4O5EA

Structure of human dna polymerase complexed with n7mg in the template base paired with incoming non-hydrolyzable ttp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
molecule keywords DNA polymerase beta
molecule tags Transferase, lyase/dna
source organism Homo sapiens
total genus 103
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o5eA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4o5eA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4o5eA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4o5eA03
3JPQA 2LYHA 3HW8A 1HUZA 5L9XA 1BPEA 4PGYA 5BPCA 4DOBA 3RR7A 5HR9A 5DG7A 1IXRA 1C7YA 9ICUA 5KFTA 5KFPA 4RNNA 4KLMA 1NK7A 2FPKA 4KN7A 4YP3A 3UPQA 2NRVA 4TURA 4MFCA 2KZMA 4TUQA 4EZ9A 4QZHA 1EXNA 4WC4A 1ZQRA 4O9MA 4AT8A 5KFDA 4R64A 4I28A 9ICPA 4EP7A 5J2GA 2HHUA 5KFFA 2HHWA 7ICEA 1Z3EB 7ICGA 4J9OA 3THVA 2BHNA 4KITB 1TK0A 5CJ7A 4I29A 3UPSA 2J6SA 7ICRA 3H40A 2HHVA 5HRLA 3PW5A 4B9TA 2R8KA 4RWQA 1TFWA 9ICIA 2UVWA 4QWCA 2P6UA 2VA3A 4KTQA 1ZQJA 5L1JA 4RQ5A 5DLFA 1ZQIA 3ISBA 3KTQA 9ICWA 5IIIA 3ZDDA 2M2TA 4GC6A 3MFIA 1SKRA 2MUTA 1HUOA 3KHHA 2ZH8A 1SZPA 2ISOA 4M6WB 1NKBA 3MDCA 4NLZA 8ICYA 3GIMA 4O3PA 4AT9B 4MFFA 2HVIA 1F5AA 1ZQZA 3IM1A 5IIJA 3WFPA 3AQMA 4RNMA 1TK8A 2BPFA 1VJ7A 3QEBZ 8ICBA 4NM1A 4I2JA 1R89A 3TARA 4ZH4A 4ECUA 3T5KA 8ICHA 4X4UA 2DR5A 5CWRA 3RH4A 1ZQAA 2B21A 2NRTA 2UVUA 9ICRA 4M47A 4O3SA 2ZUDA 3T5JA 5KG2A 5IIOA 5J2IA 2I9GA 2C2RA 3C1YA 4F8RA 5HRHA 3PW4A 5HHHA 3MGIA 3JPTA 2BDPA 4QZCA 3OVSA 1U49A 3PO5A 5L1LA 4XQ7A 4DL3A 2ZH6A 1BPDA 4P4PA 3GDXA 1ZQDA 4MFAA 4RWNA 4X4RA 4IR1A 3UQ2A 4ECVA 2JEFA 5DQIA 4YMNA 5J0RA 2XY6A 4DF8A 1RYRA 3TQ1A 5J0TA 2RFFA 2HHTA 1A76A 3RB3A 2AGQA 1TAQA 4GXJA 4GC7A 4F93B 3PX0A 1ZQNA 3G6VA 2A1JA 1ZQCA 2UVRA 5KFGA 4KLIA 3B0YA 4Q43A 4J9SA 4I2EA 1ZQTA 1A77A 5KT3A 1QSYA 4I2DA 4JV0A 1ZQUA 3PR4A 8ICXA 4DQIA 5J2CA 4UB2A 4YR3A 2Q0ZX 1T4GA 2AGPA 9ICOA 4ED0A 4F3OA 4ECYA 5HRKA 3M9MB 2PFPA 4M9HA 3PW0A 4S3NA 4DSEA 3ISCA 2KZ3A 4IQVA 1LV5A 1BNOA 3KHLA 1NZPA 5J0QA 4YMOA 4KLQA 1T8EA 1KFTA 3Q8MA 5DECA 1XU4A 4YXMA 4DSIA 1QSLA 2ZUBA 4WC3A 2JEJA 5KFBA 2C22A 3PO4A 3Q8PB 7ICJA 8ICQA 2XCPA 2DPJA 3RJGA 2AJQA 5J2DA 5KTQA 5BOLA 2IBKA 3RR8A 3AU2A 2WTFA 4BXOA 2IHNA 5BOMA 4M9LA 1R8CA 4UBCA 3NTUA 3OJSA 1X9WA 4F5QA 5DB6A 1TAUA 1TFYA 1S77D 4NM2A 2ZH9A 3OGUA 1KTQA 1XWLA 2KFNA 3MR3A 2KZZA 2HW3A 4NKTA 4AT8B 9ICJA 3EPGA 4JUZA 1ZQFA 1NK9A 4GXKA 4DQPA 2ZUCA 3KHRA 5DGAA 1ZQGA 2BCUA 2BCVA 2P66A 4LZDA 4YVZA 3V6JA 2W9MA 4LZGA 2BGWA 4NKUA 1V9PA 5J2BA 4WC5A 5D4BA 4DQRA 1B22A 5KG6A 2ASDA 2ZJAA 5HRBA 4DFKA 1JAJA 2XY7A 1RZTA 3GFKB 5J2EA 5KFSA 3KHGA 4R63A 3RB6A 4M5DA 3FDSA 1BGXT 3PR5B 2HHQA 3SV3A 4X4TA 2BCQA 2W8KA 3B0XA 3LDAA 3SYZA 4R66A 3AQKA 1U45A 5IIMA 5DB7A 4RPYA 4PHDA 2ZTDA 2R8HA 3RJHA 4I27A 5J0UA 2MUTB 8ICPA 3T3FA 4JWNA 4BGDA 3MDAA 1JN3A 9ICCA 1U47A 3Q8LA 4WCWA 2BE3A 4DQSA 4X4OA 3M9NB 4DS4A 2BPGA 4RU9A 5KFNA 3G6YA 7ICKA 1OU5A 4JK1A 4RT2A 2XCAA 2W8LA 3V72A 4ECRA 3C2LA 3RRHA 1XSLA 1ZQBA 1L3SA 1T7PA 3BDPA 4M04A 1KFSA 4X4QA 3PMNA 2DRBA 1ZJMA 4FBTA 9ICLA 4X4NA 5CB1A 3C2MA 4Z6CA 2ISPA 5KFIA 1DK2A 1KNYA 4F92B 2PFOA 3OVBA 