4O5EA

Structure of human dna polymerase complexed with n7mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 103
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5eA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5eA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5eA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5eA03
3ORYA 4KLGA 1HJPA 1WCNA 1KFSA 4I2JA 3RJHA 1Y88A 4I2EA 3NYBA 1DOQA 4O3PA 3C18A 3PW0A 2M2TA 4X4VA 4E8FA 3MDAA 1ZQKA 4I2CA 4M9NA 4NLZA 3RJGA 3B0YA 3AUOA 4J9NA 7ICGA 2O1PA 4GXKA 1BVSA 3H40A 5J0PA 1ZQMA 4ED7A 5KFDA 2P6UA 4UB1A 9ICVA 5J2HA 1X9MA 1EXNA 2ZUDA 5CR0A 3H8JA 5KT4A 5D4BA 2KTQA 4YVZA 4Q44A 4UAZA 4R66A 4DL6A 2ASJA 3GIKA 5J0WA 2C2EA 4MEXA 1ZQCA 8ICMA 3H3AA 4FHWA 1NK5A 1S97A 5BOMA 3C2LA 2IHMA 4X4NA 1RYRA 3RBDA 1NJZA 2MAXA 2JEIA 2M2WA 4RU9A 3OVBA 4QZAA 3H8WA 3MR2A 4I2AA 7ICLA 5DEDA 1SL0A 4DFJA 2XY6A 4NXZA 1QSLA 5CHGA 4DSIA 1XU4A 1NJXA 3PO5A 2DR5A 1PZNA 2XC9A 3RRGA 5IINA 4QW8A 3E2EA 5KFZA 9ICUA 3HP6A 4DL2A 1NKBA 5J2FA 3C1YA 5KG6A 4ECXA 1SKSA 2ISPA 4WC6A 5J0QA 4DFPA 4X4SA 4YR3A 2IA6A 4DL4A 4DL5A 8ICAA 5HRLA 4BDPA 4WBZA 3RAQA 1SZPA 7ICKA 2DRBA 4C8NA 3OJUA 4F5RA 1UA1A 2W9CA 3OUYA 3SV3A 4QZHA 1V9PA 4DOCA 2XY7A 5J2EA 1NK6A 3AU2A 2BPGA 1BNPA 3EPGA 3LK9A 5IIOA 4ZH4A 2KZMA 2HHQA 1BGXT 1COOA 1NK4A 1ZQAA 5KG1A 1ZQWA 4FS2A 2AU0A 3MR3A 3MGIA 4QZ9A 5DLGA 4GXJA 5F2VO 1MIYA 4IR9A 4NKUA 5KTQA 4JV1A 4RT2A 4F5PA 1XS9D 2C28A 2NRVA 3PMNA 3HPOA 3GIJA 4KLOA 8ICWA 5KFKA 3LWLA 4MFFA 4FO6A 5J2BA 2XGQA 4R64A 1BPEA 1SL2A 4B9NA 3PX0A 2A1JA 3H7IA 1NOMA 3RR8A 3RTVA 5L1KA 4BXOB 5HR9A 9ICEA 1CEZA 5HMMA 5KFVA 2VA2A 1UA0A 1R8BA 3JZ0A 5KFFA 2HVHA 5CP2A 4NLNA 4B9MA 4E80A 2XCPA 9ICGA 3Q8QB 4IQUA 3BQTA 3M9MB 5KG3A 1ZQTA 8ICUA 7ICQA 1TAUA 5HRDA 5KG4A 4RWQA 4WC7A 4RQ3A 1TFRA 5DKWA 3H38A 9ICCA 4AT9B 3C1ZA 4TQRA 4IRDA 4YP3A 3M9OB 3V7JA 3V6HA 4IRKA 1KRPA 2MUTB 4M6WB 4EYIB 4M9GA 1NO5A 3AQNA 4EP7A 3HT3A 3C21A 8ICHA 5HRFA 5KFNA 1RXWA 9ICXA 3NGDA 4F5NA 1U45A 2VA3A 4I2IA 4F93B 4C8LA 2W9BA 4ECRA 1U49A 4YD1A 1X2IA 8ICCA 3ZDEA 2XO7A 1KFDA 1K1SA 2NRKA 5J2DA 4ECWA 4MF8A 2JZBA 4FHXA 4RPXA 1Z00B 4O5KA 4AT8A 4RZRA 2F1IA 3TANA 9ICNA 4QZFA 3T5KA 2F1JA 5D46A 1QLNA 4NM1A 2ZH5A 4UB2A 4DQRA 3AU6A 3GQCA 5HC9A 4F4XA 5IIKA 9ICJA 4AT7B 4X4UA 4RWPA 5J2IA 8ICQA 5EWGA 2KZ3A 3HWTA 4ATBB 4RQ8A 3MGHA 4O3QA 4J9SA 4DWIA 5IILA 4KLTA 4X0AA 5KG0A 2PFQA 8ICOA 3WFQE 4YR2A 7ICIA 2ZHAA 3TAQA 2F1HA 2J6TA 4PHPA 2BCRA 4F2SA 2KN7A 3C2KA 1TV9A 2AGOA 7ICSA 5EOZA 4FBUA 3RJIA 1XSNA 5DBBA 1ZQUA 5F9NA 3M9NB 1ZJNA 1SKWA 1ZQQA 4KLFA 2DR8A 4ED8A 3ZDBA 5DLFA 4DLGA 2JEGA 5HRIA 2VA8A 2HVIA 3IHQB 3UXOA 2BPCA 5KFOA 4Z6EA 4DSKA 1MIVA 2P6RA 1D8YA 2RDIA 2PI4A 4NLGA 3T5HA 4PHAA 4ECVA 2PFOA 4BWJA 5KFSA 4F8RA 4O3SA 3T5JA 4YD2A 5DECA 4UBCA 3RH5A 4UAYA 2M2VA 7ICNA 4R8UB 1TK8A 1Q78A 5KFMA 4G3IA 1TVAA 4RQ6A 3KHHA 3PNCA 5DB9A 2KFNA 5HRHA 5JUMA 3HJ4A 2BQUA 1ZQXA 3UPSA 2FPLA 2V9WA 4J9LA 4DSJA 3G6XA 4DL7A 3PV8A 3MFIA 2ALZA 3PR5B 4DQIA 3JYYA 2ZH8A 4RQ1A 1L5UA 4B9UA 3JPSA 4QWAA 1ZQPA 4RQ4A 2AQ0A 4O5EA 3UQ2A 1KLNA 4UQGA 4KLUA 3Q8RB 3KHRA 7ICVA 8ICTA 3LQCB 3BQ1A 3C5FA 5L1LA 1TFYA 1IXRA 1XWLA 2UVRA 4EBKA 3OHBA 2ASDA 3RJEA 4KN7A 4LZDA 4DQQA 2HHWA 5DDMA 3Q8MA 9ICBA 2HHVA 4X4QA 3QE9Y 8ICEA 3GILA 5DDYA 1QSYA 2I1QA 1ZQBA 4QZ8A 4DL3A 8ICSA 1ZQOA 5J2GA 5IIIA 2PFNA 1JN3A 1RXVA 5L9XA 2BCSA 4ELVA 4NLKA 2KFZA 4J9KA 4FHVA 2DVIA 4QWCA 3ETLA 3BDPA 1NZPA 5D49A 2IMWP 3TI0A 2FPMA 4FHYA 3OJSA 4B9VA 2UVUA 1VJ7A 3Q8PB 2BQRA 1BPYA 5HHHA 5CJ7A 4FH3A 2NRWA 1KEJA 4F5QA 5J2AA 1LB2B 4ED0A 2BCUA 1A77A 4Q45A 4C8KA 4B9LA 3JPPA 3MR5A 1NKCA 3TQ1A 8ICBA 4X4TA 4JV0A 2W8LA 4J9QA 4M9JA 2DRAA 4DOAA 4JK1A 5L1IA 4ELTA 4E7XA 3RAXA 9ICSA 5KT6A 3H4DA 3PW2A 4I2HA 3ISDA 3OSPA 1Q79A 1UEUA 4YMNA 4O9MA 3K75D 4DLEA 3B0XA 4JWNA 4M2YA 1MC8A 4KN4A 5KFBA 4MFCA 7ICOA 4F91B 3OGUA 9ICFA 4QWBA 9ICMA 2ZH9A 8ICVA 3EWAA 4ECSA 3OHAA 3C2MA 4F4YA 7ICMA 8ICXA 2BE3A 3RB6A 3RJJA 3Q8KA 2BCQA 4BXOA 4P4PA 3PX6A 2JEJA 1KFTA 3RRHA 4RPZA 4ED2A 2UVVA 1NK8A 3EZ5A 5J0SA 4KMUA 4F92B 1KSPA 1S10A 3ZDCA 5DBCA 3C66A 3AQKA 4FH5A 3PR4A 9ICPA 1RYSA 4JV2A 5HMLA 4F50A 4I2GA 3GV5B 5DQHA 2C22A 2HHPA 5KT3A 2VANA 2DPJA 4RQ5A 4ELUA 2FLNA 2W9CB 3FDSA 2ZJAA 4FBTA 3BQ2A 1NKEA 2HW3A 4Q8EA 2FMPA 2UVWA 5KFYA 3T5LA 4DSEA 3V72A 4J9OA 9ICAA 5DGBA 4EZ9A 2MUTA 1TAQA 1UT8A 4M6WA 4RNOA 4IQVA 2W9AA 5KFAA 4ECTA 1ZETA 4DSLA 4KLIA 4FHPA 1BPBA 1IM4A 1S0MA 4RT3A 5KFXA 8ICFA 1KDHA 1NK0A 1TK0A 1FA0A 1JXEA 7ICRA 2ID1A 2Q0ZX 4WC1A 2ZH1A 5IIJA 4BGDA 1JAJA 1MQ2A 4WC2A 4F4KA 4Q8FA 1Z00A 1ZQEA 5KG5A 4YXJA 1XSPA 3RJKA 9ICIA 1S76D 1U4BA 5DG8A 7ICFA 2A1JB 3OVAA 7ICEA 4I2DA 1JMSA 4RQ2A 2AGPA 3OV7A 2ZH6A 9ICOA 3NTUA 2ZUBA 1U9LA 4ED1A 1S0OA 4WC0A 4AT7A 3OSNA 1L3TA 1ZQIA 1S0NA 4UB3A 3MFHA 1MQ3A 1ZJMA 1T7PA 4P2HA 2IBKA 5HRKA 3RR7A 4ATBA 8ICGA 1BPXA 2PI5A 5DQGA 2KZZA 3PVXA 3RH4A 4PH5A 5HREA 2ZH3A 4XUSA 3MR6A 4I27A 1Z3EB 3JPOA 4C8OA 4M47A 3GFKB 4M0AA 1MSWD 1U47A 4J9MA 2RDJA 3WFPA 2R8GA 2W9MA 4EBCA 4YQWA 4YCXA 3BJYA 4EZ6A 5KT5A 2OWOA 1L3VA 5BPCA 2BDPA 3RBEA 5J0TA 4Q43A 4I29A 1ZYQA 2HHSA 1R89A 4DF4A 1ZQSA 4O0IA 5L1JA 1RZTA 2C2DA 2ISOA 4O3RA 8ICRA 1V4AA 9ICTA 3V7KA 1KNYA 7ICPA 5KFPA 1N48A 3K4GA 5KFQA 2BPFA 4UD4A 4RUAA 3V7LA 3HIYA 2ZH4A 4UAWA 3MDCA 4RQ7A 4KITB 8ICIA 3UXNA 2XCAA 4KLLA 4R8UA 4F2RA 4PGXA 2Y1JA 4F4WA 4KLMA 2HHXA 4QZGA 3MBYA 4DSFA 5KFGA 4X5VA 1T3NA 4GC7A 3V6KA 4Z6DA 3C23A 1QTMA 4K4IA 5DB8A 3EW9A 8ICZA 3L9DA 3OVSA 4XA5A 3MABA 5HNKA 4E0DA 4PHDA 1H38A 2PFPA 3ISCA 4F3OA 3H37A 4ECQA 5KFWA 3QEBZ 1KTQA 2NRXA 4YXMA 1ZQFA 1ZQGA 3PY8A 1T4GA 1B43A 4MFAA 3C5GA 5DB6A 1XC9A 1U48A 3GIIA 1S9FA 4S3NA 1VFGA 3JPNA 2J6UA 3EYZA 2ZJ5A 2M2UA 4UBBA 4DF8A 4KLDA 2HHUA 3UPQA 1WOTA 8ICLA 4I2FA 3H4BA 2ZTDA 4O5CA 1ZQNA 3UQ0A 4P4MA 2FMSA 4TURA 4ECZA 2FLLA 4KLEA 1BNOA 3RH6A 4I2BA 5KFUA 2KP7A 4YG2A 4QZEA 4QWEA 4F5OA 4TUQA 9ICHA 3H8SA 2C2RA 2V4RA 2ZJ8A 4M9HA 4QZIA 5KG7A 5KFHA 4NM2A 5KFEA 1B22A 4DQPA 3Q8LA 5J0UA 1X9WA 4WCWA 1MIWA 2M9NA 3KHLA 5KFTA 5TZVA 4ED3A 1SL1A 5DBAA 2ATLA 4J9RA 4O3NA 5KT7A 4K4GA 4RWOA 3EPIA 1D8LA 5J0YA 1ZQYA 1XSLA 2ZTCA 3Q8SB 2Y1IA 4M04A 4RNNA 1C7YA 2IHNA 4DS4A 3TAPA 4DEZA 1JIHA 1WCLA 5DB7A 4Z6FA 4GXIA 4EBEA 4DFMA 3PW7A 7ICUA 5CA7A 4TQSA 4RNMA 1DK3A 1UETA 1HUZA 3G6VA 4JWMA 4EBDA 5EWFA 4DO9A 1BPZA 2I9GA 3JPRA 3GIMA 4IQTA 4UB5A 5KT2A 1D9DA 2NRTA 2R8JA 4TUSA 4YN4A 3QZ8A 2AGQA 3H39A 5KG2A 5J2KA 4LZGA 3PX4A 1L3SA 1JQRA 1ZQVA 5DQIA 3RB4A 2BR0A 1R8CA 5HHIA 1XO1A 2DFLA 4YMOA 3M8SA 3WFRE 5EWEA 3UXPA 2XGPA 3ZDAA 4IG8A 4Z6CA 1NJWA 4KLHA 3KTQA 4NKTA 4PGQA 2BQ3A 2HHTA 2ZH7A 4XQ7A 5KFJA 5CB1A 5CWRA 2P66A 4QZDA 2W8KA 2ZUCA 4EBJA 1UT5A 4B9SA 7ICTA 5J0XA 4M9LA 1NJYA 3HX0A 1JX4A 1ZQJA 4PPXA 1JXLA 2BHNA 3OUYB 4GLXA 4RQ0A 2BGWA 9ICWA 3QZ7A 4X4PA 3GDXA 1TKDA 5BOLA 4ECUA 4AT9A 1OU5A 3M8RA 1TK5A 1AROP 4X0BA 4GC6A 1R8AA 2FLPA 4CCHA 4DS5A 8ICJA 9ICLA 4QZBA 1PX5A 1ZQRA 1T8EA 4WC5A 1SKRA 4RUCA 4P4OA 1L3UA 5HRBA 1D9FA 4RPYA 2R8IA 4IR1A 4C8MA 4ECYA 5J2JA 1DK2A 2H5XA 5KFCA 3SV4A 9ICRA 4ED6A 4WBYA 4M5DA 3PMLA 2XY5A 3ZD9A 2BCVA 4B9TA 3RB3A 2DR7A 4QW9A 4FS1A 2J6SA 3IM1A 4JUZA 4IRCA 1QSSA 4X4OA 1NK9A 3SI8A 1ZQLA 1F5AA 3G6YA 4DFKA 4LT6A 3JPQA 4DQSA 1S77D 5J2CA 3SYZA 3N97B 3PW4A 2PXIA 5KFRA 1X9SA 4LVSA 4PHEA 5C5JA 2BKEA 3GV7B 3TFSA 3GV8B 4EEYA 2DPIA 3N4MB 2DR9A 4YFKA 4DOBA 4UB4A 1ZQZA 2V4QA 1ZQDA 3HJ1A 1UEVA 4EYHB 2O5AA 4R65A 2FPKA 3RJFA 3PO4A 1A76A 5J29A 3WFOA 4RWNA 2GWSA 8ICNA 2B21A 3FYHA 7ICHA 2FMQA 2ZH2A 1HUOA 4BWMA 3ZDDA 2RFFA 1LV5A 3ISBA 4KTQA 5HRGA 4WC3A 2W9BB 1N56A 1ZQHA 3T3FA 5DG9A 4HYKA 1DGSA 2AQ4A 2R8HA 5DG7A 2ZHBA 5KFIA 2PBEA 3PW5A 5IIMA 2JZBB 4KLQA 4AT8B 1K1QA 4X4RA 3SZ2A 8ICPA 1TFWA 3TARA 4XRHA 2LYHA 4TUPA 4I28A 5J0RA 9ICKA 4MEYA 3AQLA 3TFRA 4UD5A 4KLJA 1RPLA 4WC4A 3V6JA 4YR0A 4YMMA 3THVA 8ICYA 5DGAA 4IQWA 2WTFA 3HW8A 3RB0A 4XQ8A 3QEAZ 1NK7A 4NY8A 4KLSA 4QZCA 2ZTEA 3JPTA 4J9PA 3LDAA 1S0VA 2AJQA 3LWMA 4MF2A 4K4HA 4QWDA 2JEFA 3BQ0A 3KHGA 1YLQA 4R63A 3AQMA 7ICJA 5F9LA 4F4ZA 5KFLA 8ICKA 5HP4A 2ASLA 1CUKA 2R8KA 2Q66A 9ICQA 2NRZA 5J0OA 3ZD8A 3WFSC 4PGYA 1BPDA 4O3OA
chains in the Genus database with same CATH superfamily
