B;  1RYS A;  2HHS A;  2M9N A;  2PFQ A;  4YR3 A;  1N2X A;  3K75 D;  4UB2 A;  1SGG A;  5IIO A;  2QB1 A;  2KFN A;  3GIM A;  4M5D A;  4O3Q A;  3LWM A;  2HCF A;  1DGS A;  5L1K A;  1U47 A;  3VCB A;  2BPC A;  4JB3 A;  1COK A;  4J9M A;  5HHH A;  1ZQE A;  2JZB A;  4O6A A;  4TUQ A;  3M9N B;  4E8F A;  5KT6 A;  2KEY A;  4Z6C A;  2E1F A;  5KT5 A;  5KTQ A;  4DSI A;  1VDV A;  1PK3 A;  4GC6 A;  5CP2 A;  3WK7 A;  4KLF A;  5DLF A;  3HPO A;  5AIB A;  2E3T A;  1FIQ A;  2ZH5 A;  4EZ9 A;  4C8K A;  4K98 A;  2HMX A;  5HRG A;  1F44 A;  4M2Y A;  2VA8 A;  1L7N A;  5J0R A;  4UB4 A;  2PBE A;  2W43 A;  2PI5 A;  2ZH8 A;  5E79 U;  2HBK A;  2ZJ8 A;  3MFI A;  4NLZ A;  1Z3E B;  1RZT A;  4NXX A;  1ZQX A;  5KFS A;  3ZDC A;  4XA5 A;  4OJL A;  4BDP A;  4ICA A;  5J2H A;  2ZUB A;  5CWR A;  4O3P A;  4O5K A;  4X0A A;  1KDH A;  2VA3 A;  1Z1V A;  1K1Q A;  1UEU A;  4NLK A;  2KTQ A;  4ZH4 A;  3RAQ A;  5HRI A;  4IQU A;  3H7I A;  2DVI A;  2NRK A;  1ED1 A;  3C2K A;  2LM4 A;  4DL5 A;  4CF4 A;  8ICC A;  1XSN A;  3NRZ A;  4FZL A;  3PR5 B;  4PGY A;  3U26 A;  4EX6 A;  2W8K A;  5AM2 A;  4RU9 A;  3BZC A;  5B5E U;  4FO6 A;  4PJ0 U;  2KD1 A;  2KG5 A;  1D9D A;  4KN4 A;  5AHX A;  4MF8 A;  3KFU F;  3FM9 A;  3S6J A;  5ALG A;  3C5G A;  3MR2 A;  2PXI A;  4F5P A;  1MSW D;  2Y1J A;  5H2F U;  2J6T A;  5KFX A;  5KFH A;  2K4I A;  4J9S A;  4J9P A;  4RQ6 A;  3ZDB A;  2GAF D;  3JPN A;  3N28 A;  4KLL A;  3CRX A;  4M47 A;  1ZXI A;  3T5H A;  4DL3 A;  1S0O A;  2KSO B;  1C20 A;  2OM6 A;  2F3N A;  1L5U A;  4M04 A;  1CUK A;  5BOL A;  3RF9 A;  2BCQ A;  2M2W A;  2E8N A;  1SZH A;  4QZG A;  1ZQH A;  2D8C A;  2HBM A;  1B43 A;  2W7O A;  4F4W A;  2K8B B;  5D62 A;  3F2B A;  1X2I A;  4I2G A;  5TIS U;  3QZ7 A;  3H4B A;  3NAS A;  8ICG A;  8ICF A;  3DV9 A;  2Y9U A;  2FDR A;  4P2H A;  4JMU A;  2KP7 A;  2HOQ A;  4Y2P A;  3ICX A;  3MBY A;  2WFA A;  2KVC A;  3GU3 A;  4YP3 A;  2ASL A;  2FLL A;  5HNK A;  4O9M A;  3Q8K A;  1HUZ A;  3CK6 A;  1QQ6 A;  5J2B A;  4Y2Q A;  5AKL A;  3EYZ A;  4X4R A;  3JPP A;  3PSF A;  4F2R A;  7ICP A;  5AKZ A;  1ECW A;  3M9O B;  2AGO A;  5J0Y A;  2MSN A;  1JN3 A;  2XVT A;  5DBB A;  2HW3 A;  3WFS C;  1S8O A;  7ICU A;  2F77 X;  4J9L A;  4B9L A;  1OUQ A;  2DBY A;  3DEE A;  1WCN A;  3KD3 A;  1BPB A;  1ZQA A;  2W7P A;  4I2D A;  3WFQ E;  4ED6 A;  3AQK A;  5J0U A;  2XY6 A;  2ES6 A;  3WKC A;  1QLN A;  4DSL A;  1ZD3 A;  1ZQW A;  4O5E A;  4NXT A;  5F2V O;  4E7X A;  1QQ5 A;  4IR9 A;  2YY6 A;  4DFM A;  2PFN A;  2M2V A;  4C8M A;  4F93 B;  2Y0S F;  1PZN A;  1RPL A;  5J2D A;  4RQ1 A;  3ORY A;  4GC7 A;  1RYR A;  4RUA A;  2Y0S C;  5B3Q A;  1SKS A;  1NI3 A;  2ZH9 A;  2UVU A;  3GDX A;  5J8Y A;  1S10 A;  4I28 A;  8ICI A;  3OJU A;  5CFT A;  4KMU A;  4HYK A;  2ZIW