4O5EA

Structure of human dna polymerase complexed with n7mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5eA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5eA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5eA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5eA03
3BQ1A 4YQWA 4KLUA 5HRFA 4UAZA 4EEYA 4X4QA 3BQ0A 2PXIA 1U48A 4RNOA 5HC9A 3TFRA 2DR8A 4QZ9A 1U45A 2P66A 4B9MA 4ELTA 4LVSA 3OUYB 3C5GA 1MIYA 4TQRA 5KTQA 3SV4A 2ASLA 5BOLA 4DWIA 3OV7A 4TQSA 4KLSA 1N56A 3HX0A 4ED0A 5KT6A 3RH6A 4P4MA 5F9NA 3PVXA 4I2GA 1NK8A 9ICAA 7ICLA 2O5AA 1NK6A 5JUMA 4O9MA 1MC8A 3GIMA 2BDPA 5HRKA 2M2WA 1Q79A 1UT8A 4DSKA 3PO4A 1BVSA 9ICHA 2XO7A 1ZQZA 4DFMA 5D4BA 4IQTA 1KEJA 3JPQA 4DFJA 2FMQA 4M9HA 1ZQDA 8ICGA 3EZ5A 3ZDDA 4AT8B 1UEUA 2C22A 4QZBA 1Z00B 4UB1A 4HYKA 1NKBA 5CA7A 2KN7A 1ZQRA 2XGPA 1KRPA 2XY5A 4EZ6A 3RJEA 4MFCA 3MDCA 4PGYA 5J0XA 5DGAA 2KFNA 8ICKA 2BPFA 7ICRA 5KFQA 4AT7A 1JMSA 3M9MB 2ZH2A 2HHSA 1S0NA 4FHPA 3TAQA 3QEBZ 4KLJA 4WCWA 2DPIA 4Z6CA 2VA3A 3PY8A 5DDYA 3PX0A 4M9JA 2M2UA 4WC5A 4JK1A 2KP7A 5J2IA 3H8JA 1U49A 1NK9A 5EWGA 4F5PA 3SV3A 2FPKA 2DRBA 1UT5A 2PFNA 4F4YA 8ICOA 1BPEA 4F3OA 4X4PA 3OSNA 4RWPA 4QZIA 4C8LA 4O3NA 4DSLA 4LZGA 4X4RA 2F1HA 1N48A 2DR5A 4I28A 1L3TA 7ICNA 5DQGA 3T5JA 4F93B 2W9BA 4X4OA 4JWMA 2DRAA 3MFHA 4F4WA 4RZRA 4YD1A 2JEFA 5F9LA 2H5XA 4DFPA 3HIYA 8ICTA 4RU9A 1R8CA 4WC1A 4IRCA 1X2IA 3TFSA 3ZDEA 2PFOA 4B9UA 4BXOA 3ZD8A 2V9WA 2I9GA 4DQIA 4FHWA 5DGBA 4UB2A 5J0SA 1NJZA 5KFCA 4F4XA 3C23A 4J9QA 4FS1A 3KHHA 4YXMA 4O0IA 3H39A 4PHDA 3H38A 3V6JA 3SI8A 1ZJMA 8ICRA 4FH5A 1S0MA 2BCQA 5KFSA 3OHAA 4ECZA 4ED3A 3MR6A 2IMWP 4I2HA 2XCAA 4UD4A 2ISOA 3RR7A 5KG2A 3EYZA 4DL6A 4MEYA 2NRWA 5CWRA 1BGXT 4P4OA 2Y1JA 4KLIA 3M9OB 4NLNA 4IQUA 7ICHA 2PFQA 1Q78A 4DOAA 1V9PA 5KFIA 2UVWA 3PR5B 4F50A 3L9DA 4DF8A 4YMOA 5DB6A 3JPOA 3HJ1A 1S9FA 3HPOA 4RT2A 7ICMA 2ZHAA 2HVIA 4B9VA 8ICLA 7ICUA 1NK0A 5J2DA 4QZDA 2BCSA 5J0YA 3AQLA 4FBUA 4WC6A 3UXOA 3V7KA 1KFSA 3B0XA 2WTFA 3QZ7A 2VA2A 9ICUA 9ICWA 5HR9A 4NM2A 2ZH4A 4DF4A 4IR1A 3TAPA 7ICPA 3MR5A 3Q8KA 3UQ0A 1XC9A 4NKTA 5DLGA 1ZQIA 2XGQA 5DG7A 3RJHA 2DFLA 3EW9A 1TFYA 2Y1IA 3RB4A 1T3NA 2BCVA 4E8FA 4RWNA 5HNKA 4RNMA 9ICRA 4WBYA 4FS2A 3MGIA 3AQMA 3Q8RB 7ICOA 3Q8PB 1SKWA 4O5KA 2BCUA 4DSEA 7ICIA 2BPGA 8ICHA 1TK8A 1RZTA 8ICMA 3JPPA 5KT4A 4QWAA 2PFPA 3AQNA 1KTQA 4O3QA 3Q8SB 2AGOA 5HMMA 1NKCA 4X4UA 3JPSA 3TANA 4YR3A 5DEDA 1ZQLA 1R8BA 4RQ6A 3Q8MA 5IIKA 1ZQWA 4YCXA 1SL1A 2PI4A 1RYRA 1B43A 5DLFA 5KG1A 2V4RA 5CB1A 4I2BA 4QWBA 9ICLA 5KFLA 4DFKA 4LT6A 5J29A 4DQRA 4F91B 9ICGA 3FYHA 4J9SA 1KFTA 4S3NA 3NGDA 4Z6EA 3RJIA 2ID1A 5KFTA 5HP4A 5DBBA 4E7XA 3H8WA 2R8GA 8ICJA 4O3PA 1QSYA 1UA0A 1ZQUA 2ZUDA 3ZDAA 4RT3A 4KLDA 4AT9A 3M8RA 9ICEA 4X0BA 1IM4A 4YR0A 3IHQB 4RWQA 4ATBA 4QWDA 4M9GA 3EPIA 5KT3A 5KFJA 2XY7A 1SL0A 1ZQQA 4WBZA 4QW8A 4DLGA 1JQRA 1BPZA 4GXKA 3MR3A 7ICSA 3C2KA 4QZFA 2J6SA 2FLNA 2ZH8A 4YMMA 1KLNA 5J2HA 3JPTA 4I2DA 2ATLA 4KLLA 3H3AA 5J0PA 2J6TA 5KFEA 3C2MA 4RUAA 5KFAA 2BHNA 5CHGA 4RQ2A 4B9LA 4R66A 1NOMA 5KFOA 1U47A 7ICTA 2ZH6A 3TQ1A 3PW4A 3T5LA 1ZQCA 1S0VA 5J2KA 8ICVA 4RPYA 3V6KA 4ECVA 1TVAA 4EBKA 2XY6A 4KITB 1TV9A 2AJQA 5IIIA 4I2JA 5CR0A 3K75D 3GIJA 3ZDBA 9ICVA 4C8KA 4GXJA 4DL3A 4QZ8A 4KLMA 4WC0A 4B9TA 1OU5A 4XQ8A 4PGQA 4EBCA 2LYHA 4DL4A 2BQUA 5L1LA 4P2HA 1MSWD 4I29A 3JYYA 2NRTA 4ECUA 4KTQA 1ZQVA 8ICZA 4NM1A 5IIJA 4UBBA 1ZQYA 8ICFA 3V7JA 1XO1A 2R8KA 2BQ3A 1LV5A 4M47A 3AU6A 4RQ5A 5J0TA 2JEIA 3RB0A 1ZJNA 3EWAA 9ICSA 2NRXA 5J2EA 3HP6A 3HT3A 4ECYA 2FMPA 3PO5A 4O5EA 4R8UB 1F5AA 2M9NA 4LZDA 5HRDA 1ZQKA 4Q8FA 4MF8A 1NJWA 8ICPA 4WC7A 3UQ2A 3WFPA 7ICVA 3PV8A 2IA6A 4X4NA 1JIHA 2ZJ5A 4E0DA 4I27A 7ICEA 5EOZA 4QWCA 3MFIA 1BPDA 2Q0ZX 9ICQA 2NRKA 3HJ4A 2A1JA 1ZQHA 5KFGA 1Z3EB 1NJYA 7ICKA 1BPBA 4JV0A 4UBCA 4UB4A 9ICBA 1NZPA 3GV8B 5IILA 2BE3A 3OUYA 5DQIA 5J0OA 2HHWA 4EP7A 4GC6A 3V6HA 1ZQJA 5J0UA 2J6UA 4DSIA 4X4VA 2W9AA 4NXZA 4Q8EA 3KHGA 4QWEA 7ICJA 2BGWA 2ZH5A 1C7YA 4J9PA 1A77A 3C1YA 5KFRA 1PZNA 4YVZA 1L3VA 1S10A 3HW8A 4DQQA 9ICJA 4QZHA 2FPMA 4R64A 4O3OA 4RQ7A 1XSLA 4DSJA 8ICXA 2ASJA 2ZH7A 1DK2A 5KFVA 1ZQNA 2R8HA 1ZQFA 5D49A 4PH5A 3NYBA 4AT9B 3PMNA 4O3RA 5DDMA 3RB6A 2MAXA 4FHVA 1HUOA 1DGSA 3GIKA 4R8UA 1K1SA 4YN4A 5KFNA 1RXVA 3V72A 2HHPA 1ZQGA 2GWSA 4XUSA 1NKEA 2IHNA 5KG7A 4I2CA 5J0QA 1ZQBA 4M04A 4RPXA 3TARA 1QTMA 3WFRE 1TFRA 2W8KA 4MF2A 4J9KA 2Q66A 2KTQA 1X9SA 5J2AA 2ZH9A 2I1QA 5DG9A 4JV2A 2F1IA 1LB2B 4BDPA 3FDSA 3MABA 2BPCA 4ECQA 1ZQAA 1KSPA 5DB8A 3B0YA 5HHHA 4ED1A 4F5QA 4DS5A 2PI5A 4IRDA 2DR7A 3NTUA 4ZH4A 9ICMA 4WC3A 5HMLA 3K4GA 5F2VO 5BPCA 1QSSA 3AQKA 4IQVA 2P6UA 4RQ0A 4FBTA 5DG8A 3OHBA 2KZMA 9ICIA 2HVHA 4K4HA 1NO5A 3RH5A 3RAXA 3ISDA 1SL2A 3H40A 4DL2A 4KLGA 3BQTA 4F5NA 1JXEA 3QEAZ 2W8LA 3RAQA 2AGPA 4B9SA 4PHPA 3GV5B 8ICYA 4DEZA 3LDAA 3GIIA 1JXLA 5DKWA 4FHYA 1D8YA 1MIWA 3GDXA 3JPRA 9ICOA 3RBEA 3PNCA 2OWOA 2P6RA 2BR0A 8ICIA 3WFQE 5J0WA 3QZ8A 2AQ0A 3BDPA 1RYSA 3RJGA 3T5KA 4KLOA 2AQ4A 5J2FA 1T8EA 3KHLA 4DSFA 8ICAA 3RJJA 1MQ2A 4PHAA 3PX4A 5KFXA 4DS4A 4DQSA 3OSPA 4KN4A 4R63A 1BPYA 2A1JB 3THVA 5J2GA 4ELUA 8ICEA 3Q8QB 3M8SA 2FLPA 5KG0A 1XSNA 1IXRA 4RQ4A 3OVBA 3E2EA 1XWLA 5TZVA 1S77D 2ZUCA 1COOA 8ICCA 4AT7B 5IIMA 1XU4A 4DL7A 1TKDA 2ZH1A 2C2RA 5KFKA 1KFDA 4F4ZA 4YD2A 1U4BA 1S76D 3N4MB 4QZCA 3RJFA 1ZQMA 4EBJA 4RQ3A 3ORYA 3UPQA 3KTQA 2O1PA 4R65A 3ISCA 4IRKA 1NK7A 4XQ7A 8ICNA 3SZ2A 4C8MA 2C2EA 4X4TA 3LWLA 3WFSC 4Z6DA 2W9CB 5DQHA 3RB3A 4BGDA 5D46A 1CUKA 2IHMA 4RWOA 2ZJAA 4B9NA 2KFZA 1EXNA 2ZTCA 4Q45A 3KHRA 2ASDA 3OVAA 4UD5A 4I2IA 4FHXA 3H7IA 4C8NA 3V7LA 9ICKA 5L1JA 2HHUA 9ICFA 1Y88A 5KG5A 4J9OA 3LK9A 1SKRA 1X9WA 5HRGA 1VJ7A 4TURA 3C18A 7ICFA 5EWFA 4MFAA 4TUQA 2IBKA 2MUTA 1ZQPA 1ZQSA 3QE9Y 1XSPA 4KMUA 3GILA 3BJYA 4BWJA 5J0RA 4DL5A 4CCHA 4J9LA 4YG2A 4M6WB 4XA5A 3RTVA 1JX4A 4F4KA 5J2CA 1NJXA 4O3SA 5CP2A 1R8AA 1KNYA 3T3FA 3C1ZA 3PW2A 4JUZA 3BQ2A 1SKSA 2M2VA 2FMSA 1D9FA 3C21A 1S0OA 4PHEA 2XCPA 8ICBA 4ED7A 4EYHB 4QZEA 4ED8A 4J9NA 1T7PA 1A76A 1D8LA 5KFZA 3LQCB 5HRBA 4O5CA 4X0AA 3RJKA 4UAYA 3JZ0A 5KT5A 4UB3A 3OJUA 1QSLA 3H8SA 1D9DA 2ZH3A 3G6VA 3G6XA 3C5FA 3PW0A 4KN7A 1TK0A 4F2RA 4NY8A 4G3IA 8ICQA 4Q43A 1NK5A 2DVIA 3OVSA 2DPJA 4DO9A 1HUZA 2JZBA 3PR4A 4MEXA 4KLEA 4ECXA 5DBCA 9ICCA 4QW9A 4IR9A 1L5UA 1TFWA 2MUTB 2HHXA 8ICUA 4FO6A 3PMLA 4P4PA 9ICNA 3RRGA 1L3UA 3C2LA 1YLQA 2XC9A 4TUSA 2NRZA 4GXIA 5KFMA 4ECTA 1HJPA 4DOBA 4ECRA 2C2DA 1ZQEA 5L1IA 5KG3A 1V4AA 3WFOA 4RPZA 4F92B 3GFKB 4WC2A 1ZYQA 1WOTA 4GLXA 2HHQA 2ZTEA 3MDAA 7ICQA 4RUCA 5KFYA 2FPLA 2HHVA 2UVRA 4TUPA 1TAQA 3Q8LA 3N97B 4YXJA 4RNNA 5KFUA 3M9NB 4EBEA 5DB7A 5DB9A 1S97A 3MGHA 1KDHA 4NLKA 1B22A 9ICXA 2W9CA 5KFBA 4ED2A 5HRHA 4UQGA 4YMNA 2AGQA 2UVVA 5KG4A 4ED6A 2C28A 2RDIA 5L9XA 1UETA 1R89A 1K1QA 4IQWA 4KLFA 3GQCA 4KLHA 5KFWA 2R8JA 4FH3A 1MQ3A 4YP3A 1BNOA 3H37A 3UPSA 1JN3A 5DBAA 5IIOA 4BWMA 3MR2A 5J2BA 3PW5A 3C66A 2RDJA 4KLQA 2KZ3A 1ZQOA 5L1KA 4ECSA 1MIVA 4M0AA 4YR2A 2NRVA 4IG8A 1Z00A 4M9LA 4PGXA 3MBYA 5DECA 1UEVA 5CJ7A 5J2JA 4PPXA 3PX6A 1RPLA 5KT7A 2FLLA 4NLGA 4M5DA 5HHIA 4F2SA 4JV1A 3AU2A 3UXNA 1T4GA 2F1JA 3RRHA 3RBDA 2UVUA 4I2EA 3JPNA 4JWNA 2M2TA 3HWTA 4ATBB 3RR8A 5KFDA 1QLNA 4YFKA 1TK5A 5C5JA 4J9RA 3LWMA 4J9MA 2V4QA 3OJSA 3ISBA 4DLEA 7ICGA 2KZZA 1U9LA 3H4BA 2B21A 4E80A 2JEGA 4C8OA 4NLZA 4I2AA 4M6WA 4ECWA 3GV7B 1L3SA 4M2YA 5KG6A 5KFFA 4F5RA 2HHTA 4EZ9A 4MFFA 1TAUA 1SZPA 4UB5A 2ISPA 4AT8A 2DR9A 3RH4A 1DK3A 4Z6FA 4XRHA 3ZDCA 3H4DA 8ICWA 1H38A 2ZJ8A 4ELVA 3PW7A 2R8IA 3OGUA 2JZBB 3IM1A 5HRLA 4NKUA 3G6YA 1AROP 2JEJA 5KFHA 2BQRA 4BXOB 2W9BB 3ETLA 3UXPA 4F8RA 2W9MA 2BKEA 2PBEA 1VFGA 2BCRA 4K4IA 1PX5A 4I2FA 1RXWA 2HW3A 5HRIA 4QZAA 9ICTA 2ZTDA 2RFFA 5KFPA 4RQ1A 1FA0A 1JAJA 1NK4A 1ZQXA 2ZHBA 4KLTA 4Q44A 3ZD9A 1ZETA 1X9MA 9ICPA 1BPXA 1DOQA 4EBDA 3TI0A 3EPGA 2ZUBA 4RQ8A 1WCNA 1WCLA 4UAWA 3SYZA 8ICSA 4F5OA 4M9NA 4DQPA 5EWEA 4X5VA 4K4GA 1XS9D 3AUOA 2ALZA 3T5HA 1CEZA 1BNPA 4GC7A 5KT2A 2VA8A 4X4SA 4EYIB 4DOCA 4WC4A 4QZGA 2AU0A 5HREA 1UA1A 1ZQTA 5BOMA 5IINA 2VANA
chains in the Genus database with same CATH superfamily