5AK6A 3L3FX 3SAGA 1C20A 3NYBA 2M2TA 3ER8C 4M9NA 2RRDA 3RJGA 5ALIA 2O1PA 1D8BA 4UB1A 1X9MA 2ZUDA 1KW4A 3D2SA 4R66A 4DL6A 4MEXA 2Y0SF 3GIKA 2ASJA 3H3AA 1PVQA 3RBDA 3CNHA 2MAXA 2JEIA 3BZKA 3OVBA 1LKYA 2FE9A 2VIXA 5DEDA 4DFJA 2XY6A 5CHGA 1URJA 5D63A 1NJXA 3PO5A 1PZNA 2K60A 5ALMA 1IV8A 2QB1A 4UW9A 3UM9A 3K7DA 9ICUA 3HP6A 4DL2A 2DF4B 3C1YA 4WC6A 2ISPA 4X4SA 2H3FA 2IA6A 4DL5A 1CRXA 2ZIXB 1XO0A 3FM9A 1AQ6A 2JR5A 3OUYA 4QZHA 1V9PA 3LYSA 3AU2A 4FE3A 2BPGA 3EPGA 1J2NA 1CI4A 5KG1A 2ZIVA 5F2VO 1L7OA 2E8PA 3HPOA 3F2CA 1A6SA 8ICWA 2FCLA 2XGQA 4R64A 1BPEA 2ES6A 3PX0A 2JXJA 3RTVA 1SV0A 1UA0A 3JZ0A 2HVHA 4OJLA 9ICGA 1ZRNA 1SV0C 2ZXHA 4IQUA 4RWQA 4LEZA 8ICUA 7ICQA 1TAUA 4RQ3A 5DKWA 1FEZA 4AT9B 3C1ZA 2E1EA 3M9OB 2KIWA 8ICHA 5B3PA 3ZDEA 1K1SA 4FHXA 4RPXA 4O5KA 2LMRA 3GZFA 5AI9A 3TANA 4QZFA 3I76A 4DQRA 3AU6A 3GQCA 4RWPA 8ICQA 2EAMA 2KZ3A 3HWTA 2WF7A 2HOIA 4US9A 5IILA 5KG0A 3QUBA 8ICOA 3WFQE 3H8MA 2KVCA 4KX3A 2JV3A 4PHPA 4OCZA 2AH5A 1KQQA 1ZQQA 4ED8A 1Q8KA 1TAMA 5DLFA 4DLGA 2VA8A 1IG6A 1KN5A 2BPCA 2F3NA 1D8YA 4JMUA 3T5HA 4ECVA 1A0PA 4BWJA 2PFOA 4F8RA 2HSZA 5CEHA 4UAYA 5KFMA 3CW2C 4G3IA 2OHFA 2LBOA 3L4PA 5HRHA 2FPLA 3AQEA 4DL7A 3MFIA 2ALZA 4DQIA 2ZH8A 1Q3VA 2L5YA 1NNLA 3QNMA 1L5UA 1ZQPA 4KLUA 3Q8RB 8ICTA 3IN5A 1IXRA 2UVRA 3OHBA 3SMVA 4LZDA 2A1AA 2K8BB 2HHVA 4X4QA 3QE9Y 1QSYA 5J8YA 4WJ3B 2DVIA 3ETLA 5AHXA 4K98A 1DGJA 2IMWP 4FHYA 3OJSA 2UVUA 1BPYA 3A0HU 4B9LA 3TQ1A 1ZD4A 4J9QA 2DRAA 4DOAA 4E7XA 3O0FA 4ELTA 3TADC 9ICSA 1Q79A 2W04A 1UEUA 4YMNA 4DLEA 4JWNA 3B0XA 3N28A 4MFCA 2E8MA 4O68A 2KK0A 2ZH9A 2KG5A 2BE3A 4BXOA 4RPZA 4ED2A 2UVVA 1NK8A 3EZ5A 4F92B 5J0SA 3D2QA 2CXYA 5DQHA 2C22A 2DPJA 3BZCA 3FDSA 4FBTA 1L7NA 2FMPA 5AKLA 2UVWA 5AM3A 1TAQA 2W9AA 5KFAA 4Y2UA 4RT3A 8ICFA 1KDHA 1NK0A 3QU9A 2ID1A 1Z00A 2RP5A 3M6ZA 1XSPA 2YMMA 7ICEA 3OV7A 1HEKA 2GLEA 2ZUBA 1U9LA 4WC0A 2P35A 3OSNA 1L3TA 1S0NA 1MN8A 1MQ3A 3MFHA 1ZJMA 2KHQA 4ATBA 5DQGA 4IS7A 4PH5A 5HREA 3MR6A 2KE7A 4C8OA 3WK5A 1MSWD 1HIWA 2NV3A 4YCXA 2G08A 3BJYA 5BPCA 1R89A 3F2BA 2HHSA 1ZQSA 5G5GA 2ISOA 8ICRA 2QARA 9ICTA 3AMZA 3K4GA 4UD4A 4RUAA 4KITB 4F2RA 4PGXA 2Y1JA 3TACB 3PSTA 4QZGA 5ALDA 1T3NA 4FZNA 3V6KA 1QTMA 4Y2SA 4PHDA 4KB6A 4ECQA 1ZQGA 1KTQA 2NRXA 1B43A 4MFAA 3C5GA 1VFGA 3JPNA 3TKAA 4UBBA 1WOTA 4LEYA 3H4BA 1FO4A 2FLLA 4EEDA 4A8EA 2PKEA 4YG2A 2CPRA 4QZEA 1FFVA 5KFHA 3K1RB 1UQVA 4NM2A 1L7PA 5KFEA 1SV4A 3KKAA 1MIWA 2GH1A 3JCFA 4O3NA 3DDHA 2OYYA 1QQ7A 1C7YA 4C4RA 4Z6FA 4EBEA 1DK3A 4RNMA 4NXXA 3CYMA 2EAPA 1HUZA 1S8OA 4EBDA 2I9GA 3JPRA 3GIMA 4UB5A 1D9DA 2KIVA 4YN4A 2AGQA 3H39A 2I6XA 5DQIA 5HHIA 2DFLA 2KJ8A 3M8SA 3WFRE 2XGPA 4IG8A 4Z6CA 4Y2XA 4XQ7A 5KFJA 3PSPA 5ALYA 1UT5A 5AI6A 5KAIU 3QUQA 1ZQJA 4PPXA 4EGWA 4RQ0A 1QCKA 3QZ7A 4F72A 3M8RA 4NL9A 2FLPA 8ICJA 4QZBA 4WC5A 1L3UA 5HRBA 4NL9C 2R8IA 3SV4A 9ICRA 2E8OA 3OTQA 2XY5A 4B9TA 2BDUA 4IRCA 1QSSA 4X4OA 3JPQA 1S77D 3IV6A 5J2CA 5KFRA 1X9SA 2KEYA 3GV7B 2BKEA 4K8VA 4YFKA 4UB4A 1ZQDA 3HJ1A 3WKCA 4R65A 1N5XA 2ZH2A 3H0RB 4HYKA 1DGSA 2DL0A 3U26A 3PW5A 3SD7A 3WKAA 1M6YA 3TARA 4I28A 9ICKA 4KLJA 1RPLA 2K4PA 3QU2A 3WK8A 2F8LA 5DGAA 2KNJA 2Q4TA 4C7YA 5ALJA 2IOFK 1S0VA 3LWMA 2JEFA 3BQ0A 2BZFA 4R63A 5AM1A 5KFLA 1CUKA 2R8KA 5FP0A 5J0OA 3ZD8A 1SXDA 1BPDA 4O3OA 4KLGA 1WCNA 1KFSA 3RJHA 3ONNA 5CFSA 2AXTU 3PW0A 2HBKA 1ZQKA 3QX7A 4I2CA 3SAHA 4NLZA 3PHZA 4Y2JA 4GXKA 1BVSA 2YQEA 3H40A 1ZQMA 3VCBA 5KFDA 9ICVA 3H8JA 4Q44A 4UAZA 5AM2A 2C2EA 1ZOLA 1T3QA 1NK5A 2IHMA 4X4NA 3HKZC 4OJ5A 4RU9A 2M0NA 3MR2A 3NVYA 2RQ5A 7ICLA 1SL0A 2HOFA 4UARA 1ZD2P 5CHEA 3MGVA 4DSIA 2K4IA 1NKBA 4YR3A 5HRLA 4BDPA 5GTIU 7ICKA 2IOHA 2YMPA 3SV3A 4DOCA 2XY7A 3SENA 1PVPA 4B6JA 3RF9A 4ICAA 5E79U 4U6PA 2B56A 1BGXT 1COOA 4OAFA 5AKJA 4FS2A 2XICA 5DLGA 4GXJA 2CRXA 1MIYA 4IR9A 3HRDD 4F5PA 1XS9D 2C28A 2NRVA 2FDRA 2W3RA 3MC1A 5KFKA 3LWLA 4NXUA 4NV0A 2KJ5A 3H7IA 5HMMA 4IL6U 2VA2A 1R8BA 4NLNA 5ALSA 4E80A 3CP8A 4P0QB 3M9MB 1TFRA 4IRKA 5HRDA 3VC8A 4YP3A 4IRDA 4M9GA 1KRPA 4M6WB 1NO5A 3AQNA 3HT3A 4QJFB 1P7DA 1U45A 4C8LA 2KHVA 8ICCA 2W9BA 1X2IA 2XO7A 2NRKA 3FC4A 5J2DA 4F71A 3QYPA 4AT8A 2YB4A 1DRGA 2G09A 4OJ6A 3R9KA 2ZH5A 1N61A 4CF5A 3EUB2 2HMXA 4F4XA 5IIKA 4X4UA 3UMBA 2HBLA 4RQ8A 1QH9A 4YR2A 2ZHAA 2J6TA 5AKHA 2BCRA 3NASA 4HX0A 2JH7A 7ICSA 2AGOA 1GO3F 1XSNA 5DBBA 1ZJNA 4NXTA 2HVIA 3IHQB 3UXOA 5KFOA 4Z6EA 1MIVA 2P6RA 3E58A 2PI4A 4PHAA 5KFSA 2YX8A 3T5JA 3J81j 2M2VA 4R8UB 4OD0A 1Q78A 1TVAA 3KHHA 2KFNA 5JUMA 3WKDA 2BQUA 1PVRA 3UPSA 3G6XA 5K4LA 3JYYA 3PR5B 1VJ5A 1SB3C 4O69A 3C5FA 1O03A 3RJEA 4DQQA 3Q8MA 4PZNA 3NVVA 4EENA 2DKXA 8ICSA 2BCSA 4NLKA 4NXWA 2D6FC 3TI0A 2DBYA 1VLBA 1KFTA 1KEJA 4C8KA 5J2AA 4ED0A 2A19A 1L6NA 3M6KA 2W8LA 4M9JA 4JK1A 2WF5A 5KT6A 4I2HA 3F2DA 4O9MA 4M2YA 2H3ZA 4KN4A 4UB8U 4WQLA 1ZXIA 4PL2A 4ECSA 3C2MA 4F4YA 4CGZA 3BQ7A 5JTIA 7ICMA 8ICXA 4P0PB 3RRHA 3D2NA 2F8KA 4MHVA 3AQKA 3PR4A 2EWRA 1RYSA 4JV2A 5HMLA 4F50A 3GV5B 4ELUA 1RM6C 1NKEA 4Q8EA 1Z1BA 5KFYA 1JUDA 5ALNA 5DGBA 4EZ9A 2MUTA 1UT8A 4ECTA 5EE9A 4DSLA 4FHPA 1BPBA 1IM4A 1JXEA 7ICRA 4WC1A 2Q0ZX 1OUQA 4F4KA 3SEIA 3NS1A 1UCVA 4LJXA 3RJKA 9ICIA 1U4BA 4AT7A 4EV6A 2GA9D 3BS5A 4P2HA 5HRKA 1ZQ1C 1BPXA 3M1YA 2IUBA 3RH4A 1QQ6A 2ZH3A 4XUSA 4I27A 4M47A 4M0AA 3I28A 5CFTA 1WG8A 3B9JA 5KT5A 3FAHA 4I29A 1ZYQA 4O0IA 5L1JA 2C2DA 1N48A 2ZH4A 2E5SA 3IG5A 4UAWA 4RQ7A 2VJ5A 3F5AA 2W55A 3KFUF 4EEBA 4KLMA 2HHXA 5AIAA 3MBYA 5KFGA 3C23A 4K4IA 3EW9A 3L9DA 4F3OA 3MABA 3QEBZ 4YXMA 1ZQFA 3PY8A 3ZI4A 4K9BA 2HHUA 4KLDA 3UPQA 3HKZF 4I2FA 2ZTDA 4P4MA 2G5HB 5AI8A 4KLEA 1BNOA 4NJ8A 3QU5A 4O6AA 4TUQA 2C2RA 2V4RA 4M9HA 3TADA 1B22A 3Q8LA 1NI3A 4IC9A 3QUCA 3KHLA 1SL1A 5TZVA 4ED3A 4Y2TA 2K8AA 5HR7A 5KT7A 3EPIA 2K8CB 1XSLA 2ZTCA 3ED5A 4DEZA 1JIHA 2D8CA 1ZRMA 1LKYB 1UETA 4JWMA 4DO9A 1BPZA 5KT2A 4TUSA 4LZGA 1L3SA 1JQRA 1VDVA 5EE3A 4J03A 5EWEA 4NKTA 2K4HA 2O6KA 4US8A 2BQ3A 2HHTA 5CWRA 4EBJA 4QZDA 2ZUCA 2QLTA 5J0XA 4M9LA 1NJYA 2F44A 1S5LU 3I1YA 5ALWA 3OUYB 2H3QA 3QU4A 2ESEA 2BGWA 2R18A 4X4PA 2RLTA 2IOFA 4ECUA 4UATA 3WKBA 4PZOA 1AROP 1ZQRA 2LKYA 2ZIVB 2IHOA 4RPYA 4C8MA 4ECYA 5J2JA 2VKQA 5KNIA 3PMLA 4FS1A 3AM9A 4FFDA 3SI8A 1NK9A 2DQNB 2PXIA 4LVSA 4PHEA 3TFSA 4EEYA 2DPIA 4USAA 4DOBA 4EELA 5D61A 2FPKA 3PO4A 1A76A 5J29A 3PSFA 4BJQA 2GWSA 2B21A 4FZMA 5ALRA 4BWMA 1LV5A 4KTQA 5HRGA 3LVWA 3T3FA 1ZQHA 1ZD3A 2R8HA 2ZHBA 1TFWA 2XVTA 3SZ2A 8ICPA 4XRHA 2LYHA 5J0RA 4MEYA 4UD5A 3TFRA 3V6JA 5AM5A 5KAFU 5GTHU 4LEVA 4YMMA 4KMOB 8ICYA 2MU2A 3HW8A 2E3TA 3NWIA 4KLSA 2ZTEA 4J9PA 5JRTA 4K4HA 4QWDA 3KHGA 3AQMA 7ICJA 5F9LA 5HP4A 4JLXA 5AKEA 9ICQA 2NRZA 5ALUA 4PGYA 4CF3A 3WK7A 3ORYA 1HJPA 4I2JA 4I2EA 1Y88A 1DOQA 4O3PA 3C18A 5AIBA 4X4VA 2B0CA 3CK6A 3B0YA 2D3DA 1DXSA 2BBHA 4ED7A 3IDWA 2P6UA 5J2HA 2WB1C 3HJEA 2KTQA 1YZ6A 2PMZC 8ICMA 5ALTA 5AI4A 2ZIWA 1S97A 2WAQC 5BOMA 1RYRA 4QZAA 3H8WA 4I2AA 1TE2A 4NXZA 1QSLA 3N7SC 1GPJA 2XC9A 3RRGA 4BX9C 5IINA 4QW8A 3E2EA 2OM6A 5KFZA 5J2FA 5KG6A 1SXEA 2RHFA 2Y0SC 1F44A 1PUZA 4WBZA 3RAQA 1SZPA 2DRBA 4C8NA 2EANA 4F5RA 1UA1A 2W9CA 2NO5A 2LPEA 5J2EA 3AEVA 1BNPA 5IIOA 4ZH4A 2KZMA 2HHQA 1NK4A 1ZQAA 3MGIA 4NKUA 4WOYA 5KTQA 4JV1A 3PMNA 1FFUA 3GIJA 4KLOA 4MFFA 1YZ7A 4O67A 5KL1B 3WK9A 4FO6A 2QB0A 1SL2A 1V97A 2EAOA 2A1JA 3RR8A 1NOMA 5HR9A 4BXOB 9ICEA 1CEZA 5KFVA 3SAFA 2KSOA 5KFFA 1V85A 4CDGA 3Q8QB 5TISU 3BQTA 4EX6A 9ICCA 4TQRA 3V7JA 3V6HA 3KZIU 2E1FA 3C21A 2OH2A 2W3SA 5KFNA 3WKEA 3NGDA 4I2IA 4F93B 3NVZA 4ECRA 4YD1A 1KFDA 4GFJA 1X6IA 4MF8A 2JZBA 1Z00B 4RZRA 3T5KA 2OXOA 4UB2A 4QIWC 5EWGA 4ATBB 3MGHA 4O3QA 4DWIA 2K4EA 4KLTA 7ICIA 1L7MA 2LYBA 3TAQA 4WQKA 2KN7A 3C2KA 5EOZA 2MSNA 1J2MA 5F9NA 1SKWA 2DR8A 1Z4OA 2W7PA 5ALKA 5AKKA 2JEGA 5HRIA 1ECWA 2G07A 2N1RA 3UMCA 4DSKA 2QARB 2RDIA 3H0MB 2F76X 4NLGA 5CFUA 5DECA 3SR6A 4UBCA 1TK8A 4RQ6A 3PNCA 5DB9A 3C28A 4Y2QA 2B6GA 2YY6A 4RQ1A 3JPSA 3NVWA 2AQ0A 4O5EA 7ICVA 5L1LA 1XWLA 2LI6A 4EBKA 2ASDA 4KN7A 2EZZA 5DDMA 8ICEA 5DDYA 2I1QA 1ZQBA 4QZ8A 4DL3A 1ZQOA 4ELVA 1JN3A 1RXVA 5L9XA 2KFZA 2HI0A 4J9KA 2ZXIA 4QWCA 3BDPA 1Q46A 1NZPA 3ALRA 3HILA 4B9VA 1VJ7A 2BQRA 5HHHA 1LB2B 4F5QA 2BCUA 2ZIXA 8ICBA 5JU5A 3JPPA 4NXVA 4AP9A 3H4DA 3PW2A 3M7DA 2ZIWB 4C0ZA 2KMDA 3K75D 4CRXA 5KFBA 9ICFA 9ICMA 3OHAA 3RJJA 4EX7A 4P4PA 3PX6A 2JEJA 2JH1A 4KMUA 3C66A 1S10A 2YTUA 3ZDCA 4OAGA 1LVHA 2B4VA 3UMGA 4I2GA 3D6JA 2HHPA 3WU2U 2VANA 2G06A 4UAVA 4RQ5A 2F77X 2W9CB 2HW3A 2G5IB 3KBBA 4RNOA 2JGAA 5AKIA 4KLIA 3ETRA 3H0LB 1S0MA 2HBJA 5KFXA 5AI5A 1UPHA 1V38A 5IIJA 2ZH1A 2F2AB 2GOLA 1MQ2A 4Y2VA 5KG5A 4YXJA 3F5EA 1S76D 5DG8A 7ICFA 2A1JB 4RQ2A 2ZH6A 2DWQA 1ZQIA 3AL0B 1T7PA 1L8OA 4XJEA 2IBKA 3RR7A 1MA7A 8ICGA 2PI5A 2KZZA 2DUYA 1B0XA 5ALOA 3GFKB 5ALZA 1F0MA 4J9MA 2RDJA 2NO4A 5ALGA 1N2XA 5AI0A 2W9MA 2WFAA 4EBCA 4FO1A 2W03A 1L3VA 2BDPA 3RBEA 5J0TA 4DF4A 4O3RA 1SWVA 4N7RA 1KNYA 7ICPA 5KFQA 3HIYA 4NWIA 8ICIA 3UXNA 2HN1A 2WF9A 2I5HA 4DFDA 2AHOB 4X5VA 4GC7A 3F53A 5DB8A 2GAFD 4K9AA 2PFPA 4UB6U 3ISCA 5KFWA 1T4GA 2PMZF 4S3NA 5DB6A 3L5KA 1S9FA 2HOQA 2WAQF 2ZJ5A 2BBJA 4DF8A 8ICLA 4O5CA 4TURA 3RH6A 5AICA 3ERCC 4I2BA 2MRLA 2KP7A 4F5OA 9ICHA 3H8SA 1IIPA 4QZIA 1N62A 4JB3A 4WCWA 2M9NA 2EH9A 4K4GA 5DBAA 4J9RA 4O3MA 1D8LA 5J0YA 1ZQYA 2Y1IA 4RNNA 2IHNA 1OXJA 5AKZA 4DS4A 3TAPA 1WCLA 4GXIA 7ICUA 2A3VA 4DFMA 3PW7A 3NRWA 4Y2YA 3G6VA 1O08A 4IQTA 3DEEA 2WHEA 2NRTA 4NLCA 2R8JA 4BUGA 4OO1J 4CNQA 3T79A 4KM5A 3ER9B 1XO1A 3UXPA 4PL1A 1NJWA 4KLHA 3KTQA 2ZH7A 4PGQA 3OPXA 2FI1A 5CB1A 2EZXA 3LVVA 2G0AA 2KICA 4I0UA 1JXLA 4GLXA 1X9XA 3NKUA 3GDXA 1TKDA 5BOLA 3AQFA 1TK5A 4X0BA 1SKRA 4RUCA 4AYBC 1D9FA 1ED1A 5ALHA 5JTGA 1DK2A 2H5XA 4UASA 4K99A 4ED6A 4M5DA 3ZD9A 3RB3A 2DR7A 4QW9A 2J6SA 3IM1A 4LT6A 4DQSA 3N97B 3PW4A 4QIWF 2DR9A 3GV8B 5B3QA 3N4MB 1KBUA 2V4QA 3K1ZA 1YT3A 3WFOA 1NZBA 8ICNA 3FYHA 7ICHA 2RFFA 4WC3A 3ISBA 2W9BB 2K89A 1N56A 3WK6A 2AQ4A 1OW5A 5DG7A 2PBEA 5IIMA 