B;  3QE9 Y;  4NLC A;  4QJF B;  1ZQN A;  3RH5 A;  1X9W A;  1SZP A;  3ISC A;  3OJS A;  2ZIW A;  2C2D A;  1WG8 A;  3BQ7 A;  5ALO A;  3RRG A;  5KFP A;  3QYP A;  5KL8 B;  3RB6 A;  5DGA A;  5JU5 A;  5JTG A;  2WAQ C;  4R8U B;  1KKX A;  3M6K A;  4X4N A;  4DSJ A;  1O03 A;  5KFR A;  5J0Q A;  4OAG A;  1XO1 A;  2EAO A;  5C0Y A;  4KLS A;  4OJP A;  5KG7 A;  3B0X A;  1Y88 A;  1X66 A;  1ZOL A;  3OVB A;  4UB8 U;  3RR8 A;  2C28 A;  3K7D A;  3F2C A;  3V7K A;  2RP5 A;  4RPY A;  3H37 A;  2LBO A;  1NK6 A;  2FLP A;  3K4G A;  2KZZ A;  2VJ5 A;  1SKR A;  8ICR A;  3NKU A;  4S3N A;  1ZQ1 C;  5ALJ A;  4P0Q A;  2ZUC A;  2YN4 A;  4MEX A;  1TE2 A;  5AM5 A;  1T3N A;  4WOY A;  3D2S A;  3RBD A;  5IIJ A;  1J2N A;  4KLU A;  4WC5 A;  3HW8 A;  4QWE A;  4Q44 A;  8ICT A;  4WC0 A;  3H8J A;  4OJO A;  4DWI A;  4KLO A;  2G09 A;  3H40 A;  4LJX A;  4M6W B;  2F1I A;  3THV A;  5DG9 A;  4FHX A;  1JRO A;  1YT3 A;  5EWE A;  2ZH4 A;  3MR3 A;  4KTQ A;  2E5S A;  4N7R A;  2A19 A;  4I2E A;  2WTF A;  1TK8 A;  4ED7 A;  4OAI Z;  1JAL A;  3MR5 A;  1NKC A;  2R8K A;  3FYH A;  1D8B A;  5KFG A;  5L9X A;  3B0Y A;  5KT2 A;  3WK9 A;  2KVS A;  4C8O A;  5HRB A;  1Q78 A;  1KNY A;  4XRH A;  4DLG A;  4ELV A;  4U6P A;  4O69 A;  2C2E A;  3NVV A;  4TUS A;  1ZQB A;  1HUO A;  3PW7 A;  3RB0 A;  1B0X A;  1SKW A;  2ZTE A;  5CFU A;  5IIN A;  2F44 A;  4NV0 A;  4P4P A;  4JV1 A;  5KFQ A;  3J81 j;  2G5I B;  2H3I A;  3H8S A;  2RFF A;  2ZH2 A;  4Q8F A;  3SEI A;  3QZ8 A;  4NL9 A;  2ZTC A;  2W11 A;  3SYZ A;  1T94 A;  4BUG A;  5ALU A;  2M0N A;  1S77 D;  1ZQK A;  1JQR A;  2ZXI A;  1ZQR A;  1N48 A;  1BPZ A;  1TFW A;  5CJ7 A;  4AT7 A;  4F5R A;  4UB5 A;  3RJF A;  2R8I A;  4EP7 A;  5DQH A;  2J6S A;  2YML A;  3TQ1 A;  1YZ7 A;  1NJZ A;  2YMQ A;  3TAC B;  4FH3 A;  2RDI A;  5ALF A;  5GTH U;  4C8N A;  4LEY A;  3NUQ A;  4WBZ A;  2KOB A;  2JH7 A;  3BS5 B;  2FI1 A;  3ONN A;  4I2J A;  2ZIV A;  5KFE A;  1KN5 A;  4FZN A;  4DOA A;  1Z4O A;  2DRB A;  2ZH6 A;  3AQN A;  2QAR A;  1U45 A;  2G0A A;  3ERC C;  3A0B U;  1A77 A;  4WC6 A;  2WB1 F;  4FHY A;  3WK4 A;  1NK9 A;  4NM2 A;  3QNM A;  4RQ4 A;  4F8R A;  2F76 X;  4F91 B;  4RUC A;  1IXR A;  5HR7 A;  2AU0 A;  3KKA C;  2NO5 A;  2K8C B;  2MRL A;  3NVZ A;  3FDS A;  8ICV A;  5AKG A;  2QLT A;  5ALP A;  2F1J A;  3OGU A;  4ED2 A;  2BPG A;  2DPJ A;  3NRW A;  2JRZ A;  1NK8 A;  1QSL A;  1BPX A;  3AUO A;  1PX5 A;  4LVS A;  4Z6D A;  2AGQ A;  2UVW A;  4KX5 A;  3HKZ C;  5KFU A;  1XSP A;  3C18 A;  3PML A;  2ZH1 A;  5K4L A;  5KFI A;  8ICN A;  1R89 A;  4IRD A;  4KLJ A;  3TAN A;  4XUS A;  4QZ8 A;  3BQT A;  3OVS A;  3RAX A;  1ZQO A;  4DQQ A;  3F5A A;  4EEB A;  2R8H A;  1SWW A;  4C4T A;  1SV4 A;  3QU7 A;  3OSP A;  2F1H A;  4K9A A;  3CYM A;  3H39 A;  4GXK