3AN1A 4EEYA 4Y2RA 1U48A 3TFRA 2H3QA 1U45A 3OUYB 1J2MA 3IG5A 2EH9A 1QQ7A 5BOLA 1ED1A 4IC9A 1N56A 4I2GA 3PVXA 1MC8A 2QB0B 3GIMA 2M2WA 1M6YA 4RQMA 4DFMA 3JPQA 4DFJA 8ICGA 3EZ5A 2NV3A 3WKBA 1UEUA 3SAHA 4QZBA 3C28A 1Z00B 4HYKA 5CA7A 1ZQRA 2XGPA 1RYUA 3RJEA 1MA7A 5DGAA 4US8A 4AT7A 1JMSA 2HHSA 1SIJA 4WCWA 2DPIA 3PX0A 3F2BA 4JK1A 4ICAA 2HI0A 1U49A 4F5PA 3N7SC 2PFNA 4GFJA 3DEEA 4C8LA 4DSLA 2DR5A 7ICNA 5DQGA 5FP0A 4YD1A 5F9LA 2H5XA 2PMZC 3HIYA 8ICTA 4OO1J 1R8CA 2MSNA 4CGZA 1SWWA 4BXOA 3KBBA 2ES6A 2I9GA 2R18A 4FHWA 5J0SA 1NJZA 4FO1A 3C23A 4YXMA 4O0IA 4FFDA 2OHFA 3QYPA 3SI8A 2LMRA 4FH5A 4I2HA 4ED3A 3MR6A 2XCAA 2ISOA 4K98A 1BGXT 4P4OA 2Y1JA 7ICHA 4NXUA 4DOAA 1V9PA 5KFIA 3IV6A 3WK5A 4YMOA 3HJ1A 5T14A 2KOBA 7ICMA 4CNQA 2E8PA 4WC6A 4Y2SA 3B0XA 3QZ7A 9ICWA 4NM2A 4IR1A 3TAPA 4EELA 1XC9A 3QU9A 3D2SA 5CEHA 5DG7A 2Y1IA 1ZOLA 4RWNA 1L7OA 4FS2A 7ICOA 2YTUA 2F8LA 8ICHA 1TK8A 8ICMA 3LVWA 5DEDA 5ALTA 1R8BA 2PI4A 1B43A 1KBUA 2V4RA 4I2BA 4DFKA 4DQRA 9ICGA 3KZIU 3FYHA 4J9SA 4S3NA 5HP4A 3BZKA 4AT9A 1UA0A 1T94A 2ZUDA 3F2CA 2KNJA 4KLDA 2B6GA 2D6FC 1JALA 3BQ7A 4RWQA 4ATBA 2YMPA 1SL0A 3NKUA 4DLGA 4GXKA 3MR3A 3D2QA 3K1RB 2J6SA 2ZH8A 1JROA 5AICA 4YMMA 3H3AA 4I2DA 5J0PA 3NASA 2J6TA 2HN2A 5KFAA 2BHNA 4RQ2A 4R66A 5KFOA 1U47A 3TQ1A 3PW4A 3T5LA 2KG5A 2CPRA 3ONNA 4EBKA 4CF4A 1TV9A 2E3TA 5IIIA 2AJQA 2HOIA 1L8LA 4DL3A 4EBCA 4B6JA 4P2HA 1MSWD 4U6PA 5IIJA 3AM9A 1ZQYA 8ICFA 2R8KA 2IUBA 2JEIA 3IDWA 2NRXA 3HP6A 3PO5A 2HDOA 4BJQA 1AQ6A 4LZDA 3RFAA 4Q8FA 3CW2C 1NJWA 4WC7A 3WFPA 3J81j 4U7CA 4I27A 4QWCA 1BPDA 9ICQA 5D62A 2A1JA 3MGVA 4QJFB 1NJYA 7ICKA 4UBCA 4UB4A 4EV6A 4GC6A 3B9JA 4PJ0U 4NXZA 4QWEA 3WKDA 5AKHA 1C7YA 3C1YA 4YVZA 1S10A 3HW8A 2FPMA 2ZH7A 4O3OA 8ICXA 4DSJA 1DK2A 3PSTA 4PH5A 3WKAA 5CFTA 3PMNA 4O3RA 5DDMA 4LEYA 2MAXA 2G06A 4Y2XA 1K1SA 2H3VA 5HR6A 1JUDA 2GWSA 2WF6A 4A8EA 4XUSA 1NKEA 4I2CA 5J0QA 2XI9A 4FZMA 5B3QA 4RPXA 3TARA 1TFRA 2ODGA 4MF2A 2KTQA 2F1IA 4BDPA 1KSPA 1UPHA 4IRDA 1UEVA 4ED1A 4ZH4A 4NXXA 4WC3A 3AQKA 2W3SA 4FBTA 5AK6A 1UQVA 3FAHA 3RH5A 1SL2A 3H40A 4DL2A 3F5AA 3QEAZ 2AGPA 4PHPA 3GV5B 3ALRA 5B5EU 5DKWA 1D8YA 3GDXA 9ICOA 8ICIA 1L7PA 5J0WA 3TADC 1T8EA 8ICAA 4G9BA 4DS4A 4R63A 4QIWF 5ALLA 1RM6C 5KG0A 2EZYA 1XWLA 1S77D 2ZUCA 5IIMA 2OH2A 4C7YA 4QZCA 3RJFA 3ORYA 4AYBF 4IRKA 1NK7A 4XQ7A 1SXDA 2B56A 2C2EA 4X4TA 3WFSC 1N60A 1FO4A 3RB3A 4BGDA 5C0YA 3CNHA 3EUB2 4C8NA 3O0FA 1SV0C 9ICFA 1Y88A 5KG5A 1SKRA 2G5HB 4MFAA 2IBKA 2MUTA 1ZQSA 3QE9Y 4DL5A 4BWJA 5J0RA 4P0PB 3RTVA 4YG2A 1JX4A 3KOOA 5J2CA 1KNYA 2Y9UA 2E8OA 1HIWA 4EYHB 3I1YA 4QZEA 4P0QB 3LQCB 2VJ5A 4X0AA 1LKYB 1B0XA 1RQLA 3H8SA 3E58A 3QX7A 1DXSA 3G6XA 4NY8A 4EEKA 2W55A 2EDUA 2DPJA 2W43A 4DO9A 2K60A 2ZG6A 5K4LA 5DBCA 4ECXA 1ZXIA 4NXWA 2DQNB 1ZD4A 2WF5A 2XC9A 2KVSA 2GAFD 4DOBA 5L1IA 5KG3A 2AH5A 3GFKB 2HHQA 2KIWA 3MDAA 2QKQA 4C4RA 4TUPA 2K89A 3EF2A 1J2NA 3N97B 5DB7A 5DB9A 4OJ5A 5A0LA 4UQGA 5KG4A 4ED6A 4KMOB 1R89A 4IQWA 4FH3A 1BNOA 3MCRA 1ECWA 4BWMA 5J8YA 5J2BA 5F3XB 4ECSA 4Y2PA 5ALYA 2NRVA 1Z00A 4PGXA 3MBYA 5DECA 5J2JA 3PX6A 3K7DA 4NLGA 5ALHA 5HHIA 4F2SA 4JV1A 3UXNA 3HWTA 4YFKA 5L1MA 2Z7JA 4ECWA 1WYGA 1L3SA 5KG6A 2DR9A 3RH4A 1H38A 3IM1A 5HRLA 2BBHA 5CRXA 4Y2UA 1Z1BA 1PK3A 2EAMA 2BQRA 2W9BB 4BXOB 3SD7A 1VFGA 2JXJA 2BCRA 4I2FA 5HRIA 4QZAA 2ZXHA 4RQ1A 1ZQXA 4KLTA 4Q44A 3ZD9A 2DGZA 1X6JA 1BPXA 8ICSA 5ALSA 4UAWA 3H8MA 4M9NA 4JLZA 4K4GA 1Z4OA 5KL8B 5AI9A 4GC7A 4EYIB 4WQLA 2LI6A 2AU0A 1UA1A 8ICQA 5BOMA 5IINA 2VANA 4YQWA 4KLUA 4X4QA 3BQ0A 1C20A 5HC9A 2E8NA 2DR8A 2A19A 4LVSA 3C5GA 1MIYA 3L4PA 2ASLA 4TQSA 4KLSA 2DL0A 4P4MA 1NK8A 4O67A 1NK6A 4O9MA 3PO4A 9ICHA 2XO7A 2WAQF 1KEJA 2FMQA 4M9HA 2G0AA 4AT8B 2LKYA 3ZDDA 4UASA 2F44A 4UB1A 2KN7A 2XICA 2KFNA 2Y0SF 2VIXA 1S0NA 5D61A 4UB6U 2VA3A 4UAVA 1Q46A 5DDYA 1L7NA 1NK9A 2DRBA 5EWGA 5ALUA 3NVYA 4F4YA 1BPEA 4F3OA 4X4PA 4RWPA 4UB8U 4LZGA 2MRLA 1L3TA 3T5JA 4F93B 4N7RA 3MFHA 4F4WA 1X2IA 2ZXIA 2PFOA 4MHVA 1JI7A 2W54A 2F8KA 3IRUA 3PSIA 4UB2A 5KFCA 4F4XA 3H38A 4K9AA 1ZJMA 2BCQA 3OHAA 2EAOA 3RR7A 5KG2A 2JH7A 4DL6A 3E0FA 3NRZA 3OPXA 1Q78A 4MKPA 2UVWA 4RT2A 4OCZA 1NK0A 4QZDA 1B4FA 3QUTA 3V7KA 1KFSA 1CRXA 9ICUA 2VA2A 7ICPA 5DLGA 3EW9A 3A0BU 1TFYA 5HNKA 9ICRA 4WBYA 3MGIA 3AQMA 3Q8RB 1RQNA 2AGOA 4O3QA 2MA1A 5HMMA 3JPSA 4YR3A 5IIKA 5AM4A 1PK1B 5KG1A 4P0PA 2WF7A 5CB1A 1ZD5A 5KFLA 4BX9C 2LYAA 4F91B 5B3PA 4Z6EA 2LHTA 4GIBA 4E7XA 3H8WA 2R8GA 3ZDAA 1ZQUA 3M8RA 3IHQB 3D2NA 4QWDA 4M9GA 3EPIA 5AKEA 5KFJA 4CF5A 4WBZA 2DUYA 1JQRA 7ICSA 3C2KA 4QZFA 1KLNA 4KLLA 3JPTA 2H3ZA 2JMGA 5ALVA 2Y0SC 1N5XA 2PKEA 1D8BA 1ZQCA 8ICVA 1L6NA 4RPYA 3V6KA 2JGAA 4I2JA 3K75D 3GIJA 5AM3A 5KL1B 4QZ8A 4KLMA 1VJ5A 2LYHA 4DL4A 2BQUA 3F53A 2KVCA 2NRTA 4ECUA 2CRXA 8ICZA 5EE1A 4NM1A 4UBBA 4AYBC 3V7JA 3ZI4A 2BQ3A 3AU6A 5AK3A 5J0TA 3RB0A 1ZJNA 5J2EA 4WQKA 1YZ6A 3HKZF 4JMUA 4O5EA 2AXTU 4HX0A 1X6IA 4OAGA 5EOZA 2OXOA 2NRKA 1ZQHA 5KFGA 1BPBA 4JV0A 5J0OA 1SV4A 3V6HA 4DSIA 4X4VA 2W7PA 2W9AA 5G5HA 1A77A 5KFRA 1PZNA 9ICJA 4QZHA 4R64A 3SR6A 2R8HA 3KFUF 4AT9B 3RB6A 1HUOA 3GIKA 4R8UA 3V72A 3T79A 2K8CB 5D63A 2IHNA 5KG7A 4M04A 3WFRE 2E1EA 2RP5A 2I1QA 5DG9A 4ECQA 2BPCA 2PI5A 2KICA 5HHHA 2D8CA 5DB8A 4F5QA 2DR7A 3NTUA 4JLXA 2W7OA 3K4GA 2ZIUA 2P6UA 1RDFA 5AI0A 3OHBA 9ICIA 4WJ3B 3K1ZA 3GU3A 3RAXA 3CK6A 4PL2A 4Y2JA 2WF8A 4DEZA 3LDAA 4EENA 3GIIA 3WFQE 2P6RA 4BUGA 3PNCA 2OWOA 4OJ6A 3BDPA 4KLOA 5J2FA 1A0PA 1MQ2A 3QNMA 5KFXA 4DQSA 2AHOB 3THVA 3KKAC 3R9KA 1XSNA 1IXRA 4RQ4A 2RRDA 5AK4A 2YMQA 1KL9A 4AT7B 1J97A 3NVVA 3FC4A 4DL7A 4EEBA 2ZH1A 2ZIXA 1KFDA 2KKPA 1ZQMA 3UPQA 1A6SA 3KTQA 2YN4A 4Z6DA 1K5OA 3C29A 1CUKA 1GO3F 1EXNA 3IP4B 5CFSA 4O3MA 4KX3A 9ICKA 2HHUA 2D3DA 3LK9A 4K97A 1VJ7A 5ALFA 7ICFA 5EWFA 1NNLA 4C80A 4IS7A 4KMUA 3GILA 3BJYA 4F4KA 3SMVA 4O3SA 4XA5A 4M6WB 1NJXA 5CP2A 3T3FA 3PW2A 3BQ2A 2FMSA 4NWIA 2W11A 5ALKA 3CP8A 5AI5A 2HOQA 2FCLA 3DDHA 1D8LA 5KFZA 4O5CA 3JZ0A 1D9DA 3QXGA 3G6VA 3C5FA 4KN7A 1TK0A 1NK5A 3OVSA 2JZBA 2OYYA 4QW9A 4IR9A 1L5UA 2MUTB 4P4PA 3M6ZA 3U26A 3RRGA 1YLQA 1L7MA 3QU2A 2C2DA 4C0ZA 2FE9A 1V4AA 3WFOA 4F92B 4WC2A 1ZYQA 2UVRA 1TAQA 3HJEA 2KJ8A 3M9NB 5EE9A 1S97A 4ED2A 5HR9A 2ZHBA 4C4SA 2UVVA 2C28A 5AKLA 5KAFU 4KLHA 5KFWA 2R8JA 1MQ3A 3WU2U 2ZIXB 3MR2A 3OWGA 2KZ3A 1KW4A 1WUDA 4EX6A 4YR2A 4UATA 1FEZA 5EE3A 4CE6A 1Q8KA 3RBDA 2UVUA 4I2EA 1O03A 2YB1A 2M2TA 1N2XA 3JPNA 1QLNA 1TK5A 1DRGA 4J9RA 2KZZA 3OJSA 4KB6A 1U9LA 2LYBA 3L5KA 4C8OA 4NLZA 2EZZA 5ALMA 5JRTA 2KD1A 5ALXA 1WWUA 4MFFA 1SZPA 1TAUA 2ISPA 1DK3A 4Z6FA 3ZDCA 2PMZF 2JZBB 2KMDA 1AROP 2JEJA 4F8RA 3ETLA 3UXPA 4K99A 4K4IA 1PX5A 1ZRMA 3NRWA 9ICTA 5G5GA 1NK4A 4OAFA 1X9MA 1ZETA 1DOQA 3TI0A 4AT8A 2ZUBA 1WCNA 2W03A 4DQPA 5EWEA 2CN1A 4X5VA 1CEZA 1BNPA 1GPJA 4DOCA 5HREA 1ZQTA 3AQEA 8ICPA 1ZRNA 4WOYA 4UAZA 2W04A 2PXIA 4RNOA 5TISU 4ELTA 2WHEA 3HX0A 2A1AA 4ED0A 3QU4A 4X4OA 5F9NA 7ICLA 2BDPA 2HN1A 4DSKA 4K9BA 1BVSA 1L8OA 2E5SA 2B51A 4IQTA 5ALDA 1ZQDA 1FFVA 2C22A 2YY6A 4OD0A 3OTQA 4EZ6A 2XY5A 2IHOA 5J0XA 8ICKA 3PHZA 5B66U 3ER9B 3M9MB 2ZH2A 1UHUA 4FHPA 2VJ4A 2IOFA 3TAQA 3DV9A 1N5WA 2M2UA 1URJA 3QUCA 2KP7A 5J2IA 3SV3A 4K96A 2FPKA 8ICOA 3OSNA 3SEIA 3NWIA 2F1HA 1N48A 2HBLA 4I28A 3VC8A 2W9BA 4JWMA 2DRAA 2JEFA 1XO0A 3UM9A 2H3FA 3TFSA 5ALGA 4B9UA 2V9WA 4DQIA 2VKQA 5DGBA 4O6AA 4FS1A 3H39A 4PHDA 3V6JA 2DKZA 2ZIWA 1S0MA 2K8AA 1S8OA 2EANA 3EYZA 5CWRA 4IQUA 2PFQA 4F50A 1F44A 1SWVA 1S9FA 2K4IA 3QU7A 2HVIA 5JU5A 8ICLA 7ICUA 1WWVA 4OJPA 2BCSA 4FBUA 3UXOA 1F0MA 2WTFA 2ZH4A 4DF4A 2EWRA 3MR5A 3Q8KA 4NKTA 1ZQIA 2XGQA 4AP9A 3RB4A 3ETRA 2QARB 3Q8PB 5ALRA 4FZNA 1SKWA 4DSEA 4O5KA 5EE0A 1FFUA 5KT4A 4QWAA 2PFPA 1KTQA 2GA9D 1V38A 4PZOA 3TANA 3NVOA 1SL1A 1RYRA 5DLFA 3QUQA 1YT3A 2WFAA 2HMXA 9ICLA 3JCFA 4UW9A 1SV0A 5J29A 2G07A 1KFTA 4P0QA 3NGDA 3RJIA 3H0LB 5DBBA 2HBJA 3QU5A 8ICJA 3QUBA 9ICEA 4X0BA 5AI6A 3S6JA 5KT3A 1ZQQA 1BPZA 2NO4A 2ZIWB 5J2HA 3MC1A 1SB3C 3C2MA 1NOMA 2ZH6A 2KHVA 1S0VA 5J2KA 2Q4TA 3TKAA 5CR0A 9ICVA 4C8KA 4C4TA 4GXJA 4WC0A 4B9TA 4XQ8A 4PGQA 5L1LA 4I29A 1ZQVA 4M47A 1LV5A 4RQ5A 2HSZA 5H2FU 3EWAA 4ECYA 2FMPA 2YB4A 4R8UB 2M9NA 5HRDA 1NZBA 3BS5B 4PZNA 3UQ2A 3TACB 2YMMA 5ALPA 3PV8A 2IA6A 7ICVA 4X4NA 1JIHA 3HJ4A 3IG8A 2GLEA 1Z3EB 2F3NA 3GV8B 2JRZA 3OUYA 5DQIA 2HHWA 3PZPA 2LM4A 1ZQJA 5J0UA 2OM6A 4Q8EA 3KHGA 2MU2A 1Q3UA 2BGWA 1HEKA 2ZH5A 1KQQA 4J9PA 1L3VA 4EEDA 3ERCC 4PL1A 1XSLA 1OXJA 4NLCA 4X4UA 3HILA 2ASJA 5KFVA 1ZQFA 5D49A 1ZQ1C 5AHXA 3NYBA 2YMLA 2LBOA 4FHVA 5AI4A 2H3IA 5KFNA 1RXVA 3A0HU 2DBYA 2W3RA 3WK6A 1QTMA 2W8KA 2QB1A 2K4HA 2ZH9A 3FDSA 4KLIA 4NLNA 1ZQAA 5AKKA 4DS5A 2WF9A 9ICMA 5HMLA 5F2VO 5ALJA 5BPCA 3IN5A 2EAPA 4IQVA 2GOLA 5JTIA 5DG8A 2DF4B 2FJ6A 2HVHA 4K4HA 3ISDA 4NJ8A 4F5NA 1JXEA 2W8LA 3RAQA 2QB0A 3LVVA 4FHYA 1MIWA 2BR0A 3QZ8A 2YQEA 1RYSA 3T5KA 2AQ4A 3KHLA 4DSFA 1Q3VA 4PHAA 2ZIUB 3OSPA 4KN4A 3D6JA 2A1JB 4KM5A 1QH9A 4UARA 2E1FA 4QNLA 4Y2QA 3OVBA 4NLBA 3GZFA 5TZVA 5CHEA 8ICCA 1TKDA 2BDUA 5KFKA 2ZIVB 3N4MB 4EBJA 4RQ3A 1SZHA 2RQ5A 4R65A 3ISCA 1PVQA 8ICNA 3SZ2A 4C8MA 3LWLA 2HBKA 5DQHA 4OAHA 4RWOA 2ZJAA 2ZTCA 4NV0A 3OVAA 5ALWA 4I2IA 4FHXA 4J03A 5L1JA 4J9OA 1X9WA 4TURA 2K8BB 3CRXA 1ZQPA 4J9LA 1KN5A 4JUZA 2XIDA 5AI8A 1D9FA 3C21A 1S0OA 4PHEA 4ED8A 1T7PA 2KV2A 4RQNA 2O6KA 5HRBA 1RG6A 5KT5A 4UB3A 3OJUA 3PW0A 4F2RA 1Z4NA 1X42A 3F5EA 4Q43A 2DVIA 1KKXA 1UCVA 4KX5A 3PR4A 4MEXA 2KE7A 4O68A 1TFWA 4FO6A 3PMLA 1ZD3A 4I0UA 1SGGA 4GXIA 4ECTA 1HJPA 4ECRA 1PVRA 1ZQEA 4RPZA 3WK8A 4QIWC 2KSOA 4GLXA 7ICQA 5KFYA 4CDGA 2HHVA 2EZXA 3Q8LA 4YXJA 1B22A 4NLKA 3MGHA 9ICXA 5KFBA 4YMNA 3FM9A 2RDIA 2JR5A 1LVHA 3H37A 3UPSA 5DBAA 2N1RA 2RDJA 5L1KA 1MIVA 4M0AA 4JB3A 5CJ7A 2FLLA 2NYVA 4M5DA 3RRHA 2F1JA 4IL6U 4JWNA 2I5HA 4ATBB 5KFDA 7ICGA 1XNSA 2V4QA 3ISBA 1CI4A 3RF9A 2B21A 1PVPA 2JEGA 4ACOA 2F2AB 4I2AA 2HCFA 3GV7B 4M2YA 2HHTA 5KAIU 3H0RB 4XRHA 4ELVA 3PW7A 2R8IA 4UAUA 3OGUA 5AM0A 3WKEA 2A3VA 4NKUA 3G6YA 