3NRZA 4X4RA 4AT8B 4EEKA 4UAUA 2KJ9A 4G9BA 4WC4A 4FZLA 4YR0A 4CE6A 3THVA 5AKGA 4XQ8A 1NK7A 1JRPA 3JPTA 1SGGA 2AJQA 4MF2A 3N7PD 2ASLA 2KKPA 3WFSC 3PVXA 3PSIA 4E8FA 3MDAA 3C29A 2QKQA 3AUOA 4J9NA 7ICGA 5J0PA 2KV2A 1EXNA 5CR0A 5KT4A 5D4BA 4YVZA 3S6JA 5J0WA 1Q3UA 1ZQCA 4FHWA 3OWGA 4ZOHC 3C2LA 2M2WA 1NJZA 2W43A 5ALEA 1XU4A 5T14A 5J8YC 1K5OA 4ECXA 1SKSA 3IRUA 5J0QA 4DFPA 4DL4A 8ICAA 3OJUA 2XIDA 5AKXA 1WYGA 1NK6A 3LK9A 2YN4A 1ZQWA 2AU0A 3MR3A 4QZ9A 2Z7JA 1SIJA 4RT2A 5CRXA 1WWUA 4KX5A 5J2BA 2LM4A 4B9NA 5D62A 3IG8A 5L1KA 3NUQA 5CP2A 1X66A 4B9MA 2XCPA 5C0YA 1X42A 2MA1A 5KG3A 1UHUA 2WF8A 1ZQTA 4WC7A 5KG4A 3H38A 2ZG6A 4GIBA 4CF4A 4Y2RA 4EP7A 1N63A 2MUTB 1F5SA 4EYIB 5HRFA 1RXWA 9ICXA 4F5NA 4C4TA 2VA3A 1U49A 3N7RC 1WWVA 4ECWA 2F1IA 5AKYA 9ICNA 2JHDA 2F1JA 5D46A 1QLNA 4NM1A 5A0LA 5HR6A 2E8NA 5HC9A 1Z19A 9ICJA 4AT7B 5J2IA 2NYVA 3BS5B 5ALLA 2YMQA 4OAHA 4J9SA 4X0AA 2PFQA 2F1HA 4F2SA 1TV9A 4FBUA 3RJIA 5AM4A 1ZQUA 3M9NB 4KLFA 3ZDBA 2KOBA 4PJ0U 3KD3A 5H2FU 4WH5A 2LM1A 4O3SA 5ALFA 4YD2A 2JRZA 3RH5A 1Z4NA 2YMLA 7ICNA 4C80A 2KVSA 4LEWA 3HJ4A 2YB1A 1ZQXA 5AK4A 3A0BU 2V9WA 4J9LA 4DSJA 3PV8A 5AK5A 4B9UA 4QWAA 2Y9UA 4RQ4A 3UQ2A 1KLNA 4UQGA 3LQCB 3KZXA 3KHRA 1TFYA 3BQ1A 3PZPA 2HHWA 9ICBA 1JALA 3GILA 4OJPA 3DV9A 2KD1A 5ALVA 1B4FA 5J2GA 5IIIA 2PFNA 2VJ4A 4FHVA 5D49A 2FPMA 2Y9TA 2B51A 3BS7A 3Q8PB 5CJ7A 4FH3A 2NRWA 1A77A 4Q45A 3MR5A 1NKCA 4ACOA 4X4TA 4JV0A 5L1IA 3RAXA 1JROA 5EE1A 3ISDA 3OSPA 3KKAC 1X40A 1MC8A 4DCCA 7ICOA 4F91B 3OGUA 4QWBA 2HBMA 2W54A 8ICVA 1SWWA 3EWAA 1ZD5A 2EQYA 3RB6A 3IP4B 3Q8KA 4AYBF 1Z1VA 2BCQA 2DGZA 4OAIZ 1KSPA 2DKZA 5DBCA 4FH5A 9ICPA 1N5WA 2LYAA 5KT3A 4P0QA 2FLNA 2ZJAA 3BQ2A 5KL8B 2CN1A 3T5LA 4DSEA 3V72A 4J9OA 9ICAA 5ALXA 4M6WA 4IQVA 1ZETA 3GU3A 1TK0A 1FA0A 2H3VA 4BGDA 1JAJA 4Q8FA 1ZQEA 5AK3A 3OVAA 4I2DA 1JMSA 2AGPA 1RDFA 9ICOA 3NTUA 4ED1A 1S0OA 3CRXA 4UB3A 1QQ5A 1SZHA 1Z3EB 3JPOA 1U47A 1COKA 3WFPA 2R8GA 4YQWA 4EZ6A 2OWOA 4MKPA 4Q43A 1RZTA 1V4AA 2ZIUA 3V7KA 3NVOA 1PK1A 5KFPA 2XI9A 2BPFA 3V7LA 3MDCA 2EDUA 2XCAA 4KLLA 4R8UA 5F3XB 2HDOA 3AN1A 4F4WA 2W7OA 3WK4A 4OJOA 4DSFA 4Z6DA 3EF2A 1FIQA 8ICZA 3OVSA 4XA5A 5HNKA 4E0DA 1H38A 2DR5A 3H37A 1RG6A 1KL9A 1XC9A 1U48A 3GIIA 2J6UA 3EYZA 2M2UA 1ZQNA 3UQ0A 4Y2PA 1RQNA 2FMSA 4ECZA 2W11A 3QXGA 5B5EU 1RQLA 5KFUA 2EZYA 4QWEA 2ZJ8A 5KG7A 5J0UA 1X9WA 4WC2A 5KFTA 2ATLA 4RQMA 1XNSA 4RWOA 5ALQA 3Q8SB 4M04A 2LHTA 5DB7A 5CA7A 4TQSA 3RFAA 5EWFA 4P0PA 5B66U 3QZ8A 5ALPA 5KG2A 5J2KA 3PX4A 1J97A 1ZQVA 3ICXA 3RB4A 2BR0A 1R8CA 4YMOA 2KKVA 1PK3A 1L8LA 4RQNA 5L1MA 3ZDAA 3KOOA 2P66A 5G5HA 2W8KA 4JLZA 4HAIA 3QU7A 4B9SA 7ICTA 3HX0A 2WF6A 1JX4A 2BHNA 9ICWA 4AT9A 1OU5A 3E0FA 3QUTA 4GC6A 1R8AA 4CCHA 9ICLA 4DS5A 4K97A 1PX5A 2GO7A 4U7CA 1T8EA 4P4OA 1X6JA 1N60A 4QNLA 2ODGA 1KKXA 1WUDA 4IR1A 1RYUA 5KFCA 5AM0A 4WBYA 4K96A 2QB0B 2BCVA 4JUZA 2FJ6A 2KSOB 1ZQLA 1F5AA 3G6YA 4DFKA 3SYZA 3SQIA 5C5JA 2HCFA 1JI7A 4NLBA 1ZQZA 1UEVA 3MCRA 4EYHB 2HN2A 2O5AA 5EE0A 3RJFA 4RWNA 2FMQA 1HUOA 3ZDDA 5DG9A 2H3IA 5KFIA 2JMGA 2JZBB 4KLQA 2OCEA 1K1QA 4C7ZA 4TUPA 3AQLA 2OEHA 4IQWA 2WTFA 3RB0A 3QEAZ 4NY8A 4QZCA 4C4SA 3LDAA 1YLQA 4F4ZA 8ICKA 2WB1F 2Q66A 1T94A 4DQPA 2ZIUB 1PK1B
chains in the Genus database with same CATH topology
3ORYA 4KLGA 1HJPA 1WCNA 1KFSA 4I2JA 3RJHA 1Y88A 4I2EA 3NYBA 1DOQA 4O3PA 3C18A 3PW0A 2M2TA 4X4VA 4E8FA 3MDAA 1ZQKA 4I2CA 4M9NA 4NLZA 3RJGA 3B0YA 3AUOA 4J9NA 7ICGA 2O1PA 4GXKA 1BVSA 3H40A 5J0PA 1ZQMA 4ED7A 5KFDA 2P6UA 4UB1A 9ICVA 5J2HA 1X9MA 1EXNA 2ZUDA 5CR0A 3H8JA 5KT4A 5D4BA 2KTQA 4YVZA 4Q44A 4UAZA 4R66A 4DL6A 2ASJA 3GIKA 5J0WA 2C2EA 4MEXA 1ZQCA 8ICMA 3H3AA 4FHWA 1NK5A 1S97A 5BOMA 3C2LA 2IHMA 4X4NA 1RYRA 3RBDA 1NJZA 2MAXA 2JEIA 2M2WA 4RU9A 3OVBA 4QZAA 3H8WA 3MR2A 4I2AA 7ICLA 5DEDA 1SL0A 4DFJA 2XY6A 4NXZA 1QSLA 5CHGA 4DSIA 1XU4A 1NJXA 3PO5A 2DR5A 1PZNA 2XC9A 3RRGA 5IINA 4QW8A 3E2EA 5KFZA 9ICUA 3HP6A 4DL2A 1NKBA 5J2FA 3C1YA 5KG6A 4ECXA 1SKSA 2ISPA 4WC6A 5J0QA 4DFPA 4X4SA 4YR3A 2IA6A 4DL4A 4DL5A 8ICAA 5HRLA 4BDPA 4WBZA 3RAQA 1SZPA 7ICKA 2DRBA 4C8NA 3OJUA 4F5RA 1UA1A 2W9CA 3OUYA 3SV3A 4QZHA 1V9PA 4DOCA 2XY7A 5J2EA 1NK6A 3AU2A 2BPGA 1BNPA 3EPGA 3LK9A 5IIOA 4ZH4A 2KZMA 2HHQA 1BGXT 1COOA 1NK4A 1ZQAA 5KG1A 1ZQWA 4FS2A 2AU0A 3MR3A 3MGIA 4QZ9A 5DLGA 4GXJA 5F2VO 1MIYA 4IR9A 4NKUA 5KTQA 4JV1A 4RT2A 4F5PA 1XS9D 2C28A 2NRVA 3PMNA 3HPOA 3GIJA 4KLOA 8ICWA 5KFKA 3LWLA 4MFFA 4FO6A 5J2BA 2XGQA 4R64A 1BPEA 1SL2A 4B9NA 3PX0A 2A1JA 3H7IA 1NOMA 3RR8A 3RTVA 5L1KA 4BXOB 5HR9A 9ICEA 1CEZA 5HMMA 5KFVA 2VA2A 1UA0A 1R8BA 3JZ0A 5KFFA 2HVHA 5CP2A 4NLNA 4B9MA 4E80A 2XCPA 9ICGA 3Q8QB 4IQUA 3BQTA 3M9MB 5KG3A 1ZQTA 8ICUA 7ICQA 1TAUA 5HRDA 5KG4A 4RWQA 4WC7A 4RQ3A 1TFRA 5DKWA 3H38A 9ICCA 4AT9B 3C1ZA 4TQRA 4IRDA 4YP3A 3M9OB 3V7JA 3V6HA 4IRKA 1KRPA 2MUTB 4M6WB 4EYIB 4M9GA 1NO5A 3AQNA 4EP7A 3HT3A 3C21A 8ICHA 5HRFA 5KFNA 1RXWA 9ICXA 3NGDA 4F5NA 1U45A 2VA3A 4I2IA 4F93B 4C8LA 2W9BA 4ECRA 1U49A 4YD1A 1X2IA 8ICCA 3ZDEA 2XO7A 1KFDA 1K1SA 2NRKA 5J2DA 4ECWA 4MF8A 2JZBA 4FHXA 4RPXA 1Z00B 4O5KA 4AT8A 4RZRA 2F1IA 3TANA 9ICNA 4QZFA 3T5KA 2F1JA 5D46A 1QLNA 4NM1A 2ZH5A 4UB2A 4DQRA 3AU6A 3GQCA 5HC9A 4F4XA 5IIKA 9ICJA 4AT7B 4X4UA 4RWPA 5J2IA 8ICQA 5EWGA 2KZ3A 3HWTA 4ATBB 4RQ8A 3MGHA 4O3QA 4J9SA 4DWIA 5IILA 4KLTA 4X0AA 5KG0A 2PFQA 8ICOA 3WFQE 4YR2A 7ICIA 2ZHAA 3TAQA 2F1HA 2J6TA 4PHPA 2BCRA 4F2SA 2KN7A 3C2KA 1TV9A 2AGOA 7ICSA 5EOZA 4FBUA 3RJIA 1XSNA 5DBBA 1ZQUA 5F9NA 3M9NB 1ZJNA 1SKWA 1ZQQA 4KLFA 2DR8A 4ED8A 3ZDBA 5DLFA 4DLGA 2JEGA 5HRIA 2VA8A 2HVIA 3IHQB 3UXOA 2BPCA 5KFOA 4Z6EA 4DSKA 1MIVA 2P6RA 1D8YA 2RDIA 2PI4A 4NLGA 3T5HA 4PHAA 4ECVA 2PFOA 4BWJA 5KFSA 4F8RA 4O3SA 3T5JA 4YD2A 5DECA 4UBCA 3RH5A 4UAYA 2M2VA 7ICNA 4R8UB 1TK8A 1Q78A 5KFMA 4G3IA 1TVAA 4RQ6A 3KHHA 3PNCA 5DB9A 2KFNA 5HRHA 5JUMA 3HJ4A 2BQUA 1ZQXA 3UPSA 2FPLA 2V9WA 4J9LA 4DSJA 3G6XA 4DL7A 3PV8A 3MFIA 2ALZA 3PR5B 4DQIA 3JYYA 2ZH8A 4RQ1A 1L5UA 4B9UA 3JPSA 4QWAA 1ZQPA 4RQ4A 2AQ0A 4O5EA 3UQ2A 1KLNA 4UQGA 4KLUA 3Q8RB 3KHRA 7ICVA 8ICTA 3LQCB 3BQ1A 3C5FA 5L1LA 1TFYA 1IXRA 1XWLA 2UVRA 4EBKA 3OHBA 2ASDA 3RJEA 4KN7A 4LZDA 4DQQA 2HHWA 5DDMA 3Q8MA 9ICBA 2HHVA 4X4QA 3QE9Y 8ICEA 3GILA 5DDYA 1QSYA 2I1QA 1ZQBA 4QZ8A 4DL3A 8ICSA 1ZQOA 5J2GA 5IIIA 2PFNA 1JN3A 1RXVA 5L9XA 2BCSA 4ELVA 4NLKA 2KFZA 4J9KA 4FHVA 2DVIA 4QWCA 3ETLA 3BDPA 1NZPA 5D49A 2IMWP 3TI0A 2FPMA 4FHYA 3OJSA 4B9VA 2UVUA 1VJ7A 3Q8PB 2BQRA 1BPYA 5HHHA 5CJ7A 4FH3A 2NRWA 1KEJA 4F5QA 5J2AA 1LB2B 4ED0A 2BCUA 1A77A 4Q45A 4C8KA 4B9LA 3JPPA 3MR5A 1NKCA 3TQ1A 8ICBA 4X4TA 4JV0A 2W8LA 4J9QA 4M9JA 2DRAA 4DOAA 4JK1A 5L1IA 4ELTA 4E7XA 3RAXA 9ICSA 5KT6A 3H4DA 3PW2A 4I2HA 3ISDA 3OSPA 1Q79A 1UEUA 4YMNA 4O9MA 3K75D 4DLEA 3B0XA 4JWNA 4M2YA 1MC8A 4KN4A 5KFBA 4MFCA 7ICOA 4F91B 3OGUA 9ICFA 4QWBA 9ICMA 2ZH9A 8ICVA 3EWAA 4ECSA 3OHAA 3C2MA 4F4YA 7ICMA 8ICXA 2BE3A 3RB6A 3RJJA 3Q8KA 2BCQA 4BXOA 4P4PA 3PX6A 2JEJA 1KFTA 3RRHA 4RPZA 4ED2A 2UVVA 1NK8A 3EZ5A 5J0SA 4KMUA 4F92B 1KSPA 1S10A 3ZDCA 5DBCA 3C66A 3AQKA 4FH5A 3PR4A 9ICPA 1RYSA 4JV2A 5HMLA 4F50A 4I2GA 3GV5B 5DQHA 2C22A 2HHPA 5KT3A 2VANA 2DPJA 4RQ5A 4ELUA 2FLNA 2W9CB 3FDSA 2ZJAA 4FBTA 3BQ2A 1NKEA 2HW3A 4Q8EA 2FMPA 2UVWA 5KFYA 3T5LA 4DSEA 3V72A 4J9OA 9ICAA 5DGBA 4EZ9A 2MUTA 1TAQA 1UT8A 4M6WA 4RNOA 4IQVA 2W9AA 5KFAA 4ECTA 1ZETA 4DSLA 4KLIA 4FHPA 1BPBA 1IM4A 1S0MA 4RT3A 5KFXA 8ICFA 1KDHA 1NK0A 1TK0A 1FA0A 1JXEA 7ICRA 2ID1A 2Q0ZX 4WC1A 2ZH1A 5IIJA 4BGDA 1JAJA 1MQ2A 4WC2A 4F4KA 4Q8FA 1Z00A 1ZQEA 5KG5A 4YXJA 1XSPA 3RJKA 9ICIA 1S76D 1U4BA 5DG8A 7ICFA 2A1JB 3OVAA 7ICEA 4I2DA 1JMSA 4RQ2A 2AGPA 3OV7A 2ZH6A 9ICOA 3NTUA 2ZUBA 1U9LA 4ED1A 1S0OA 4WC0A 4AT7A 3OSNA 1L3TA 1ZQIA 1S0NA 4UB3A 3MFHA 1MQ3A 1ZJMA 1T7PA 4P2HA 2IBKA 5HRKA 3RR7A 4ATBA 8ICGA 1BPXA 2PI5A 5DQGA 2KZZA 3PVXA 3RH4A 4PH5A 5HREA 2ZH3A 4XUSA 3MR6A 4I27A 1Z3EB 3JPOA 4C8OA 4M47A 3GFKB 4M0AA 1MSWD 1U47A 4J9MA 2RDJA 3WFPA 2R8GA 2W9MA 4EBCA 4YQWA 4YCXA 3BJYA 4EZ6A 5KT5A 2OWOA 1L3VA 5BPCA 2BDPA 3RBEA 5J0TA 4Q43A 4I29A 1ZYQA 2HHSA 1R89A 4DF4A 1ZQSA 4O0IA 5L1JA 1RZTA 2C2DA 2ISOA 4O3RA 8ICRA 1V4AA 9ICTA 3V7KA 1KNYA 7ICPA 5KFPA 1N48A 3K4GA 5KFQA 2BPFA 4UD4A 4RUAA 3V7LA 3HIYA 2ZH4A 4UAWA 3MDCA 4RQ7A 4KITB 8ICIA 3UXNA 2XCAA 4KLLA 4R8UA 4F2RA 4PGXA 2Y1JA 4F4WA 4KLMA 2HHXA 4QZGA 3MBYA 4DSFA 5KFGA 4X5VA 1T3NA 4GC7A 3V6KA 4Z6DA 3C23A 1QTMA 4K4IA 5DB8A 3EW9A 8ICZA 3L9DA 3OVSA 4XA5A 3MABA 5HNKA 4E0DA 4PHDA 1H38A 2PFPA 3ISCA 4F3OA 3H37A 4ECQA 5KFWA 3QEBZ 1KTQA 2NRXA 4YXMA 1ZQFA 1ZQGA 3PY8A 1T4GA 1B43A 4MFAA 3C5GA 5DB6A 1XC9A 1U48A 3GIIA 1S9FA 4S3NA 1VFGA 3JPNA 2J6UA 3EYZA 2ZJ5A 2M2UA 4UBBA 4DF8A 4KLDA 2HHUA 3UPQA 1WOTA 8ICLA 4I2FA 3H4BA 2ZTDA 4O5CA 1ZQNA 3UQ0A 4P4MA 2FMSA 4TURA 4ECZA 2FLLA 4KLEA 1BNOA 3RH6A 4I2BA 5KFUA 2KP7A 4YG2A 4QZEA 4QWEA 4F5OA 4TUQA 9ICHA 3H8SA 2C2RA 2V4RA 2ZJ8A 4M9HA 4QZIA 5KG7A 5KFHA 4NM2A 5KFEA 1B22A 4DQPA 3Q8LA 5J0UA 1X9WA 4WCWA 1MIWA 2M9NA 3KHLA 5KFTA 5TZVA 4ED3A 1SL1A 5DBAA 2ATLA 4J9RA 4O3NA 5KT7A 4K4GA 4RWOA 3EPIA 1D8LA 5J0YA 