A;  1Q79 A;  1WCL A;  3V6H A;  5DDM A;  5ALH A;  4YR2 A;  1N56 A;  2KE7 A;  4RNO A;  4USA A;  4YVZ A;  1KLN A;  2ZUD A;  2MU2 A;  1A76 A;  1SIJ A;  3BQ2 A;  2BE3 A;  4UAT A;  2C22 A;  3AQE A;  2MUT B;  3QEB Z;  2V4R A;  1TAQ A;  1X6I A;  3F5E A;  5KFD A;  4EYI B;  2RHF A;  5F9N A;  2DRA A;  4FBU A;  3NGD A;  1L3U A;  1KSP A;  3PHZ A;  4G9B A;  4WC3 A;  1QCK A;  4PGX A;  2ATL A;  3ETR A;  8ICY A;  5EOZ A;  3ZD8 A;  2ZIX B;  2GO7 A;  4I2A A;  4IQV A;  1QSY A;  5ALS A;  4F72 A;  2FJ6 A;  2C2R A;  3QUT A;  4O3M A;  4CE6 A;  4AYB C;  3V6J A;  5ALK A;  2G5H B;  3HX0 A;  2F8K A;  9ICT A;  4Y2U A;  2KZM A;  3SV4 A;  5AI8 A;  2I9G A;  3NWI A;  3GZF A;  4QNL A;  3IG8 A;  4ZOH C;  4US8 A;  3N7P D;  2QAR B;  1YZ6 A;  2ZJ5 A;  3LYS A;  3UMB A;  3PZP A;  4X4O A;  1NKB A;  4P0P B;  4RNN A;  4OAF A;  2DR8 A;  4QWB A;  3RFA A;  4M0A A;  1MC8 A;  4WCW A;  1RXV A;  4O3R A;  5KG4 A;  3Q8Q B;  5CR0 A;  4ACO A;  4G3I A;  4QZI A;  2ALZ A;  3G6Y A;  2A1J B;  4U7C A;  3TAD C;  4NWI A;  2HOI A;  9ICV A;  1PVR A;  5IIM A;  3F2D A;  5J2G A;  1B4F A;  1X42 A;  2A1J A;  4QZD A;  4JV0 A;  9ICS A;  3M7D A;  3GV7 B;  3M8R A;  3PST A;  3RJH A;  9ICW A;  4BGD A;  3GIJ A;  5HRL A;  3PX6 A;  1MQ2 A;  4K96 A;  4R64 A;  2NV3 A;  4EEN A;  3GQC A;  5IIK A;  4FZM A;  2Y9T A;  2XID A;  4FHV A;  8ICZ A;  2GH1 A;  4RPZ A;  2K4P A;  1EXN A;  5AI4 A;  2HN2 A;  4QIW F;  3PMN A;  3QEA Z;  2LYA A;  4JUZ A;  9ICX A;  2QB0 B;  5DBC A;  4B9N A;  1UT8 A;  4IQW A;  1ZQT A;  3LDA A;  3QX7 A;  1KTQ A;  4ELT A;  2IOH A;  4AT9 A;  2NRX A;  1MIV A;  4F5O A;  3WKB A;  5KT4 A;  2OXO A;  7ICQ A;  4IR1 A;  4EZ6 A;  2W3S A;  4O0I A;  4MFA A;  4X4S A;  4ECT A;  3UPQ A;  4GLX A;  4I2B A;  2JEF A;  4AYB F;  4R63 A;  5DEC A;  3UPS A;  4QWA A;  1J97 A;  5AM1 A;  2ZHA A;  1BGX T;  2BBH A;  3UXN A;  3PO5 A;  1X9S A;  1ZQD A;  4C8L A;  2R8J A;  4P0P A;  9ICH A;  8ICX A;  1KFD A;  4DOB A;  9ICC A;  5BOM A;  4UW9 A;  2I6X A;  2F8L A;  2HHP A;  1L7P A;  3EPG A;  1NKE A;  3PV8 A;  2K4E A;  1RQL A;  1NZP A;  9ICN A;  1NK7 A;  2L5Y A;  2KKP A;  3PR4 A;  3LVV A;  1F5A A;  3PSP A;  4IC9 A;  1Z4N A;  5ALZ A;  4EEK A;  5BPC A;  1UHU A;  2V4Q A;  2D6F C;  1IIP A;  4ECW A;  4O5C A;  2XCP A;  1NK5 A;  4Y2X A;  8ICB A;  3PVX A;  4O68 A;  5AKJ A;  3AU6 A;  2D3D A;  5CB1 A;  1JAJ A;  1U4B A;  1MQ3 A;  9ICB A;  5JTI A;  2HN1 A;  1RG6 A;  3NVO A;  3ZDD A;  2OCE A;  4K97 A;  2P6U A;  3C23 A;  1WOT A;  3PW0 A;  9ICE A;  5KFY A;  4XJE A;  3GII A;  2Q66 A;  4UBB A;  3E2E A;  3LVW A;  8ICS A;  2VAN A;  2J6U A;  3TAP A;  3F53 A;  5KNI A;  5KFC A;  4RPX A;  3Q8S B;  1PVQ A;  4J9K A;  2OWO A;  5HML A;  1N61 A;  2BCS A;  2F2A B;  5L1I A;  4NLG A;  3WKD A;  4F92 B;  4B9M