4EX7A 5KFHA 5HR7A 1FIQA 1IV8A 4USAA 2ZTDA 2RFFA 1JAJA 9ICPA 4KLGA 3SYZA 3AUOA 4K8VA 3T5HA 2E8MA 2VA8A 4X4SA 3HRDD 3BQ1A 2G09A 5AKIA 5HRFA 4WH5A 1VLBA 3TADA 2QLTA 4QZ9A 2P66A 4B9MA 4F71A 4CF3A 4TQRA 5KTQA 3SV4A 4OJLA 5E79U 5AM2A 3N28A 4DWIA 1V85A 2B4VA 2F77X 5KT6A 3RH6A 3SENA 9ICAA 2O5AA 5JUMA 5HRKA 1Q79A 1UT8A 1ZQZA 5D4BA 5GTHU 1NKBA 3WK4A 1KRPA 1PK1A 3MDCA 4PGYA 3AMZA 2BPFA 7ICRA 3N7PD 5KFQA 3F2DA 3SAGA 3QEBZ 4KLJA 2KHQA 4Z6CA 3PY8A 1Z1VA 4ZOHC 3PSPA 4M9JA 3ER8C 4WC5A 3H8JA 1UT5A 2LM1A 4C7ZA 4QZIA 4CRXA 4O3NA 4X4RA 1SXEA 3BS7A 4RZRA 4DFPA 3KD3A 4WC1A 4RU9A 4IRCA 3ZDEA 3ZD8A 2KSOB 4J9QA 1T3QA 3KHHA 1MN8A 2KIVA 8ICRA 2IMWP 5KFSA 4ECZA 4UD4A 2GO7A 1X66A 3PSFA 4MEYA 2NRWA 2XVTA 3M9OB 3LYSA 3NVWA 3PR5B 1N61A 3L9DA 4DF8A 5DB6A 3JPOA 2F76X 3UMCA 1NI3A 3HPOA 2ZHAA 4B9VA 1IG6A 5J2DA 3AQLA 4NXVA 5J0YA 5AKYA 2KK0A 2K4PA 3UQ0A 4US9A 5AKJA 5AIAA 1V97A 3RJHA 3HKZC 1T3NA 3I76A 2BCVA 4E8FA 4RNMA 2BBJA 7ICIA 2BCUA 2BPGA 1YZ7A 1RZTA 3JPPA 4OAIZ 3AQNA 2KKVA 3Q8SB 1NKCA 4LEVA 1ZQLA 4RQ6A 3Q8MA 1ZQWA 4YCXA 3SAFA 4LEZA 4LT6A 4QWBA 2BZFA 2ID1A 5KFTA 4O3PA 2KEYA 1QSYA 4RT3A 1IM4A 4YR0A 2XY7A 4HAIA 4QW8A 5ALEA 2FLNA 1X9XA 2ATLA 3WK7A 5KFEA 4RUAA 5CHGA 4B9LA 5ALZA 7ICTA 4F72A 2JH1A 1N63A 4XJEA 2RLTA 2EQYA 4ECVA 1TVAA 2XY6A 4KITB 3ZDBA 2DKXA 2KJ9A 3WKCA 1OU5A 5ALNA 3JYYA 2IOHA 4KTQA 1DGJA 1XO1A 9ICSA 1Z19A 3HT3A 1OW5A 1F5AA 1LKYA 1QCKA 1ZQKA 1COKA 4MF8A 3M7DA 2B0CA 2ZJ5A 4E0DA 7ICEA 4FZLA 3MFIA 2NO5A 2Q0ZX 1TAMA 9ICBA 1NZPA 2BE3A 5IILA 4EP7A 2J6UA 7ICJA 2OCEA 4DQQA 4RQ7A 1ZQNA 2L5YA 4EGWA 1DGSA 4YN4A 2HHPA 1ZQGA 1ZQBA 2KJ5A 4Y2YA 4J9KA 2Q66A 1X9SA 5J2AA 4JV2A 3L3FX 1LB2B 3MABA 3B0YA 1QSSA 4RQ0A 1TE2A 2KZMA 2CXYA 2DWQA 1NO5A 3BQTA 3I28A 5AKZA 4B9SA 8ICYA 1JXLA 3JPRA 2RHFA 3RBEA 1O08A 2AQ0A 5CFUA 2WB1F 3RJGA 3H0MB 4FE3A 3RJJA 3PX4A 1BPYA 5J2GA 4ELUA 8ICEA 3Q8QB 3M8SA 2FLPA 2OEHA 1F5SA 2FDRA 3E2EA 1COOA 1XU4A 2IOFK 2C2RA 1OUQA 4F4ZA 4YD2A 1U4BA 1S76D 5AM5A 2HBMA 2O1PA 3ED5A 2W9CB 1VDVA 3AQFA 2WB1C 5D46A 3KZXA 5ALQA 2IHMA 5AM1A 4B9NA 2KFZA 4LEWA 4Q45A 3KHRA 2ASDA 4UD5A 3H7IA 3V7LA 2Y9TA 4O69A 5HRGA 3C18A 4Y2TA 4TUQA 1XSPA 2QARA 4CCHA 5KNIA 3OV7A 9ICNA 1R8AA 3C1ZA 1SKSA 2M2VA 5AKGA 2XCPA 3BS5A 2JHDA 4ED7A 2K4EA 4J9NA 2M0NA 2GH1A 1A76A 3RJKA 4UAYA 1QSLA 2LPEA 3VCBA 2ZH3A 2JV3A 4NL9C 4G3IA 2WAQC 1HUZA 4KLEA 9ICCA 2G08A 3N7RC 2HHXA 8ICUA 5ALIA 1QQ5A 1L3UA 3C2LA 4TUSA 2NRZA 3CYMA 5KFMA 2YX8A 1WOTA 2ZTEA 4RUCA 2FPLA 5AKXA 5ALOA 4RNNA 5KFUA 4EBEA 1KDHA 2ZIVA 2W9CA 5HRHA 2AGQA 1PUZA 5L9XA 1UETA 3WK9A 1K1QA 4DFDA 1P7DA 1IIPA 3GQCA 4KLFA 1N62A 4YP3A 1JN3A 5IIOA 4NL9A 3PW5A 3C66A 4KLQA 4DCCA 1ZQOA 1QQ6A 3M1YA 4IG8A 4M9LA 4OJOA 3SQIA 4PPXA 1RPLA 5KT7A 1WG8A 3AU2A 4MFCA 1T4GA 1S5LU 3M6KA 3RR8A 3KKAA 5C5JA 4J9MA 3LWMA 4DLEA 3H4BA 4LJXA 4E80A 2HOFA 5J8YC 2P35A 3NVZA 4M6WA 5GTIU 5KFFA 4F5RA 5JTGA 4EZ9A 1X40A 4UB5A 3NS1A 3H4DA 8ICWA 2FI1A 2ZJ8A 3NUQA 3AL0B 3BZCA 5AK5A 5AIBA 1ZD2P 2I6XA 3UMBA 3AEVA 2W9MA 2BKEA 2PBEA 2G5IB 3UMGA 2HW3A 1RXWA 5KFPA 1FA0A 4NXTA 2ESEA 4Y2VA 4EBDA 3EPGA 4RQ8A 1WCLA 3ICXA 1JRPA 4F5OA 1XS9D 2ALZA 5KT2A 4WC4A 4QZGA 8ICBA 2DFLA
chains in the Genus database with same CATH topology
3BQ1A 4YQWA 4KLUA 5HRFA 4UAZA 4EEYA 4X4QA 3BQ0A 2PXIA 1U48A 4RNOA 5HC9A 3TFRA 2DR8A 4QZ9A 1U45A 2P66A 4B9MA 4ELTA 4LVSA 3OUYB 3C5GA 1MIYA 4TQRA 5KTQA 3SV4A 2ASLA 5BOLA 4DWIA 3OV7A 4TQSA 4KLSA 1N56A 3HX0A 4ED0A 5KT6A 3RH6A 4P4MA 5F9NA 3PVXA 4I2GA 1NK8A 9ICAA 7ICLA 2O5AA 1NK6A 5JUMA 4O9MA 1MC8A 3GIMA 2BDPA 5HRKA 2M2WA 1Q79A 1UT8A 4DSKA 3PO4A 1BVSA 9ICHA 2XO7A 1ZQZA 4DFMA 5D4BA 4IQTA 1KEJA 3JPQA 4DFJA 2FMQA 4M9HA 1ZQDA 8ICGA 3EZ5A 3ZDDA 4AT8B 1UEUA 2C22A 4QZBA 1Z00B 4UB1A 4HYKA 1NKBA 5CA7A 2KN7A 1ZQRA 2XGPA 1KRPA 2XY5A 4EZ6A 3RJEA 4MFCA 3MDCA 4PGYA 5J0XA 5DGAA 2KFNA 8ICKA 2BPFA 7ICRA 5KFQA 4AT7A 1JMSA 3M9MB 2ZH2A 2HHSA 1S0NA 4FHPA 3TAQA 3QEBZ 4KLJA 4WCWA 2DPIA 4Z6CA 2VA3A 3PY8A 5DDYA 3PX0A 4M9JA 2M2UA 4WC5A 4JK1A 2KP7A 5J2IA 3H8JA 1U49A 1NK9A 5EWGA 4F5PA 3SV3A 2FPKA 2DRBA 1UT5A 2PFNA 4F4YA 8ICOA 1BPEA 4F3OA 4X4PA 3OSNA 4RWPA 4QZIA 4C8LA 4O3NA 4DSLA 4LZGA 4X4RA 2F1HA 1N48A 2DR5A 4I28A 1L3TA 7ICNA 5DQGA 3T5JA 4F93B 2W9BA 4X4OA 4JWMA 2DRAA 3MFHA 4F4WA 4RZRA 4YD1A 2JEFA 5F9LA 2H5XA 4DFPA 3HIYA 8ICTA 4RU9A 1R8CA 4WC1A 4IRCA 1X2IA 3TFSA 3ZDEA 2PFOA 4B9UA 4BXOA 3ZD8A 2V9WA 2I9GA 4DQIA 4FHWA 5DGBA 4UB2A 5J0SA 1NJZA 5KFCA 4F4XA 3C23A 4J9QA 4FS1A 3KHHA 4YXMA 4O0IA 3H39A 4PHDA 3H38A 3V6JA 3SI8A 1ZJMA 8ICRA 4FH5A 1S0MA 2BCQA 5KFSA 3OHAA 4ECZA 4ED3A 3MR6A 2IMWP 4I2HA 2XCAA 4UD4A 2ISOA 3RR7A 5KG2A 3EYZA 4DL6A 4MEYA 2NRWA 5CWRA 1BGXT 4P4OA 2Y1JA 4KLIA 3M9OB 4NLNA 4IQUA 7ICHA 2PFQA 1Q78A 4DOAA 1V9PA 5KFIA 2UVWA 3PR5B 4F50A 3L9DA 4DF8A 4YMOA 5DB6A 3JPOA 3HJ1A 1S9FA 3HPOA 4RT2A 7ICMA 2ZHAA 2HVIA 4B9VA 8ICLA 7ICUA 1NK0A 5J2DA 4QZDA 2BCSA 5J0YA 3AQLA 4FBUA 4WC6A 3UXOA 3V7KA 1KFSA 3B0XA 2WTFA 3QZ7A 2VA2A 9ICUA 9ICWA 5HR9A 4NM2A 2ZH4A 4DF4A 4IR1A 3TAPA 7ICPA 3MR5A 3Q8KA 3UQ0A 1XC9A 4NKTA 5DLGA 1ZQIA 2XGQA 5DG7A 3RJHA 2DFLA 3EW9A 1TFYA 2Y1IA 3RB4A 1T3NA 2BCVA 4E8FA 4RWNA 5HNKA 4RNMA 9ICRA 4WBYA 4FS2A 3MGIA 3AQMA 3Q8RB 7ICOA 3Q8PB 1SKWA 4O5KA 2BCUA 4DSEA 7ICIA 2BPGA 8ICHA 1TK8A 1RZTA 8ICMA 3JPPA 5KT4A 4QWAA 2PFPA 3AQNA 1KTQA 4O3QA 3Q8SB 2AGOA 5HMMA 1NKCA 4X4UA 3JPSA 3TANA 4YR3A 5DEDA 1ZQLA 1R8BA 4RQ6A 3Q8MA 5IIKA 1ZQWA 4YCXA 1SL1A 2PI4A 1RYRA 1B43A 5DLFA 5KG1A 2V4RA 5CB1A 4I2BA 4QWBA 9ICLA 5KFLA 4DFKA 4LT6A 5J29A 4DQRA 4F91B 9ICGA 3FYHA 4J9SA 1KFTA 4S3NA 3NGDA 4Z6EA 3RJIA 2ID1A 5KFTA 5HP4A 5DBBA 4E7XA 3H8WA 2R8GA 8ICJA 4O3PA 1QSYA 1UA0A 1ZQUA 2ZUDA 3ZDAA 4RT3A 4KLDA 4AT9A 3M8RA 9ICEA 4X0BA 1IM4A 4YR0A 3IHQB 4RWQA 4ATBA 4QWDA 4M9GA 3EPIA 5KT3A 5KFJA 2XY7A 1SL0A 1ZQQA 4WBZA 4QW8A 4DLGA 1JQRA 1BPZA 4GXKA 3MR3A 7ICSA 3C2KA 4QZFA 2J6SA 2FLNA 2ZH8A 4YMMA 1KLNA 5J2HA 3JPTA 4I2DA 2ATLA 4KLLA 3H3AA 5J0PA 2J6TA 5KFEA 3C2MA 4RUAA 5KFAA 2BHNA 5CHGA 4RQ2A 4B9LA 4R66A 1NOMA 5KFOA 1U47A 7ICTA 2ZH6A 3TQ1A 3PW4A 3T5LA 1ZQCA 1S0VA 5J2KA 8ICVA 4RPYA 3V6KA 4ECVA 1TVAA 4EBKA 2XY6A 4KITB 1TV9A 2AJQA 5IIIA 4I2JA 5CR0A 3K75D 3GIJA 3ZDBA 9ICVA 4C8KA 4GXJA 4DL3A 4QZ8A 4KLMA 4WC0A 4B9TA 1OU5A 4XQ8A 4PGQA 4EBCA 2LYHA 4DL4A 2BQUA 5L1LA 4P2HA 1MSWD 4I29A 3JYYA 2NRTA 4ECUA 4KTQA 1ZQVA 8ICZA 4NM1A 5IIJA 4UBBA 1ZQYA 8ICFA 3V7JA 1XO1A 2R8KA 2BQ3A 1LV5A 4M47A 3AU6A 4RQ5A 5J0TA 2JEIA 3RB0A 1ZJNA 3EWAA 9ICSA 2NRXA 5J2EA 3HP6A 3HT3A 4ECYA 2FMPA 3PO5A 4O5EA 4R8UB 1F5AA 2M9NA 4LZDA 5HRDA 1ZQKA 4Q8FA 4MF8A 1NJWA 8ICPA 4WC7A 3UQ2A 3WFPA 7ICVA 3PV8A 2IA6A 4X4NA 1JIHA 2ZJ5A 4E0DA 4I27A 7ICEA 5EOZA 4QWCA 3MFIA 1BPDA 2Q0ZX 9ICQA 2NRKA 3HJ4A 2A1JA 1ZQHA 5KFGA 1Z3EB 1NJYA 7ICKA 1BPBA 4JV0A 4UBCA 4UB4A 9ICBA 1NZPA 3GV8B 5IILA 2BE3A 3OUYA 5DQIA 5J0OA 2HHWA 4EP7A 4GC6A 3V6HA 1ZQJA 5J0UA 2J6UA 4DSIA 4X4VA 2W9AA 4NXZA 4Q8EA 3KHGA 4QWEA 7ICJA 2BGWA 2ZH5A 1C7YA 4J9PA 1A77A 3C1YA 5KFRA 1PZNA 4YVZA 1L3VA 1S10A 3HW8A 4DQQA 9ICJA 4QZHA 2FPMA 4R64A 4O3OA 4RQ7A 1XSLA 4DSJA 8ICXA 2ASJA 2ZH7A 1DK2A 5KFVA 1ZQNA 2R8HA 1ZQFA 5D49A 4PH5A 3NYBA 4AT9B 3PMNA 4O3RA 5DDMA 3RB6A 2MAXA 4FHVA 1HUOA 1DGSA 3GIKA 4R8UA 1K1SA 4YN4A 5KFNA 1RXVA 3V72A 2HHPA 1ZQGA 2GWSA 4XUSA 1NKEA 2IHNA 5KG7A 4I2CA 5J0QA 1ZQBA 4M04A 4RPXA 3TARA 1QTMA 3WFRE 1TFRA 2W8KA 4MF2A 4J9KA 2Q66A 2KTQA 1X9SA 5J2AA 2ZH9A 2I1QA 5DG9A 4JV2A 2F1IA 1LB2B 4BDPA 3FDSA 3MABA 2BPCA 4ECQA 1ZQAA 1KSPA 5DB8A 3B0YA 5HHHA 4ED1A 4F5QA 4DS5A 2PI5A 4IRDA 2DR7A 3NTUA 4ZH4A 9ICMA 4WC3A 5HMLA 3K4GA 5F2VO 5BPCA 1QSSA 3AQKA 4IQVA 2P6UA 4RQ0A 4FBTA 5DG8A 3OHBA 2KZMA 9ICIA 2HVHA 4K4HA 1NO5A 3RH5A 3RAXA 3ISDA 1SL2A 3H40A 4DL2A 4KLGA 3BQTA 4F5NA 1JXEA 3QEAZ 2W8LA 3RAQA 2AGPA 4B9SA 4PHPA 3GV5B 8ICYA 4DEZA 3LDAA 3GIIA 1JXLA 5DKWA 4FHYA 1D8YA 1MIWA 3GDXA 3JPRA 9ICOA 3RBEA 3PNCA 2OWOA 2P6RA 2BR0A 8ICIA 3WFQE 5J0WA 3QZ8A 2AQ0A 3BDPA 1RYSA 3RJGA 3T5KA 4KLOA 2AQ4A 5J2FA 1T8EA 3KHLA 4DSFA 8ICAA 3RJJA 1MQ2A 4PHAA 3PX4A 5KFXA 4DS4A 4DQSA 3OSPA 4KN4A 4R63A 1BPYA 2A1JB 3THVA 5J2GA 4ELUA 8ICEA 3Q8QB 3M8SA 2FLPA 5KG0A 1XSNA 1IXRA 4RQ4A 3OVBA 3E2EA 1XWLA 5TZVA 1S77D 2ZUCA 1COOA 8ICCA 4AT7B 5IIMA 1XU4A 4DL7A 1TKDA 2ZH1A 2C2RA 5KFKA 1KFDA 4F4ZA 4YD2A 1U4BA 1S76D 3N4MB 4QZCA 3RJFA 1ZQMA 4EBJA 4RQ3A 3ORYA 3UPQA 3KTQA 2O1PA 4R65A 3ISCA 4IRKA 1NK7A 4XQ7A 8ICNA 3SZ2A 4C8MA 2C2EA 4X4TA 3LWLA 3WFSC 4Z6DA 2W9CB 5DQHA 3RB3A 4BGDA 5D46A 1CUKA 2IHMA 4RWOA 2ZJAA 4B9NA 2KFZA 1EXNA 2ZTCA 4Q45A 3KHRA 2ASDA 3OVAA 4UD5A 4I2IA 4FHXA 3H7IA 4C8NA 3V7LA 9ICKA 5L1JA 2HHUA 9ICFA 1Y88A 5KG5A 4J9OA 3LK9A 1SKRA 1X9WA 5HRGA 1VJ7A 4TURA 3C18A 7ICFA 5EWFA 4MFAA 4TUQA 2IBKA 2MUTA 1ZQPA 1ZQSA 3QE9Y 1XSPA 4KMUA 3GILA 3BJYA 4BWJA 5J0RA 4DL5A 4CCHA 4J9LA 4YG2A 4M6WB 4XA5A 3RTVA 1JX4A 4F4KA 5J2CA 1NJXA 4O3SA 5CP2A 1R8AA 1KNYA 3T3FA 3C1ZA 3PW2A 4JUZA 3BQ2A 1SKSA 2M2VA 2FMSA 1D9FA 3C21A 1S0OA 4PHEA 2XCPA 8ICBA 4ED7A 4EYHB 4QZEA 4ED8A 4J9NA 1T7PA 1A76A 1D8LA 5KFZA 3LQCB 5HRBA 4O5CA 4X0AA 3RJKA 4UAYA 3JZ0A 