1ZQYA 1XSLA 2ZTCA 3Q8SB 2Y1IA 4M04A 4RNNA 1C7YA 2IHNA 4DS4A 3TAPA 4DEZA 1JIHA 1WCLA 5DB7A 4Z6FA 4GXIA 4EBEA 4DFMA 3PW7A 7ICUA 5CA7A 4TQSA 4RNMA 1DK3A 1UETA 1HUZA 3G6VA 4JWMA 4EBDA 5EWFA 4DO9A 1BPZA 2I9GA 3JPRA 3GIMA 4IQTA 4UB5A 5KT2A 1D9DA 2NRTA 2R8JA 4TUSA 4YN4A 3QZ8A 2AGQA 3H39A 5KG2A 5J2KA 4LZGA 3PX4A 1L3SA 1JQRA 1ZQVA 5DQIA 3RB4A 2BR0A 1R8CA 5HHIA 1XO1A 2DFLA 4YMOA 3M8SA 3WFRE 5EWEA 3UXPA 2XGPA 3ZDAA 4IG8A 4Z6CA 1NJWA 4KLHA 3KTQA 4NKTA 4PGQA 2BQ3A 2HHTA 2ZH7A 4XQ7A 5KFJA 5CB1A 5CWRA 2P66A 4QZDA 2W8KA 2ZUCA 4EBJA 1UT5A 4B9SA 7ICTA 5J0XA 4M9LA 1NJYA 3HX0A 1JX4A 1ZQJA 4PPXA 1JXLA 2BHNA 3OUYB 4GLXA 4RQ0A 2BGWA 9ICWA 3QZ7A 4X4PA 3GDXA 1TKDA 5BOLA 4ECUA 4AT9A 1OU5A 3M8RA 1TK5A 1AROP 4X0BA 4GC6A 1R8AA 2FLPA 4CCHA 4DS5A 8ICJA 9ICLA 4QZBA 1PX5A 1ZQRA 1T8EA 4WC5A 1SKRA 4RUCA 4P4OA 1L3UA 5HRBA 1D9FA 4RPYA 2R8IA 4IR1A 4C8MA 4ECYA 5J2JA 1DK2A 2H5XA 5KFCA 3SV4A 9ICRA 4ED6A 4WBYA 4M5DA 3PMLA 2XY5A 3ZD9A 2BCVA 4B9TA 3RB3A 2DR7A 4QW9A 4FS1A 2J6SA 3IM1A 4JUZA 4IRCA 1QSSA 4X4OA 1NK9A 3SI8A 1ZQLA 1F5AA 3G6YA 4DFKA 4LT6A 3JPQA 4DQSA 1S77D 5J2CA 3SYZA 3N97B 3PW4A 2PXIA 5KFRA 1X9SA 4LVSA 4PHEA 5C5JA 2BKEA 3GV7B 3TFSA 3GV8B 4EEYA 2DPIA 3N4MB 2DR9A 4YFKA 4DOBA 4UB4A 1ZQZA 2V4QA 1ZQDA 3HJ1A 1UEVA 4EYHB 2O5AA 4R65A 2FPKA 3RJFA 3PO4A 1A76A 5J29A 3WFOA 4RWNA 2GWSA 8ICNA 2B21A 3FYHA 7ICHA 2FMQA 2ZH2A 1HUOA 4BWMA 3ZDDA 2RFFA 1LV5A 3ISBA 4KTQA 5HRGA 4WC3A 2W9BB 1N56A 1ZQHA 3T3FA 5DG9A 4HYKA 1DGSA 2AQ4A 2R8HA 5DG7A 2ZHBA 5KFIA 2PBEA 3PW5A 5IIMA 2JZBB 4KLQA 4AT8B 1K1QA 4X4RA 3SZ2A 8ICPA 1TFWA 3TARA 4XRHA 2LYHA 4TUPA 4I28A 5J0RA 9ICKA 4MEYA 3AQLA 3TFRA 4UD5A 4KLJA 1RPLA 4WC4A 3V6JA 4YR0A 4YMMA 3THVA 8ICYA 5DGAA 4IQWA 2WTFA 3HW8A 3RB0A 4XQ8A 3QEAZ 1NK7A 4NY8A 4KLSA 4QZCA 2ZTEA 3JPTA 4J9PA 3LDAA 1S0VA 2AJQA 3LWMA 4MF2A 4K4HA 4QWDA 2JEFA 3BQ0A 3KHGA 1YLQA 4R63A 3AQMA 7ICJA 5F9LA 4F4ZA 5KFLA 8ICKA 5HP4A 2ASLA 1CUKA 2R8KA 2Q66A 9ICQA 2NRZA 5J0OA 3ZD8A 3WFSC 4PGYA 1BPDA 4O3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORY A;  4KLG A;  1HJP A;  1WCN A;  1KFS A;  4I2J A;  3RJH A;  1Y88 A;  4I2E A;  3NYB A;  1DOQ A;  4O3P A;  3C18 A;  3PW0 A;  2M2T A;  4X4V A;  4E8F A;  3MDA A;  1ZQK A;  4I2C A;  4M9N A;  4NLZ A;  3RJG A;  3B0Y A;  3AUO A;  4J9N A;  7ICG A;  2O1P A;  4GXK A;  1BVS A;  3H40 A;  5J0P A;  1ZQM A;  4ED7 A;  5KFD A;  2P6U A;  4UB1 A;  9ICV A;  5J2H A;  1X9M A;  1EXN A;  2ZUD A;  5CR0 A;  3H8J A;  5KT4 A;  5D4B A;  2KTQ A;  4YVZ A;  4Q44 A;  4UAZ A;  4R66 A;  4DL6 A;  2ASJ A;  3GIK A;  5J0W A;  2C2E A;  4MEX A;  1ZQC A;  8ICM A;  3H3A A;  4FHW A;  1NK5 A;  1S97 A;  5BOM A;  3C2L A;  2IHM A;  4X4N A;  1RYR A;  3RBD A;  1NJZ A;  2MAX A;  2JEI A;  2M2W A;  4RU9 A;  3OVB A;  4QZA A;  3H8W A;  3MR2 A;  4I2A A;  7ICL A;  5DED A;  1SL0 A;  4DFJ A;  2XY6 A;  4NXZ A;  1QSL A;  5CHG A;  4DSI A;  1XU4 A;  1NJX A;  3PO5 A;  2DR5 A;  1PZN A;  2XC9 A;  3RRG A;  5IIN A;  4QW8 A;  3E2E A;  5KFZ A;  9ICU A;  3HP6 A;  4DL2 A;  1NKB A;  5J2F A;  3C1Y A;  5KG6 A;  4ECX A;  1SKS A;  2ISP A;  4WC6 A;  5J0Q A;  4DFP A;  4X4S A;  4YR3 A;  2IA6 A;  4DL4 A;  4DL5 A;  8ICA A;  5HRL A;  4BDP A;  4WBZ A;  3RAQ A;  1SZP A;  7ICK A;  2DRB A;  4C8N A;  3OJU A;  4F5R A;  1UA1 A;  2W9C A;  3OUY A;  3SV3 A;  4QZH A;  1V9P A;  4DOC A;  2XY7 A;  5J2E A;  1NK6 A;  3AU2 A;  2BPG A;  1BNP A;  3EPG A;  3LK9 A;  5IIO A;  4ZH4 A;  2KZM A;  2HHQ A;  1BGX T;  1COO A;  1NK4 A;  1ZQA A;  5KG1 A;  1ZQW A;  4FS2 A;  2AU0 A;  3MR3 A;  3MGI A;  4QZ9 A;  5DLG A;  4GXJ A;  5F2V O;  1MIY A;  4IR9 A;  4NKU A;  5KTQ A;  4JV1 A;  4RT2 A;  4F5P A;  1XS9 D;  2C28 A;  2NRV A;  3PMN A;  3HPO A;  3GIJ A;  4KLO A;  8ICW A;  5KFK A;  3LWL A;  4MFF A;  4FO6 A;  5J2B A;  2XGQ A;  4R64 A;  1BPE A;  1SL2 A;  4B9N A;  3PX0 A;  2A1J A;  3H7I A;  1NOM A;  3RR8 A;  3RTV A;  5L1K A;  4BXO B;  5HR9 A;  9ICE A;  1CEZ A;  5HMM A;  5KFV A;  2VA2 A;  1UA0 A;  1R8B A;  3JZ0 A;  5KFF A;  2HVH A;  5CP2 A;  4NLN A;  4B9M A;  4E80 A;  2XCP A;  9ICG A;  3Q8Q B;  4IQU A;  3BQT A;  3M9M B;  5KG3 A;  1ZQT A;  8ICU A;  7ICQ A;  1TAU A;  5HRD A;  5KG4 A;  4RWQ A;  4WC7 A;  4RQ3 A;  1TFR A;  5DKW A;  3H38 A;  9ICC A;  4AT9 B;  3C1Z A;  4TQR A;  4IRD A;  4YP3 A;  3M9O B;  3V7J A;  3V6H A;  4IRK A;  1KRP A;  2MUT B;  4M6W B;  4EYI B;  4M9G A;  1NO5 A;  3AQN A;  4EP7 A;  3HT3 A;  3C21 A;  8ICH A;  5HRF A;  5KFN A;  1RXW A;  9ICX A;  3NGD A;  4F5N A;  1U45 A;  2VA3 A;  4I2I A;  4F93 B;  4C8L A;  2W9B A;  4ECR A;  1U49 A;  4YD1 A;  1X2I A;  8ICC A;  3ZDE A;  2XO7 A;  1KFD A;  1K1S A;  2NRK A;  5J2D A;  4ECW A;  4MF8 A;  2JZB A;  4FHX A;  4RPX A;  1Z00 B;  4O5K A;  4AT8 A;  4RZR A;  2F1I A;  3TAN A;  9ICN A;  4QZF A;  3T5K A;  2F1J A;  5D46 A;  1QLN A;  4NM1 A;  2ZH5 A;  4UB2 A;  4DQR A;  3AU6 A;  3GQC A;  5HC9 A;  4F4X A;  5IIK A;  9ICJ A;  4AT7 B;  4X4U A;  4RWP A;  5J2I A;  8ICQ A;  5EWG A;  2KZ3 A;  3HWT A;  4ATB B;  4RQ8 A;  3MGH A;  4O3Q A;  4J9S A;  4DWI A;  5IIL A;  4KLT A;  4X0A A;  5KG0 A;  2PFQ A;  8ICO A;  3WFQ E;  4YR2 A;  7ICI A;  2ZHA A;  3TAQ A;  2F1H A;  2J6T A;  4PHP A;  2BCR A;  4F2S A;  2KN7 A;  3C2K A;  1TV9 A;  2AGO A;  7ICS A;  5EOZ A;  4FBU A;  3RJI A;  1XSN A;  5DBB A;  1ZQU A;  5F9N A;  3M9N B;  1ZJN A;  1SKW A;  1ZQQ A;  4KLF A;  2DR8 A;  4ED8 A;  3ZDB A;  5DLF A;  4DLG A;  2JEG A;  5HRI A;  2VA8 A;  2HVI A;  3IHQ B;  3UXO A;  2BPC A;  5KFO A;  4Z6E A;  4DSK A;  1MIV A;  2P6R A;  1D8Y A;  2RDI A;  2PI4 A;  4NLG A;  3T5H A;  4PHA A;  4ECV A;  2PFO A;  4BWJ A;  5KFS A;  4F8R A;  4O3S A;  3T5J A;  4YD2 A;  5DEC A;  4UBC A;  3RH5 A;  4UAY A;  2M2V A;  7ICN A;  4R8U B;  1TK8 A;  1Q78 A;  5KFM A;  4G3I A;  1TVA A;  4RQ6 A;  3KHH A;  3PNC A;  5DB9 A;  2KFN A;  5HRH A;  5JUM A;  3HJ4 A;  2BQU A;  1ZQX A;  3UPS A;  2FPL A;  2V9W A;  4J9L A;  4DSJ A;  3G6X A;  4DL7 A;  3PV8 A;  3MFI A;  2ALZ A;  3PR5 B;  4DQI A;  3JYY A;  2ZH8 A;  4RQ1 A;  1L5U A;  4B9U A;  3JPS A;  4QWA A;  1ZQP A;  4RQ4 A;  2AQ0 A;  4O5E A;  3UQ2 A;  1KLN A;  4UQG A;  4KLU A;  3Q8R B;  3KHR A;  7ICV A;  8ICT A;  3LQC B;  3BQ1 A;  3C5F A;  5L1L A;  1TFY A;  1IXR A;  1XWL A;  2UVR A;  4EBK A;  3OHB A;  2ASD A;  3RJE A;  4KN7 A;  4LZD A;  4DQQ A;  2HHW A;  5DDM A;  3Q8M A;  9ICB A;  2HHV A;  4X4Q A;  3QE9 Y;  8ICE A;  3GIL A;  5DDY A;  1QSY A;  2I1Q A;  1ZQB A;  4QZ8 A;  4DL3 A;  8ICS A;  1ZQO A;  5J2G A;  5III A;  2PFN A;  1JN3 A;  1RXV A;  5L9X A;  2BCS A;  4ELV A;  4NLK A;  2KFZ A;  4J9K A;  4FHV A;  2DVI A;  4QWC A;  3ETL A;  3BDP A;  1NZP A;  5D49 A;  2IMW P;  3TI0 A;  2FPM A;  4FHY A;  3OJS A;  4B9V A;  2UVU A;  1VJ7 A;  3Q8P B;  2BQR A;  1BPY A;  5HHH A;  5CJ7 A;  4FH3 A;  2NRW A;  1KEJ A;  4F5Q A;  5J2A A;  1LB2 B;  4ED0 A;  2BCU A;  1A77 A;  4Q45 A;  4C8K A;  4B9L A;  3JPP A;  3MR5 A;  1NKC A;  3TQ1 A;  8ICB A;  4X4T A;  4JV0 A;  2W8L A;  4J9Q A;  4M9J A;  2DRA A;  4DOA A;  4JK1 A;  5L1I A;  4ELT A;  4E7X A;  3RAX A;  9ICS A;  5KT6 A;  3H4D A;  3PW2 A;  4I2H A;  3ISD A;  3OSP A;  1Q79 A;  1UEU A;  4YMN A;  4O9M A;  3K75 D;  4DLE A;  3B0X A;  4JWN A;  4M2Y A;  1MC8 A;  4KN4 A;  5KFB A;  4MFC A;  7ICO A;  4F91 B;  3OGU A;  9ICF A;  4QWB A;  9ICM A;  2ZH9 A;  8ICV A;  3EWA A;  4ECS A;  3OHA A;  3C2M A;  4F4Y A;  7ICM A;  8ICX A;  2BE3 A;  3RB6 A;  3RJJ A;  3Q8K A;  2BCQ A;  4BXO A;  4P4P A;  3PX6 A;  2JEJ A;  1KFT A;  3RRH A;  4RPZ A;  4ED2 A;  2UVV A;  1NK8 A;  3EZ5 A;  5J0S A;  4KMU A;  4F92 B;  1KSP A;  1S10 A;  3ZDC A;  5DBC A;  3C66 A;  3AQK A;  4FH5 A;  3PR4 A;  9ICP A;  1RYS A;  4JV2 A;  5HML A;  4F50 A;  4I2G A;  3GV5 B;  5DQH A;  2C22 A;  2HHP A;  5KT3 A;  2VAN A;  2DPJ A;  4RQ5 A;  4ELU A;  2FLN A;  2W9C B;  3FDS A;  2ZJA A;  4FBT A;  3BQ2 A;  1NKE A;  2HW3 A;  4Q8E A;  2FMP A;  2UVW A;  5KFY A;  3T5L A;  4DSE A;  3V72 A;  4J9O A;  9ICA A;  5DGB A;  4EZ9 A;  2MUT A;  1TAQ A;  1UT8 A;  4M6W A;  4RNO A;  4IQV A;  2W9A A;  5KFA A;  4ECT A;  1ZET A;  4DSL A;  4KLI A;  4FHP A;  1BPB A;  1IM4 A;  1S0M A;  4RT3 A;  5KFX A;  8ICF A;  1KDH A;  1NK0 A;  1TK0 A;  1FA0 A;  1JXE A;  7ICR A;  2ID1 A;  2Q0Z X;  4WC1 A;  2ZH1 A;  5IIJ A;  4BGD A;  1JAJ A;  1MQ2 A;  4WC2 A;  4F4K A;  4Q8F A;  1Z00 A;  1ZQE A;  5KG5 A;  4YXJ A;  1XSP A;  3RJK A;  9ICI A;  1S76 D;  1U4B A;  5DG8 A;  7ICF A;  2A1J B;  3OVA A;  7ICE A;  4I2D A;  1JMS A;  4RQ2 A;  2AGP A;  3OV7 A;  2ZH6 A;  9ICO A;  3NTU A;  2ZUB A;  1U9L A;  4ED1 A;  1S0O A;  4WC0 A;  4AT7 A;  3OSN A;  1L3T A;  1ZQI A;  1S0N A;  4UB3 A;  3MFH A;  1MQ3 A;  1ZJM A;  1T7P A;  4P2H A;  2IBK A;  5HRK A;  3RR7 A;  4ATB A;  8ICG A;  1BPX A;  2PI5 A;  5DQG A;  2KZZ A;  3PVX A;  3RH4 A;  4PH5 A;  5HRE A;  2ZH3 A;  4XUS A;  3MR6 A;  4I27 A;  1Z3E B;  3JPO A;  4C8O A;  4M47 A;  3GFK B;  4M0A A;  1MSW D;  1U47 A;  4J9M A;  2RDJ A;  3WFP A;  2R8G A;  2W9M