A;  4YD1 A;  3C28 A;  2R8G A;  3JZ0 A;  3OHA A;  4R66 A;  4BX9 C;  1IV8 A;  2DR7 A;  3HT3 A;  2JEJ A;  1N5X A;  1XC9 A;  3C2M A;  5D63 A;  2E8M A;  1KQQ A;  4WC4 A;  4YQW A;  7ICL A;  4QZC A;  2VIX A;  5AK3 A;  3RJI A;  4RQ7 A;  3Q8P B;  2DF4 B;  4IG8 A;  2KJ8 A;  9ICU A;  5ALY A;  2YB1 A;  4MFF A;  4OD0 A;  3RJJ A;  4P4O A;  2W04 A;  4MF2 A;  4F4Z A;  2ZHB A;  2W54 A;  4UB6 U;  3WKE A;  4RQN A;  2KHV A;  4Z6F A;  4F4K A;  4DEZ A;  2BPF A;  3UM9 A;  7ICV A;  4RWP A;  2HHU A;  2LI6 A;  2A1A A;  4NKT A;  2ZH7 A;  4O3O A;  3TFR A;  2FPK A;  3ER8 C;  1V38 A;  3HKZ F;  2ASJ A;  5KFT A;  3OVA A;  3QUC A;  2AGP A;  4XQ7 A;  2WF6 A;  3TI0 A;  1N62 A;  4C7Y A;  4C4R A;  1JXL A;  2W9C B;  2EAP A;  3D2N A;  5ALX A;  3EW9 A;  4DFP A;  3HJ1 A;  2ODG A;  3ED5 A;  2B6G A;  1S97 A;  2WF7 A;  9ICO A;  4K9B A;  2MUT A;  4EBC A;  2LYH A;  4IRK A;  1HEK A;  5F3X B;  1X9M A;  2ASD A;  4IL6 U;  4NM1 A;  2GA9 D;  7ICF A;  3H8M A;  5ALT A;  9ICM A;  4E0D A;  4NXW A;  2PKE A;  2EQY A;  2WB1 C;  2ZIV B;  4ATB A;  2FMS A;  4X4U A;  2LYB A;  4ED3 A;  1L8L A;  5DQI A;  4ELU A;  3JPT A;  4DQS A;  1GO3 F;  5J2C A;  3Q8L A;  3WKA A;  1WWV A;  1L7M A;  2EZZ A;  3CNH A;  8ICP A;  1FA0 A;  4KB6 A;  4AP9 A;  3GV5 B;  4F4Y A;  5AM4 A;  2G08 A;  1KW4 A;  3OUY B;  3Q8M A;  3QU5 A;  4PL2 A;  4QW8 A;  2WHE A;  2PMZ C;  5ALI A;  4P0Q B;  5T14 A;  4UAV A;  2CPR A;  3RTV A;  2HHV A;  3IHQ B;  4QZH A;  2G07 A;  4I29 A;  5KAF U;  2BQR A;  1BVS A;  2NO4 A;  2PFO A;  1ZJN A;  1D9F A;  1XU4 A;  2OEH A;  1BNP A;  8ICL A;  2XY5 A;  3IM1 A;  5AKI A;  1ZYQ A;  1KL9 A;  4Z6E A;  2FPL A;  2IHN A;  4X4Q A;  4EBK A;  3IP4 B;  2AJQ A;  8ICO A;  4DFD A;  4UD5 A;  4B9T A;  4CF3 A;  4R65 A;  4AT7 B;  3MC1 A;  1DGJ A;  5HC9 A;  3PSI A;  4AT9 B;  3BDP A;  2CRX A;  5AIC A;  5AM0 A;  5TZV A;  4FBT A;  1FFV A;  3AM9 A;  3UMC A;  5DB7 A;  2CXY A;  5DB9 A;  5CFS A;  4DL6 A;  1TV9 A;  3HJ4 A;  3AL0 B;  5J2K A;  5J0T A;  4KLM A;  1VFG A;  3FC4 A;  2B21 A;  5KFA A;  5L1M A;  3M8S A;  1D8Y A;  8ICW A;  1NJW A;  4Y2J A;  5AM3 A;  2FLN A;  7ICK A;  2HHX A;  2DFL A;  4KIT B;  3SI8 A;  2DR9 A;  8ICA A;  3H0L B;  3WFP A;  4C0Z A;  4K8V A;  2YMM A;  5B66 U;  3OSN A;  5ALR A;  5KFZ A; 
#chains in the Genus database with same CATH homology
 3PR5 B;  4PGY A;  3PNC A;  4RNO A;  2AQ0 A;  1S0N A;  5KFL A;  4YVZ A;  1KLN A;  4K4G A;  2ZUD A;  1SL1 A;  4R8U A;  1A76 A;  3BQ2 A;  1S0M A;  5KFK A;  2W8K A;  2C22 A;  2BE3 A;  3ISD A;  4QZE A;  4J9N A;  4NLN A;  4RU9 A;  7ICM A;  2MUT B;  4FO6 A;  3AQM A;  3QEB Z;  9ICI A;  4DSE A;  2V4R A;  1S0V A;  1D9D A;  1TAQ A;  4KN4 A;  5KFD A;  7ICS A;  2XC9 A;  4MF8 A;  4EYI B;  4LT6 A;  5F9N A;  2DRA A;  4Q43 A;  2W9C