5KT5A 4UB3A 3OJUA 1QSLA 3H8SA 1D9DA 2ZH3A 3G6VA 3G6XA 3C5FA 3PW0A 4KN7A 1TK0A 4F2RA 4NY8A 4G3IA 8ICQA 4Q43A 1NK5A 2DVIA 3OVSA 2DPJA 4DO9A 1HUZA 2JZBA 3PR4A 4MEXA 4KLEA 4ECXA 5DBCA 9ICCA 4QW9A 4IR9A 1L5UA 1TFWA 2MUTB 2HHXA 8ICUA 4FO6A 3PMLA 4P4PA 9ICNA 3RRGA 1L3UA 3C2LA 1YLQA 2XC9A 4TUSA 2NRZA 4GXIA 5KFMA 4ECTA 1HJPA 4DOBA 4ECRA 2C2DA 1ZQEA 5L1IA 5KG3A 1V4AA 3WFOA 4RPZA 4F92B 3GFKB 4WC2A 1ZYQA 1WOTA 4GLXA 2HHQA 2ZTEA 3MDAA 7ICQA 4RUCA 5KFYA 2FPLA 2HHVA 2UVRA 4TUPA 1TAQA 3Q8LA 3N97B 4YXJA 4RNNA 5KFUA 3M9NB 4EBEA 5DB7A 5DB9A 1S97A 3MGHA 1KDHA 4NLKA 1B22A 9ICXA 2W9CA 5KFBA 4ED2A 5HRHA 4UQGA 4YMNA 2AGQA 2UVVA 5KG4A 4ED6A 2C28A 2RDIA 5L9XA 1UETA 1R89A 1K1QA 4IQWA 4KLFA 3GQCA 4KLHA 5KFWA 2R8JA 4FH3A 1MQ3A 4YP3A 1BNOA 3H37A 3UPSA 1JN3A 5DBAA 5IIOA 4BWMA 3MR2A 5J2BA 3PW5A 3C66A 2RDJA 4KLQA 2KZ3A 1ZQOA 5L1KA 4ECSA 1MIVA 4M0AA 4YR2A 2NRVA 4IG8A 1Z00A 4M9LA 4PGXA 3MBYA 5DECA 1UEVA 5CJ7A 5J2JA 4PPXA 3PX6A 1RPLA 5KT7A 2FLLA 4NLGA 4M5DA 5HHIA 4F2SA 4JV1A 3AU2A 3UXNA 1T4GA 2F1JA 3RRHA 3RBDA 2UVUA 4I2EA 3JPNA 4JWNA 2M2TA 3HWTA 4ATBB 3RR8A 5KFDA 1QLNA 4YFKA 1TK5A 5C5JA 4J9RA 3LWMA 4J9MA 2V4QA 3OJSA 3ISBA 4DLEA 7ICGA 2KZZA 1U9LA 3H4BA 2B21A 4E80A 2JEGA 4C8OA 4NLZA 4I2AA 4M6WA 4ECWA 3GV7B 1L3SA 4M2YA 5KG6A 5KFFA 4F5RA 2HHTA 4EZ9A 4MFFA 1TAUA 1SZPA 4UB5A 2ISPA 4AT8A 2DR9A 3RH4A 1DK3A 4Z6FA 4XRHA 3ZDCA 3H4DA 8ICWA 1H38A 2ZJ8A 4ELVA 3PW7A 2R8IA 3OGUA 2JZBB 3IM1A 5HRLA 4NKUA 3G6YA 1AROP 2JEJA 5KFHA 2BQRA 4BXOB 2W9BB 3ETLA 3UXPA 4F8RA 2W9MA 2BKEA 2PBEA 1VFGA 2BCRA 4K4IA 1PX5A 4I2FA 1RXWA 2HW3A 5HRIA 4QZAA 9ICTA 2ZTDA 2RFFA 5KFPA 4RQ1A 1FA0A 1JAJA 1NK4A 1ZQXA 2ZHBA 4KLTA 4Q44A 3ZD9A 1ZETA 1X9MA 9ICPA 1BPXA 1DOQA 4EBDA 3TI0A 3EPGA 2ZUBA 4RQ8A 1WCNA 1WCLA 4UAWA 3SYZA 8ICSA 4F5OA 4M9NA 4DQPA 5EWEA 4X5VA 4K4GA 1XS9D 3AUOA 2ALZA 3T5HA 1CEZA 1BNPA 4GC7A 5KT2A 2VA8A 4X4SA 4EYIB 4DOCA 4WC4A 4QZGA 2AU0A 5HREA 1UA1A 1ZQTA 5BOMA 5IINA 2VANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ1 A;  4YQW A;  4KLU A;  5HRF A;  4UAZ A;  4EEY A;  4X4Q A;  3BQ0 A;  2PXI A;  1U48 A;  4RNO A;  5HC9 A;  3TFR A;  2DR8 A;  4QZ9 A;  1U45 A;  2P66 A;  4B9M A;  4ELT A;  4LVS A;  3OUY B;  3C5G A;  1MIY A;  4TQR A;  5KTQ A;  3SV4 A;  2ASL A;  5BOL A;  4DWI A;  3OV7 A;  4TQS A;  4KLS A;  1N56 A;  3HX0 A;  4ED0 A;  5KT6 A;  3RH6 A;  4P4M A;  5F9N A;  3PVX A;  4I2G A;  1NK8 A;  9ICA A;  7ICL A;  2O5A A;  1NK6 A;  5JUM A;  4O9M A;  1MC8 A;  3GIM A;  2BDP A;  5HRK A;  2M2W A;  1Q79 A;  1UT8 A;  4DSK A;  3PO4 A;  1BVS A;  9ICH A;  2XO7 A;  1ZQZ A;  4DFM A;  5D4B A;  4IQT A;  1KEJ A;  3JPQ A;  4DFJ A;  2FMQ A;  4M9H A;  1ZQD A;  8ICG A;  3EZ5 A;  3ZDD A;  4AT8 B;  1UEU A;  2C22 A;  4QZB A;  1Z00 B;  4UB1 A;  4HYK A;  1NKB A;  5CA7 A;  2KN7 A;  1ZQR A;  2XGP A;  1KRP A;  2XY5 A;  4EZ6 A;  3RJE A;  4MFC A;  3MDC A;  4PGY A;  5J0X A;  5DGA A;  2KFN A;  8ICK A;  2BPF A;  7ICR A;  5KFQ A;  4AT7 A;  1JMS A;  3M9M B;  2ZH2 A;  2HHS A;  1S0N A;  4FHP A;  3TAQ A;  3QEB Z;  4KLJ A;  4WCW A;  2DPI A;  4Z6C A;  2VA3 A;  3PY8 A;  5DDY A;  3PX0 A;  4M9J A;  2M2U A;  4WC5 A;  4JK1 A;  2KP7 A;  5J2I A;  3H8J A;  1U49 A;  1NK9 A;  5EWG A;  4F5P A;  3SV3 A;  2FPK A;  2DRB A;  1UT5 A;  2PFN A;  4F4Y A;  8ICO A;  1BPE A;  4F3O A;  4X4P A;  3OSN A;  4RWP A;  4QZI A;  4C8L A;  4O3N A;  4DSL A;  4LZG A;  4X4R A;  2F1H A;  1N48 A;  2DR5 A;  4I28 A;  1L3T A;  7ICN A;  5DQG A;  3T5J A;  4F93 B;  2W9B A;  4X4O A;  4JWM A;  2DRA A;  3MFH A;  4F4W A;  4RZR A;  4YD1 A;  2JEF A;  5F9L A;  2H5X A;  4DFP A;  3HIY A;  8ICT A;  4RU9 A;  1R8C A;  4WC1 A;  4IRC A;  1X2I A;  3TFS A;  3ZDE A;  2PFO A;  4B9U A;  4BXO A;  3ZD8 A;  2V9W A;  2I9G A;  4DQI A;  4FHW A;  5DGB A;  4UB2 A;  5J0S A;  1NJZ A;  5KFC A;  4F4X A;  3C23 A;  4J9Q A;  4FS1 A;  3KHH A;  4YXM A;  4O0I A;  3H39 A;  4PHD A;  3H38 A;  3V6J A;  3SI8 A;  1ZJM A;  8ICR A;  4FH5 A;  1S0M A;  2BCQ A;  5KFS A;  3OHA A;  4ECZ A;  4ED3 A;  3MR6 A;  2IMW P;  4I2H A;  2XCA A;  4UD4 A;  2ISO A;  3RR7 A;  5KG2 A;  3EYZ A;  4DL6 A;  4MEY A;  2NRW A;  5CWR A;  1BGX T;  4P4O A;  2Y1J A;  4KLI A;  3M9O B;  4NLN A;  4IQU A;  7ICH A;  2PFQ A;  1Q78 A;  4DOA A;  1V9P A;  5KFI A;  2UVW A;  3PR5 B;  4F50 A;  3L9D A;  4DF8 A;  4YMO A;  5DB6 A;  3JPO A;  3HJ1 A;  1S9F A;  3HPO A;  4RT2 A;  7ICM A;  2ZHA A;  2HVI A;  4B9V A;  8ICL A;  7ICU A;  1NK0 A;  5J2D A;  4QZD A;  2BCS A;  5J0Y A;  3AQL A;  4FBU A;  4WC6 A;  3UXO A;  3V7K A;  1KFS A;  3B0X A;  2WTF A;  3QZ7 A;  2VA2 A;  9ICU A;  9ICW A;  5HR9 A;  4NM2 A;  2ZH4 A;  4DF4 A;  4IR1 A;  3TAP A;  7ICP A;  3MR5 A;  3Q8K A;  3UQ0 A;  1XC9 A;  4NKT A;  5DLG A;  1ZQI A;  2XGQ A;  5DG7 A;  3RJH A;  2DFL A;  3EW9 A;  1TFY A;  2Y1I A;  3RB4 A;  1T3N A;  2BCV A;  4E8F A;  4RWN A;  5HNK A;  4RNM A;  9ICR A;  4WBY A;  4FS2 A;  3MGI A;  3AQM A;  3Q8R B;  7ICO A;  3Q8P B;  1SKW A;  4O5K A;  2BCU A;  4DSE A;  7ICI A;  2BPG A;  8ICH A;  1TK8 A;  1RZT A;  8ICM A;  3JPP A;  5KT4 A;  4QWA A;  2PFP A;  3AQN A;  1KTQ A;  4O3Q A;  3Q8S B;  2AGO A;  5HMM A;  1NKC A;  4X4U A;  3JPS A;  3TAN A;  4YR3 A;  5DED A;  1ZQL A;  1R8B A;  4RQ6 A;  3Q8M A;  5IIK A;  1ZQW A;  4YCX A;  1SL1 A;  2PI4 A;  1RYR A;  1B43 A;  5DLF A;  5KG1 A;  2V4R A;  5CB1 A;  4I2B A;  4QWB A;  9ICL A;  5KFL A;  4DFK A;  4LT6 A;  5J29 A;  4DQR A;  4F91 B;  9ICG A;  3FYH A;  4J9S A;  1KFT A;  4S3N A;  3NGD A;  4Z6E A;  3RJI A;  2ID1 A;  5KFT A;  5HP4 A;  5DBB A;  4E7X A;  3H8W A;  2R8G A;  8ICJ A;  4O3P A;  1QSY A;  1UA0 A;  1ZQU A;  2ZUD A;  3ZDA A;  4RT3 A;  4KLD A;  4AT9 A;  3M8R A;  9ICE A;  4X0B A;  1IM4 A;  4YR0 A;  3IHQ B;  4RWQ A;  4ATB A;  4QWD A;  4M9G A;  3EPI A;  5KT3 A;  5KFJ A;  2XY7 A;  1SL0 A;  1ZQQ A;  4WBZ A;  4QW8 A;  4DLG A;  1JQR A;  1BPZ A;  4GXK A;  3MR3 A;  7ICS A;  3C2K A;  4QZF A;  2J6S A;  2FLN A;  2ZH8 A;  4YMM A;  1KLN A;  5J2H A;  3JPT A;  4I2D A;  2ATL A;  4KLL A;  3H3A A;  5J0P A;  2J6T A;  5KFE A;  3C2M A;  4RUA A;  5KFA A;  2BHN A;  5CHG A;  4RQ2 A;  4B9L A;  4R66 A;  1NOM A;  5KFO A;  1U47 A;  7ICT A;  2ZH6 A;  3TQ1 A;  3PW4 A;  3T5L A;  1ZQC A;  1S0V A;  5J2K A;  8ICV A;  4RPY A;  3V6K A;  4ECV A;  1TVA A;  4EBK A;  2XY6 A;  4KIT B;  1TV9 A;  2AJQ A;  5III A;  4I2J A;  5CR0 A;  3K75 D;  3GIJ A;  3ZDB A;  9ICV A;  4C8K A;  4GXJ A;  4DL3 A;  4QZ8 A;  4KLM A;  4WC0 A;  4B9T A;  1OU5 A;  4XQ8 A;  4PGQ A;  4EBC A;  2LYH A;  4DL4 A;  2BQU A;  5L1L A;  4P2H A;  1MSW D;  4I29 A;  3JYY A;  2NRT A;  4ECU A;  4KTQ A;  1ZQV A;  8ICZ A;  4NM1 A;  5IIJ A;  4UBB A;  1ZQY A;  8ICF A;  3V7J A;  1XO1 A;  2R8K A;  2BQ3 A;  1LV5 A;  4M47 A;  3AU6 A;  4RQ5 A;  5J0T A;  2JEI A;  3RB0 A;  1ZJN A;  3EWA A;  9ICS A;  2NRX A;  5J2E A;  3HP6 A;  3HT3 A;  4ECY A;  2FMP A;  3PO5 A;  4O5E A;  4R8U B;  1F5A A;  2M9N A;  4LZD A;  5HRD A;  1ZQK A;  4Q8F A;  4MF8 A;  1NJW A;  8ICP A;  4WC7 A;  3UQ2 A;  3WFP A;  7ICV A;  3PV8 A;  2IA6 A;  4X4N A;  1JIH A;  2ZJ5 A;  4E0D A;  4I27 A;  7ICE A;  5EOZ A;  4QWC A;  3MFI A;  1BPD A;  2Q0Z X;  9ICQ A;  2NRK A;  3HJ4 A;  2A1J A;  1ZQH A;  5KFG A;  1Z3E B;  1NJY A;  7ICK A;  1BPB A;  4JV0 A;  4UBC A;  4UB4 A;  9ICB A;  1NZP A;  3GV8 B;  5IIL A;  2BE3 A;  3OUY A;  5DQI A;  5J0O A;  2HHW A;  4EP7 A;  4GC6 A;  3V6H A;  1ZQJ A;  5J0U A;  2J6U A;  4DSI A;  4X4V A;  2W9A A;  4NXZ A;  4Q8E A;  3KHG A;  4QWE A;  7ICJ A;  2BGW A;  2ZH5 A;  1C7Y A;  4J9P A;  1A77 A;  3C1Y A;  5KFR A;  1PZN A;  4YVZ A;  1L3V A;  1S10 A;  3HW8 A;  4DQQ A;  9ICJ A;  4QZH A;  2FPM A;  4R64 A;  4O3O A;  4RQ7 A;  1XSL A;  4DSJ A;  8ICX A;  2ASJ A;  2ZH7 A;  1DK2 A;  5KFV A;  1ZQN A;  2R8H A;  1ZQF A;  5D49 A;  4PH5 A;  3NYB A;  4AT9 B;  3PMN A;  4O3R A;  5DDM A;  3RB6 A;  2MAX A;  4FHV A;  1HUO A;  1DGS A;  3GIK A;  4R8U A;  1K1S A;  4YN4 A;  5KFN A;  1RXV A;  3V72 A;  2HHP A;  1ZQG A;  2GWS A;  4XUS A;  1NKE A;  2IHN A;  5KG7 A;  4I2C A;  5J0Q A;  1ZQB A;  4M04 A;  4RPX A;  3TAR A;  1QTM A;  3WFR E;  1TFR A;  2W8K A;  4MF2 A;  4J9K A;  2Q66 A;  2KTQ A;  1X9S A;  5J2A A;  2ZH9 A;  2I1Q A;  5DG9 A;  4JV2 A;  2F1I A;  1LB2 B;  4BDP A;  3FDS A;  3MAB A;  2BPC A;  4ECQ A;  1ZQA A;  1KSP A;  5DB8 A;  3B0Y A;  5HHH A;  4ED1 A;  4F5Q A;  4DS5 A;  2PI5 A;  4IRD A;  2DR7 A;  3NTU A;  4ZH4 A;  9ICM A;  4WC3 A;  5HML A;  3K4G A;  5F2V O;  5BPC A;  1QSS A;  3AQK A;  4IQV A;  2P6U A;  4RQ0 A;  4FBT A;  5DG8 A;  3OHB A;  2KZM A;  9ICI A;  2HVH A;  4K4H A;  1NO5 A;  3RH5 A;  3RAX A;  3ISD A;  1SL2 A;  3H40 A;  4DL2 A;  4KLG A;  3BQT A;  4F5N A;  1JXE A;  3QEA Z;  2W8L A;  3RAQ A;  2AGP A;  4B9S A;  4PHP A;  3GV5 B;  8ICY A;  4DEZ A;  3LDA A;  3GII A;  1JXL A;  5DKW A;  4FHY A;  1D8Y A;  1MIW A;  3GDX A;  3JPR A;  9ICO A;  3RBE A;  3PNC A;  2OWO A;  2P6R A;  2BR0 A;  8ICI A;  3WFQ E;  5J0W A;  3QZ8 A;  2AQ0 A;  3BDP