A;  4EBC A;  4YQW A;  4YCX A;  3BJY A;  4EZ6 A;  5KT5 A;  2OWO A;  1L3V A;  5BPC A;  2BDP A;  3RBE A;  5J0T A;  4Q43 A;  4I29 A;  1ZYQ A;  2HHS A;  1R89 A;  4DF4 A;  1ZQS A;  4O0I A;  5L1J A;  1RZT A;  2C2D A;  2ISO A;  4O3R A;  8ICR A;  1V4A A;  9ICT A;  3V7K A;  1KNY A;  7ICP A;  5KFP A;  1N48 A;  3K4G A;  5KFQ A;  2BPF A;  4UD4 A;  4RUA A;  3V7L A;  3HIY A;  2ZH4 A;  4UAW A;  3MDC A;  4RQ7 A;  4KIT B;  8ICI A;  3UXN A;  2XCA A;  4KLL A;  4R8U A;  4F2R A;  4PGX A;  2Y1J A;  4F4W A;  4KLM A;  2HHX A;  4QZG A;  3MBY A;  4DSF A;  5KFG A;  4X5V A;  1T3N A;  4GC7 A;  3V6K A;  4Z6D A;  3C23 A;  1QTM A;  4K4I A;  5DB8 A;  3EW9 A;  8ICZ A;  3L9D A;  3OVS A;  4XA5 A;  3MAB A;  5HNK A;  4E0D A;  4PHD A;  1H38 A;  2PFP A;  3ISC A;  4F3O A;  3H37 A;  4ECQ A;  5KFW A;  3QEB Z;  1KTQ A;  2NRX A;  4YXM A;  1ZQF A;  1ZQG A;  3PY8 A;  1T4G A;  1B43 A;  4MFA A;  3C5G A;  5DB6 A;  1XC9 A;  1U48 A;  3GII A;  1S9F A;  4S3N A;  1VFG A;  3JPN A;  2J6U A;  3EYZ A;  2ZJ5 A;  2M2U A;  4UBB A;  4DF8 A;  4KLD A;  2HHU A;  3UPQ A;  1WOT A;  8ICL A;  4I2F A;  3H4B A;  2ZTD A;  4O5C A;  1ZQN A;  3UQ0 A;  4P4M A;  2FMS A;  4TUR A;  4ECZ A;  2FLL A;  4KLE A;  1BNO A;  3RH6 A;  4I2B A;  5KFU A;  2KP7 A;  4YG2 A;  4QZE A;  4QWE A;  4F5O A;  4TUQ A;  9ICH A;  3H8S A;  2C2R A;  2V4R A;  2ZJ8 A;  4M9H A;  4QZI A;  5KG7 A;  5KFH A;  4NM2 A;  5KFE A;  1B22 A;  4DQP A;  3Q8L A;  5J0U A;  1X9W A;  4WCW A;  1MIW A;  2M9N A;  3KHL A;  5KFT A;  5TZV A;  4ED3 A;  1SL1 A;  5DBA A;  2ATL A;  4J9R A;  4O3N A;  5KT7 A;  4K4G A;  4RWO A;  3EPI A;  1D8L A;  5J0Y A;  1ZQY A;  1XSL A;  2ZTC A;  3Q8S B;  2Y1I A;  4M04 A;  4RNN A;  1C7Y A;  2IHN A;  4DS4 A;  3TAP A;  4DEZ A;  1JIH A;  1WCL A;  5DB7 A;  4Z6F A;  4GXI A;  4EBE A;  4DFM A;  3PW7 A;  7ICU A;  5CA7 A;  4TQS A;  4RNM A;  1DK3 A;  1UET A;  1HUZ A;  3G6V A;  4JWM A;  4EBD A;  5EWF A;  4DO9 A;  1BPZ A;  2I9G A;  3JPR A;  3GIM A;  4IQT A;  4UB5 A;  5KT2 A;  1D9D A;  2NRT A;  2R8J A;  4TUS A;  4YN4 A;  3QZ8 A;  2AGQ A;  3H39 A;  5KG2 A;  5J2K A;  4LZG A;  3PX4 A;  1L3S A;  1JQR A;  1ZQV A;  5DQI A;  3RB4 A;  2BR0 A;  1R8C A;  5HHI A;  1XO1 A;  2DFL A;  4YMO A;  3M8S A;  3WFR E;  5EWE A;  3UXP A;  2XGP A;  3ZDA A;  4IG8 A;  4Z6C A;  1NJW A;  4KLH A;  3KTQ A;  4NKT A;  4PGQ A;  2BQ3 A;  2HHT A;  2ZH7 A;  4XQ7 A;  5KFJ A;  5CB1 A;  5CWR A;  2P66 A;  4QZD A;  2W8K A;  2ZUC A;  4EBJ A;  1UT5 A;  4B9S A;  7ICT A;  5J0X A;  4M9L A;  1NJY A;  3HX0 A;  1JX4 A;  1ZQJ A;  4PPX A;  1JXL A;  2BHN A;  3OUY B;  4GLX A;  4RQ0 A;  2BGW A;  9ICW A;  3QZ7 A;  4X4P A;  3GDX A;  1TKD A;  5BOL A;  4ECU A;  4AT9 A;  1OU5 A;  3M8R A;  1TK5 A;  1ARO P;  4X0B A;  4GC6 A;  1R8A A;  2FLP A;  4CCH A;  4DS5 A;  8ICJ A;  9ICL A;  4QZB A;  1PX5 A;  1ZQR A;  1T8E A;  4WC5 A;  1SKR A;  4RUC A;  4P4O A;  1L3U A;  5HRB A;  1D9F A;  4RPY A;  2R8I A;  4IR1 A;  4C8M A;  4ECY A;  5J2J A;  1DK2 A;  2H5X A;  5KFC A;  3SV4 A;  9ICR A;  4ED6 A;  4WBY A;  4M5D A;  3PML A;  2XY5 A;  3ZD9 A;  2BCV A;  4B9T A;  3RB3 A;  2DR7 A;  4QW9 A;  4FS1 A;  2J6S A;  3IM1 A;  4JUZ A;  4IRC A;  1QSS A;  4X4O A;  1NK9 A;  3SI8 A;  1ZQL A;  1F5A A;  3G6Y A;  4DFK A;  4LT6 A;  3JPQ A;  4DQS A;  1S77 D;  5J2C A;  3SYZ A;  3N97 B;  3PW4 A;  2PXI A;  5KFR A;  1X9S A;  4LVS A;  4PHE A;  5C5J A;  2BKE A;  3GV7 B;  3TFS A;  3GV8 B;  4EEY A;  2DPI A;  3N4M B;  2DR9 A;  4YFK A;  4DOB A;  4UB4 A;  1ZQZ A;  2V4Q A;  1ZQD A;  3HJ1 A;  1UEV A;  4EYH B;  2O5A A;  4R65 A;  2FPK A;  3RJF A;  3PO4 A;  1A76 A;  5J29 A;  3WFO A;  4RWN A;  2GWS A;  8ICN A;  2B21 A;  3FYH A;  7ICH A;  2FMQ A;  2ZH2 A;  1HUO A;  4BWM A;  3ZDD A;  2RFF A;  1LV5 A;  3ISB A;  4KTQ A;  5HRG A;  4WC3 A;  2W9B B;  1N56 A;  1ZQH A;  3T3F A;  5DG9 A;  4HYK A;  1DGS A;  2AQ4 A;  2R8H A;  5DG7 A;  2ZHB A;  5KFI A;  2PBE A;  3PW5 A;  5IIM A;  2JZB B;  4KLQ A;  4AT8 B;  1K1Q A;  4X4R A;  3SZ2 A;  8ICP A;  1TFW A;  3TAR A;  4XRH A;  2LYH A;  4TUP A;  4I28 A;  5J0R A;  9ICK A;  4MEY A;  3AQL A;  3TFR A;  4UD5 A;  4KLJ A;  1RPL A;  4WC4 A;  3V6J A;  4YR0 A;  4YMM A;  3THV A;  8ICY A;  5DGA A;  4IQW A;  2WTF A;  3HW8 A;  3RB0 A;  4XQ8 A;  3QEA Z;  1NK7 A;  4NY8 A;  4KLS A;  4QZC A;  2ZTE A;  3JPT A;  4J9P A;  3LDA A;  1S0V A;  2AJQ A;  3LWM A;  4MF2 A;  4K4H A;  4QWD A;  2JEF A;  3BQ0 A;  3KHG A;  1YLQ A;  4R63 A;  3AQM A;  7ICJ A;  5F9L A;  4F4Z A;  5KFL A;  8ICK A;  5HP4 A;  2ASL A;  1CUK A;  2R8K A;  2Q66 A;  9ICQ A;  2NRZ A;  5J0O A;  3ZD8 A;  3WFS C;  4PGY A;  1BPD A;  4O3O A; 
#chains in the Genus database with same CATH topology
 5AK6 A;  3L3F X;  3SAG A;  1C20 A;  3NYB A;  2M2T A;  3ER8 C;  4M9N A;  2RRD A;  3RJG A;  5ALI A;  2O1P A;  1D8B A;  4UB1 A;  1X9M A;  2ZUD A;  1KW4 A;  3D2S A;  4R66 A;  4DL6 A;  4MEX A;  2Y0S F;  3GIK A;  2ASJ A;  3H3A A;  1PVQ A;  3RBD A;  3CNH A;  2MAX A;  2JEI A;  3BZK A;  3OVB A;  1LKY A;  2FE9 A;  2VIX A;  5DED A;  4DFJ A;  2XY6 A;  5CHG A;  1URJ A;  5D63 A;  1NJX A;  3PO5 A;  1PZN A;  2K60 A;  5ALM A;  1IV8 A;  2QB1 A;  4UW9 A;  3UM9 A;  3K7D A;  9ICU A;  3HP6 A;  4DL2 A;  2DF4 B;  3C1Y A;  4WC6 A;  2ISP A;  4X4S A;  2H3F A;  2IA6 A;  4DL5 A;  1CRX A;  2ZIX B;  1XO0 A;  3FM9 A;  1AQ6 A;  2JR5 A;  3OUY A;  4QZH A;  1V9P A;  3LYS A;  3AU2 A;  4FE3 A;  2BPG A;  3EPG A;  1J2N A;  1CI4 A;  5KG1 A;  2ZIV A;  5F2V O;  1L7O A;  2E8P A;  3HPO A;  3F2C A;  1A6S A;  8ICW A;  2FCL A;  2XGQ A;  4R64 A;  1BPE A;  2ES6 A;  3PX0 A;  2JXJ A;  3RTV A;  1SV0 A;  1UA0 A;  3JZ0 A;  2HVH A;  4OJL A;  9ICG A;  1ZRN A;  1SV0 C;  2ZXH A;  4IQU A;  4RWQ A;  4LEZ A;  8ICU A;  7ICQ A;  1TAU A;  4RQ3 A;  5DKW A;  1FEZ A;  4AT9 B;  3C1Z A;  2E1E A;  3M9O B;  2KIW A;  8ICH A;  5B3P A;  3ZDE A;  1K1S A;  4FHX A;  4RPX A;  4O5K A;  2LMR A;  3GZF A;  5AI9 A;  3TAN A;  4QZF A;  3I76 A;  4DQR A;  3AU6 A;  3GQC A;  4RWP A;  8ICQ A;  2EAM A;  2KZ3 A;  3HWT A;  2WF7 A;  2HOI A;  4US9 A;  5IIL A;  5KG0 A;  3QUB A;  8ICO A;  3WFQ E;  3H8M A;  2KVC A;  4KX3 A;  2JV3 A;  4PHP A;  4OCZ A;  2AH5 A;  1KQQ A;  1ZQQ A;  4ED8 A;  1Q8K A;  1TAM A;  5DLF A;  4DLG A;  2VA8 A;  1IG6 A;  1KN5 A;  2BPC A;  2F3N A;  1D8Y A;  4JMU A;  3T5H A;  4ECV A;  1A0P A;  4BWJ A;  2PFO A;  4F8R A;  2HSZ A;  5CEH A;  4UAY A;  5KFM A;  3CW2 C;  4G3I A;  2OHF A;  2LBO A;  3L4P A;  5HRH A;  2FPL A;  3AQE A;  4DL7 A;  3MFI A;  2ALZ A;  4DQI A;  2ZH8 A;  1Q3V A;  2L5Y A;  1NNL A;  3QNM A;  1L5U A;  1ZQP A;  4KLU A;  3Q8R B;  8ICT A;  3IN5 A;  1IXR A;  2UVR A;  3OHB A;  3SMV A;  4LZD A;  2A1A A;  2K8B B;  2HHV A;  4X4Q A;  3QE9 Y;  1QSY A;  5J8Y A;  4WJ3 B;  2DVI A;  3ETL A;  5AHX A;  4K98 A;  1DGJ A;  2IMW P;  4FHY A;  3OJS A;  2UVU A;  1BPY A;  3A0H U;  4B9L A;  3TQ1 A;  1ZD4 A;  4J9Q A;  2DRA A;  4DOA A;  4E7X A;  3O0F A;  4ELT A;  3TAD C;  9ICS A;  1Q79 A;  2W04 A;  1UEU A;  4YMN A;  4DLE A;  4JWN A;  3B0X A;  3N28 A;  4MFC A;  2E8M A;  4O68 A;  2KK0 A;  2ZH9 A;  2KG5 A;  2BE3 A;  4BXO A;  4RPZ A;  4ED2 A;  2UVV A;  1NK8 A;  3EZ5 A;  4F92 B;  5J0S A;  3D2Q A;  2CXY A;  5DQH A;  2C22 A;  2DPJ A;  3BZC A;  3FDS A;  4FBT A;  1L7N A;  2FMP A;  5AKL A;  2UVW A;  5AM3 A;  1TAQ A;  2W9A A;  5KFA A;  4Y2U A;  4RT3 A;  8ICF A;  1KDH A;  1NK0 A;  3QU9 A;  2ID1 A;  1Z00 A;  2RP5 A;  3M6Z A;  1XSP A;  2YMM A;  7ICE A;  3OV7 A;  1HEK A;  2GLE A;  2ZUB A;  1U9L A;  4WC0 A;  2P35 A;  3OSN A;  1L3T A;  1S0N A;  1MN8 A;  1MQ3 A;  3MFH A;  1ZJM A;  2KHQ A;  4ATB A;  5DQG A;  4IS7 A;  4PH5 A;  5HRE A;  3MR6 A;  2KE7 A;  4C8O A;  3WK5 A;  1MSW D;  1HIW A;  2NV3 A;  4YCX A;  2G08 A;  3BJY A;  5BPC A;  1R89 A;  3F2B A;  2HHS A;  1ZQS A;  5G5G A;  2ISO A;  8ICR A;  2QAR A;  9ICT A;  3AMZ A;  3K4G A;  4UD4 A;  4RUA A;  4KIT B;  4F2R A;  4PGX A;  2Y1J A;  3TAC B;  3PST A;  4QZG A;  5ALD A;  1T3N A;  4FZN A;  3V6K A;  1QTM A;  4Y2S A;  4PHD A;  4KB6 A;  4ECQ A;  1ZQG A;  1KTQ A;  2NRX A;  1B43 A;  4MFA A;  3C5G A;  1VFG A;  3JPN A;  3TKA A;  4UBB A;  1WOT A;  4LEY A;  3H4B A;  1FO4 A;  2FLL A;  4EED A;  4A8E A;  2PKE A;  4YG2 A;  2CPR A;  4QZE A;  1FFV A;  5KFH A;  3K1R B;  1UQV A;  4NM2 A;  1L7P A;  5KFE A;  1SV4 A;  3KKA A;  1MIW A;  2GH1 A;  3JCF A;  4O3N A;  3DDH A;  2OYY A;  1QQ7 A;  1C7Y A;  4C4R A;  4Z6F A;  4EBE A;  1DK3 A;  4RNM A;  4NXX A;  3CYM A;  2EAP A;  1HUZ A;  1S8O A;  4EBD A;  2I9G A;  3JPR A;  3GIM A;  4UB5 A;  1D9D A;  2KIV A;  4YN4 A;  2AGQ A;  3H39 A;  2I6X A;  5DQI A;  5HHI A;  2DFL A;  2KJ8 A;  3M8S A;  3WFR E;  2XGP A;  4IG8 A;  4Z6C A;  4Y2X A;  4XQ7 A;  5KFJ A;  3PSP A;  5ALY A;  1UT5 A;  5AI6 A;  5KAI U;  3QUQ A;  1ZQJ A;  4PPX A;  4EGW A;  4RQ0 A;  1QCK A;  3QZ7 A;  4F72 A;  3M8R A;  4NL9 A;  2FLP A;  8ICJ A;  4QZB A;  4WC5 A;  1L3U A;  5HRB A;  4NL9 C;  2R8I A;  3SV4 A;  9ICR A;  2E8O A;  