A;  2RDJ A;  4FBU A;  4TQR A;  3NTU A;  3NGD A;  4EBD A;  1U48 A;  1L3U A;  1KSP A;  3C5G A;  3MR2 A;  2PXI A;  4F5P A;  4IRC A;  4QWD A;  5DLG A;  2W9M A;  5DG8 A;  1MSW D;  4PGX A;  3MGI A;  4WC3 A;  1B22 A;  2Y1J A;  2IBK A;  2ATL A;  2ZHA A;  4NKU A;  8ICY A;  2J6T A;  5KFX A;  5KFH A;  4DL2 A;  4DSF A;  5EOZ A;  4J9S A;  4J9P A;  2H5X A;  1JX4 A;  4RQ6 A;  2JEG A;  3ZDB A;  3JPN A;  3ZD8 A;  4KLL A;  3M9M B;  2NRT A;  2W9B A;  4I2A A;  4IQV A;  4ECY A;  3N97 B;  1QSY A;  4M47 A;  2MAX A;  4PHP A;  7ICG A;  3T5H A;  2Q0Z X;  4DL3 A;  1S0O A;  1NJX A;  4NXZ A;  4B9V A;  4LZD A;  2ISO A;  3T5K A;  1ZQU A;  7ICI A;  5J2E A;  2C2R A;  1L5U A;  4RWN A;  4RWQ A;  4EBJ A;  1ZQI A;  3V6J A;  1CUK A;  5BOL A;  4IQT A;  3HX0 A;  3KHG A;  4BXO A;  4M04 A;  1TAU A;  9ICT A;  3V72 A;  2KZM A;  3SV4 A;  1HJP A;  5KG1 A;  2I9G A;  4Q45 A;  3H3A A;  2BCQ A;  3MDA A;  4M9J A;  2UVR A;  1TKD A;  4BXO B;  2M2W A;  4KLE A;  1Z00 B;  3EZ5 A;  1XS9 D;  4M9N A;  5J0P A;  4QZG A;  1ZQH A;  4RWO A;  2ZJ5 A;  5HMM A;  4ECU A;  4X4O A;  2ISP A;  2M2U A;  1NKB A;  1B43 A;  4RNN A;  3MR6 A;  4F4W A;  1V9P A;  5KG6 A;  4K4I A;  2DR8 A;  4QWB A;  1V4A A;  4PH5 A;  4FS2 A;  4M0A A;  3RH6 A;  4AT8 B;  1MC8 A;  4WCW A;  1JMS A;  1RXV A;  4YG2 A;  4F5Q A;  4O3R A;  5KG4 A;  3Q8Q B;  5CR0 A;  1X2I A;  2BHN A;  4I2G A;  2DPI A;  2DR5 A;  3QZ7 A;  3H4B A;  1ZJM A;  1UEV A;  3V6K A;  4G3I A;  1BNO A;  4QZI A;  3C1Z A;  2ALZ A;  8ICG A;  3HIY A;  3G6Y A;  3WFR E;  1ZQZ A;  8ICF A;  2A1J B;  8ICU A;  4P2H A;  9ICV A;  5IIM A;  5KG5 A;  4KLD A;  4E80 A;  5J2G A;  2KP7 A;  4DS4 A;  2A1J A;  4QZD A;  8ICQ A;  8ICE A;  4JV0 A;  9ICS A;  4TQS A;  4M6W A;  4DQR A;  3GV7 B;  3MBY A;  3M8R A;  4LZG A;  4EBE A;  2JZB B;  3RJH A;  9ICW A;  1SL0 A;  2VA2 A;  4BGD A;  3C5F A;  3GIJ A;  4YP3 A;  4FHW A;  3AU2 A;  3G6X A;  2ASL A;  4I27 A;  5HRL A;  3PX6 A;  1MQ2 A;  4I2I A;  5HNK A;  2FLL A;  4O9M A;  4UB3 A;  5KFF A;  4R64 A;  3Q8K A;  3PW4 A;  1HUZ A;  3BQ1 A;  3KTQ A;  5J2B A;  3T5J A;  3EYZ A;  3GQC A;  5IIK A;  4X4R A;  3JPP A;  2HHT A;  4F2R A;  4FHV A;  3OV7 A;  8ICZ A;  7ICP A;  4RPZ A;  3RB4 A;  3H4D A;  3M9O B;  1EXN A;  4UD4 A;  1L3S A;  4I2F A;  5L1L A;  2IHM A;  4CCH A;  3PW2 A;  2AGO A;  4DS5 A;  5J0Y A;  2XCA A;  3L9D A;  3PMN A;  3C2L A;  1JN3 A;  5DBB A;  3QEA Z;  3PY8 A;  2HW3 A;  3WFS C;  7ICU A;  4JUZ A;  1JIH A;  4JWN A;  9ICX A;  3JPQ A;  5DBC A;  4J9L A;  2W8L A;  4B9N A;  4UAY A;  4ECS A;  1ZQF A;  4B9L A;  1UT8 A;  4IQW A;  1MIW A;  1UA1 A;  4X4V A;  1ZQT A;  3LDA A;  4ELT A;  1KTQ A;  3WFO A;  4AT9 A;  3OUY A;  2P66 A;  1WCN A;  3TFS A;  1BPB A;  2NRX A;  4ED8 A;  1ZQA A;  1MIV A;  4F5O A;  9ICR