A;  1RYS A;  3RJG A;  3T5K A;  4KLO A;  2AQ4 A;  5J2F A;  1T8E A;  3KHL A;  4DSF A;  8ICA A;  3RJJ A;  1MQ2 A;  4PHA A;  3PX4 A;  5KFX A;  4DS4 A;  4DQS A;  3OSP A;  4KN4 A;  4R63 A;  1BPY A;  2A1J B;  3THV A;  5J2G A;  4ELU A;  8ICE A;  3Q8Q B;  3M8S A;  2FLP A;  5KG0 A;  1XSN A;  1IXR A;  4RQ4 A;  3OVB A;  3E2E A;  1XWL A;  5TZV A;  1S77 D;  2ZUC A;  1COO A;  8ICC A;  4AT7 B;  5IIM A;  1XU4 A;  4DL7 A;  1TKD A;  2ZH1 A;  2C2R A;  5KFK A;  1KFD A;  4F4Z A;  4YD2 A;  1U4B A;  1S76 D;  3N4M B;  4QZC A;  3RJF A;  1ZQM A;  4EBJ A;  4RQ3 A;  3ORY A;  3UPQ A;  3KTQ A;  2O1P A;  4R65 A;  3ISC A;  4IRK A;  1NK7 A;  4XQ7 A;  8ICN A;  3SZ2 A;  4C8M A;  2C2E A;  4X4T A;  3LWL A;  3WFS C;  4Z6D A;  2W9C B;  5DQH A;  3RB3 A;  4BGD A;  5D46 A;  1CUK A;  2IHM A;  4RWO A;  2ZJA A;  4B9N A;  2KFZ A;  1EXN A;  2ZTC A;  4Q45 A;  3KHR A;  2ASD A;  3OVA A;  4UD5 A;  4I2I A;  4FHX A;  3H7I A;  4C8N A;  3V7L A;  9ICK A;  5L1J A;  2HHU A;  9ICF A;  1Y88 A;  5KG5 A;  4J9O A;  3LK9 A;  1SKR A;  1X9W A;  5HRG A;  1VJ7 A;  4TUR A;  3C18 A;  7ICF A;  5EWF A;  4MFA A;  4TUQ A;  2IBK A;  2MUT A;  1ZQP A;  1ZQS A;  3QE9 Y;  1XSP A;  4KMU A;  3GIL A;  3BJY A;  4BWJ A;  5J0R A;  4DL5 A;  4CCH A;  4J9L A;  4YG2 A;  4M6W B;  4XA5 A;  3RTV A;  1JX4 A;  4F4K A;  5J2C A;  1NJX A;  4O3S A;  5CP2 A;  1R8A A;  1KNY A;  3T3F A;  3C1Z A;  3PW2 A;  4JUZ A;  3BQ2 A;  1SKS A;  2M2V A;  2FMS A;  1D9F A;  3C21 A;  1S0O A;  4PHE A;  2XCP A;  8ICB A;  4ED7 A;  4EYH B;  4QZE A;  4ED8 A;  4J9N A;  1T7P A;  1A76 A;  1D8L A;  5KFZ A;  3LQC B;  5HRB A;  4O5C A;  4X0A A;  3RJK A;  4UAY A;  3JZ0 A;  5KT5 A;  4UB3 A;  3OJU A;  1QSL A;  3H8S A;  1D9D A;  2ZH3 A;  3G6V A;  3G6X A;  3C5F A;  3PW0 A;  4KN7 A;  1TK0 A;  4F2R A;  4NY8 A;  4G3I A;  8ICQ A;  4Q43 A;  1NK5 A;  2DVI A;  3OVS A;  2DPJ A;  4DO9 A;  1HUZ A;  2JZB A;  3PR4 A;  4MEX A;  4KLE A;  4ECX A;  5DBC A;  9ICC A;  4QW9 A;  4IR9 A;  1L5U A;  1TFW A;  2MUT B;  2HHX A;  8ICU A;  4FO6 A;  3PML A;  4P4P A;  9ICN A;  3RRG A;  1L3U A;  3C2L A;  1YLQ A;  2XC9 A;  4TUS A;  2NRZ A;  4GXI A;  5KFM A;  4ECT A;  1HJP A;  4DOB A;  4ECR A;  2C2D A;  1ZQE A;  5L1I A;  5KG3 A;  1V4A A;  3WFO A;  4RPZ A;  4F92 B;  3GFK B;  4WC2 A;  1ZYQ A;  1WOT A;  4GLX A;  2HHQ A;  2ZTE A;  3MDA A;  7ICQ A;  4RUC A;  5KFY A;  2FPL A;  2HHV A;  2UVR A;  4TUP A;  1TAQ A;  3Q8L A;  3N97 B;  4YXJ A;  4RNN A;  5KFU A;  3M9N B;  4EBE A;  5DB7 A;  5DB9 A;  1S97 A;  3MGH A;  1KDH A;  4NLK A;  1B22 A;  9ICX A;  2W9C A;  5KFB A;  4ED2 A;  5HRH A;  4UQG A;  4YMN A;  2AGQ A;  2UVV A;  5KG4 A;  4ED6 A;  2C28 A;  2RDI A;  5L9X A;  1UET A;  1R89 A;  1K1Q A;  4IQW A;  4KLF A;  3GQC A;  4KLH A;  5KFW A;  2R8J A;  4FH3 A;  1MQ3 A;  4YP3 A;  1BNO A;  3H37 A;  3UPS A;  1JN3 A;  5DBA A;  5IIO A;  4BWM A;  3MR2 A;  5J2B A;  3PW5 A;  3C66 A;  2RDJ A;  4KLQ A;  2KZ3 A;  1ZQO A;  5L1K A;  4ECS A;  1MIV A;  4M0A A;  4YR2 A;  2NRV A;  4IG8 A;  1Z00 A;  4M9L A;  4PGX A;  3MBY A;  5DEC A;  1UEV A;  5CJ7 A;  5J2J A;  4PPX A;  3PX6 A;  1RPL A;  5KT7 A;  2FLL A;  4NLG A;  4M5D A;  5HHI A;  4F2S A;  4JV1 A;  3AU2 A;  3UXN A;  1T4G A;  2F1J A;  3RRH A;  3RBD A;  2UVU A;  4I2E A;  3JPN A;  4JWN A;  2M2T A;  3HWT A;  4ATB B;  3RR8 A;  5KFD A;  1QLN A;  4YFK A;  1TK5 A;  5C5J A;  4J9R A;  3LWM A;  4J9M A;  2V4Q A;  3OJS A;  3ISB A;  4DLE A;  7ICG A;  2KZZ A;  1U9L A;  3H4B A;  2B21 A;  4E80 A;  2JEG A;  4C8O A;  4NLZ A;  4I2A A;  4M6W A;  4ECW A;  3GV7 B;  1L3S A;  4M2Y A;  5KG6 A;  5KFF A;  4F5R A;  2HHT A;  4EZ9 A;  4MFF A;  1TAU A;  1SZP A;  4UB5 A;  2ISP A;  4AT8 A;  2DR9 A;  3RH4 A;  1DK3 A;  4Z6F A;  4XRH A;  3ZDC A;  3H4D A;  8ICW A;  1H38 A;  2ZJ8 A;  4ELV A;  3PW7 A;  2R8I A;  3OGU A;  2JZB B;  3IM1 A;  5HRL A;  4NKU A;  3G6Y A;  1ARO P;  2JEJ A;  5KFH A;  2BQR A;  4BXO B;  2W9B B;  3ETL A;  3UXP A;  4F8R A;  2W9M A;  2BKE A;  2PBE A;  1VFG A;  2BCR A;  4K4I A;  1PX5 A;  4I2F A;  1RXW A;  2HW3 A;  5HRI A;  4QZA A;  9ICT A;  2ZTD A;  2RFF A;  5KFP A;  4RQ1 A;  1FA0 A;  1JAJ A;  1NK4 A;  1ZQX A;  2ZHB A;  4KLT A;  4Q44 A;  3ZD9 A;  1ZET A;  1X9M A;  9ICP A;  1BPX A;  1DOQ A;  4EBD A;  3TI0 A;  3EPG A;  2ZUB A;  4RQ8 A;  1WCN A;  1WCL A;  4UAW A;  3SYZ A;  8ICS A;  4F5O A;  4M9N A;  4DQP A;  5EWE A;  4X5V A;  4K4G A;  1XS9 D;  3AUO A;  2ALZ A;  3T5H A;  1CEZ A;  1BNP A;  4GC7 A;  5KT2 A;  2VA8 A;  4X4S A;  4EYI B;  4DOC A;  4WC4 A;  4QZG A;  2AU0 A;  5HRE A;  1UA1 A;  1ZQT A;  5BOM A;  5IIN A;  2VAN A; 
#chains in the Genus database with same CATH topology
 3AN1 A;  4EEY A;  4Y2R A;  1U48 A;  3TFR A;  2H3Q A;  1U45 A;  3OUY B;  1J2M A;  3IG5 A;  2EH9 A;  1QQ7 A;  5BOL A;  1ED1 A;  4IC9 A;  1N56 A;  4I2G A;  3PVX A;  1MC8 A;  2QB0 B;  3GIM A;  2M2W A;  1M6Y A;  4RQM A;  4DFM A;  3JPQ A;  4DFJ A;  8ICG A;  3EZ5 A;  2NV3 A;  3WKB A;  1UEU A;  3SAH A;  4QZB A;  3C28 A;  1Z00 B;  4HYK A;  5CA7 A;  1ZQR A;  2XGP A;  1RYU A;  3RJE A;  1MA7 A;  5DGA A;  4US8 A;  4AT7 A;  1JMS A;  2HHS A;  1SIJ A;  4WCW A;  2DPI A;  3PX0 A;  3F2B A;  4JK1 A;  4ICA A;  2HI0 A;  1U49 A;  4F5P A;  3N7S C;  2PFN A;  4GFJ A;  3DEE A;  4C8L A;  4DSL A;  2DR5 A;  7ICN A;  5DQG A;  5FP0 A;  4YD1 A;  5F9L A;  2H5X A;  2PMZ C;  3HIY A;  8ICT A;  4OO1 J;  1R8C A;  2MSN A;  4CGZ A;  1SWW A;  4BXO A;  3KBB A;  2ES6 A;  2I9G A;  2R18 A;  4FHW A;  5J0S A;  1NJZ A;  4FO1 A;  3C23 A;  4YXM A;  4O0I A;  4FFD A;  2OHF A;  3QYP A;  3SI8 A;  2LMR A;  4FH5 A;  4I2H A;  4ED3 A;  3MR6 A;  2XCA A;  2ISO A;  4K98 A;  1BGX T;  4P4O A;  2Y1J A;  7ICH A;  4NXU A;  4DOA A;  1V9P A;  5KFI A;  3IV6 A;  3WK5 A;  4YMO A;  3HJ1 A;  5T14 A;  2KOB A;  7ICM A;  4CNQ A;  2E8P A;  4WC6 A;  4Y2S A;  3B0X A;  3QZ7 A;  9ICW A;  4NM2 A;  4IR1 A;  3TAP A;  4EEL A;  1XC9 A;  3QU9 A;  3D2S A;  5CEH A;  5DG7 A;  2Y1I A;  1ZOL A;  4RWN A;  1L7O A;  4FS2 A;  7ICO A;  2YTU A;  2F8L A;  8ICH A;  1TK8 A;  8ICM A;  3LVW A;  5DED A;  5ALT A;  1R8B A;  2PI4 A;  1B43 A;  1KBU A;  2V4R A;  4I2B A;  4DFK A;  4DQR A;  9ICG A;  3KZI U;  3FYH A;  4J9S A;  4S3N A;  5HP4 A;  3BZK A;  4AT9 A;  1UA0 A;  1T94 A;  2ZUD A;  3F2C A;  2KNJ A;  4KLD A;  2B6G A;  2D6F C;  1JAL A;  3BQ7 A;  4RWQ A;  4ATB A;  2YMP A;  1SL0 A;  3NKU A;  4DLG A;  4GXK A;  3MR3 A;  3D2Q A;  3K1R B;  2J6S A;  2ZH8 A;  1JRO A;  5AIC A;  4YMM A;  3H3A A;  4I2D A;  5J0P A;  3NAS A;  2J6T A;  2HN2 A;  5KFA A;  2BHN A;  4RQ2 A;  4R66 A;  5KFO A;  1U47 A;  3TQ1 A;  3PW4 A;  3T5L A;  2KG5 A;  2CPR A;  3ONN A;  4EBK A;  4CF4 A;  1TV9 A;  2E3T A;  5III A;  2AJQ A;  2HOI A;  1L8L A;  4DL3 A;  4EBC A;  4B6J A;  4P2H A;  1MSW D;  4U6P A;  5IIJ A;  3AM9 A;  1ZQY A;  8ICF A;  2R8K A;  2IUB A;  2JEI A;  3IDW A;  2NRX A;  3HP6 A;  3PO5 A;  2HDO A;  4BJQ A;  1AQ6 A;  4LZD A;  3RFA A;  4Q8F A;  3CW2 C;  1NJW A;  4WC7 A;  3WFP A;  3J81 j;  4U7C A;  4I27 A;  4QWC A;  1BPD A;  9ICQ A;  5D62 A;  2A1J A;  3MGV A;  4QJF B;  1NJY A;  7ICK A;  4UBC A;  4UB4 A;  4EV6 A;  4GC6 A;  3B9J A;  4PJ0 U;  4NXZ A;  4QWE A;  3WKD A;  5AKH A;  1C7Y A;  3C1Y A;  4YVZ A;  1S10 A;  3HW8 A;  2FPM A;  2ZH7 A;  4O3O A;  8ICX A;  4DSJ A;  1DK2 A;  3PST A;  4PH5 A;  3WKA A;  5CFT A;  3PMN A;  4O3R A;  5DDM A;  4LEY A;  2MAX A;  2G06 A;  4Y2X A;  1K1S A;  2H3V A;  5HR6 A;  1JUD A;  2GWS A;  2WF6 A;  4A8E A;  4XUS A;  1NKE A;  4I2C A;  5J0Q A;  2XI9 A;  4FZM A;  5B3Q A;  4RPX A;  3TAR A;  1TFR A;  2ODG A;  4MF2 A;  2KTQ A;  2F1I A;  4BDP A;  1KSP A;  1UPH A;  4IRD A;  1UEV A;  4ED1 A;  4ZH4 A;  4NXX A;  4WC3 A;  3AQK A;  2W3S A;  4FBT A;  5AK6 A;  1UQV A;  3FAH A;  3RH5 A;  1SL2 A;  3H40 A;  4DL2 A;  3F5A A;  3QEA Z;  2AGP A;  4PHP A;  3GV5 B;  3ALR A;  5B5E U;  5DKW A;  1D8Y A;  3GDX A;  9ICO A;  8ICI A;  1L7P A;  5J0W A;  3TAD C;  1T8E A;  8ICA A;  4G9B A;  4DS4 A;  4R63 A;  4QIW F;  5ALL A;  1RM6 C;  5KG0 A;  2EZY A;  1XWL A;  1S77 D;  2ZUC A;  5IIM A;  2OH2 A;  4C7Y A;  4QZC A;  3RJF A;  3ORY A;  4AYB F;  4IRK A;  1NK7 A;  4XQ7 A;  1SXD A;  2B56 A;  2C2E A;  4X4T A;  3WFS C;  1N60 A;  1FO4 A;  3RB3 A;  4BGD A;  5C0Y A;  3CNH A;  3EUB 2;  4C8N A;  3O0F A;  1SV0 C;  9ICF A;  1Y88 A;  5KG5 A;  1SKR A;  2G5H B;  4MFA A;  2IBK A;  2MUT A;  1ZQS A;  3QE9 Y;  4DL5 A;  4BWJ A;  5J0R A;  4P0P B;  3RTV A;  4YG2 A;  1JX4 A;  3KOO A;  5J2C A;  1KNY A;  2Y9U A;  2E8O A;  1HIW A;  4EYH B;  3I1Y A;  4QZE A;  4P0Q B;  3LQC B;  2VJ5 A;  4X0A A;  1LKY B;  1B0X A;  1RQL A;  3H8S A;  3E58 A;  3QX7 A;  1DXS A;  3G6X A;  4NY8 A;  4EEK A;  2W55 A;  2EDU A;  2DPJ A;  2W43 A;  4DO9 A;  2K60 A;  2ZG6 A;  5K4L A;  5DBC A;  4ECX A;  1ZXI A;  4NXW A;  2DQN B;  1ZD4 A;  2WF5 A;  2XC9 A;  2KVS A;  2GAF D;  4DOB A;  5L1I A;  5KG3 A;  2AH5 A;  3GFK B;  2HHQ A;  2KIW A;  3MDA A;  2QKQ A;  4C4R A;  4TUP