3OTQ A;  2XY5 A;  4B9T A;  2BDU A;  4IRC A;  1QSS A;  4X4O A;  3JPQ A;  1S77 D;  3IV6 A;  5J2C A;  5KFR A;  1X9S A;  2KEY A;  3GV7 B;  2BKE A;  4K8V A;  4YFK A;  4UB4 A;  1ZQD A;  3HJ1 A;  3WKC A;  4R65 A;  1N5X A;  2ZH2 A;  3H0R B;  4HYK A;  1DGS A;  2DL0 A;  3U26 A;  3PW5 A;  3SD7 A;  3WKA A;  1M6Y A;  3TAR A;  4I28 A;  9ICK A;  4KLJ A;  1RPL A;  2K4P A;  3QU2 A;  3WK8 A;  2F8L A;  5DGA A;  2KNJ A;  2Q4T A;  4C7Y A;  5ALJ A;  2IOF K;  1S0V A;  3LWM A;  2JEF A;  3BQ0 A;  2BZF A;  4R63 A;  5AM1 A;  5KFL A;  1CUK A;  2R8K A;  5FP0 A;  5J0O A;  3ZD8 A;  1SXD A;  1BPD A;  4O3O A;  4KLG A;  1WCN A;  1KFS A;  3RJH A;  3ONN A;  5CFS A;  2AXT U;  3PW0 A;  2HBK A;  1ZQK A;  3QX7 A;  4I2C A;  3SAH A;  4NLZ A;  3PHZ A;  4Y2J A;  4GXK A;  1BVS A;  2YQE A;  3H40 A;  1ZQM A;  3VCB A;  5KFD A;  9ICV A;  3H8J A;  4Q44 A;  4UAZ A;  5AM2 A;  2C2E A;  1ZOL A;  1T3Q A;  1NK5 A;  2IHM A;  4X4N A;  3HKZ C;  4OJ5 A;  4RU9 A;  2M0N A;  3MR2 A;  3NVY A;  2RQ5 A;  7ICL A;  1SL0 A;  2HOF A;  4UAR A;  1ZD2 P;  5CHE A;  3MGV A;  4DSI A;  2K4I A;  1NKB A;  4YR3 A;  5HRL A;  4BDP A;  5GTI U;  7ICK A;  2IOH A;  2YMP A;  3SV3 A;  4DOC A;  2XY7 A;  3SEN A;  1PVP A;  4B6J A;  3RF9 A;  4ICA A;  5E79 U;  4U6P A;  2B56 A;  1BGX T;  1COO A;  4OAF A;  5AKJ A;  4FS2 A;  2XIC A;  5DLG A;  4GXJ A;  2CRX A;  1MIY A;  4IR9 A;  3HRD D;  4F5P A;  1XS9 D;  2C28 A;  2NRV A;  2FDR A;  2W3R A;  3MC1 A;  5KFK A;  3LWL A;  4NXU A;  4NV0 A;  2KJ5 A;  3H7I A;  5HMM A;  4IL6 U;  2VA2 A;  1R8B A;  4NLN A;  5ALS A;  4E80 A;  3CP8 A;  4P0Q B;  3M9M B;  1TFR A;  4IRK A;  5HRD A;  3VC8 A;  4YP3 A;  4IRD A;  4M9G A;  1KRP A;  4M6W B;  1NO5 A;  3AQN A;  3HT3 A;  4QJF B;  1P7D A;  1U45 A;  4C8L A;  2KHV A;  8ICC A;  2W9B A;  1X2I A;  2XO7 A;  2NRK A;  3FC4 A;  5J2D A;  4F71 A;  3QYP A;  4AT8 A;  2YB4 A;  1DRG A;  2G09 A;  4OJ6 A;  3R9K A;  2ZH5 A;  1N61 A;  4CF5 A;  3EUB 2;  2HMX A;  4F4X A;  5IIK A;  4X4U A;  3UMB A;  2HBL A;  4RQ8 A;  1QH9 A;  4YR2 A;  2ZHA A;  2J6T A;  5AKH A;  2BCR A;  3NAS A;  4HX0 A;  2JH7 A;  7ICS A;  2AGO A;  1GO3 F;  1XSN A;  5DBB A;  1ZJN A;  4NXT A;  2HVI A;  3IHQ B;  3UXO A;  5KFO A;  4Z6E A;  1MIV A;  2P6R A;  3E58 A;  2PI4 A;  4PHA A;  5KFS A;  2YX8 A;  3T5J A;  3J81 j;  2M2V A;  4R8U B;  4OD0 A;  1Q78 A;  1TVA A;  3KHH A;  2KFN A;  5JUM A;  3WKD A;  2BQU A;  1PVR A;  3UPS A;  3G6X A;  5K4L A;  3JYY A;  3PR5 B;  1VJ5 A;  1SB3 C;  4O69 A;  3C5F A;  1O03 A;  3RJE A;  4DQQ A;  3Q8M A;  4PZN A;  3NVV A;  4EEN A;  2DKX A;  8ICS A;  2BCS A;  4NLK A;  4NXW A;  2D6F C;  3TI0 A;  2DBY A;  1VLB A;  1KFT A;  1KEJ A;  4C8K A;  5J2A A;  4ED0 A;  2A19 A;  1L6N A;  3M6K A;  2W8L A;  4M9J A;  4JK1 A;  2WF5 A;  5KT6 A;  4I2H A;  3F2D A;  4O9M A;  4M2Y A;  2H3Z A;  4KN4 A;  4UB8 U;  4WQL A;  1ZXI A;  4PL2 A;  4ECS A;  3C2M A;  4F4Y A;  4CGZ A;  3BQ7 A;  5JTI A;  7ICM A;  8ICX A;  4P0P B;  3RRH A;  3D2N A;  2F8K A;  4MHV A;  3AQK A;  3PR4 A;  2EWR A;  1RYS A;  4JV2 A;  5HML A;  4F50 A;  3GV5 B;  4ELU A;  1RM6 C;  1NKE A;  4Q8E A;  1Z1B A;  5KFY A;  1JUD A;  5ALN A;  5DGB A;  4EZ9 A;  2MUT A;  1UT8 A;  4ECT A;  5EE9 A;  4DSL A;  4FHP A;  1BPB A;  1IM4 A;  1JXE A;  7ICR A;  4WC1 A;  2Q0Z X;  1OUQ A;  4F4K A;  3SEI A;  3NS1 A;  1UCV A;  4LJX A;  3RJK A;  9ICI A;  1U4B A;  4AT7 A;  4EV6 A;  2GA9 D;  3BS5 A;  4P2H A;  5HRK A;  1ZQ1 C;  1BPX A;  3M1Y A;  2IUB A;  3RH4 A;  1QQ6 A;  2ZH3 A;  4XUS A;  4I27 A;  4M47 A;  4M0A A;  3I28 A;  5CFT A;  1WG8 A;  3B9J A;  5KT5 A;  3FAH A;  4I29 A;  1ZYQ A;  4O0I A;  5L1J A;  2C2D A;  1N48 A;  2ZH4 A;  2E5S A;  3IG5 A;  4UAW A;  4RQ7 A;  2VJ5 A;  3F5A A;  2W55 A;  3KFU F;  4EEB A;  4KLM A;  2HHX A;  5AIA A;  3MBY A;  5KFG A;  3C23 A;  4K4I A;  3EW9 A;  3L9D A;  4F3O A;  3MAB A;  3QEB Z;  4YXM A;  1ZQF A;  3PY8 A;  3ZI4 A;  4K9B A;  2HHU A;  4KLD A;  3UPQ A;  3HKZ F;  4I2F A;  2ZTD A;  4P4M A;  2G5H B;  5AI8 A;  4KLE A;  1BNO A;  4NJ8 A;  3QU5 A;  4O6A A;  4TUQ A;  2C2R A;  2V4R A;  4M9H A;  3TAD A;  1B22 A;  3Q8L A;  1NI3 A;  4IC9 A;  3QUC A;  3KHL A;  1SL1 A;  5TZV A;  4ED3 A;  4Y2T A;  2K8A A;  5HR7 A;  5KT7 A;  3EPI A;  2K8C B;  1XSL A;  2ZTC A;  3ED5 A;  4DEZ A;  1JIH A;  2D8C A;  1ZRM A;  1LKY B;  1UET A;  4JWM A;  4DO9 A;  1BPZ A;  5KT2 A;  4TUS A;  4LZG A;  1L3S A;  1JQR A;  1VDV A;  5EE3 A;  4J03 A;  5EWE A;  4NKT A;  2K4H A;  2O6K A;  4US8 A;  2BQ3 A;  2HHT A;  5CWR A;  4EBJ A;  4QZD A;  2ZUC A;  2QLT A;  5J0X A;  4M9L A;  1NJY A;  2F44 A;  1S5L U;  3I1Y A;  5ALW A;  3OUY B;  2H3Q A;  3QU4 A;  2ESE A;  2BGW A;  2R18 A;  4X4P A;  2RLT A;  2IOF A;  4ECU A;  4UAT A;  3WKB A;  4PZO A;  1ARO P;  1ZQR A;  2LKY A;  2ZIV B;  2IHO A;  4RPY A;  4C8M A;  4ECY A;  5J2J A;  2VKQ A;  5KNI A;  3PML A;  4FS1 A;  3AM9 A;  4FFD A;  3SI8 A;  1NK9 A;  2DQN B;  2PXI A;  4LVS A;  4PHE A;  3TFS A;  4EEY A;  2DPI A;  4USA A;  4DOB A;  4EEL A;  5D61 A;  2FPK A;  3PO4 A;  1A76 A;  5J29 A;  3PSF A;  4BJQ A;  2GWS A;  2B21 A;  4FZM A;  5ALR A;  4BWM A;  1LV5 A;  4KTQ A;  5HRG A;  3LVW A;  3T3F A;  1ZQH A;  1ZD3 A;  2R8H A;  2ZHB A;  1TFW A;  2XVT A;  3SZ2 A;  8ICP A;  4XRH A;  2LYH A;  5J0R A;  4MEY A;  4UD5 A;  3TFR A;  3V6J A;  5AM5 A;  5KAF U;  5GTH U;  4LEV A;  4YMM A;  4KMO B;  8ICY A;  2MU2 A;  3HW8 A;  2E3T A;  3NWI A;  4KLS A;  2ZTE A;  4J9P A;  5JRT A;  4K4H A;  4QWD A;  3KHG A;  3AQM A;  7ICJ A;  5F9L A;  5HP4 A;  4JLX A;  5AKE A;  9ICQ A;  2NRZ A;  5ALU A;  4PGY A;  4CF3 A;  3WK7 A;  3ORY A;  1HJP A;  4I2J A;  4I2E A;  1Y88 A;  1DOQ A;  4O3P A;  3C18 A;  5AIB A;  4X4V A;  2B0C A;  3CK6 A;  3B0Y A;  2D3D A;  1DXS A;  2BBH A;  4ED7 A;  3IDW A;  2P6U A;  5J2H A;  2WB1 C;  3HJE A;  2KTQ A;  1YZ6 A;  2PMZ C;  8ICM A;  5ALT A;  5AI4 A;  2ZIW A;  1S97 A;  2WAQ C;  5BOM A;  1RYR A;  4QZA A;  3H8W A;  4I2A A;  1TE2 A;  4NXZ A;  1QSL A;  3N7S C;  1GPJ A;  2XC9 A;  3RRG A;  4BX9 C;  5IIN A;  4QW8 A;  3E2E A;  2OM6 A;  5KFZ A;  5J2F A;  5KG6 A;  1SXE A;  2RHF A;  2Y0S C;  1F44 A;  1PUZ A;  4WBZ A;  3RAQ A;  1SZP A;  2DRB A;  4C8N A;  2EAN A;  4F5R A;  1UA1 A;  2W9C A;  2NO5 A;  2LPE A;  5J2E A;  3AEV A;  1BNP A;  5IIO A;  4ZH4 A;  2KZM A;  2HHQ A;  1NK4 A;  1ZQA A;  3MGI A;  4NKU A;  4WOY A;  5KTQ A;  4JV1 A;  3PMN A;  1FFU A;  3GIJ A;  4KLO A;  4MFF A;  1YZ7 A;  4O67 A;  5KL1 B;  3WK9 A;  4FO6 A;  2QB0 A;  1SL2 A;  1V97 A;  2EAO A;  2A1J A;  3RR8 A;  1NOM A;  5HR9 A;  4BXO B;  9ICE A;  1CEZ A;  5KFV A;  3SAF A;  2KSO A;  5KFF A;  1V85 A;  4CDG A;  3Q8Q B;  5TIS U;  3BQT A;  4EX6 A;  9ICC A;  4TQR A;  3V7J A;  3V6H A;  3KZI U;  2E1F A;  3C21 A;  2OH2 A;  2W3S A;  5KFN A;  3WKE A;  3NGD A;  4I2I A;  4F93 B;  3NVZ A;  4ECR A;  4YD1 A;  1KFD A;  4GFJ A;  1X6I A;  4MF8 A;  2JZB A;  1Z00 B;  4RZR A;  3T5K A;  2OXO A;  4UB2 A;  4QIW C;  5EWG A;  4ATB B;  3MGH A;  4O3Q A;  4DWI A;  2K4E A;  4KLT A;  7ICI A;  1L7M A;  2LYB A;  3TAQ A;  4WQK A;  2KN7 A;  3C2K A;  5EOZ A;  2MSN A;  1J2M A;  5F9N A;  1SKW A;  2DR8 A;  1Z4O A;  2W7P A;  5ALK A;  5AKK A;  2JEG A;  5HRI A;  1ECW A;  2G07 A;  2N1R A;  3UMC A;  4DSK A;  2QAR B;  2RDI A;  3H0M B;  2F76 X;  4NLG A;  5CFU A;  5DEC A;  3SR6 A;  4UBC A;  1TK8 A;  4RQ6 A;  3PNC A;  5DB9 A;  3C28 A;  4Y2Q A;  2B6G A;  2YY6 A;  4RQ1 A;  3JPS A;  3NVW A;  2AQ0 A;  4O5E A;  7ICV A;  5L1L A;  1XWL A;  2LI6 A;  4EBK A;  2ASD A;  4KN7 A;  2EZZ A;  5DDM A;  8ICE A;  5DDY A;  2I1Q A;  1ZQB A;  4QZ8 A;  4DL3 A;  1ZQO A;  4ELV A;  1JN3 A;  1RXV A;  5L9X A;  2KFZ A;  2HI0 A;  4J9K A;  2ZXI A;  4QWC A;  3BDP A;  1Q46 A;  1NZP A;  3ALR A;  3HIL A;  4B9V A;  1VJ7 A;  2BQR A;  5HHH A;  1LB2 B;  4F5Q A;  2BCU A;  2ZIX A;  8ICB A;  5JU5 A;  3JPP A;  4NXV A;  4AP9 A;  3H4D A;  3PW2 A;  3M7D A;  2ZIW B;  4C0Z A;  2KMD A;  3K75 D;  4CRX A;  5KFB A;  9ICF A;  9ICM A;  3OHA A;  3RJJ A;  4EX7 A;  4P4P A;  3PX6 A;  2JEJ A;  2JH1 A;  4KMU A;  3C66 A;  1S10 A;  2YTU A;  3ZDC A;  4OAG A;  1LVH A;  2B4V A;  3UMG A;  4I2G A;  3D6J A;  2HHP A;  3WU2 U;  2VAN A;  2G06 A;  4UAV A;  4RQ5 A;  2F77 X;  2W9C B;  2HW3 A;  2G5I B;  3KBB A;  4RNO A;  2JGA A;  5AKI A;  4KLI A;  3ETR A;  3H0L B;  1S0M A;  2HBJ A;  5KFX A;  5AI5 A;  1UPH A;  1V38 A;  5IIJ A;  2ZH1 A;  2F2A B;  2GOL A;  1MQ2 A;  4Y2V A;  5KG5 A;  4YXJ A;  3F5E A;  1S76 D;  5DG8 A;  7ICF A;  2A1J B;  4RQ2 A;  2ZH6 A;  2DWQ A;  1ZQI A;  3AL0 B;  1T7P A;  1L8O A;  4XJE A;  2IBK A;  3RR7 A;  1MA7 A;  8ICG A;  2PI5 A;  2KZZ A;  2DUY A;  1B0X A;  5ALO A;  3GFK B;  5ALZ A;  1F0M A;  4J9M A;  2RDJ A;  2NO4 A;  5ALG A;  1N2X A;  5AI0 A;  2W9M A;  2WFA A;  4EBC A;  4FO1 A;  2W03 A;  1L3V A;  2BDP A;  3RBE A;  5J0T A;  4DF4 A;  4O3R A;  1SWV A;  4N7R A;  1KNY A;  7ICP A;  5KFQ A;  3HIY A;  4NWI A;  8ICI A;  3UXN A;  2HN1 A;  2WF9 A;  2I5H A;  4DFD