A;  5KT4 A;  4I2D A;  2M2T A;  3GIK A;  3WFQ E;  1ZQC A;  7ICH A;  7ICQ A;  4KLQ A;  4ED6 A;  1QTM A;  4YXJ A;  3N4M B;  2JEI A;  5HHI A;  2Y1I A;  4PHE A;  4IR1 A;  5J0U A;  2XY6 A;  4RT2 A;  1QLN A;  3H8W A;  4WBY A;  4EZ6 A;  4DSL A;  1ZQW A;  4O0I A;  1NOM A;  2GWS A;  5DDY A;  4MFA A;  4X4S A;  4UAZ A;  5C5J A;  4O5E A;  4KLH A;  4DL4 A;  4ECT A;  5F2V O;  3UPQ A;  1ZQM A;  4GLX A;  4I2B A;  2JEF A;  3EPI A;  2BQU A;  4R63 A;  3MGH A;  4NY8 A;  4QWA A;  9ICP A;  5DEC A;  3UPS A;  4IR9 A;  4E7X A;  4YMO A;  7ICN A;  4DFM A;  2PFN A;  1BGX T;  4C8M A;  2M2V A;  3UXN A;  3UXO A;  2XGQ A;  1TVA A;  2UVV A;  3C66 A;  4F93 B;  3MFH A;  1RPL A;  1PZN A;  5J2D A;  1X9S A;  1ZQD A;  3PO5 A;  4C8L A;  4RQ1 A;  4J9O A;  2BCU A;  2R8J A;  1BPE A;  4ED0 A;  2V9W A;  9ICH A;  1KFD A;  8ICX A;  4DOB A;  1ZQQ A;  9ICC A;  3ORY A;  4GC7 A;  2ZTD A;  1RYR A;  5BOM A;  1L3T A;  4RUA A;  2BCR A;  4DQP A;  2HHP A;  4B9S A;  3EPG A;  7ICJ A;  1NKE A;  2XO7 A;  3PV8 A;  3RH4 A;  1SL2 A;  1C7Y A;  2PFP A;  4J9Q A;  1SKS A;  8ICH A;  4DF8 A;  4I2H A;  9ICN A;  1NZP A;  1NJY A;  2ZH9 A;  2BKE A;  5F9L A;  1NK7 A;  2KN7 A;  3GDX A;  2UVU A;  1S10 A;  5HR9 A;  4I28 A;  8ICI A;  3PR4 A;  3OJU A;  5J2F A;  1F5A A;  2XGP A;  4KLT A;  4KMU A;  3AQL A;  4DFJ A;  5BPC A;  4RQ8 A;  4HYK A;  3QE9 Y;  4ATB B;  1KEJ A;  1ZQN A;  4JV2 A;  5KG3 A;  3UQ2 A;  2V4Q A;  3RH5 A;  5DB8 A;  3JPR A;  8ICM A;  5HRK A;  5DBA A;  1X9W A;  1SZP A;  1LV5 A;  4ECW A;  4JWM A;  2XCP A;  4O5C A;  3ISC A;  1NK5 A;  3OJS A;  8ICB A;  3PVX A;  4K4H A;  3HWT A;  2C2D A;  1KFT A;  4RNM A;  7ICO A;  3RRG A;  3AU6 A;  8ICK A;  1D8L A;  5CB1 A;  5KFP A;  1JAJ A;  4FS1 A;  1U4B A;  1MQ3 A;  9ICB A;  3RB6 A;  5DGA A;  3GFK B;  4TUP A;  1UA0 A;  4YD2 A;  3AQK A;  4R8U B;  1ZQL A;  3ZDD A;  1ARO P;  2P6U A;  5IIL A;  1XSL A;  2P6R A;  2BCV A;  3C23 A;  1WOT A;  5EWF A;  3PW0 A;  4X4N A;  4DSJ A;  4P4M A;  4TUR A;  5KFR A;  5J0Q A;  5J0X A;  4O3S A;  9ICE A;  3JYY A;  5KFY A;  1XO1 A;  5J29 A;  5D49 A;  9ICL A;  4ECQ A;  1LB2 B;  4KLS A;  4UAW A;  3GII A;  3PX0 A;  2Q66 A;  4UBB A;  1UT5 A;  4I2C A;  4RQ5 A;  3E2E A;  8ICS A;  2VAN A;  2J6U A;  3TAP A;  5KG7 A;  9ICA A;  3B0X A;  1Y88 A;  5HRD A;  3OVB A;  7ICE A;  4M9G A;  5KFC A;  4RPX A;  4QZB A;  3Q8S B;  4J9K A;  4RQ0 A;  5HML A;  2OWO A;  3RR8 A;  2C28 A;  2BCS A;  5L1I A;  3V7K A;  5J2J A;  4RPY A;  2W9B B;  4NLG A;  3H37 A;  1NK6 A;  2FLP A;  2I1Q A;  3K4G A;  4M9L A;  2KZZ A;  1TK5 A;  4F92 B;  1SKR A;  8ICR A;  1ZQJ A;  4B9M A;  1DK2 A;  4YD1 A;  3PX4 A;  2R8G A;  9ICK A;  1R8A A;  1UET A;  1JXE A;  4S3N A;  3JZ0 A;  4UB1 A;  3OHA A;  3RBE A;  1YLQ A;  4R66 A;  4DFK A;  3RJE