4KLJA 4PPXA 1ZQPA 1YLQA 5CHGA 4RQ1A 9ICMA 3AQLA 3PV8A 3N97B 2XO7A 1X9SA 4C8LA 5KFAA 4Q44A 3NGDA 3Q8QB 5J2HA 4ED2A 3RBEA 1X9MA 1SKWA 3JYYA 4UB3A 1B43A 3UQ0A 3T5HA 1TVAA 4B9MA 3M9OB 3HWTA 2DRAA 3OUYA 3LK9A 4WC2A 4EYHB 1SKSA 2F1HA 2VA8A 4X5VA 4X4VA 4NLGA 2KP7A 3GV5B 4YFKA 2KTQA 2JEIA 1MC8A 4QZ9A 9ICEA 5DKWA 8ICRA 4O3RA 2A1JB 1S0MA 1H38A 1JIHA 4J9KA 4YD1A 4RUCA 2Y1JA 4C8KA 1BVSA 5KG0A 4YN4A 3OSPA 4EBEA 1NK0A 4M9JA 1V4AA 2HHSA 2Q66A 4GLXA 8ICEA 4RQ7A 4ED8A 3H4DA 1NKCA 5KFWA 4YQWA 3BQ2A 4Q45A 3V7KA 4F4KA 5DEDA 3V7LA 1ZQLA 5HRIA 2DR8A 4UB5A 3MR2A 4RPZA 1S9FA 4B9VA 3H39A 3Q8SB 2ZH2A 1RYSA 5KFQA 3WFSC 1DGSA 4ECQA 3IHQB 4E7XA 7ICTA 5KT6A 4ED6A 5J2AA 4QZIA 1Q78A 5DBAA 3N4MB 1K1QA 3UXOA 3AUOA 1XSNA 4IRCA 4KLHA 7ICSA 1NK8A 4BXOB 2J6TA 2KFZA 8ICIA 4DSLA 4WBZA 4I2FA 4EBKA 3ZD8A 4M9GA 4UAWA 3JZ0A 3ZDEA 4ED3A 3T5LA 4ED7A 5KG3A 2M2UA 2AU0A 1ZQOA 3BQ0A 4EYIB 2RDJA 4ECWA 1U9LA 5L1IA 4QZAA 1QSSA 4QWAA 5D49A 1UA0A 1S97A 3MR6A 2FMQA 4I2HA 4RWOA 1WOTA 5KFVA 5KT7A 3Q8RB 3M8SA 1JMSA 2ATLA 1FA0A 1R8BA 2PBEA 4CCHA 8ICOA 4ECZA 3GV7B 4C8OA 2FLLA 4IRKA 5KFHA 2XGPA 3C5FA 4JV2A 2PI4A 1Y88A 1PZNA 5J0YA 5KFZA 3ZDBA 3C1ZA 4YXJA 3QEAZ 2Y1IA 3QZ8A 5KFCA 1L5UA 4QZEA 2ZHBA 5J2KA 4J9NA 3V6HA 5CR0A 4DSKA 9ICAA 3H8WA 5DB9A 4BDPA 3G6XA 5KFOA 4DFJA 4ECXA 2R8GA 9ICNA 2P6RA 8ICGA 5C5JA 5KG7A 3GILA 2VANA 2FMPA 2R8JA 9ICTA 4FHPA 4E80A 1NOMA 5HP4A 2ZH5A 1ZQHA 3ZDCA 3RAXA 1ZJNA 4XQ8A 1ZQWA 3GIIA 4KLTA 5D46A 5HRDA 4RQ0A 4O5KA 3E2EA 4TQRA 2O5AA 2UVVA 4DEZA 5HRGA 3K4GA 4ED1A 3TFSA 4XRHA 2IHMA 5KFYA 4O0IA 1NK6A 9ICFA 9ICQA 2DR9A 2ZTEA 5EOZA 5EWEA 4RQ2A 3HJ4A 3GV8B 1MIVA 4O3OA 5DB8A 1UEVA 4E8FA 1COOA 4FHVA 3ZD9A 1ZQKA 2BKEA 2ID1A 4G3IA 4FS1A 4KN4A 1K1SA 1TV9A 4DF4A 1LB2B 3LQCB 4C8MA 2FLNA 5KFKA 2W9CA 1KLNA 3H3AA 4YR2A 3PW2A 4NLNA 3OUYB 2I1QA 2PXIA 1L3VA 4PHEA 4O5EA 5DLGA 1SL2A 4O5CA 2DR7A 2NRXA 4F4YA 4J9PA 4NY8A 9ICXA 5HMLA 2BQUA 1QTMA 5DDMA 2BCSA 4IRDA 1TFRA 1JQRA 2F1IA 4ECSA 8ICSA 4E0DA 5EWGA 4DSFA 3TAPA 1UEUA 4DL6A 9ICHA 2FPLA 2ZJ8A 2AQ4A 5F9LA 4KLDA 3EW9A 4M2YA 4YMMA 2ZTCA 1VFGA 3RJFA 2HHXA 1ZQVA 4J9QA 3H7IA 4TUSA 2DPIA 2PFNA 5KFUA 1KDHA 3EYZA 5J0XA 4B9UA 8ICCA 4KLFA 4QWBA 1S10A 7ICLA 4K4IA 1UT8A 4KLLA 2O1PA 4GXIA 4F91B 1XS9D 1BPZA 2XC9A 4M9NA 1ZQMA 3V6KA 3EWAA 5DG8A 1IM4A 2V4RA 3JPOA 2FPMA 2V4QA 3JPSA 4RPXA 3JPRA 5KFLA 3JPNA 4PHPA 4F5PA 3PW7A 5KT4A 1D9DA 2M2WA 2NRKA 2VA2A 1HJPA 3MGHA 5HREA 1UETA 4EEYA 4WC6A 2ZH3A 2ZH4A 4RUAA 2BQ3A 3H8SA 4Z6EA 4DLEA 3HX0A 3OVAA 3RJEA 3H38A 3RH6A 2W9BA 7ICMA 9ICVA 2BPCA 1KSPA 1ZQYA 1TK5A 5HNKA 3EZ5A 1JX4A 4P4MA 3OJUA 4UAZA 1S0VA 2AGOA 3QZ7A 1MQ3A 1ZQQA 1BPBA 3QE9Y 2PI5A 1NKEA 4F2RA 4X4SA 3OSNA 4NXZA 4O3QA 2ASLA 3JPPA 3HPOA 2OWOA 4ELUA 4ATBA 4X4PA 2XY5A 2ZHAA 5KG4A 8ICMA 3PMLA 4QWDA 1XC9A 4J9MA 4IQWA 3GIKA 8ICFA 4XUSA 1ZQSA 4TUPA 5DBCA 4QZFA 1L3UA 4MF8A 4AT7A 1MSWD 2NRWA 5KG1A 9ICSA 2M2VA 4PHAA 4QZ8A 5F9NA 5L1KA 4LT6A 4DL5A 1NJWA 3RJIA 3GQCA 5J0PA 3TFRA 5DQGA 3MBYA 3V7JA 2BQRA 1ZQEA 5IIKA 3NYBA 2BR0A 4KLSA 4F5NA 4B9SA 4B9LA 5J0OA 5KFXA 1NK5A 4RWPA 4BWJA 4KLOA 5KFJA 1Q79A 2C2EA 9ICGA 4X0AA 4QZDA 1Z00A 4FO6A 3PX6A 4KMUA 4Z6DA 3MFHA 