A;  2K89 A;  3EF2 A;  1J2N A;  3N97 B;  5DB7 A;  5DB9 A;  4OJ5 A;  5A0L A;  4UQG A;  5KG4 A;  4ED6 A;  4KMO B;  1R89 A;  4IQW A;  4FH3 A;  1BNO A;  3MCR A;  1ECW A;  4BWM A;  5J8Y A;  5J2B A;  5F3X B;  4ECS A;  4Y2P A;  5ALY A;  2NRV A;  1Z00 A;  4PGX A;  3MBY A;  5DEC A;  5J2J A;  3PX6 A;  3K7D A;  4NLG A;  5ALH A;  5HHI A;  4F2S A;  4JV1 A;  3UXN A;  3HWT A;  4YFK A;  5L1M A;  2Z7J A;  4ECW A;  1WYG A;  1L3S A;  5KG6 A;  2DR9 A;  3RH4 A;  1H38 A;  3IM1 A;  5HRL A;  2BBH A;  5CRX A;  4Y2U A;  1Z1B A;  1PK3 A;  2EAM A;  2BQR A;  2W9B B;  4BXO B;  3SD7 A;  1VFG A;  2JXJ A;  2BCR A;  4I2F A;  5HRI A;  4QZA A;  2ZXH A;  4RQ1 A;  1ZQX A;  4KLT A;  4Q44 A;  3ZD9 A;  2DGZ A;  1X6J A;  1BPX A;  8ICS A;  5ALS A;  4UAW A;  3H8M A;  4M9N A;  4JLZ A;  4K4G A;  1Z4O A;  5KL8 B;  5AI9 A;  4GC7 A;  4EYI B;  4WQL A;  2LI6 A;  2AU0 A;  1UA1 A;  8ICQ A;  5BOM A;  5IIN A;  2VAN A;  4YQW A;  4KLU A;  4X4Q A;  3BQ0 A;  1C20 A;  5HC9 A;  2E8N A;  2DR8 A;  2A19 A;  4LVS A;  3C5G A;  1MIY A;  3L4P A;  2ASL A;  4TQS A;  4KLS A;  2DL0 A;  4P4M A;  1NK8 A;  4O67 A;  1NK6 A;  4O9M A;  3PO4 A;  9ICH A;  2XO7 A;  2WAQ F;  1KEJ A;  2FMQ A;  4M9H A;  2G0A A;  4AT8 B;  2LKY A;  3ZDD A;  4UAS A;  2F44 A;  4UB1 A;  2KN7 A;  2XIC A;  2KFN A;  2Y0S F;  2VIX A;  1S0N A;  5D61 A;  4UB6 U;  2VA3 A;  4UAV A;  1Q46 A;  5DDY A;  1L7N A;  1NK9 A;  2DRB A;  5EWG A;  5ALU A;  3NVY A;  4F4Y A;  1BPE A;  4F3O A;  4X4P A;  4RWP A;  4UB8 U;  4LZG A;  2MRL A;  1L3T A;  3T5J A;  4F93 B;  4N7R A;  3MFH A;  4F4W A;  1X2I A;  2ZXI A;  2PFO A;  4MHV A;  1JI7 A;  2W54 A;  2F8K A;  3IRU A;  3PSI A;  4UB2 A;  5KFC A;  4F4X A;  3H38 A;  4K9A A;  1ZJM A;  2BCQ A;  3OHA A;  2EAO A;  3RR7 A;  5KG2 A;  2JH7 A;  4DL6 A;  3E0F A;  3NRZ A;  3OPX A;  1Q78 A;  4MKP A;  2UVW A;  4RT2 A;  4OCZ A;  1NK0 A;  4QZD A;  1B4F A;  3QUT A;  3V7K A;  1KFS A;  1CRX A;  9ICU A;  2VA2 A;  7ICP A;  5DLG A;  3EW9 A;  3A0B U;  1TFY A;  5HNK A;  9ICR A;  4WBY A;  3MGI A;  3AQM A;  3Q8R B;  1RQN A;  2AGO A;  4O3Q A;  2MA1 A;  5HMM A;  3JPS A;  4YR3 A;  5IIK A;  5AM4 A;  1PK1 B;  5KG1 A;  4P0P A;  2WF7 A;  5CB1 A;  1ZD5 A;  5KFL A;  4BX9 C;  2LYA A;  4F91 B;  5B3P A;  4Z6E A;  2LHT A;  4GIB A;  4E7X A;  3H8W A;  2R8G A;  3ZDA A;  1ZQU A;  3M8R A;  3IHQ B;  3D2N A;  4QWD A;  4M9G A;  3EPI A;  5AKE A;  5KFJ A;  4CF5 A;  4WBZ A;  2DUY A;  1JQR A;  7ICS A;  3C2K A;  4QZF A;  1KLN A;  4KLL A;  3JPT A;  2H3Z A;  2JMG A;  5ALV A;  2Y0S C;  1N5X A;  2PKE A;  1D8B A;  1ZQC A;  8ICV A;  1L6N A;  4RPY A;  3V6K A;  2JGA A;  4I2J A;  3K75 D;  3GIJ A;  5AM3 A;  5KL1 B;  4QZ8 A;  4KLM A;  1VJ5 A;  2LYH A;  4DL4 A;  2BQU A;  3F53 A;  2KVC A;  2NRT A;  4ECU A;  2CRX A;  8ICZ A;  5EE1 A;  4NM1 A;  4UBB A;  4AYB C;  3V7J A;  3ZI4 A;  2BQ3 A;  3AU6 A;  5AK3 A;  5J0T A;  3RB0 A;  1ZJN A;  5J2E A;  4WQK A;  1YZ6 A;  3HKZ F;  4JMU A;  4O5E A;  2AXT U;  4HX0 A;  1X6I A;  4OAG A;  5EOZ A;  2OXO A;  2NRK A;  1ZQH A;  5KFG A;  1BPB A;  4JV0 A;  5J0O A;  1SV4 A;  3V6H A;  4DSI A;  4X4V A;  2W7P A;  2W9A A;  5G5H A;  1A77 A;  5KFR A;  1PZN A;  9ICJ A;  4QZH A;  4R64 A;  3SR6 A;  2R8H A;  3KFU F;  4AT9 B;  3RB6 A;  1HUO A;  3GIK A;  4R8U A;  3V72 A;  3T79 A;  2K8C B;  5D63 A;  2IHN A;  5KG7 A;  4M04 A;  3WFR E;  2E1E A;  2RP5 A;  2I1Q A;  5DG9 A;  4ECQ A;  2BPC A;  2PI5 A;  2KIC A;  5HHH A;  2D8C A;  5DB8 A;  4F5Q A;  2DR7 A;  3NTU A;  4JLX A;  2W7O A;  3K4G A;  2ZIU A;  2P6U A;  1RDF A;  5AI0 A;  3OHB A;  9ICI A;  4WJ3 B;  3K1Z A;  3GU3 A;  3RAX A;  3CK6 A;  4PL2 A;  4Y2J A;  2WF8 A;  4DEZ A;  3LDA A;  4EEN A;  3GII A;  3WFQ E;  2P6R A;  4BUG A;  3PNC A;  2OWO A;  4OJ6 A;  3BDP A;  4KLO A;  5J2F A;  1A0P A;  1MQ2 A;  3QNM A;  5KFX A;  4DQS A;  2AHO B;  3THV A;  3KKA C;  3R9K A;  1XSN A;  1IXR A;  4RQ4 A;  2RRD A;  5AK4 A;  2YMQ A;  1KL9 A;  4AT7 B;  1J97 A;  3NVV A;  3FC4 A;  4DL7 A;  4EEB A;  2ZH1 A;  2ZIX A;  1KFD A;  2KKP A;  1ZQM A;  3UPQ A;  1A6S A;  3KTQ A;  2YN4 A;  4Z6D A;  1K5O A;  3C29 A;  1CUK A;  1GO3 F;  1EXN A;  3IP4 B;  5CFS A;  4O3M A;  4KX3 A;  9ICK A;  2HHU A;  2D3D A;  3LK9 A;  4K97 A;  1VJ7 A;  5ALF A;  7ICF A;  5EWF A;  1NNL A;  4C80 A;  4IS7 A;  4KMU A;  3GIL A;  3BJY A;  4F4K A;  3SMV A;  4O3S A;  4XA5 A;  4M6W B;  1NJX A;  5CP2 A;  3T3F A;  3PW2 A;  3BQ2 A;  2FMS A;  4NWI A;  2W11 A;  5ALK A;  3CP8 A;  5AI5 A;  2HOQ A;  2FCL A;  3DDH A;  1D8L A;  5KFZ A;  4O5C A;  3JZ0 A;  1D9D A;  3QXG A;  3G6V A;  3C5F A;  4KN7 A;  1TK0 A;  1NK5 A;  3OVS A;  2JZB A;  2OYY A;  4QW9 A;  4IR9 A;  1L5U A;  2MUT B;  4P4P A;  3M6Z A;  3U26 A;  3RRG A;  1YLQ A;  1L7M A;  3QU2 A;  2C2D A;  4C0Z A;  2FE9 A;  1V4A A;  3WFO A;  4F92 B;  4WC2 A;  1ZYQ A;  2UVR A;  1TAQ A;  3HJE A;  2KJ8 A;  3M9N B;  5EE9 A;  1S97 A;  4ED2 A;  5HR9 A;  2ZHB A;  4C4S A;  2UVV A;  2C28 A;  5AKL A;  5KAF U;  4KLH A;  5KFW A;  2R8J A;  1MQ3 A;  3WU2 U;  2ZIX B;  3MR2 A;  3OWG A;  2KZ3 A;  1KW4 A;  1WUD A;  4EX6 A;  4YR2 A;  4UAT A;  1FEZ A;  5EE3 A;  4CE6 A;  1Q8K A;  3RBD A;  2UVU A;  4I2E A;  1O03 A;  2YB1 A;  2M2T A;  1N2X A;  3JPN A;  1QLN A;  1TK5 A;  1DRG A;  4J9R A;  2KZZ A;  3OJS A;  4KB6 A;  1U9L A;  2LYB A;  3L5K A;  4C8O A;  4NLZ A;  2EZZ A;  5ALM A;  5JRT A;  2KD1 A;  5ALX A;  1WWU A;  4MFF A;  1SZP A;  1TAU A;  2ISP A;  1DK3 A;  4Z6F A;  3ZDC A;  2PMZ F;  2JZB B;  2KMD A;  1ARO P;  2JEJ A;  4F8R A;  3ETL A;  3UXP A;  4K99 A;  4K4I A;  1PX5 A;  1ZRM A;  3NRW A;  9ICT A;  5G5G A;  1NK4 A;  4OAF A;  1X9M A;  1ZET A;  1DOQ A;  3TI0 A;  4AT8 A;  2ZUB A;  1WCN A;  2W03 A;  4DQP A;  5EWE A;  2CN1 A;  4X5V A;  1CEZ A;  1BNP A;  1GPJ A;  4DOC A;  5HRE A;  1ZQT A;  3AQE A;  8ICP A;  1ZRN A;  4WOY A;  4UAZ A;  2W04 A;  2PXI A;  4RNO A;  5TIS U;  4ELT A;  2WHE A;  3HX0 A;  2A1A A;  4ED0 A;  3QU4 A;  4X4O A;  5F9N A;  7ICL A;  2BDP A;  2HN1 A;  4DSK A;  4K9B A;  1BVS A;  1L8O A;  2E5S A;  2B51 A;  4IQT A;  5ALD A;  1ZQD A;  1FFV A;  2C22 A;  2YY6 A;  4OD0 A;  3OTQ A;  4EZ6 A;  2XY5 A;  2IHO A;  5J0X A;  8ICK A;  3PHZ A;  5B66 U;  3ER9 B;  3M9M B;  2ZH2 A;  1UHU A;  4FHP A;  2VJ4 A;  2IOF A;  3TAQ A;  3DV9 A;  1N5W A;  2M2U A;  1URJ A;  3QUC A;  2KP7 A;  5J2I A;  3SV3 A;  4K96 A;  2FPK A;  8ICO A;  3OSN A;  3SEI A;  3NWI A;  2F1H A;  1N48 A;  2HBL A;  4I28 A;  3VC8 A;  2W9B A;  4JWM A;  2DRA A;  2JEF A;  1XO0 A;  3UM9 A;  2H3F A;  3TFS A;  5ALG A;  4B9U A;  2V9W A;  4DQI A;  2VKQ A;  5DGB A;  4O6A A;  4FS1 A;  3H39 A;  4PHD A;  3V6J A;  2DKZ A;  2ZIW A;  1S0M A;  2K8A A;  1S8O A;  2EAN A;  3EYZ A;  5CWR A;  4IQU A;  2PFQ A;  4F50 A;  1F44 A;  1SWV A;  1S9F A;  2K4I A;  3QU7 A;  2HVI A;  5JU5 A;  8ICL A;  7ICU A;  1WWV A;  4OJP A;  2BCS A;  4FBU A;  3UXO A;  1F0M A;  2WTF A;  2ZH4 A;  4DF4 A;  2EWR A;  3MR5 A;  3Q8K A;  4NKT A;  1ZQI A;  2XGQ A;  4AP9 A;  3RB4 A;  3ETR A;  2QAR B;  3Q8P B;  5ALR A;  4FZN A;  1SKW A;  4DSE A;  4O5K A;  5EE0 A;  1FFU A;  5KT4 A;  4QWA A;  2PFP A;  1KTQ A;  2GA9 D;  1V38 A;  4PZO A;  3TAN A;  3NVO A;  1SL1 A;  1RYR A;  5DLF A;  3QUQ A;  1YT3 A;  2WFA A;  2HMX A;  9ICL A;  3JCF A;  4UW9 A;  1SV0 A;  5J29 A;  2G07 A;  1KFT A;  4P0Q A;  3NGD A;  3RJI A;  3H0L B;  5DBB A;  2HBJ A;  3QU5 A;  8ICJ A;  3QUB A;  9ICE A;  4X0B A;  5AI6 A;  3S6J A;  5KT3 A;  1ZQQ A;  1BPZ A;  2NO4 A;  2ZIW B;  5J2H A;  3MC1 A;  1SB3 C;  3C2M A;  1NOM A;  2ZH6 A;  2KHV A;  1S0V A;  5J2K A;  2Q4T A;  3TKA A;  5CR0 A;  9ICV A;  4C8K A;  4C4T A;  4GXJ A;  4WC0 A;  4B9T A;  4XQ8 A;  4PGQ A;  5L1L A;  4I29 A;  1ZQV A;  4M47 A;  1LV5 A;  4RQ5 A;  2HSZ A;  5H2F U;  3EWA A;  4ECY A;  2FMP A;  2YB4 A;  4R8U B;  2M9N A;  5HRD A;  1NZB A;  3BS5 B;  4PZN A;  3UQ2 A;  3TAC B;  2YMM A;  5ALP A;  3PV8 A;  2IA6 A;  7ICV A;  4X4N A;  1JIH A;  3HJ4 A;  3IG8 A;  2GLE A;  1Z3E B;  2F3N A;  3GV8 B;  2JRZ A;  3OUY A;  5DQI A;  2HHW A;  3PZP A;  2LM4 A;  1ZQJ A;  5J0U A;  2OM6 A;  4Q8E A;  3KHG A;  2MU2 A;  1Q3U A;  2BGW A;  1HEK A;  2ZH5 A;  1KQQ A;  4J9P A;  1L3V A;  4EED A;  3ERC C;  4PL1 A;  1XSL A;  1OXJ A;  4NLC A;  4X4U A;  3HIL A;  2ASJ A;  5KFV A;  1ZQF A;  5D49 A;  1ZQ1 C;  5AHX A;  3NYB A;  2YML A;  2LBO A;  4FHV A;  5AI4 A;  2H3I A;  5KFN A;  1RXV A;  3A0H U;  2DBY A;  2W3R A;  3WK6 A;  1QTM A;  2W8K A;  2QB1 A;  2K4H A;  2ZH9 A;  3FDS A;  4KLI A;  4NLN A;  1ZQA A;  5AKK A;  4DS5 A;  2WF9 A;  9ICM A;  5HML A;  5F2V O;  5ALJ A;  5BPC A;  3IN5 A;  2EAP A;  4IQV A;  2GOL A;  5JTI A;  5DG8 A;  2DF4 B;  2FJ6 A;  2HVH A;  4K4H A;  3ISD A;  4NJ8 A;  4F5N A;  1JXE A;  2W8L A;  3RAQ A;  2QB0 A;  3LVV A;  4FHY A;  1MIW A;  2BR0 A;  3QZ8 A;  2YQE A;  1RYS A;  3T5K A;  2AQ4 A;  3KHL A;  4DSF A;  1Q3V A;  4PHA A;  2ZIU B;  3OSP A;  4KN4 A;  3D6J A;  2A1J B;  4KM5 A;  1QH9 A;  4UAR A;  2E1F A;  4QNL A;  