A;  1R8C A;  3KHL A;  3TAR A;  2ZUC A;  1QSS A;  3RJK A;  4MEX A;  2DR7 A;  1T3N A;  3HT3 A;  4RT3 A;  2FMQ A;  2JEJ A;  4JK1 A;  3C2M A;  3RBD A;  1XC9 A;  5IIJ A;  2HHW A;  4KLU A;  4WC5 A;  3HW8 A;  4QWE A;  1KFS A;  5KG0 A;  5KFW A;  4Q44 A;  4Q8E A;  8ICT A;  4WC0 A;  1TFY A;  3H38 A;  3H8J A;  1DK3 A;  4MEY A;  4QZF A;  4DWI A;  1T7P A;  4KLO A;  4DSK A;  4WC4 A;  1S76 D;  3H40 A;  3SV3 A;  5KT3 A;  4M6W B;  4YQW A;  7ICL A;  1T4G A;  5KFM A;  5DG7 A;  2F1I A;  4QZC A;  4F2S A;  4YXM A;  3THV A;  1NK4 A;  5EWG A;  3OHB A;  3RRH A;  4DQI A;  3RJI A;  4RQ7 A;  5DG9 A;  4FHX A;  2NRW A;  3Q8P B;  1ZQY A;  4GXI A;  1DOQ A;  3HP6 A;  9ICQ A;  5DED A;  1L3V A;  4IG8 A;  5EWE A;  4F5N A;  2ZH4 A;  3MR3 A;  2KZ3 A;  4QZ9 A;  3RR7 A;  4KTQ A;  5III A;  4YMM A;  5DGB A;  9ICU A;  4F50 A;  5KFN A;  4MFF A;  3RJJ A;  3SZ2 A;  7ICR A;  4RQ2 A;  4P4O A;  3C1Y A;  2BQ3 A;  4I2E A;  4X0B A;  2WTF A;  1TK8 A;  4MF2 A;  3MAB A;  4PGQ A;  4F4Z A;  4ED7 A;  1K1S A;  4FHP A;  2ZHB A;  4UQG A;  2XY7 A;  3MR5 A;  3BQ0 A;  4DO9 A;  1NKC A;  2R8K A;  4EYH B;  3FYH A;  4KLG A;  7ICT A;  3KHR A;  4Z6F A;  5L9X A;  3B0Y A;  5KFG A;  4DEZ A;  2BPF A;  4F4K A;  7ICV A;  5KT2 A;  4RWP A;  2IMW P;  3ZD9 A;  2HHU A;  2FPM A;  4ECZ A;  4C8O A;  5HRB A;  4YFK A;  5J0W A;  4NKT A;  1Q78 A;  2ZH7 A;  1KNY A;  4O3O A;  4XRH A;  2FPK A;  3TFR A;  4DLG A;  1U49 A;  4ELV A;  2BDP A;  4XQ8 A;  3PW5 A;  2C2E A;  1T8E A;  2ASJ A;  2HVH A;  5KFT A;  1NO5 A;  9ICJ A;  3OVA A;  2AGP A;  4ECX A;  3RJG A;  3LQC B;  4TUS A;  5JUM A;  4XQ7 A;  1ZQB A;  1ZQS A;  3GIL A;  3LWL A;  5CA7 A;  3TI0 A;  1HUO A;  3PW7 A;  1ZQP A;  1NK0 A;  1JXL A;  2W9C B;  2O1P A;  3EWA A;  3RB0 A;  4O3N A;  4QZA A;  5HP4 A;  3EW9 A;  1SKW A;  3RB3 A;  4DFP A;  4PPX A;  3HJ1 A;  5L1J A;  4PHD A;  1H38 A;  2ZTE A;  4YCX A;  1S97 A;  1S9F A;  9ICO A;  2MUT A;  2LYH A;  4EBC A;  5IIN A;  3Q8R B;  4P4P A;  4IRK A;  4JV1 A;  3BJY A;  1X9M A;  5KFQ A;  5DB6 A;  5J2A A;  2ASD A;  2AQ4 A;  2KFZ A;  4BWM A;  2RFF A;  3ETL A;  3H8S A;  4NM1 A;  2ZH2 A;  3LK9 A;  1TK0 A;  4Q8F A;  3QZ8 A;  7ICF A;  9ICM A;  4WC1 A;  3V7J A;  2ZTC A;  4ECR A;  3C21 A;  4UBC A;  3SYZ A;  4FH5 A;  4X4P A;  5KFO A;  4E0D A;  4GXJ A;  1RXW A;  1ZQV A;  5DKW A;  1Z00 A;  4ECV A;  2O5A A;  4KLI A;  4ED1 A;  3G6V A;  4F3O A;  3MDC A;  1S77 D;  1MIY A;  3PO4 A;  1ZQK A;  1JQR A;  4YR0 A;  1ZQR A;  4B9U A;  4ATB A;  1N48 A;  2FMS A;  1BPZ A;  4X4U A;  4ED3 A;  5KT7 A;  4YMN A;  5DQI A;  1TFW A;  4QW9 A;  4ELU A;  3JPT A;  4MFC A;  4DQS A;  4DF4 A;  5J2C A;  3Q8L A;  5CJ7 A;  4WC2 A;  9ICF A;  4AT7 A;  1R8B A;  2ZJA A;  3ZDA A;  4F5R A;  9ICG A;  1RYS A;  5D4B A;  4UB5 A;  3RJF