4R8UA 1N56A 4RQ3A 4EBCA 1RPLA 1BPXA 3GIJA 4FH5A 3OHBA 3ORYA 4DOAA 1JXLA 1MIWA 5HC9A 3UXPA 7ICOA 5DGBA 4YCXA 4FH3A 2DVIA 3PNCA 3SI8A 3RJKA 8ICZA 4F4XA 4F50A 4F5RA 5TZVA 3C21A 4HYKA 2J6UA 4UD4A 4R65A 1DOQA 3C23A 3K75D 5CA7A 1UT5A 5KFEA 5KG5A 4RQ6A 5CP2A 3M8RA 2JZBA 4DFMA 3AU6A 4DLGA 2H5XA 3RBDA 2C2DA 3LWMA 1MQ2A 2IA6A 1CUKA 3C5GA 7ICHA 9ICKA 3LWLA 3HP6A 2W9AA 5J0SA 4DFPA 2W9CB 4I2AA 4Q8FA 3OV7A 2ZH7A 4PGXA 1SL0A 1S0NA 2BCRA 7ICPA 1JXEA 1WCNA 4QZGA 4I2CA 2JEGA 4BWMA 4MEXA 2F1JA 4IG8A 2NRZA 4FS2A 4DSJA 7ICVA 4KLUA 3WFQE 4DL2A 3TAQA 1DK3A 4EZ6A 7ICNA 1NK4A 8ICNA 5KT5A 4JWMA 5JUMA 1R8AA 7ICQA 4UB4A 8ICAA 5KFRA 3C18A 2ZH1A 1D8YA 4MEYA 4MF2A 3RH5A 4KLGA 2ASJA 1T3NA 3RRGA 5EWFA 1UA1A 4K4GA 3SZ2A 1BPYA 8ICKA 4J9LA 4WC1A 4B9NA 1ZQXA 5DG9A 2R8IA 5J29A 2V9WA 3ZDAA 5IILA 3RJJA 2M9NA 3EPIA 1RXWA 4DWIA 1U48A 3ETLA 4UBBA 2DFLA 5KFMA 4IQTA 2XGQA 4FBUA 2ALZA 4I2BA 4Q8EA 3H37A 1WCLA 4KLEA 4WC7A 3L9DA 2KN7A 4J9RA 3BQ1A 1BNPA 5DBBA 4RT3A 3ISDA 4C8NA 1S0OA 4UD5A 3BQTA 1D9FA 4JV1A 1D8LA 4LVSA 3Q8KA 4WC0A 3UXNA 4M6WA 4UB1A 3AQNA 4RNOA 1XSPA 4FHXA 4AT9A 2HHPA 3RB4A 4ELTA 2W9BB 5F2VO 4F4WA 2GWSA 4NLKA 1KFDA 9ICBA 3TI0A 3MABA 3OHAA 1ZYQA 3H8JA 5HRFA 1NO5A 1X2IA 4ATBB 4F2SA 8ICLA 4I2GA 4IR9A 4DL7A 8ICWA 2PFQA 4F4ZA 4DL4A 4FHYA 1L3TA 4PGQA 4K4HA 4DO9A 4QZBA 2AQ0A 5KT2A 1ZETA 2C28A 3MR5A 4YD2A 8ICTA 2FLPA 4YG2A 5J2JA 1U4BA 4QW9A 2FMSA 4AT7B 4UQGA 1N48A 3WFRE 1NJXA 5HMMA 4RQ4A 5DQHA 4ECTA 3HJ1A 3RTVA 3HIYA 1QLNA 4PH5A 5J2FA 1PX5A 4EBJA 3PX4A 4WBYA 3SV4A 3PY8A 1AROP 5IINA 4O3NA 4X0BA 2HVHA 1Z00B 2IMWP 4YR0A 3WFOA 4R8UB 4M0AA 4FHWA 1S76D 3RAQA 4RZRA 1XO1A 4Z6FA 4XA5A 8ICJA 4F5OA 7ICIA 1KEJA 5DDYA 4P4OA 1MIYA 4I2IA 4TQSA 3TANA 1TKDA 4DOCA 3FYHA 3BJYA 5HHIA 3C2KA 8ICVA 3H4BA 3C66A 1NJYA 4QW8A 4IQUA 8ICUA 7ICUA 2JZBB 2RDIA 4ELVA 3RB0A 1RXVA 1NJZA 4RQ8A 4DQQA 3PVXA 4P2HA 4UAYA 3HT3A 2MAXA 4DS5A 4EBDA 1KRPA 1CEZA 4QWEA 2ZJ5A 7ICFA 1SL1A 5J0WA
chains in the Genus database with same CATH superfamily
3RR7A 4PGYA 4DOBA 2HBKA 5ALQA 4K97A 2ZIWA 1IXRA 1C7YA 1V97A 1B4FA 4EGWA 2AHOB 4RNNA 2Y9UA 1SWWA 2FPKA 4YP3A 4KLMA 4MFCA 2KZMA 4WC4A 1EXNA 4O9MA 9ICPA 5J2GA 1Z3EB 2FCLA 7ICGA 1TK0A 4OAGA 5HRLA 3H40A 2HHVA 1J2NA 3PW5A 3M1YA 2R8KA 4RQ5A 3ZDDA 1NKBA 1Q3UA 4UAUA 4MFFA 2HVIA 2LYAA 2F3NA 1WYGA 1VJ7A 3QEBZ 2HCFA 2KVSA 5ALTA 5B5EU 2WB1F 4ZH4A 5ALVA 4ECUA 2E5SA 3RH4A 4C4RA 1ZQAA 2NRTA 2UVUA 5ALOA 2ZUDA 3T5JA 5J2IA 5AM3A 2C2RA 4F8RA 2GOLA 4EX6A 2G07A 4QZCA 1U49A 3OVSA 2ZH6A 1BPDA 4RWNA 4ECVA 3CRXA 2XY6A 4DF8A 5CFSA 1DGJA 2RFFA 2DUYA 1QH9A 4OD0A 1A76A 4F71A 1TAQA 5KFGA 5KAIU 4I2EA 1ZQTA 5KT3A 4I2DA 1ZQUA 3JCFA 1ZOLA 1KN5A 2AGPA 4K99A 1NNLA 2KZ3A 1LV5A 1T8EA 3QU2A 1QSLA 3PO4A 2Q4TA 3LVWA 3IV6A 4BXOA 2IHNA 3TADC 4OJOA 5DB6A 1TFYA 1SXDA 1XWLA 5AK4A 4NKTA 9ICJA 1NI3A 2BZFA 1ZQFA 5CHEA 2ZUCA 1ZQGA 5DGAA 2P66A 3V6JA 2W9MA 2BGWA 4WC5A 2YMMA 4DQRA 5D4BA 1GPJA 3IDWA 5HRBA 1RYUA 5KFSA 4R63A 1SV0A 2HHQA 4X4TA 2PMZF 2BCQA 3B0XA 3LDAA 2W55A 4JWNA 4WCWA 4BGDA 5ALRA 3Q8LA 3EF2A 2EAPA 3G6YA 1OU5A 1L7MA 1TFWA 3BDPA 4M04A 1ZQBA 3MGVA 1L3SA 1KFSA 4X4NA 2G09A 4F92B 4PPXA 1ZQPA 5C0YA 