4Y2Q A;  3OVB A;  4NLB A;  3GZF A;  5TZV A;  5CHE A;  8ICC A;  1TKD A;  2BDU A;  5KFK A;  2ZIV B;  3N4M B;  4EBJ A;  4RQ3 A;  1SZH A;  2RQ5 A;  4R65 A;  3ISC A;  1PVQ A;  8ICN A;  3SZ2 A;  4C8M A;  3LWL A;  2HBK A;  5DQH A;  4OAH A;  4RWO A;  2ZJA A;  2ZTC A;  4NV0 A;  3OVA A;  5ALW A;  4I2I A;  4FHX A;  4J03 A;  5L1J A;  4J9O A;  1X9W A;  4TUR A;  2K8B B;  3CRX A;  1ZQP A;  4J9L A;  1KN5 A;  4JUZ A;  2XID A;  5AI8 A;  1D9F A;  3C21 A;  1S0O A;  4PHE A;  4ED8 A;  1T7P A;  2KV2 A;  4RQN A;  2O6K A;  5HRB A;  1RG6 A;  5KT5 A;  4UB3 A;  3OJU A;  3PW0 A;  4F2R A;  1Z4N A;  1X42 A;  3F5E A;  4Q43 A;  2DVI A;  1KKX A;  1UCV A;  4KX5 A;  3PR4 A;  4MEX A;  2KE7 A;  4O68 A;  1TFW A;  4FO6 A;  3PML A;  1ZD3 A;  4I0U A;  1SGG A;  4GXI A;  4ECT A;  1HJP A;  4ECR A;  1PVR A;  1ZQE A;  4RPZ A;  3WK8 A;  4QIW C;  2KSO A;  4GLX A;  7ICQ A;  5KFY A;  4CDG A;  2HHV A;  2EZX A;  3Q8L A;  4YXJ A;  1B22 A;  4NLK A;  3MGH A;  9ICX A;  5KFB A;  4YMN A;  3FM9 A;  2RDI A;  2JR5 A;  1LVH A;  3H37 A;  3UPS A;  5DBA A;  2N1R A;  2RDJ A;  5L1K A;  1MIV A;  4M0A A;  4JB3 A;  5CJ7 A;  2FLL A;  2NYV A;  4M5D A;  3RRH A;  2F1J A;  4IL6 U;  4JWN A;  2I5H A;  4ATB B;  5KFD A;  7ICG A;  1XNS A;  2V4Q A;  3ISB A;  1CI4 A;  3RF9 A;  2B21 A;  1PVP A;  2JEG A;  4ACO A;  2F2A B;  4I2A A;  2HCF A;  3GV7 B;  4M2Y A;  2HHT A;  5KAI U;  3H0R B;  4XRH A;  4ELV A;  3PW7 A;  2R8I A;  4UAU A;  3OGU A;  5AM0 A;  3WKE A;  2A3V A;  4NKU A;  3G6Y A;  4EX7 A;  5KFH A;  5HR7 A;  1FIQ A;  1IV8 A;  4USA A;  2ZTD A;  2RFF A;  1JAJ A;  9ICP A;  4KLG A;  3SYZ A;  3AUO A;  4K8V A;  3T5H A;  2E8M A;  2VA8 A;  4X4S A;  3HRD D;  3BQ1 A;  2G09 A;  5AKI A;  5HRF A;  4WH5 A;  1VLB A;  3TAD A;  2QLT A;  4QZ9 A;  2P66 A;  4B9M A;  4F71 A;  4CF3 A;  4TQR A;  5KTQ A;  3SV4 A;  4OJL A;  5E79 U;  5AM2 A;  3N28 A;  4DWI A;  1V85 A;  2B4V A;  2F77 X;  5KT6 A;  3RH6 A;  3SEN A;  9ICA A;  2O5A A;  5JUM A;  5HRK A;  1Q79 A;  1UT8 A;  1ZQZ A;  5D4B A;  5GTH U;  1NKB A;  3WK4 A;  1KRP A;  1PK1 A;  3MDC A;  4PGY A;  3AMZ A;  2BPF A;  7ICR A;  3N7P D;  5KFQ A;  3F2D A;  3SAG A;  3QEB Z;  4KLJ A;  2KHQ A;  4Z6C A;  3PY8 A;  1Z1V A;  4ZOH C;  3PSP A;  4M9J A;  3ER8 C;  4WC5 A;  3H8J A;  1UT5 A;  2LM1 A;  4C7Z A;  4QZI A;  4CRX A;  4O3N A;  4X4R A;  1SXE A;  3BS7 A;  4RZR A;  4DFP A;  3KD3 A;  4WC1 A;  4RU9 A;  4IRC A;  3ZDE A;  3ZD8 A;  2KSO B;  4J9Q A;  1T3Q A;  3KHH A;  1MN8 A;  2KIV A;  8ICR A;  2IMW P;  5KFS A;  4ECZ A;  4UD4 A;  2GO7 A;  1X66 A;  3PSF A;  4MEY A;  2NRW A;  2XVT A;  3M9O B;  3LYS A;  3NVW A;  3PR5 B;  1N61 A;  3L9D A;  4DF8 A;  5DB6 A;  3JPO A;  2F76 X;  3UMC A;  1NI3 A;  3HPO A;  2ZHA A;  4B9V A;  1IG6 A;  5J2D A;  3AQL A;  4NXV A;  5J0Y A;  5AKY A;  2KK0 A;  2K4P A;  3UQ0 A;  4US9 A;  5AKJ A;  5AIA A;  1V97 A;  3RJH A;  3HKZ C;  1T3N A;  3I76 A;  2BCV A;  4E8F A;  4RNM A;  2BBJ A;  7ICI A;  2BCU A;  2BPG A;  1YZ7 A;  1RZT A;  3JPP A;  4OAI Z;  3AQN A;  2KKV A;  3Q8S B;  1NKC A;  4LEV A;  1ZQL A;  4RQ6 A;  3Q8M A;  1ZQW A;  4YCX A;  3SAF A;  4LEZ A;  4LT6 A;  4QWB A;  2BZF A;  2ID1 A;  5KFT A;  4O3P A;  2KEY A;  1QSY A;  4RT3 A;  1IM4 A;  4YR0 A;  2XY7 A;  4HAI A;  4QW8 A;  5ALE A;  2FLN A;  1X9X A;  2ATL A;  3WK7 A;  5KFE A;  4RUA A;  5CHG A;  4B9L A;  5ALZ A;  7ICT A;  4F72 A;  2JH1 A;  1N63 A;  4XJE A;  2RLT A;  2EQY A;  4ECV A;  1TVA A;  2XY6 A;  4KIT B;  3ZDB A;  2DKX A;  2KJ9 A;  3WKC A;  1OU5 A;  5ALN A;  3JYY A;  2IOH A;  4KTQ A;  1DGJ A;  1XO1 A;  9ICS A;  1Z19 A;  3HT3 A;  1OW5 A;  1F5A A;  1LKY A;  1QCK A;  1ZQK A;  1COK A;  4MF8 A;  3M7D A;  2B0C A;  2ZJ5 A;  4E0D A;  7ICE A;  4FZL A;  3MFI A;  2NO5 A;  2Q0Z X;  1TAM A;  9ICB A;  1NZP A;  2BE3 A;  5IIL A;  4EP7 A;  2J6U A;  7ICJ A;  2OCE A;  4DQQ A;  4RQ7 A;  1ZQN A;  2L5Y A;  4EGW A;  1DGS A;  4YN4 A;  2HHP A;  1ZQG A;  1ZQB A;  2KJ5 A;  4Y2Y A;  4J9K A;  2Q66 A;  1X9S A;  5J2A A;  4JV2 A;  3L3F X;  1LB2 B;  3MAB A;  3B0Y A;  1QSS A;  4RQ0 A;  1TE2 A;  2KZM A;  2CXY A;  2DWQ A;  1NO5 A;  3BQT A;  3I28 A;  5AKZ A;  4B9S A;  8ICY A;  1JXL A;  3JPR A;  2RHF A;  3RBE A;  1O08 A;  2AQ0 A;  5CFU A;  2WB1 F;  3RJG A;  3H0M B;  4FE3 A;  3RJJ A;  3PX4 A;  1BPY A;  5J2G A;  4ELU A;  8ICE A;  3Q8Q B;  3M8S A;  2FLP A;  2OEH A;  1F5S A;  2FDR A;  3E2E A;  1COO A;  1XU4 A;  2IOF K;  2C2R A;  1OUQ A;  4F4Z A;  4YD2 A;  1U4B A;  1S76 D;  5AM5 A;  2HBM A;  2O1P A;  3ED5 A;  2W9C B;  1VDV A;  3AQF A;  2WB1 C;  5D46 A;  3KZX A;  5ALQ A;  2IHM A;  5AM1 A;  4B9N A;  2KFZ A;  4LEW A;  4Q45 A;  3KHR A;  2ASD A;  4UD5 A;  3H7I A;  3V7L A;  2Y9T A;  4O69 A;  5HRG A;  3C18 A;  4Y2T A;  4TUQ A;  1XSP A;  2QAR A;  4CCH A;  5KNI A;  3OV7 A;  9ICN A;  1R8A A;  3C1Z A;  1SKS A;  2M2V A;  5AKG A;  2XCP A;  3BS5 A;  2JHD A;  4ED7 A;  2K4E A;  4J9N A;  2M0N A;  2GH1 A;  1A76 A;  3RJK A;  4UAY A;  1QSL A;  2LPE A;  3VCB A;  2ZH3 A;  2JV3 A;  4NL9 C;  4G3I A;  2WAQ C;  1HUZ A;  4KLE A;  9ICC A;  2G08 A;  3N7R C;  2HHX A;  8ICU A;  5ALI A;  1QQ5 A;  1L3U A;  3C2L A;  4TUS A;  2NRZ A;  3CYM A;  5KFM A;  2YX8 A;  1WOT A;  2ZTE A;  4RUC A;  2FPL A;  5AKX A;  5ALO A;  4RNN A;  5KFU A;  4EBE A;  1KDH A;  2ZIV A;  2W9C A;  5HRH A;  2AGQ A;  1PUZ A;  5L9X A;  1UET A;  3WK9 A;  1K1Q A;  4DFD A;  1P7D A;  1IIP A;  3GQC A;  4KLF A;  1N62 A;  4YP3 A;  1JN3 A;  5IIO A;  4NL9 A;  3PW5 A;  3C66 A;  4KLQ A;  4DCC A;  1ZQO A;  1QQ6 A;  3M1Y A;  4IG8 A;  4M9L A;  4OJO A;  3SQI A;  4PPX A;  1RPL A;  5KT7 A;  1WG8 A;  3AU2 A;  4MFC A;  1T4G A;  1S5L U;  3M6K A;  3RR8 A;  3KKA A;  5C5J A;  4J9M A;  3LWM A;  4DLE A;  3H4B A;  4LJX A;  4E80 A;  2HOF A;  5J8Y C;  2P35 A;  3NVZ A;  4M6W A;  5GTI U;  5KFF A;  4F5R A;  5JTG A;  4EZ9 A;  1X40 A;  4UB5 A;  3NS1 A;  3H4D A;  8ICW A;  2FI1 A;  2ZJ8 A;  3NUQ A;  3AL0 B;  3BZC A;  5AK5 A;  5AIB A;  1ZD2 P;  2I6X A;  3UMB A;  3AEV A;  2W9M A;  2BKE A;  2PBE A;  2G5I B;  3UMG A;  2HW3 A;  1RXW A;  5KFP A;  1FA0 A;  4NXT A;  2ESE A;  4Y2V A;  4EBD A;  3EPG A;  4RQ8 A;  1WCL A;  3ICX A;  1JRP A;  4F5O A;  1XS9 D;  2ALZ A;  5KT2 A;  4WC4 A;  4QZG A;  8ICB A;  2DFL A; 
#chains in the Genus database with same CATH homology
 3BQ1 A;  4YQW A;  4KLU A;  5HRF A;  4UAZ A;  4EEY A;  4X4Q A;  3BQ0 A;  2PXI A;  1U48 A;  4RNO A;  5HC9 A;  3TFR A;  2DR8 A;  4QZ9 A;  1U45 A;  2P66 A;  4B9M A;  4ELT A;  4LVS A;  3OUY B;  3C5G A;  1MIY A;  4TQR A;  5KTQ A;  3SV4 A;  2ASL A;  5BOL A;  4DWI A;  3OV7 A;  4TQS A;  4KLS A;  1N56 A;  3HX0 A;  4ED0 A;  5KT6 A;  3RH6 A;  4P4M A;  5F9N A;  3PVX A;  4I2G A;  1NK8 A;  9ICA A;  7ICL A;  2O5A A;  1NK6 A;  5JUM A;  4O9M A;  1MC8 A;  3GIM A;  2BDP A;  5HRK A;  2M2W A;  1Q79 A;  1UT8 A;  4DSK A;  3PO4 A;  1BVS A;  9ICH A;  2XO7 A;  1ZQZ A;  4DFM A;  5D4B A;  4IQT A;  1KEJ A;  3JPQ A;  4DFJ A;  2FMQ A;  4M9H A;  1ZQD A;  8ICG A;  3EZ5 A;  3ZDD A;  4AT8 B;  1UEU A;  2C22 A;  4QZB A;  1Z00 B;  4UB1 A;  4HYK A;  1NKB A;  5CA7 A;  2KN7 A;  1ZQR A;  2XGP A;  1KRP A;  2XY5 A;  4EZ6 A;  3RJE A;  4MFC A;  3MDC A;  4PGY A;  5J0X A;  5DGA A;  2KFN A;  8ICK A;  2BPF A;  7ICR A;  5KFQ A;  4AT7 A;  1JMS A;  3M9M B;  2ZH2 A;  2HHS A;  1S0N A;  4FHP A;  3TAQ A;  3QEB Z;  4KLJ A;  4WCW A;  2DPI A;  4Z6C A;  2VA3 A;  3PY8 A;  5DDY A;  3PX0 A;  4M9J A;  2M2U A;  4WC5 A;  4JK1 A;  2KP7 A;  5J2I A;  3H8J A;  1U49 A;  1NK9 A;  5EWG A;  4F5P A;  3SV3 A;  2FPK A;  2DRB A;  1UT5 A;  2PFN A;  4F4Y A;  8ICO A;  1BPE A;  4F3O A;  4X4P A;  3OSN A;  4RWP A;  4QZI A;  4C8L A;  4O3N A;  4DSL A;  4LZG A;  4X4R A;  2F1H A;  1N48 A;  2DR5 A;  4I28 A;  1L3T A;  7ICN A;  5DQG A;  3T5J A;  4F93 B;  2W9B A;  4X4O A;  4JWM A;  2DRA A;  3MFH A;  4F4W A;  4RZR A;  4YD1 A;  2JEF A;  5F9L A;  2H5X A;  4DFP A;  3HIY A;  8ICT A;  4RU9 A;  1R8C A;  4WC1 A;  4IRC A;  1X2I A;  3TFS A;  3ZDE A;  2PFO A;  4B9U A;  4BXO A;  3ZD8 A;  2V9W A;  2I9G A;  4DQI A;  4FHW A;  5DGB A;  4UB2 A;  5J0S A;  1NJZ A;  5KFC A;  4F4X A;  3C23 A;  4J9Q A;  4FS1 A;  3KHH A;  4YXM A;  4O0I A;  3H39 A;  4PHD A;  3H38 A;  3V6J A;  3SI8 A;  1ZJM A;  8ICR A;  4FH5 A;  1S0M A;  2BCQ A;  5KFS A;  3OHA A;  4ECZ A;  4ED3 A;  3MR6 A;  2IMW P;  4I2H A;  2XCA A;  4UD4 A;  2ISO A;  3RR7 A;  5KG2 A;  3EYZ A;  4DL6 A;  4MEY A;  2NRW A;  5CWR A;  1BGX T;  4P4O A;  2Y1J A;  4KLI A;  3M9O B;  4NLN A;  4IQU A;  7ICH A;  2PFQ A;  1Q78 A;  4DOA A;  1V9P A;  5KFI A;  2UVW A;  3PR5 B;  4F50 A;  3L9D A;  4DF8 A;  4YMO A;  5DB6 A;  3JPO A;  3HJ1 A;  1S9F A;  3HPO A;  4RT2 A;  7ICM A;  2ZHA A;  2HVI A;  4B9V A;  8ICL A;  7ICU A;  1NK0 A;  5J2D A;  4QZD A;  2BCS A;  5J0Y A;  3AQL A;  4FBU A;  4WC6 A;  3UXO A;  3V7K A;  1KFS A;  3B0X A;  2WTF A;  3QZ7 A;  2VA2 A;  9ICU A;  9ICW A;  5HR9 A;  4NM2 A;  2ZH4 A;  4DF4 A;  4IR1 A;  3TAP A;  7ICP