A;  2AHO B;  4X5V A;  4GC7 A;  3F53 A;  5DB8 A;  2GAF D;  4K9A A;  2PFP A;  4UB6 U;  3ISC A;  5KFW A;  1T4G A;  2PMZ F;  4S3N A;  5DB6 A;  3L5K A;  1S9F A;  2HOQ A;  2WAQ F;  2ZJ5 A;  2BBJ A;  4DF8 A;  8ICL A;  4O5C A;  4TUR A;  3RH6 A;  5AIC A;  3ERC C;  4I2B A;  2MRL A;  2KP7 A;  4F5O A;  9ICH A;  3H8S A;  1IIP A;  4QZI A;  1N62 A;  4JB3 A;  4WCW A;  2M9N A;  2EH9 A;  4K4G A;  5DBA A;  4J9R A;  4O3M A;  1D8L A;  5J0Y A;  1ZQY A;  2Y1I A;  4RNN A;  2IHN A;  1OXJ A;  5AKZ A;  4DS4 A;  3TAP A;  1WCL A;  4GXI A;  7ICU A;  2A3V A;  4DFM A;  3PW7 A;  3NRW A;  4Y2Y A;  3G6V A;  1O08 A;  4IQT A;  3DEE A;  2WHE A;  2NRT A;  4NLC A;  2R8J A;  4BUG A;  4OO1 J;  4CNQ A;  3T79 A;  4KM5 A;  3ER9 B;  1XO1 A;  3UXP A;  4PL1 A;  1NJW A;  4KLH A;  3KTQ A;  2ZH7 A;  4PGQ A;  3OPX A;  2FI1 A;  5CB1 A;  2EZX A;  3LVV A;  2G0A A;  2KIC A;  4I0U A;  1JXL A;  4GLX A;  1X9X A;  3NKU A;  3GDX A;  1TKD A;  5BOL A;  3AQF A;  1TK5 A;  4X0B A;  1SKR A;  4RUC A;  4AYB C;  1D9F A;  1ED1 A;  5ALH A;  5JTG A;  1DK2 A;  2H5X A;  4UAS A;  4K99 A;  4ED6 A;  4M5D A;  3ZD9 A;  3RB3 A;  2DR7 A;  4QW9 A;  2J6S A;  3IM1 A;  4LT6 A;  4DQS A;  3N97 B;  3PW4 A;  4QIW F;  2DR9 A;  3GV8 B;  5B3Q A;  3N4M B;  1KBU A;  2V4Q A;  3K1Z A;  1YT3 A;  3WFO A;  1NZB A;  8ICN A;  3FYH A;  7ICH A;  2RFF A;  4WC3 A;  3ISB A;  2W9B B;  2K89 A;  1N56 A;  3WK6 A;  2AQ4 A;  1OW5 A;  5DG7 A;  2PBE A;  5IIM A;  3NRZ A;  4X4R A;  4AT8 B;  4EEK A;  4UAU A;  2KJ9 A;  4G9B A;  4WC4 A;  4FZL A;  4YR0 A;  4CE6 A;  3THV A;  5AKG A;  4XQ8 A;  1NK7 A;  1JRP A;  3JPT A;  1SGG A;  2AJQ A;  4MF2 A;  3N7P D;  2ASL A;  2KKP A;  3WFS C;  3PVX A;  3PSI A;  4E8F A;  3MDA A;  3C29 A;  2QKQ A;  3AUO A;  4J9N A;  7ICG A;  5J0P A;  2KV2 A;  1EXN A;  5CR0 A;  5KT4 A;  5D4B A;  4YVZ A;  3S6J A;  5J0W A;  1Q3U A;  1ZQC A;  4FHW A;  3OWG A;  4ZOH C;  3C2L A;  2M2W A;  1NJZ A;  2W43 A;  5ALE A;  1XU4 A;  5T14 A;  5J8Y C;  1K5O A;  4ECX A;  1SKS A;  3IRU A;  5J0Q A;  4DFP A;  4DL4 A;  8ICA A;  3OJU A;  2XID A;  5AKX A;  1WYG A;  1NK6 A;  3LK9 A;  2YN4 A;  1ZQW A;  2AU0 A;  3MR3 A;  4QZ9 A;  2Z7J A;  1SIJ A;  4RT2 A;  5CRX A;  1WWU A;  4KX5 A;  5J2B A;  2LM4 A;  4B9N A;  5D62 A;  3IG8 A;  5L1K A;  3NUQ A;  5CP2 A;  1X66 A;  4B9M A;  2XCP A;  5C0Y A;  1X42 A;  2MA1 A;  5KG3 A;  1UHU A;  2WF8 A;  1ZQT A;  4WC7 A;  5KG4 A;  3H38 A;  2ZG6 A;  4GIB A;  4CF4 A;  4Y2R A;  4EP7 A;  1N63 A;  2MUT B;  1F5S A;  4EYI B;  5HRF A;  1RXW A;  9ICX A;  4F5N A;  4C4T A;  2VA3 A;  1U49 A;  3N7R C;  1WWV A;  4ECW A;  2F1I A;  5AKY A;  9ICN A;  2JHD A;  2F1J A;  5D46 A;  1QLN A;  4NM1 A;  5A0L A;  5HR6 A;  2E8N A;  5HC9 A;  1Z19 A;  9ICJ A;  4AT7 B;  5J2I A;  2NYV A;  3BS5 B;  5ALL A;  2YMQ A;  4OAH A;  4J9S A;  4X0A A;  2PFQ A;  2F1H A;  4F2S A;  1TV9 A;  4FBU A;  3RJI A;  5AM4 A;  1ZQU A;  3M9N B;  4KLF A;  3ZDB A;  2KOB A;  4PJ0 U;  3KD3 A;  5H2F U;  4WH5 A;  2LM1 A;  4O3S A;  5ALF A;  4YD2 A;  2JRZ A;  3RH5 A;  1Z4N A;  2YML A;  7ICN A;  4C80 A;  2KVS A;  4LEW A;  3HJ4 A;  2YB1 A;  1ZQX A;  5AK4 A;  3A0B U;  2V9W A;  4J9L A;  4DSJ A;  3PV8 A;  5AK5 A;  4B9U A;  4QWA A;  2Y9U A;  4RQ4 A;  3UQ2 A;  1KLN A;  4UQG A;  3LQC B;  3KZX A;  3KHR A;  1TFY A;  3BQ1 A;  3PZP A;  2HHW A;  9ICB A;  1JAL A;  3GIL A;  4OJP A;  3DV9 A;  2KD1 A;  5ALV A;  1B4F A;  5J2G A;  5III A;  2PFN A;  2VJ4 A;  4FHV A;  5D49 A;  2FPM A;  2Y9T A;  2B51 A;  3BS7 A;  3Q8P B;  5CJ7 A;  4FH3 A;  2NRW A;  1A77 A;  4Q45 A;  3MR5 A;  1NKC A;  4ACO A;  4X4T A;  4JV0 A;  5L1I A;  3RAX A;  1JRO A;  5EE1 A;  3ISD A;  3OSP A;  3KKA C;  1X40 A;  1MC8 A;  4DCC A;  7ICO A;  4F91 B;  3OGU A;  4QWB A;  2HBM A;  2W54 A;  8ICV A;  1SWW A;  3EWA A;  1ZD5 A;  2EQY A;  3RB6 A;  3IP4 B;  3Q8K A;  4AYB F;  1Z1V A;  2BCQ A;  2DGZ A;  4OAI Z;  1KSP A;  2DKZ A;  5DBC A;  4FH5 A;  9ICP A;  1N5W A;  2LYA A;  5KT3 A;  4P0Q A;  2FLN A;  2ZJA A;  3BQ2 A;  5KL8 B;  2CN1 A;  3T5L A;  4DSE A;  3V72 A;  4J9O A;  9ICA A;  5ALX A;  4M6W A;  4IQV A;  1ZET A;  3GU3 A;  1TK0 A;  1FA0 A;  2H3V A;  4BGD A;  1JAJ A;  4Q8F A;  1ZQE A;  5AK3 A;  3OVA A;  4I2D A;  1JMS A;  2AGP A;  1RDF A;  9ICO A;  3NTU A;  4ED1 A;  1S0O A;  3CRX A;  4UB3 A;  1QQ5 A;  1SZH A;  1Z3E B;  3JPO A;  1U47 A;  1COK A;  3WFP A;  2R8G A;  4YQW A;  4EZ6 A;  2OWO A;  4MKP A;  4Q43 A;  1RZT A;  1V4A A;  2ZIU A;  3V7K A;  3NVO A;  1PK1 A;  5KFP A;  2XI9 A;  2BPF A;  3V7L A;  3MDC A;  2EDU A;  2XCA A;  4KLL A;  4R8U A;  5F3X B;  2HDO A;  3AN1 A;  4F4W A;  2W7O A;  3WK4 A;  4OJO A;  4DSF A;  4Z6D A;  3EF2 A;  1FIQ A;  8ICZ A;  3OVS A;  4XA5 A;  5HNK A;  4E0D A;  1H38 A;  2DR5 A;  3H37 A;  1RG6 A;  1KL9 A;  1XC9 A;  1U48 A;  3GII A;  2J6U A;  3EYZ A;  2M2U A;  1ZQN A;  3UQ0 A;  4Y2P A;  1RQN A;  2FMS A;  4ECZ A;  2W11 A;  3QXG A;  5B5E U;  1RQL A;  5KFU A;  2EZY A;  4QWE A;  2ZJ8 A;  5KG7 A;  5J0U A;  1X9W A;  4WC2 A;  5KFT A;  2ATL A;  4RQM A;  1XNS A;  4RWO A;  5ALQ A;  3Q8S B;  4M04 A;  2LHT A;  5DB7 A;  5CA7 A;  4TQS A;  3RFA A;  5EWF A;  4P0P A;  5B66 U;  3QZ8 A;  5ALP A;  5KG2 A;  5J2K A;  3PX4 A;  1J97 A;  1ZQV A;  3ICX A;  3RB4 A;  2BR0 A;  1R8C A;  4YMO A;  2KKV A;  1PK3 A;  1L8L A;  4RQN A;  5L1M A;  3ZDA A;  3KOO A;  2P66 A;  5G5H A;  2W8K A;  4JLZ A;  4HAI A;  3QU7 A;  4B9S A;  7ICT A;  3HX0 A;  2WF6 A;  1JX4 A;  2BHN A;  9ICW A;  4AT9 A;  1OU5 A;  3E0F A;  3QUT A;  4GC6 A;  1R8A A;  4CCH A;  9ICL A;  4DS5 A;  4K97 A;  1PX5 A;  2GO7 A;  4U7C A;  1T8E A;  4P4O A;  1X6J A;  1N60 A;  4QNL A;  2ODG A;  1KKX A;  1WUD A;  4IR1 A;  1RYU A;  5KFC A;  5AM0 A;  4WBY A;  4K96 A;  2QB0 B;  2BCV A;  4JUZ A;  2FJ6 A;  2KSO B;  1ZQL A;  1F5A A;  3G6Y A;  4DFK A;  3SYZ A;  3SQI A;  5C5J A;  2HCF A;  1JI7 A;  4NLB A;  1ZQZ A;  1UEV A;  3MCR A;  4EYH B;  2HN2 A;  2O5A A;  5EE0 A;  3RJF A;  4RWN A;  2FMQ A;  1HUO A;  3ZDD A;  5DG9 A;  2H3I A;  5KFI A;  2JMG A;  2JZB B;  4KLQ A;  2OCE A;  1K1Q A;  4C7Z A;  4TUP A;  3AQL A;  2OEH A;  4IQW A;  2WTF A;  3RB0 A;  3QEA Z;  4NY8 A;  4QZC A;  4C4S A;  3LDA A;  1YLQ A;  4F4Z A;  8ICK A;  2WB1 F;  2Q66 A;  1T94 A;  4DQP A;  2ZIU B;  1PK1 B; 
#chains in the Genus database with same CATH homology
 3ORY A;  4KLG A;  1HJP A;  1WCN A;  1KFS A;  4I2J A;  3RJH A;  1Y88 A;  4I2E A;  3NYB A;  1DOQ A;  4O3P A;  3C18 A;  3PW0 A;  2M2T A;  4X4V A;  4E8F A;  3MDA A;  1ZQK A;  4I2C A;  4M9N A;  4NLZ A;  3RJG A;  3B0Y A;  3AUO A;  4J9N A;  7ICG A;  2O1P A;  4GXK A;  1BVS A;  3H40 A;  5J0P A;  1ZQM A;  4ED7 A;  5KFD A;  2P6U A;  4UB1 A;  9ICV A;  5J2H A;  1X9M A;  1EXN A;  2ZUD A;  5CR0 A;  3H8J A;  5KT4 A;  5D4B A;  2KTQ A;  4YVZ A;  4Q44 A;  4UAZ A;  4R66 A;  4DL6 A;  2ASJ A;  3GIK A;  5J0W A;  2C2E A;  4MEX A;  1ZQC A;  8ICM A;  3H3A A;  4FHW A;  1NK5 A;  1S97 A;  5BOM A;  3C2L A;  2IHM A;  4X4N A;  1RYR A;  3RBD A;  1NJZ A;  2MAX A;  2JEI A;  2M2W A;  4RU9 A;  3OVB A;  4QZA A;  3H8W A;  3MR2 A;  4I2A A;  7ICL A;  5DED A;  1SL0 A;  4DFJ A;  2XY6 A;  4NXZ A;  1QSL A;  5CHG A;  4DSI A;  1XU4 A;  1NJX A;  3PO5 A;  2DR5 A;  1PZN A;  2XC9 A;  3RRG A;  5IIN A;  4QW8 A;  3E2E A;  5KFZ A;  9ICU A;  3HP6 A;  4DL2 A;  1NKB A;  5J2F A;  3C1Y A;  5KG6 A;  4ECX A;  1SKS A;  2ISP A;  4WC6 A;  5J0Q A;  4DFP A;  4X4S A;  4YR3 A;  2IA6 A;  4DL4 A;  4DL5 A;  8ICA A;  5HRL A;  4BDP A;  4WBZ A;  3RAQ A;  1SZP A;  7ICK A;  2DRB A;  4C8N A;  3OJU A;  4F5R A;  1UA1 A;  2W9C A;  3OUY A;  3SV3 A;  4QZH A;  1V9P A;  4DOC A;  2XY7 A;  5J2E A;  1NK6 A;  3AU2 A;  2BPG A;  1BNP A;  3EPG A;  3LK9 A;  5IIO A;  4ZH4 A;  2KZM A;  2HHQ A;  1BGX T;  1COO A;  1NK4 A;  1ZQA A;  5KG1 A;  1ZQW A;  4FS2 A;  2AU0 A;  3MR3 A;  3MGI A;  4QZ9 A;  5DLG A;  4GXJ A;  5F2V O;  1MIY A;  4IR9 A;  4NKU A;  5KTQ A;  4JV1 A;  4RT2 A;  4F5P A;  1XS9 D;  2C28 A;  2NRV A;  3PMN A;  3HPO A;  3GIJ A;  4KLO A;  8ICW A;  5KFK A;  3LWL A;  4MFF A;  4FO6 A;  5J2B A;  2XGQ A;  4R64 A;  1BPE A;  1SL2 A;  4B9N A;  3PX0 A;  2A1J A;  3H7I A;  1NOM A;  3RR8 A;  3RTV A;  5L1K A;  4BXO B;  5HR9 A;  9ICE A;  1CEZ A;  5HMM A;  5KFV A;  2VA2 A;  1UA0 A;  1R8B A;  3JZ0 A;  5KFF A;  2HVH A;  5CP2 A;  4NLN A;  4B9M A;  4E80 A;  2XCP A;  9ICG A;  3Q8Q B;  4IQU A;  3BQT A;  3M9M B;  5KG3 A;  1ZQT A;  8ICU A;  7ICQ A;  1TAU A;  5HRD A;  5KG4 A;  4RWQ A;  4WC7 A;  4RQ3 A;  1TFR A;  5DKW A;  3H38 A;  9ICC A;  4AT9 B;  3C1Z A;  4TQR A;  4IRD A;  4YP3 A;  3M9O B;  3V7J A;  3V6H A;  4IRK A;  1KRP A;  2MUT B;  4M6W B;  4EYI B;  4M9G A;  1NO5 A;  3AQN A;  4EP7 A;  3HT3 A;  3C21 A;  8ICH A;  5HRF A;  5KFN A;  1RXW A;  9ICX A;  3NGD A;  4F5N A;  1U45 A;  2VA3 A;  4I2I A;  4F93 B;  4C8L A;  2W9B A;  4ECR A;  1U49 A;  4YD1 A;  1X2I A;  8ICC A;  3ZDE A;  2XO7 A;  1KFD A;  1K1S A;  2NRK A;  5J2D A;  4ECW A;  4MF8 A;  2JZB A;  4FHX A;  