4RQ1A 3PV8A 3N97B 5J2HA 4Q44A 4ED2A 4UB3A 3M9OB 3HWTA 3LK9A 1M6YA 2AXTU 4X5VA 5AKJA 4YFKA 2KTQA 2KIVA 4QZ9A 4G9BA 2Y1JA 1FFVA 2K89A 1BVSA 3C29A 4YN4A 5AHXA 4GLXA 8ICEA 4ED8A 5AM1A 2DF4B 5D61A 2KE7A 3UMBA 4UB5A 1RYSA 1DGSA 4E7XA 5KT6A 2KHVA 4QZIA 2ZIUB 3N4MB 4QIWC 1MN8A 3UXOA 1NK8A 2J6TA 2KFZA 1ZD2P 1O08A 4RQMA 1XO0A 1ZQOA 2RDJA 1U9LA 1YZ6A 2K8BB 4QZAA 5D49A 5B3QA 1UA0A 1S97A 3AQFA 2FMQA 3I1YA 4RWOA 1AQ6A 4CE6A 2KMDA 3HKZC 4C8OA 2FLLA 3L3FX 3N7SC 1RM6C 1Y88A 2B56A 5KFZA 4YXJA 1SXEA 4FZNA 5KFCA 1L5UA 2ZHBA 5AK3A 5J2KA 3H8MA 2R8GA 5KFOA 4K9AA 1LKYB 5C5JA 1FO4A 3PSIA 2HOQA 2BBJA 5GTHU 4WQLA 4ED1A 4XRHA 2IHMA 1NK6A 9ICQA 4RQ2A 5EWEA 2YB1A 3IG5A 3F5EA 4ZOHC 1MIVA 4E8FA 1COOA 2HBJA 3ZD9A 2JH7A 2BKEA 4G3IA 4KN4A 4YR2A 4IS7A 2PXIA 4NLCA 4PHEA 4WH5A 2NRXA 4J9PA 1JRPA 2E1FA 4E0DA 3TAPA 1UEUA 5F9LA 4IL6U 2ZTCA 1VFGA 2HHXA 4JB3A 2PFNA 4EELA 1JUDA 3M6KA 4KLFA 1DRGA 4KLLA 4GXIA 2XC9A 1L7PA 2FJ6A 2RP5A 3BZCA 2JMGA 3JPOA 1PK3A 2V4QA 3JPSA 5KAFU 3JPRA 4AP9A 4PHPA 2KJ9A 5HREA 4EEYA 5AI8A 4RUAA 3H8SA 4Z6EA 4DLEA 2O6KA 7ICMA 2WFAA 1GO3F 4CRXA 1S0VA 2AGOA 3QZ7A 4O3QA 2ZHAA 2D8CA 4ELUA 1DXSA 8ICMA 4Y2TA 5AKZA 3SAFA 5H2FU 3ZI4A 4TUPA 1L3UA 4MF8A 5ALYA 9ICSA 1S8OA 1T94A 4PHAA 2M2VA 5F9NA 2CXYA 1NJWA 4ACOA 5J0PA 3GQCA 3PSFA 1SWVA 4B9LA 2C2EA 9ICGA 4X0AA 4FO6A 3TADA 3PX6A 3MFHA 1FFUA 4FH5A 1JXLA 1MIWA 3PNCA 3RJKA 8ICZA 4F50A 3M6ZA 4UB6U 5CA7A 1ZQJA 3I76A 1YLQA 4IC9A 3C5GA 2K4PA 3T79A 4DFPA 2W9CB 5J8YA 1SL0A 3NASA 1WCNA 4I2CA 2KV2A 4IG8A 2QB0B 1C20A 1NK4A 5KT5A 4EV6A 4JWMA 5JUMA 4F72A 4UB4A 1D8YA 4KLGA 5EWFA 3A0BU 1UA1A 2LMRA 3SZ2A 3NRWA 5AM0A 3ZDAA 4DWIA 3K1ZA 4UBBA 3KOOA 4I2BA 4Q8EA 1WCLA 2ZXIA 1BNPA 3KKAA 1N62A 5AKGA 3CK6A 2NO4A 4RNOA 3AL0B 9ICBA 3MABA 3OHAA 1UQVA 2LM1A 1VDVA 3H8JA 3CP8A 4F2SA 3CNHA 4IR9A 4DL7A 4OJ5A 1P7DA 8ICWA 4PGQA 4K4HA 4QZBA 5KT2A 2WB1C 2C28A 3NVOA 2FMSA 1Z1VA 4QW9A 3WFRE 5HMMA 2YN4A 4ECTA 3RTVA 3HJ1A 2A1AA 1L7NA 4EBJA 3PY8A 1AROP 4O3NA 3QUTA 1Q8KA 4R8UB 4OJLA 8ICJA 2IHOA 4P4OA 2F76X 4I2IA 2NYVA 3H4BA 3WKBA 2RDIA 1S5LU 4NL9C 1CEZA 2MAXA 3SMVA 4QWEA 4N7RA 5L9XA 1BPEA 5BPCA 5DG7A 2EZZA 3QU9A 5KFPA 2Y0SF 1X6JA 3VCBA 4TUQA 4EZ9A 3OWGA 4EP7A 2HHUA 2HHWA 7ICEA 3D2SA 4J9OA 4UASA 5CJ7A 4U6PA 4I29A 3H0LB 4QWCA 2P6UA 5DLFA 3F5AA 9ICWA 3ISBA 3KTQA 4GC6A 1HUOA 2ISOA 2AH5A 4M6WB 4K8VA 3WFPA 3AQMA 1TK8A 2NO5A 2BPFA 2D6FC 1WUDA 4I2JA 2IOFA 4WJ3B 1R89A 3TARA 4X4UA 2KSOB 2B21A 1K5OA 1PUZA 2KG5A 3AQEA 3ALRA 3C1YA 3PW4A 4XQ7A 4DL3A 5AM4A 2JEFA 2WAQF 1ZRNA 3TQ1A 5J0TA 2HHTA 3N7PD 3PX0A 4Q43A 1OW5A 1A77A 1KW4A 5AI0A 4ED0A 4J03A 4ECYA 5HRKA 4S3NA 4DSEA 4IQVA 2XIDA 1KFTA 3Q8MA 5DECA 1XU4A 2K60A 2F2AB 2C22A 3Q8PB 2ZIUA 2EH9A 2DPJA 3RJGA 5J2DA 5KTQA 2IBKA 3KBBA 2GH1A 5BOMA 3NTUA 1TAUA 3QUBA 1S77D 4NM2A 2ZH9A 3OGUA 2KZZA 4Y2VA 4EX7A 1Z19A 2G5HB 3EPGA 3KHRA 2JV3A 3NUQA 5KG6A 4DFKA 1RZTA 3GFKB 5J2EA 4M5DA 5AICA 1X66A 4KX5A 1Z4NA 3QYPA 3WU2U 5IIMA 4PHDA 4KM5A 2ZTDA 2R8HA 5J0UA 2MUTB 1LKYA 2K8AA 3TACB 3WKCA 2BE3A 4USAA 3M9NB 4DS4A 2BPGA 3WKAA 4BX9C 5AKYA 1WG8A 5KFNA 7ICKA 3NYBA 4ECRA 3V72A 4X4QA 2DRBA 4FBTA 9ICLA 4Z6CA 1DK2A 3BS5A 1L7OA 4O6AA 