A;  2R8I A;  8ICP A;  5DQH A;  4EP7 A;  2J6S A;  1FA0 A;  2HHS A;  2M9N A;  3GV5 B;  3TQ1 A;  4YR3 A;  5DQG A;  2PFQ A;  4F4Y A;  3K75 D;  4UB2 A;  5KG2 A;  3JPS A;  5HRF A;  1NJZ A;  2ID1 A;  4WC7 A;  4FH3 A;  3OUY B;  1COO A;  3KHH A;  3Q8M A;  2RDI A;  3UQ0 A;  4C8N A;  5IIO A;  2ZH3 A;  4DOC A;  4QW8 A;  4AT8 A;  1VJ7 A;  2KFN A;  4WBZ A;  3GIM A;  4J9R A;  4O3Q A;  2W9A A;  1ZET A;  3LWM A;  2HHQ A;  5KFB A;  1DGS A;  5L1K A;  4M5D A;  4I2J A;  4X4T A;  1U47 A;  1OU5 A;  3RTV A;  2PI4 A;  5KFE A;  2BPC A;  3ZDE A;  4X5V A;  4DOA A;  4J9M A;  5HHH A;  1ZQE A;  2HHV A;  2DRB A;  2JZB A;  3IHQ B;  4QZH A;  3AQN A;  1IM4 A;  1U45 A;  3JPO A;  4RQ3 A;  2ZH6 A;  1A77 A;  5J0O A;  4I29 A;  4WC6 A;  4TUQ A;  3M9N B;  8ICJ A;  5KT6 A;  4E8F A;  2BQR A;  1BVS A;  4DL7 A;  4FHY A;  4Z6C A;  1ZJN A;  1D9F A;  2PFO A;  3ISB A;  5KT5 A;  1XU4 A;  4NM2 A;  4EEY A;  1NK9 A;  5KTQ A;  4DSI A;  3UXP A;  4RQ4 A;  4GC6 A;  4F8R A;  1BNP A;  5CP2 A;  4F91 B;  4RUC A;  8ICL A;  4KLF A;  5DLF A;  4M9H A;  1IXR A;  2XY5 A;  3HPO A;  3IM1 A;  2AU0 A;  1ZYQ A;  5HRE A;  5KFJ A;  4Z6E A;  2ZH5 A;  2FPL A;  5D46 A;  3T5L A;  2FMP A;  4C8K A;  4EZ9 A;  4F4X A;  1BPY A;  3OVS A;  2IHN A;  3FDS A;  8ICV A;  5HRG A;  4DLE A;  4X4Q A;  3V7L A;  4EBK A;  4M2Y A;  2AJQ A;  1XWL A;  2F1J A;  8ICO A;  3OGU A;  4ED2 A;  2HVI A;  4UD5 A;  2BPG A;  1U9L A;  2VA8 A;  4B9T A;  2DPJ A;  5HRH A;  1NK8 A;  1QSL A;  5J0R A;  4R65 A;  1BPX A;  3AUO A;  4UB4 A;  4AT7 B;  1KRP A;  2PBE A;  2BR0 A;  2PI5 A;  1PX5 A;  4LVS A;  2ZH8 A;  5HC9 A;  5CHG A;  4Z6D A;  2AGQ A;  2ZJ8 A;  1BPD A;  2UVW A;  3MFI A;  3BDP A;  4NLZ A;  4AT9 B;  1Z3E B;  1RZT A;  1CEZ A;  1ZQX A;  4BWJ A;  5KFS A;  5KFU A;  5TZV A;  1XSP A;  3ZDC A;  4FBT A;  3C18 A;  4XA5 A;  5J0S A;  3PML A;  2ZH1 A;  2BGW A;  4BDP A;  5KFI A;  4YN4 A;  5DB7 A;  5J2H A;  8ICN A;  2ZUB A;  5CWR A;  1R89 A;  4RZR A;  4IRD A;  4KLJ A;  5DB9 A;  2NRV A;  1TFR A;  4O3P A;  4DL6 A;  1TV9 A;  3TAN A;  4O5K A;  3HJ4 A;  4X0A A;  4XUS A;  1KDH A;  4PHA A;  4QWC A;  3T3F A;  2IA6 A;  5J2K A;  5J0T A;  2VA3 A;  4KLM A;  1VFG A;  2B21 A;  4QZ8 A;  3BQT A;  5KFA A;  1K1Q A;  3M8S A;  3RAX A;  1D8Y A;  1ZQO A;  1UEU A;  4NLK A;  2KTQ A;  4DQQ A;  8ICW A;  4KN7 A;  1NJW A;  4ZH4 A;  3RAQ A;  5HRI A;  4IQU A;  2R8H A;  2FLN A;  7ICK A;  3H7I A;  2HHX A;  2DVI A;  2DFL A;  1ZQG A;  4KIT B;  3SI8 A;  2NRK A;  2DR9 A;  8ICA A;  2NRZ A;  3OSP A;  3C2K A;  3NYB A;  2F1H A;  4DL5 A;  3WFP A;  3H39 A;  8ICC A;  4GXK A;  1Q79 A;  1WCL A;  3V6H A;  5KFV A;  5DDM A;  3OSN A;  3GV8 B;  1XSN A;  5J2I A;  5KFZ A;  4YR2 A;  3TAQ A;  1N56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...