A;  3MR5 A;  3Q8K A;  3UQ0 A;  1XC9 A;  4NKT A;  5DLG A;  1ZQI A;  2XGQ A;  5DG7 A;  3RJH A;  2DFL A;  3EW9 A;  1TFY A;  2Y1I A;  3RB4 A;  1T3N A;  2BCV A;  4E8F A;  4RWN A;  5HNK A;  4RNM A;  9ICR A;  4WBY A;  4FS2 A;  3MGI A;  3AQM A;  3Q8R B;  7ICO A;  3Q8P B;  1SKW A;  4O5K A;  2BCU A;  4DSE A;  7ICI A;  2BPG A;  8ICH A;  1TK8 A;  1RZT A;  8ICM A;  3JPP A;  5KT4 A;  4QWA A;  2PFP A;  3AQN A;  1KTQ A;  4O3Q A;  3Q8S B;  2AGO A;  5HMM A;  1NKC A;  4X4U A;  3JPS A;  3TAN A;  4YR3 A;  5DED A;  1ZQL A;  1R8B A;  4RQ6 A;  3Q8M A;  5IIK A;  1ZQW A;  4YCX A;  1SL1 A;  2PI4 A;  1RYR A;  1B43 A;  5DLF A;  5KG1 A;  2V4R A;  5CB1 A;  4I2B A;  4QWB A;  9ICL A;  5KFL A;  4DFK A;  4LT6 A;  5J29 A;  4DQR A;  4F91 B;  9ICG A;  3FYH A;  4J9S A;  1KFT A;  4S3N A;  3NGD A;  4Z6E A;  3RJI A;  2ID1 A;  5KFT A;  5HP4 A;  5DBB A;  4E7X A;  3H8W A;  2R8G A;  8ICJ A;  4O3P A;  1QSY A;  1UA0 A;  1ZQU A;  2ZUD A;  3ZDA A;  4RT3 A;  4KLD A;  4AT9 A;  3M8R A;  9ICE A;  4X0B A;  1IM4 A;  4YR0 A;  3IHQ B;  4RWQ A;  4ATB A;  4QWD A;  4M9G A;  3EPI A;  5KT3 A;  5KFJ A;  2XY7 A;  1SL0 A;  1ZQQ A;  4WBZ A;  4QW8 A;  4DLG A;  1JQR A;  1BPZ A;  4GXK A;  3MR3 A;  7ICS A;  3C2K A;  4QZF A;  2J6S A;  2FLN A;  2ZH8 A;  4YMM A;  1KLN A;  5J2H A;  3JPT A;  4I2D A;  2ATL A;  4KLL A;  3H3A A;  5J0P A;  2J6T A;  5KFE A;  3C2M A;  4RUA A;  5KFA A;  2BHN A;  5CHG A;  4RQ2 A;  4B9L A;  4R66 A;  1NOM A;  5KFO A;  1U47 A;  7ICT A;  2ZH6 A;  3TQ1 A;  3PW4 A;  3T5L A;  1ZQC A;  1S0V A;  5J2K A;  8ICV A;  4RPY A;  3V6K A;  4ECV A;  1TVA A;  4EBK A;  2XY6 A;  4KIT B;  1TV9 A;  2AJQ A;  5III A;  4I2J A;  5CR0 A;  3K75 D;  3GIJ A;  3ZDB A;  9ICV A;  4C8K A;  4GXJ A;  4DL3 A;  4QZ8 A;  4KLM A;  4WC0 A;  4B9T A;  1OU5 A;  4XQ8 A;  4PGQ A;  4EBC A;  2LYH A;  4DL4 A;  2BQU A;  5L1L A;  4P2H A;  1MSW D;  4I29 A;  3JYY A;  2NRT A;  4ECU A;  4KTQ A;  1ZQV A;  8ICZ A;  4NM1 A;  5IIJ A;  4UBB A;  1ZQY A;  8ICF A;  3V7J A;  1XO1 A;  2R8K A;  2BQ3 A;  1LV5 A;  4M47 A;  3AU6 A;  4RQ5 A;  5J0T A;  2JEI A;  3RB0 A;  1ZJN A;  3EWA A;  9ICS A;  2NRX A;  5J2E A;  3HP6 A;  3HT3 A;  4ECY A;  2FMP A;  3PO5 A;  4O5E A;  4R8U B;  1F5A A;  2M9N A;  4LZD A;  5HRD A;  1ZQK A;  4Q8F A;  4MF8 A;  1NJW A;  8ICP A;  4WC7 A;  3UQ2 A;  3WFP A;  7ICV A;  3PV8 A;  2IA6 A;  4X4N A;  1JIH A;  2ZJ5 A;  4E0D A;  4I27 A;  7ICE A;  5EOZ A;  4QWC A;  3MFI A;  1BPD A;  2Q0Z X;  9ICQ A;  2NRK A;  3HJ4 A;  2A1J A;  1ZQH A;  5KFG A;  1Z3E B;  1NJY A;  7ICK A;  1BPB A;  4JV0 A;  4UBC A;  4UB4 A;  9ICB A;  1NZP A;  3GV8 B;  5IIL A;  2BE3 A;  3OUY A;  5DQI A;  5J0O A;  2HHW A;  4EP7 A;  4GC6 A;  3V6H A;  1ZQJ A;  5J0U A;  2J6U A;  4DSI A;  4X4V A;  2W9A A;  4NXZ A;  4Q8E A;  3KHG A;  4QWE A;  7ICJ A;  2BGW A;  2ZH5 A;  1C7Y A;  4J9P A;  1A77 A;  3C1Y A;  5KFR A;  1PZN A;  4YVZ A;  1L3V A;  1S10 A;  3HW8 A;  4DQQ A;  9ICJ A;  4QZH A;  2FPM A;  4R64 A;  4O3O A;  4RQ7 A;  1XSL A;  4DSJ A;  8ICX A;  2ASJ A;  2ZH7 A;  1DK2 A;  5KFV A;  1ZQN A;  2R8H A;  1ZQF A;  5D49 A;  4PH5 A;  3NYB A;  4AT9 B;  3PMN A;  4O3R A;  5DDM A;  3RB6 A;  2MAX A;  4FHV A;  1HUO A;  1DGS A;  3GIK A;  4R8U A;  1K1S A;  4YN4 A;  5KFN A;  1RXV A;  3V72 A;  2HHP A;  1ZQG A;  2GWS A;  4XUS A;  1NKE A;  2IHN A;  5KG7 A;  4I2C A;  5J0Q A;  1ZQB A;  4M04 A;  4RPX A;  3TAR A;  1QTM A;  3WFR E;  1TFR A;  2W8K A;  4MF2 A;  4J9K A;  2Q66 A;  2KTQ A;  1X9S A;  5J2A A;  2ZH9 A;  2I1Q A;  5DG9 A;  4JV2 A;  2F1I A;  1LB2 B;  4BDP A;  3FDS A;  3MAB A;  2BPC A;  4ECQ A;  1ZQA A;  1KSP A;  5DB8 A;  3B0Y A;  5HHH A;  4ED1 A;  4F5Q A;  4DS5 A;  2PI5 A;  4IRD A;  2DR7 A;  3NTU A;  4ZH4 A;  9ICM A;  4WC3 A;  5HML A;  3K4G A;  5F2V O;  5BPC A;  1QSS A;  3AQK A;  4IQV A;  2P6U A;  4RQ0 A;  4FBT A;  5DG8 A;  3OHB A;  2KZM A;  9ICI A;  2HVH A;  4K4H A;  1NO5 A;  3RH5 A;  3RAX A;  3ISD A;  1SL2 A;  3H40 A;  4DL2 A;  4KLG A;  3BQT A;  4F5N A;  1JXE A;  3QEA Z;  2W8L A;  3RAQ A;  2AGP A;  4B9S A;  4PHP A;  3GV5 B;  8ICY A;  4DEZ A;  3LDA A;  3GII A;  1JXL A;  5DKW A;  4FHY A;  1D8Y A;  1MIW A;  3GDX A;  3JPR A;  9ICO A;  3RBE A;  3PNC A;  2OWO A;  2P6R A;  2BR0 A;  8ICI A;  3WFQ E;  5J0W A;  3QZ8 A;  2AQ0 A;  3BDP A;  1RYS A;  3RJG A;  3T5K A;  4KLO A;  2AQ4 A;  5J2F A;  1T8E A;  3KHL A;  4DSF A;  8ICA A;  3RJJ A;  1MQ2 A;  4PHA A;  3PX4 A;  5KFX A;  4DS4 A;  4DQS A;  3OSP A;  4KN4 A;  4R63 A;  1BPY A;  2A1J B;  3THV A;  5J2G A;  4ELU A;  8ICE A;  3Q8Q B;  3M8S A;  2FLP A;  5KG0 A;  1XSN A;  1IXR A;  4RQ4 A;  3OVB A;  3E2E A;  1XWL A;  5TZV A;  1S77 D;  2ZUC A;  1COO A;  8ICC A;  4AT7 B;  5IIM A;  1XU4 A;  4DL7 A;  1TKD A;  2ZH1 A;  2C2R A;  5KFK A;  1KFD A;  4F4Z A;  4YD2 A;  1U4B A;  1S76 D;  3N4M B;  4QZC A;  3RJF A;  1ZQM A;  4EBJ A;  4RQ3 A;  3ORY A;  3UPQ A;  3KTQ A;  2O1P A;  4R65 A;  3ISC A;  4IRK A;  1NK7 A;  4XQ7 A;  8ICN A;  3SZ2 A;  4C8M A;  2C2E A;  4X4T A;  3LWL A;  3WFS C;  4Z6D A;  2W9C B;  5DQH A;  3RB3 A;  4BGD A;  5D46 A;  1CUK A;  2IHM A;  4RWO A;  2ZJA A;  4B9N A;  2KFZ A;  1EXN A;  2ZTC A;  4Q45 A;  3KHR A;  2ASD A;  3OVA A;  4UD5 A;  4I2I A;  4FHX A;  3H7I A;  4C8N A;  3V7L A;  9ICK A;  5L1J A;  2HHU A;  9ICF A;  1Y88 A;  5KG5 A;  4J9O A;  3LK9 A;  1SKR A;  1X9W A;  5HRG A;  1VJ7 A;  4TUR A;  3C18 A;  7ICF A;  5EWF A;  4MFA A;  4TUQ A;  2IBK A;  2MUT A;  1ZQP A;  1ZQS A;  3QE9 Y;  1XSP A;  4KMU A;  3GIL A;  3BJY A;  4BWJ A;  5J0R A;  4DL5 A;  4CCH A;  4J9L A;  4YG2 A;  4M6W B;  4XA5 A;  3RTV A;  1JX4 A;  4F4K A;  5J2C A;  1NJX A;  4O3S A;  5CP2 A;  1R8A A;  1KNY A;  3T3F A;  3C1Z A;  3PW2 A;  4JUZ A;  3BQ2 A;  1SKS A;  2M2V A;  2FMS A;  1D9F A;  3C21 A;  1S0O A;  4PHE A;  2XCP A;  8ICB A;  4ED7 A;  4EYH B;  4QZE A;  4ED8 A;  4J9N A;  1T7P A;  1A76 A;  1D8L A;  5KFZ A;  3LQC B;  5HRB A;  4O5C A;  4X0A A;  3RJK A;  4UAY A;  3JZ0 A;  5KT5 A;  4UB3 A;  3OJU A;  1QSL A;  3H8S A;  1D9D A;  2ZH3 A;  3G6V A;  3G6X A;  3C5F A;  3PW0 A;  4KN7 A;  1TK0 A;  4F2R A;  4NY8 A;  4G3I A;  8ICQ A;  4Q43 A;  1NK5 A;  2DVI A;  3OVS A;  2DPJ A;  4DO9 A;  1HUZ A;  2JZB A;  3PR4 A;  4MEX A;  4KLE A;  4ECX A;  5DBC A;  9ICC A;  4QW9 A;  4IR9 A;  1L5U A;  1TFW A;  2MUT B;  2HHX A;  8ICU A;  4FO6 A;  3PML A;  4P4P A;  9ICN A;  3RRG A;  1L3U A;  3C2L A;  1YLQ A;  2XC9 A;  4TUS A;  2NRZ A;  4GXI A;  5KFM A;  4ECT A;  1HJP A;  4DOB A;  4ECR A;  2C2D A;  1ZQE A;  5L1I A;  5KG3 A;  1V4A A;  3WFO A;  4RPZ A;  4F92 B;  3GFK B;  4WC2 A;  1ZYQ A;  1WOT A;  4GLX A;  2HHQ A;  2ZTE A;  3MDA A;  7ICQ A;  4RUC A;  5KFY A;  2FPL A;  2HHV A;  2UVR A;  4TUP A;  1TAQ A;  3Q8L A;  3N97 B;  4YXJ A;  4RNN A;  5KFU A;  3M9N B;  4EBE A;  5DB7 A;  5DB9 A;  1S97 A;  3MGH A;  1KDH A;  4NLK A;  1B22 A;  9ICX A;  2W9C A;  5KFB A;  4ED2 A;  5HRH A;  4UQG A;  4YMN A;  2AGQ A;  2UVV A;  5KG4 A;  4ED6 A;  2C28 A;  2RDI A;  5L9X A;  1UET A;  1R89 A;  1K1Q A;  4IQW A;  4KLF A;  3GQC A;  4KLH A;  5KFW A;  2R8J A;  4FH3 A;  1MQ3 A;  4YP3 A;  1BNO A;  3H37 A;  3UPS A;  1JN3 A;  5DBA A;  5IIO A;  4BWM A;  3MR2 A;  5J2B A;  3PW5 A;  3C66 A;  2RDJ A;  4KLQ A;  2KZ3 A;  1ZQO A;  5L1K A;  4ECS A;  1MIV A;  4M0A A;  4YR2 A;  2NRV A;  4IG8 A;  1Z00 A;  4M9L A;  4PGX A;  3MBY A;  5DEC A;  1UEV A;  5CJ7 A;  5J2J A;  4PPX A;  3PX6 A;  1RPL A;  5KT7 A;  2FLL A;  4NLG A;  4M5D A;  5HHI A;  4F2S A;  4JV1 A;  3AU2 A;  3UXN A;  1T4G A;  2F1J A;  3RRH A;  3RBD A;  2UVU A;  4I2E A;  3JPN A;  4JWN A;  2M2T A;  3HWT A;  4ATB B;  3RR8 A;  5KFD A;  1QLN A;  4YFK A;  1TK5 A;  5C5J A;  4J9R A;  3LWM A;  4J9M A;  2V4Q A;  3OJS A;  3ISB A;  4DLE A;  7ICG A;  2KZZ A;  1U9L A;  3H4B A;  2B21 A;  4E80 A;  2JEG A;  4C8O A;  4NLZ A;  4I2A A;  4M6W A;  4ECW A;  3GV7 B;  1L3S A;  4M2Y A;  5KG6 A;  5KFF A;  4F5R A;  2HHT A;  4EZ9 A;  4MFF A;  1TAU A;  1SZP A;  4UB5 A;  2ISP A;  4AT8 A;  2DR9 A;  3RH4 A;  1DK3 A;  4Z6F A;  4XRH A;  3ZDC A;  3H4D A;  8ICW A;  1H38 A;  2ZJ8 A;  4ELV A;  3PW7 A;  2R8I A;  3OGU A;  2JZB B;  3IM1 A;  5HRL A;  4NKU A;  3G6Y A;  1ARO P;  2JEJ A;  5KFH A;  2BQR A;  4BXO B;  2W9B B;  3ETL A;  3UXP A;  4F8R A;  2W9M A;  2BKE A;  2PBE A;  1VFG A;  2BCR A;  4K4I A;  1PX5 A;  4I2F A;  1RXW A;  2HW3 A;  5HRI A;  4QZA A;  9ICT A;  2ZTD A;  2RFF A;  5KFP A;  4RQ1 A;  1FA0 A;  1JAJ A;  1NK4 A;  1ZQX A;  2ZHB A;  4KLT A;  4Q44 A;  3ZD9 A;  1ZET A;  1X9M A;  9ICP A;  1BPX A;  1DOQ A;  4EBD A;  3TI0 A;  3EPG A;  2ZUB A;  4RQ8 A;  1WCN A;  1WCL A;  4UAW A;  3SYZ A;  8ICS A;  4F5O A;  4M9N A;  4DQP A;  5EWE A;  4X5V A;  4K4G A;  1XS9 D;  3AUO A;  2ALZ A;  3T5H A;  1CEZ A;  1BNP A;  4GC7 A;  5KT2 A;  2VA8 A;  4X4S A;  4EYI B;  4DOC A;  4WC4 A;  4QZG A;  2AU0 A;  5HRE A;  1UA1 A;  1ZQT A;  5BOM A;  5IIN A;  2VAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...