3OVBA 3QXGA 3AQLA 3SEIA 4C8LA 4DCCA 4GFJA 1X9MA 1SKWA 3JYYA 3RBEA 5ALLA 3UQ0A 3T5HA 2DRAA 2LPEA 5T14A 5ALHA 1MC8A 4O3RA 2A1JB 1S0MA 1H38A 1JIHA 3QU7A 2E8NA 5KG0A 1NK0A 1V4AA 2F77X 3H4DA 1N5WA 4Q45A 3UMGA 3V7LA 3FAHA 3MR2A 4RPZA 3QUQA 1ED1A 4NXXA 3IHQB 4JLZA 1COKA 4ED6A 4NXVA 7ICSA 8ICIA 2KHQA 5EE9A 2YMQA 4DSLA 3ZD8A 4UAWA 1ZRMA 2D3DA 5ALUA 4ED3A 3QU5A 4ED7A 4UW9A 5L1IA 1QSSA 4QWAA 3MR6A 5KFVA 5KT7A 1JMSA 2ATLA 1FA0A 1R8BA 4C0ZA 2WF6A 1HIWA 3GV7B 2FE9A 1PZNA 3ZDBA 1WWUA 2WF5A 3C28A 4J9NA 3V6HA 4DSKA 4BDPA 5DB9A 3G6XA 2H3IA 3GILA 1NOMA 3ZDCA 3NKUA 2EQYA 5AKHA 5JTGA 4TQRA 5HRGA 2PBEA 4Y2PA 3TFSA 5KFYA 2VIXA 3S6JA 5EOZA 5AI6A 4O3MA 2GA9D 4O3OA 3ONNA 4FHVA 4BUGA 1ZQKA 1O03A 1TV9A 1LB2B 3LQCB 5KFKA 2W9CA 1KLNA 3WK7A 3PW2A 3OUYB 1SL2A 2QB0A 4CF5A 1TFRA 1JROA 3ED5A 4ECSA 5EWGA 4DSFA 5JU5A 2E8MA 1QQ7A 9ICHA 2FPLA 2ZJ8A 4YMMA 3RJFA 1ZQVA 4J9QA 4TUSA 4B9UA 1KDHA 3EYZA 5J0XA 7ICLA 4PZNA 1BPZA 4M9NA 1ZQMA 3V6KA 5DG8A 3PHZA 2FPMA 2W04A 2NV3A 4ICAA 4RPXA 2DWQA 2QARB 5KFLA 2M2WA 2Q66A 2A3VA 2NRKA 2VA2A 1HJPA 1UETA 2OM6A 2BQ3A 3HX0A 3RJEA 2MA1A 1N63A 1ZD4A 2BPCA 1KSPA 3NVVA 5AKKA 3EZ5A 1JX4A 1MQ3A 1ZQQA 1BPBA 3QE9Y 1UCVA 4UARA 3WK9A 4F2RA 4OAHA 3OSNA 1RQLA 1J2MA 5CFUA 4NXZA 5KL8B 3JPPA 5KG4A 3PMLA 2KD1A 8ICFA 1SV4A 4XUSA 3WK4A 4LT6A 1X9XA 3TFRA 2BQRA 4NJ8A 1UPHA 2XICA 2BR0A 4F5NA 4QJFB 4RQNA 4KLOA 1N5XA 3FM9A 1Q79A 1N56A 2AJQA 4Z6DA 4R8UA 4CF3A 4EBCA 2GO7A 3GIJA 3ORYA 5DGBA 4YCXA 1IG6A 3SI8A 2WF8A 4NWIA 5TZVA 4UD4A 2J6UA 3K75D 1UT5A 5KFEA 3M8RA 4RQ6A 4DFMA 2YMLA 1MQ2A 3F2BA 3LWMA 4OJPA 2CN1A 1RQNA 4I2AA 5JRTA 3L5KA 4XJEA 3OV7A 2ZH7A 2OYYA 1S0NA 7ICPA 1JXEA 4QZGA 4EEKA 1IIPA 4FS2A 4DSJA 2LBOA 1DK3A 8ICNA 4FZMA 4DFDA 1R8AA 7ICQA 2W7PA 2I6XA 4MEYA 4MF2A 3RH5A 2ASJA 2Y0SC 4WC1A 1ZQXA 2KK0A 3NWIA 5J29A 2V9WA 2JH1A 2M9NA 2LKYA 3ETLA 2EWRA 4FBUA 5KFMA 3N28A 4IQTA 2XGQA 2ALZA 5G5HA 2KN7A 2YX8A 4RT3A 3ISDA 4UD5A 1D9FA 5AIAA 4WC0A 2FDRA 4M6WA 5AI9A 1SIJA 3AQNA 2QKQA 1XSPA 4FHXA 4EEBA 4ELTA 1SGGA 5KL1B 2W9BB 5F2VO 4F4WA 2GWSA 2P35A 2ZG6A 1ZYQA 2KSOA 4UATA 8ICLA 4FHYA 2PFQA 4DL4A 2AQ0A 4YG2A 1U4BA 4CDGA 3NVZA 1N48A 1RG6A 2BDUA 5ALSA 1NJXA 5DQHA 3HIYA 2KVCA 4LJXA 4PH5A 5J2FA 1PX5A 4LEWA 3PX4A 4A8EA 5IINA 4P0QB 4YR0A 1S76D 3RAQA 2WAQC 4RZRA 1XO1A 4F5OA 2JR5A 2VKQA 3FC4A 4DOCA 8ICVA 3CW2C 4IQUA 8ICUA 2JZBB 4ELVA 1RXVA 1NJZA 4DQQA 3U26A 2YY6A 4O68A 1KRPA 3RF9A 2ODGA 4HAIA 4F3OA 2LYHA 5ALWA 5HR9A 3RFAA 9ICUA 1RDFA 4P0PB 2G0AA 2NRVA 2GLEA 5HR6A 1UHUA 4R64A 5KFFA 1MA7A 3THVA 4KITB 4B6JA 1Q3VA 4Y2QA 1ECWA 2E8PA 4O69A 4US8A 4B9TA 4RWQA 2UVWA 2OCEA 1ZQIA 2M2TA 1SKRA 2MUTA 3KHHA 2ZH8A 1SZPA 2ZIVB 3QUCA 4O3PA 1F5AA 3IM1A 1A6SA 4RNMA 5AK5A 4AYBF 3ERCC 8ICHA 3H0RB 2RQ5A 2DR5A 3M7DA 5KG2A 5HRHA 3SQIA 2EZXA 3MGIA 3JPTA 2BDPA 2OEHA 2ES6A 3OTQA 4P4PA 1V38A 4MFAA 1SB3C 2M0NA 4IR1A 4WQKA 2KNJA 4YMNA 3WKEA 2AGQA 2ZXHA 4GC7A 2UVRA 4F93B 4KLIA 2A1JA 4JV0A 3PR4A 5J2CA 5EE3A 4YR3A 1T4GA 9ICOA 3D2NA 2G08A 1F0MA 2LHTA 4M9HA 2HI0A 5GTIU 3KHLA 4YMOA 4KLQA 4DSIA 2ZUBA 5KFBA 3WKDA 1KBUA 3AMZA 5BOLA 4M9LA 1R8CA 1F5SA 3OJSA 3MR3A 3KZIU 5AM5A 1VLBA 3B9JA 4AT8B 4JUZA 