4RPX A;  1Z00 B;  4O5K A;  4AT8 A;  4RZR A;  2F1I A;  3TAN A;  9ICN A;  4QZF A;  3T5K A;  2F1J A;  5D46 A;  1QLN A;  4NM1 A;  2ZH5 A;  4UB2 A;  4DQR A;  3AU6 A;  3GQC A;  5HC9 A;  4F4X A;  5IIK A;  9ICJ A;  4AT7 B;  4X4U A;  4RWP A;  5J2I A;  8ICQ A;  5EWG A;  2KZ3 A;  3HWT A;  4ATB B;  4RQ8 A;  3MGH A;  4O3Q A;  4J9S A;  4DWI A;  5IIL A;  4KLT A;  4X0A A;  5KG0 A;  2PFQ A;  8ICO A;  3WFQ E;  4YR2 A;  7ICI A;  2ZHA A;  3TAQ A;  2F1H A;  2J6T A;  4PHP A;  2BCR A;  4F2S A;  2KN7 A;  3C2K A;  1TV9 A;  2AGO A;  7ICS A;  5EOZ A;  4FBU A;  3RJI A;  1XSN A;  5DBB A;  1ZQU A;  5F9N A;  3M9N B;  1ZJN A;  1SKW A;  1ZQQ A;  4KLF A;  2DR8 A;  4ED8 A;  3ZDB A;  5DLF A;  4DLG A;  2JEG A;  5HRI A;  2VA8 A;  2HVI A;  3IHQ B;  3UXO A;  2BPC A;  5KFO A;  4Z6E A;  4DSK A;  1MIV A;  2P6R A;  1D8Y A;  2RDI A;  2PI4 A;  4NLG A;  3T5H A;  4PHA A;  4ECV A;  2PFO A;  4BWJ A;  5KFS A;  4F8R A;  4O3S A;  3T5J A;  4YD2 A;  5DEC A;  4UBC A;  3RH5 A;  4UAY A;  2M2V A;  7ICN A;  4R8U B;  1TK8 A;  1Q78 A;  5KFM A;  4G3I A;  1TVA A;  4RQ6 A;  3KHH A;  3PNC A;  5DB9 A;  2KFN A;  5HRH A;  5JUM A;  3HJ4 A;  2BQU A;  1ZQX A;  3UPS A;  2FPL A;  2V9W A;  4J9L A;  4DSJ A;  3G6X A;  4DL7 A;  3PV8 A;  3MFI A;  2ALZ A;  3PR5 B;  4DQI A;  3JYY A;  2ZH8 A;  4RQ1 A;  1L5U A;  4B9U A;  3JPS A;  4QWA A;  1ZQP A;  4RQ4 A;  2AQ0 A;  4O5E A;  3UQ2 A;  1KLN A;  4UQG A;  4KLU A;  3Q8R B;  3KHR A;  7ICV A;  8ICT A;  3LQC B;  3BQ1 A;  3C5F A;  5L1L A;  1TFY A;  1IXR A;  1XWL A;  2UVR A;  4EBK A;  3OHB A;  2ASD A;  3RJE A;  4KN7 A;  4LZD A;  4DQQ A;  2HHW A;  5DDM A;  3Q8M A;  9ICB A;  2HHV A;  4X4Q A;  3QE9 Y;  8ICE A;  3GIL A;  5DDY A;  1QSY A;  2I1Q A;  1ZQB A;  4QZ8 A;  4DL3 A;  8ICS A;  1ZQO A;  5J2G A;  5III A;  2PFN A;  1JN3 A;  1RXV A;  5L9X A;  2BCS A;  4ELV A;  4NLK A;  2KFZ A;  4J9K A;  4FHV A;  2DVI A;  4QWC A;  3ETL A;  3BDP A;  1NZP A;  5D49 A;  2IMW P;  3TI0 A;  2FPM A;  4FHY A;  3OJS A;  4B9V A;  2UVU A;  1VJ7 A;  3Q8P B;  2BQR A;  1BPY A;  5HHH A;  5CJ7 A;  4FH3 A;  2NRW A;  1KEJ A;  4F5Q A;  5J2A A;  1LB2 B;  4ED0 A;  2BCU A;  1A77 A;  4Q45 A;  4C8K A;  4B9L A;  3JPP A;  3MR5 A;  1NKC A;  3TQ1 A;  8ICB A;  4X4T A;  4JV0 A;  2W8L A;  4J9Q A;  4M9J A;  2DRA A;  4DOA A;  4JK1 A;  5L1I A;  4ELT A;  4E7X A;  3RAX A;  9ICS A;  5KT6 A;  3H4D A;  3PW2 A;  4I2H A;  3ISD A;  3OSP A;  1Q79 A;  1UEU A;  4YMN A;  4O9M A;  3K75 D;  4DLE A;  3B0X A;  4JWN A;  4M2Y A;  1MC8 A;  4KN4 A;  5KFB A;  4MFC A;  7ICO A;  4F91 B;  3OGU A;  9ICF A;  4QWB A;  9ICM A;  2ZH9 A;  8ICV A;  3EWA A;  4ECS A;  3OHA A;  3C2M A;  4F4Y A;  7ICM A;  8ICX A;  2BE3 A;  3RB6 A;  3RJJ A;  3Q8K A;  2BCQ A;  4BXO A;  4P4P A;  3PX6 A;  2JEJ A;  1KFT A;  3RRH A;  4RPZ A;  4ED2 A;  2UVV A;  1NK8 A;  3EZ5 A;  5J0S A;  4KMU A;  4F92 B;  1KSP A;  1S10 A;  3ZDC A;  5DBC A;  3C66 A;  3AQK A;  4FH5 A;  3PR4 A;  9ICP A;  1RYS A;  4JV2 A;  5HML A;  4F50 A;  4I2G A;  3GV5 B;  5DQH A;  2C22 A;  2HHP A;  5KT3 A;  2VAN A;  2DPJ A;  4RQ5 A;  4ELU A;  2FLN A;  2W9C B;  3FDS A;  2ZJA A;  4FBT A;  3BQ2 A;  1NKE A;  2HW3 A;  4Q8E A;  2FMP A;  2UVW A;  5KFY A;  3T5L A;  4DSE A;  3V72 A;  4J9O A;  9ICA A;  5DGB A;  4EZ9 A;  2MUT A;  1TAQ A;  1UT8 A;  4M6W A;  4RNO A;  4IQV A;  2W9A A;  5KFA A;  4ECT A;  1ZET A;  4DSL A;  4KLI A;  4FHP A;  1BPB A;  1IM4 A;  1S0M A;  4RT3 A;  5KFX A;  8ICF A;  1KDH A;  1NK0 A;  1TK0 A;  1FA0 A;  1JXE A;  7ICR A;  2ID1 A;  2Q0Z X;  4WC1 A;  2ZH1 A;  5IIJ A;  4BGD A;  1JAJ A;  1MQ2 A;  4WC2 A;  4F4K A;  4Q8F A;  1Z00 A;  1ZQE A;  5KG5 A;  4YXJ A;  1XSP A;  3RJK A;  9ICI A;  1S76 D;  1U4B A;  5DG8 A;  7ICF A;  2A1J B;  3OVA A;  7ICE A;  4I2D A;  1JMS A;  4RQ2 A;  2AGP A;  3OV7 A;  2ZH6 A;  9ICO A;  3NTU A;  2ZUB A;  1U9L A;  4ED1 A;  1S0O A;  4WC0 A;  4AT7 A;  3OSN A;  1L3T A;  1ZQI A;  1S0N A;  4UB3 A;  3MFH A;  1MQ3 A;  1ZJM A;  1T7P A;  4P2H A;  2IBK A;  5HRK A;  3RR7 A;  4ATB A;  8ICG A;  1BPX A;  2PI5 A;  5DQG A;  2KZZ A;  3PVX A;  3RH4 A;  4PH5 A;  5HRE A;  2ZH3 A;  4XUS A;  3MR6 A;  4I27 A;  1Z3E B;  3JPO A;  4C8O A;  4M47 A;  3GFK B;  4M0A A;  1MSW D;  1U47 A;  4J9M A;  2RDJ A;  3WFP A;  2R8G A;  2W9M A;  4EBC A;  4YQW A;  4YCX A;  3BJY A;  4EZ6 A;  5KT5 A;  2OWO A;  1L3V A;  5BPC A;  2BDP A;  3RBE A;  5J0T A;  4Q43 A;  4I29 A;  1ZYQ A;  2HHS A;  1R89 A;  4DF4 A;  1ZQS A;  4O0I A;  5L1J A;  1RZT A;  2C2D A;  2ISO A;  4O3R A;  8ICR A;  1V4A A;  9ICT A;  3V7K A;  1KNY A;  7ICP A;  5KFP A;  1N48 A;  3K4G A;  5KFQ A;  2BPF A;  4UD4 A;  4RUA A;  3V7L A;  3HIY A;  2ZH4 A;  4UAW A;  3MDC A;  4RQ7 A;  4KIT B;  8ICI A;  3UXN A;  2XCA A;  4KLL A;  4R8U A;  4F2R A;  4PGX A;  2Y1J A;  4F4W A;  4KLM A;  2HHX A;  4QZG A;  3MBY A;  4DSF A;  5KFG A;  4X5V A;  1T3N A;  4GC7 A;  3V6K A;  4Z6D A;  3C23 A;  1QTM A;  4K4I A;  5DB8 A;  3EW9 A;  8ICZ A;  3L9D A;  3OVS A;  4XA5 A;  3MAB A;  5HNK A;  4E0D A;  4PHD A;  1H38 A;  2PFP A;  3ISC A;  4F3O A;  3H37 A;  4ECQ A;  5KFW A;  3QEB Z;  1KTQ A;  2NRX A;  4YXM A;  1ZQF A;  1ZQG A;  3PY8 A;  1T4G A;  1B43 A;  4MFA A;  3C5G A;  5DB6 A;  1XC9 A;  1U48 A;  3GII A;  1S9F A;  4S3N A;  1VFG A;  3JPN A;  2J6U A;  3EYZ A;  2ZJ5 A;  2M2U A;  4UBB A;  4DF8 A;  4KLD A;  2HHU A;  3UPQ A;  1WOT A;  8ICL A;  4I2F A;  3H4B A;  2ZTD A;  4O5C A;  1ZQN A;  3UQ0 A;  4P4M A;  2FMS A;  4TUR A;  4ECZ A;  2FLL A;  4KLE A;  1BNO A;  3RH6 A;  4I2B A;  5KFU A;  2KP7 A;  4YG2 A;  4QZE A;  4QWE A;  4F5O A;  4TUQ A;  9ICH A;  3H8S A;  2C2R A;  2V4R A;  2ZJ8 A;  4M9H A;  4QZI A;  5KG7 A;  5KFH A;  4NM2 A;  5KFE A;  1B22 A;  4DQP A;  3Q8L A;  5J0U A;  1X9W A;  4WCW A;  1MIW A;  2M9N A;  3KHL A;  5KFT A;  5TZV A;  4ED3 A;  1SL1 A;  5DBA A;  2ATL A;  4J9R A;  4O3N A;  5KT7 A;  4K4G A;  4RWO A;  3EPI A;  1D8L A;  5J0Y A;  1ZQY A;  1XSL A;  2ZTC A;  3Q8S B;  2Y1I A;  4M04 A;  4RNN A;  1C7Y A;  2IHN A;  4DS4 A;  3TAP A;  4DEZ A;  1JIH A;  1WCL A;  5DB7 A;  4Z6F A;  4GXI A;  4EBE A;  4DFM A;  3PW7 A;  7ICU A;  5CA7 A;  4TQS A;  4RNM A;  1DK3 A;  1UET A;  1HUZ A;  3G6V A;  4JWM A;  4EBD A;  5EWF A;  4DO9 A;  1BPZ A;  2I9G A;  3JPR A;  3GIM A;  4IQT A;  4UB5 A;  5KT2 A;  1D9D A;  2NRT A;  2R8J A;  4TUS A;  4YN4 A;  3QZ8 A;  2AGQ A;  3H39 A;  5KG2 A;  5J2K A;  4LZG A;  3PX4 A;  1L3S A;  1JQR A;  1ZQV A;  5DQI A;  3RB4 A;  2BR0 A;  1R8C A;  5HHI A;  1XO1 A;  2DFL A;  4YMO A;  3M8S A;  3WFR E;  5EWE A;  3UXP A;  2XGP A;  3ZDA A;  4IG8 A;  4Z6C A;  1NJW A;  4KLH A;  3KTQ A;  4NKT A;  4PGQ A;  2BQ3 A;  2HHT A;  2ZH7 A;  4XQ7 A;  5KFJ A;  5CB1 A;  5CWR A;  2P66 A;  4QZD A;  2W8K A;  2ZUC A;  4EBJ A;  1UT5 A;  4B9S A;  7ICT A;  5J0X A;  4M9L A;  1NJY A;  3HX0 A;  1JX4 A;  1ZQJ A;  4PPX A;  1JXL A;  2BHN A;  3OUY B;  4GLX A;  4RQ0 A;  2BGW A;  9ICW A;  3QZ7 A;  4X4P A;  3GDX A;  1TKD A;  5BOL A;  4ECU A;  4AT9 A;  1OU5 A;  3M8R A;  1TK5 A;  1ARO P;  4X0B A;  4GC6 A;  1R8A A;  2FLP A;  4CCH A;  4DS5 A;  8ICJ A;  9ICL A;  4QZB A;  1PX5 A;  1ZQR A;  1T8E A;  4WC5 A;  1SKR A;  4RUC A;  4P4O A;  1L3U A;  5HRB A;  1D9F A;  4RPY A;  2R8I A;  4IR1 A;  4C8M A;  4ECY A;  5J2J A;  1DK2 A;  2H5X A;  5KFC A;  3SV4 A;  9ICR A;  4ED6 A;  4WBY A;  4M5D A;  3PML A;  2XY5 A;  3ZD9 A;  2BCV A;  4B9T A;  3RB3 A;  2DR7 A;  4QW9 A;  4FS1 A;  2J6S A;  3IM1 A;  4JUZ A;  4IRC A;  1QSS A;  4X4O A;  1NK9 A;  3SI8 A;  1ZQL A;  1F5A A;  3G6Y A;  4DFK A;  4LT6 A;  3JPQ A;  4DQS A;  1S77 D;  5J2C A;  3SYZ A;  3N97 B;  3PW4 A;  2PXI A;  5KFR A;  1X9S A;  4LVS A;  4PHE A;  5C5J A;  2BKE A;  3GV7 B;  3TFS A;  3GV8 B;  4EEY A;  2DPI A;  3N4M B;  2DR9 A;  4YFK A;  4DOB A;  4UB4 A;  1ZQZ A;  2V4Q A;  1ZQD A;  3HJ1 A;  1UEV A;  4EYH B;  2O5A A;  4R65 A;  2FPK A;  3RJF A;  3PO4 A;  1A76 A;  5J29 A;  3WFO A;  4RWN A;  2GWS A;  8ICN A;  2B21 A;  3FYH A;  7ICH A;  2FMQ A;  2ZH2 A;  1HUO A;  4BWM A;  3ZDD A;  2RFF A;  1LV5 A;  3ISB A;  4KTQ A;  5HRG A;  4WC3 A;  2W9B B;  1N56 A;  1ZQH A;  3T3F A;  5DG9 A;  4HYK A;  1DGS A;  2AQ4 A;  2R8H A;  5DG7 A;  2ZHB A;  5KFI A;  2PBE A;  3PW5 A;  5IIM A;  2JZB B;  4KLQ A;  4AT8 B;  1K1Q A;  4X4R A;  3SZ2 A;  8ICP A;  1TFW A;  3TAR A;  4XRH A;  2LYH A;  4TUP A;  4I28 A;  5J0R A;  9ICK A;  4MEY A;  3AQL A;  3TFR A;  4UD5 A;  4KLJ A;  1RPL A;  4WC4 A;  3V6J A;  4YR0 A;  4YMM A;  3THV A;  8ICY A;  5DGA A;  4IQW A;  2WTF A;  3HW8 A;  3RB0 A;  4XQ8 A;  3QEA Z;  1NK7 A;  4NY8 A;  4KLS A;  4QZC A;  2ZTE A;  3JPT A;  4J9P A;  3LDA A;  1S0V A;  2AJQ A;  3LWM A;  4MF2 A;  4K4H A;  4QWD A;  2JEF A;  3BQ0 A;  3KHG A;  1YLQ A;  4R63 A;  3AQM A;  7ICJ A;  5F9L A;  4F4Z A;  5KFL A;  8ICK A;  5HP4 A;  2ASL A;  1CUK A;  2R8K A;  2Q66 A;  9ICQ A;  2NRZ A;  5J0O A;  3ZD8 A;  3WFS C;  4PGY A;  1BPD A;  4O3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...