4DQPA 1NK9A 4GXKA 4LZDA 5ALNA 4NLBA 4YVZA 4LZGA 4LEVA 2ASDA 3KHGA 3FDSA 3SV3A 3SYZA 2G5IB 1U45A 5DB7A 4I27A 1Q46A 3NVYA 1JN3A 1V85A 4DQSA 2EAOA 2YB4A 4Y2YA 4RU9A 3F53A 3RRHA 3C2LA 1T7PA 3PMNA 3DV9A 1ZJMA 5CB1A 3C2MA 2Y9TA 2K4HA 1Z1BA 5CHGA 9ICMA 2KEYA 2XO7A 1X9SA 3PSPA 5KFAA 3K7DA 3Q8QB 2KICA 4EEDA 1B0XA 1TVAA 3D6JA 3OUYA 2KKPA 4WC2A 3WK8A 4EYHB 1SKSA 2VA8A 2DGZA 2JEIA 3BZKA 1PK1B 4J9KA 5TISU 4C8KA 3OSPA 4EBEA 4RQ7A 1NKCA 4F4KA 3V7KA 3ER9B 3H0MB 4B9VA 2L5YA 3H39A 3DEEA 5KFQA 4ECQA 1Q78A 1K1QA 4IRCA 2QARA 4EBKA 4WBZA 4US9A 3SAHA 4I2FA 1ZQ1C 3ZDEA 3T5LA 2M2UA 4CGZA 3BQ0A 1SV0C 4C7YA 3ICXA 3N7RC 4I2HA 5AIBA 3M8SA 8ICOA 2YTUA 4JV2A 2PI4A 2OHFA 5J0YA 3C1ZA 3QEAZ 5JTIA 2JHDA 3QZ8A 2Y1IA 4PL1A 4QZEA 4FHPA 2FMPA 9ICTA 4E80A 5HP4A 2VJ5A 1ZQHA 5E79U 1ZJNA 3GIIA 1ZQWA 4RQ0A 4O5KA 3E2EA 2O5AA 2UVVA 4DEZA 3K4GA 9ICFA 2ZTEA 3GV8B 4CF4A 5DB8A 1UEVA 2ID1A 1K1SA 3LYSA 4C8MA 2FLNA 2MRLA 4Y2SA 1L3VA 4O5EA 5DLGA 4O5CA 3J81j 1ZXIA 9ICXA 1QTMA 2BQUA 4Y2UA 2BCSA 4IRDA 2W3SA 1JQRA 2F1IA 8ICSA 1YZ7A 4DL6A 2AQ4A 4KLDA 3EW9A 8ICBA 2DPIA 5KFUA 8ICCA 2EANA 5K4LA 4K4IA 2O1PA 1N60A 1URJA 3EWAA 1IM4A 5HR7A 2MSNA 3K1RB 5ALXA 1PVPA 3PW7A 1NZBA 2ZH4A 3F2DA 3OVAA 2W3RA 4JMUA 3ETRA 4KX3A 2W9BA 5HNKA 2KJ5A 4P4MA 3OJUA 4UAZA 2PI5A 3R9KA 1NKEA 4X4PA 4C4SA 1X42A 2QB1A 2XY5A 3UMCA 4QWDA 3GIKA 1ZQSA 5DBCA 2DKZA 4QZFA 1VJ5A 5KNIA 1MSWD 5L1KA 3RJIA 1ZQEA 4K9BA 5DQGA 3MBYA 3V7JA 5IIKA 2G06A 4KLSA 2IOHA 5KFXA 5J0OA 1NK5A 4BWJA 4RWPA 5KFJA 4P0QA 4KMUA 1BPXA 1RPLA 5HC9A 2W03A 5EE0A 3OHBA 4DOAA 2RLTA 3C21A 1DOQA 3C23A 5KG5A 3KFUF 2JZBA 3AU6A 2JGAA 5CFTA 2H5XA 3LWLA 2YMPA 3HP6A 4MHVA 2B0CA 2KJ8A 4Y2RA 4PGXA 2E3TA 3BQ7A 5ALGA 1CI4A 7ICVA 3TAQA 5FP0A 1F44A 4P0PA 3SR6A 5CRXA 1OUQA 8ICAA 4NL9A 5KFRA 1Z4OA 3PSTA 1BPYA 4J9LA 1WWVA 3PZPA 2R8IA 3RJJA 4FZLA 1RXWA 4NV0A 4X4SA 4Y2XA 4WC7A 4KLEA 3OPXA 1FEZA 2B51A 4J9RA 2HMXA 5DBBA 4C8NA 3BQTA 4JV1A 1D8LA 2MU2A 3UXNA 4UB1A 2ZIVA 2A19A 2HHPA 3RB4A 5ALKA 3SENA 3QX7A 1D8BA 1X2IA 2RHFA 4ATBB 4I2GA 1QCKA 4AYBC 4DO9A 4AT7B 2FLPA 2HOIA 4UQGA 4RQ4A 1QLNA 4LEYA 3SV4A 2ESEA 1A0PA 1J97A 1Z00B 2ZIXB 2W7OA 3WFOA 4M0AA 5J8YC 4Z6FA 1KEJA 5DDYA 1XNSA 4OO1J 3TANA 5B66U 3BJYA 1OXJA 1T3QA 5HHIA 3C66A 1NJYA 4QW8A 4U7CA 2H3ZA 3PVXA 4P2HA 4UAYA 4DS5A 2F44A 2ZJ5A 7ICFA 4NY8A 4WC3A 4OJ6A 3JPQA 3HW8A 1HUZA 3E0FA 3TKAA 5KFTA 1NK7A 4KN7A 3UPQA 1CRXA 4TURA 3KKAC 4QZHA 1ZQRA 4AT8A 5KFDA 3WK6A 2BHNA 3UPSA 2J6SA 7ICRA 1JI7A 9ICIA 2VA3A 4KTQA 5L1JA 5IIIA 3MFIA 4HX0A 3HILA 4NLZA 8ICYA 3MDCA 3GIMA 4AT9B 4UB8U 1ZQZA 2EZYA 5IIJA 2GAFD 1L8OA 4NM1A 3T5KA 2DL0A 5CWRA 1QQ5A 9ICRA 4M47A 4O3SA 4K96A 5IIOA 2KKVA 2I9GA 5HHHA 2W11A 3PO5A 5L1LA 2E1EA 2RRDA 1ZQDA 3GDXA 2F8KA 4X4RA 5AI4A 2E8OA 3UQ2A 5DQIA 4OAIZ 3HRDD 5J0RA 1RYRA 5B3PA 3RB3A 3IRUA 3F2CA 1PK1A 4GXJA 9ICAA 1ZQNA 3G6VA 1ZQCA 3B0YA 5CEHA 4J9SA 1QSYA 8ICXA 4DQIA 4UB2A 2Q0ZX 1ZD5A 3M9MB 2PFPA 3PW0A 1BNOA 3ISCA 1NZPA 2WF9A 5J0QA 4Y2JA 4YXMA 2JEJA 1JALA 4FFDA 1TE2A 7ICJA 8ICQA 2XCPA 3RR8A 3AU2A 2WTFA 2ZIWB 3WK5A 4UBCA 1X9WA 4F5QA 4NXTA 4K98A 3BS5B 1KTQA 2KFNA 2HW3A 1X40A 2K4EA 5ALPA 2HBMA 2PFOA 7ICIA 2BCUA 5L1MA 2BCVA 1SZHA 4LEZA 4OCZA 3KD3A 1V9PA 5J2BA 4NKUA 1B22A 2ZJAA 1JAJA 2XY7A 3RB6A 3IP4B 1N61A 1BGXT 3PR5B 2W8KA 1KKXA 1PVQA 4R66A 3SAGA 3AQKA 4I0UA 4RPYA 3RJHA 9ICCA 2K8CB 3T3FA 8ICPA 3MDAA 1U47A 4FE3A 2H3VA 4X4OA 2JRZA 2HOFA 4JK1A 4RT2A 2XCAA 2W8LA 1XSLA 2I5HA 2ISPA 5KFIA 1KNYA 1TAMA 4KLJA 1QQ6A 5ALJA 2XI9A 3NGDA 1B43A 4B9MA 3O0FA 2F1HA 4X4VA 2B4VA 2KP7A 4NLGA 3GV5B 9ICEA 5DKWA 8ICRA 4YD1A 4RUCA 5F3XB 4M9JA 2HHSA 5KFWA 4YQWA 3D2QA 3BQ2A 5DEDA 1ZQLA 5HRIA 2DR8A 1S9FA 3Q8SB 2ZH2A 3WFSC 2H3FA 7ICTA 5J2AA 5DBAA 3AUOA 1XSNA 4KLHA 4BXOB 5AKLA 1X6IA 4M9GA 5AM2A 3JZ0A 1KQQA 2F8LA 5KG3A 2AU0A 4EYIB 2DKXA 1HEKA 4ECWA 2HSZA 1ZD3A 2XVTA 1WOTA 3Q8RB 2FI1A 5AKXA 2JXJA 4CCHA 4ECZA 4IRKA 5KFHA 2XGPA 3C5FA 3A0HU 4C7ZA 3GZFA 5CR0A 3AEVA 3H8WA 9ICNA 4DFJA 4ECXA 2P6RA 8ICGA 5KG7A 2VANA 2R8JA 1FIQA 1N2XA 2H3QA 2ZH5A 2CPRA 3RAXA 4KLTA 4XQ8A 4C80A 2R18A 2B6GA 5D46A 5HRDA 5ALEA 3AM9A 2VJ4A 4O0IA 2LYBA 2DR9A 3HJ4A 2K4IA 3GU3A 4GIBA 4FS1A 2PKEA 4UAVA 4DF4A 3H3AA 4NLNA 1YT3A 2I1QA 2KIWA 2LI6A 2DR7A 4F4YA 5HMLA 5DDMA 3MCRA 2DQNB 2N1RA 5AKIA 3MC1A 4M2YA 3HJEA 4C4TA 3H7IA 4QNLA 2DBYA 4QIWF 4QWBA 1S10A 2LM4A 2YQEA 1UT8A 3E58A 4F91B 1XS9D 3QNMA 5D63A 2V4RA 2OH2A 3L4PA 2EAMA 3NS1A 3JPNA 1D9DA 4F5PA 5KT4A 4WC6A 2ZH3A 3MGHA 4NXWA 4JLXA 1L6NA 3H38A 2W43A 3RH6A 4CNQA 3HKZF 9ICVA 1ZQYA 1TK5A 4PZOA 2OWOA 2ASLA 3HPOA 4ATBA 1KL9A 3BS7A 3EUB2 1L8LA 1XC9A 4J9MA 4IQWA 2KOBA 4NXUA 3NVWA 2Z7JA 5ALDA 4AT7A 2NRWA 3SD7A 5KG1A 4QZ8A 4DL5A 4B9SA 5A0LA 2IUBA 4QZDA 1Z00A 2ZIXA 4I28A 3DDHA 5AK6A 4RQ3A 3UXPA 7ICOA 4FH3A 2DVIA 4F4XA 3KZXA 4F5RA 5EE1A 4HYKA 4R65A 1IV8A 3RBDA 5CP2A 2C2DA 2IA6A 4DLGA 7ICHA 9ICKA 1CUKA 2PMZC 3AN1A 2W9AA 5J0SA 4Q8FA 2W54A 2BCRA 4PL2A 2JEGA 4BWMA 4MEXA 2F1JA 2NRZA 4KLUA 2BBHA 4DL2A 3WFQE 4EZ6A 7ICNA 3NRZA 5ALIA 3C18A 2ZH1A 3ER8C 4OAFA 1T3NA 3RRGA 3IG8A 4K4GA 4FO1A 8ICKA 4KMOB 4B9NA 5DG9A 1PVRA 5AKEA 5IILA 2WHEA 3EPIA 1U48A 5ALFA 2DFLA 4PJ0U 3H37A 3L9DA 3BQ1A 5ALMA 1S0OA 4LVSA 3Q8KA 4MKPA 5D62A 4AT9A 5ALZA 2CRXA 4O67A 4NLKA 1KFDA 3TI0A 5HRFA 1NO5A 2WF7A 3VC8A 2HN2A 4WOYA 4F4ZA 1L3TA 2HBLA 1ZETA 2HDOA 3MR5A 4YD2A 8ICTA 5J2JA 2OXOA 4BJQA 3LVVA 3QU4A 4WBYA 4EENA 4X0BA 2HVHA 5AI5A 2IMWP 3IN5A 2HN1A 4FHWA 4XA5A 5G5GA 3UM9A 1MIYA 4TQSA 1TKDA 3FYHA 3C2KA 1LVHA 7ICUA 4KB6A 3RB0A 4RQ8A 3I28A 2EDUA 3HT3A 4EBDA 2IOFK 3CYMA 2QLTA 1SL1A 5J0WA
chains in the Genus database with same CATH topology
3JPQA 2LYHA 3HW8A 1HUZA 5L9XA 1BPEA 4PGYA 5BPCA 4DOBA 3RR7A 5HR9A 5DG7A 1IXRA 1C7YA 9ICUA 5KFTA 5KFPA 4RNNA 4KLMA 1NK7A 2FPKA 4KN7A 4YP3A 3UPQA 2NRVA 4TURA 4MFCA 2KZMA 4TUQA 4EZ9A 4QZHA 1EXNA 4WC4A 1ZQRA 4O9MA 4AT8A 5KFDA 4R64A 4I28A 9ICPA 4EP7A 5J2GA 2HHUA 5KFFA 2HHWA 7ICEA 1Z3EB 7ICGA 4J9OA 3THVA 2BHNA 4KITB 1TK0A 5CJ7A 4I29A 3UPSA 2J6SA 7ICRA 3H40A 2HHVA 5HRLA 3PW5A 4B9TA 2R8KA 4RWQA 1TFWA 9ICIA 2UVWA 4QWCA 2P6UA 2VA3A 4KTQA 1ZQJA 5L1JA 4RQ5A 5DLFA 1ZQIA 3ISBA 3KTQA 9ICWA 5IIIA 3ZDDA 2M2TA 4GC6A 3MFIA 1SKRA 2MUTA 1HUOA 3KHHA 2ZH8A 1SZPA 2ISOA 4M6WB 1NKBA 3MDCA 4NLZA 8ICYA 3GIMA 4O3PA 4AT9B 4MFFA 2HVIA 1F5AA 1ZQZA 3IM1A 5IIJA 3WFPA 3AQMA 4RNMA 1TK8A 2BPFA 1VJ7A 3QEBZ 8ICBA 4NM1A 4I2JA 1R89A 3TARA 4ZH4A 4ECUA 3T5KA 8ICHA 4X4UA 2DR5A 5CWRA 3RH4A 1ZQAA 2B21A 2NRTA 2UVUA 9ICRA 4M47A 4O3SA 2ZUDA 3T5JA 5KG2A 5IIOA 5J2IA 2I9GA 2C2RA 3C1YA 4F8RA 5HRHA 3PW4A 5HHHA 3MGIA 3JPTA 2BDPA 4QZCA 3OVSA 1U49A 3PO5A 5L1LA 4XQ7A 4DL3A 2ZH6A 1BPDA 4P4PA 3GDXA 1ZQDA 4MFAA 4RWNA 4X4RA 4IR1A 3UQ2A 4ECVA 2JEFA 5DQIA 4YMNA 5J0RA 2XY6A 4DF8A 1RYRA 3TQ1A 5J0TA 2RFFA 2HHTA 1A76A 3RB3A 2AGQA 1TAQA 4GXJA 4GC7A 4F93B 3PX0A 1ZQNA 3G6VA 2A1JA 1ZQCA 2UVRA 5KFGA 4KLIA 3B0YA 4Q43A 4J9SA 4I2EA 1ZQTA 1A77A 5KT3A 1QSYA 4I2DA 4JV0A 1ZQUA 3PR4A 8ICXA 4DQIA 5J2CA 4UB2A 4YR3A 2Q0ZX 1T4GA 2AGPA 9ICOA 4ED0A 4F3OA 4ECYA 5HRKA 3M9MB 2PFPA 4M9HA 3PW0A 4S3NA 4DSEA 3ISCA 2KZ3A 4IQVA 1LV5A 1BNOA 3KHLA 1NZPA 5J0QA 4YMOA 4KLQA 1T8EA 1KFTA 3Q8MA 5DECA 1XU4A 4YXMA 4DSIA 1QSLA 2ZUBA 4WC3A 2JEJA 5KFBA 2C22A 3PO4A 3Q8PB 7ICJA 8ICQA 2XCPA 2DPJA 3RJGA 2AJQA 5J2DA 5KTQA 5BOLA 2IBKA 3RR8A 3AU2A 2WTFA 4BXOA 2IHNA 5BOMA 4M9LA 1R8CA 4UBCA 3NTUA 3OJSA 1X9WA 4F5QA 5DB6A 1TAUA 1TFYA 1S77D 4NM2A 2ZH9A 3OGUA 1KTQA 1XWLA 2KFNA 3MR3A 2KZZA 2HW3A 4NKTA 4AT8B 9ICJA 3EPGA 4JUZA 1ZQFA 1NK9A 4GXKA 4DQPA 2ZUCA 3KHRA 5DGAA 1ZQGA 2BCUA 2BCVA 2P66A 4LZDA 4YVZA 3V6JA 2W9MA 4LZGA 2BGWA 4NKUA 1V9PA 5J2BA 4WC5A 5D4BA 4DQRA 1B22A 5KG6A 2ASDA 2ZJAA 5HRBA 4DFKA 1JAJA 2XY7A 1RZTA 3GFKB 5J2EA 5KFSA 3KHGA 4R63A 3RB6A 4M5DA 3FDSA 1BGXT 3PR5B 2HHQA 3SV3A 4X4TA 2BCQA 2W8KA 3B0XA 3LDAA 3SYZA 4R66A 3AQKA 1U45A 5IIMA 5DB7A 4RPYA 4PHDA 2ZTDA 2R8HA 3RJHA 4I27A 5J0UA 2MUTB 8ICPA 3T3FA 4JWNA 4BGDA 3MDAA 1JN3A 9ICCA 1U47A 3Q8LA 4WCWA 2BE3A 4DQSA 4X4OA 3M9NB 4DS4A 2BPGA 4RU9A 5KFNA 3G6YA 7ICKA 1OU5A 4JK1A 4RT2A 2XCAA 2W8LA 3V72A 4ECRA 3C2LA 3RRHA 1XSLA 1ZQBA 1L3SA 1T7PA 3BDPA 4M04A 1KFSA 4X4QA 3PMNA 2DRBA 1ZJMA 4FBTA 9ICLA 4X4NA 5CB1A 3C2MA 4Z6CA 2ISPA 5KFIA 1DK2A 1KNYA 4F92B 2PFOA 3OVBA 4KLJA 4PPXA 1ZQPA 1YLQA 5CHGA 4RQ1A 9ICMA 3AQLA 3PV8A 3N97B 2XO7A 1X9SA 4C8LA 5KFAA 4Q44A 3NGDA 3Q8QB 5J2HA 4ED2A 3RBEA 1X9MA 1SKWA 3JYYA 4UB3A 1B43A 3UQ0A 3T5HA 1TVAA 4B9MA 3M9OB 3HWTA 2DRAA 3OUYA 3LK9A 4WC2A 4EYHB 1SKSA 2F1HA 2VA8A 4X5VA 4X4VA 4NLGA 2KP7A 3GV5B 4YFKA 2KTQA 2JEIA 1MC8A 4QZ9A 9ICEA 5DKWA 8ICRA 4O3RA 2A1JB 1S0MA 1H38A 1JIHA 4J9KA 4YD1A 4RUCA 2Y1JA 4C8KA 1BVSA 5KG0A 4YN4A 3OSPA 4EBEA 1NK0A 4M9JA 1V4AA 2HHSA 2Q66A 4GLXA 8ICEA 4RQ7A 4ED8A 3H4DA 1NKCA 5KFWA 4YQWA 3BQ2A 4Q45A 3V7KA 4F4KA 5DEDA 3V7LA 1ZQLA 5HRIA 2DR8A 4UB5A 3MR2A 4RPZA 1S9FA 4B9VA 3H39A 3Q8SB 2ZH2A 1RYSA 5KFQA 3WFSC 1DGSA 4ECQA 3IHQB 4E7XA 7ICTA 5KT6A 4ED6A 5J2AA 4QZIA 1Q78A 5DBAA 3N4MB 1K1QA 3UXOA 3AUOA 1XSNA 4IRCA 4KLHA 7ICSA 1NK8A 4BXOB 2J6TA 2KFZA 8ICIA 4DSLA 4WBZA 4I2FA 4EBKA 3ZD8A 4M9GA 4UAWA 3JZ0A 3ZDEA 4ED3A 3T5LA 4ED7A 5KG3A 2M2UA 2AU0A 1ZQOA 3BQ0A 4EYIB 2RDJA 4ECWA 1U9LA 5L1IA 4QZAA 1QSSA 4QWAA 5D49A 1UA0A 1S97A 3MR6A 2FMQA 4I2HA 4RWOA 1WOTA 5KFVA 5KT7A 3Q8RB 3M8SA 1JMSA 2ATLA 1FA0A 1R8BA 2PBEA 4CCHA 8ICOA 4ECZA 3GV7B 4C8OA 2FLLA 4IRKA 5KFHA 2XGPA 3C5FA 4JV2A 2PI4A 1Y88A 1PZNA 5J0YA 5KFZA 3ZDBA 3C1ZA 4YXJA 3QEAZ 2Y1IA 3QZ8A 5KFCA 1L5UA 4QZEA 2ZHBA 5J2KA 4J9NA 3V6HA 5CR0A 4DSKA 9ICAA 3H8WA 5DB9A 4BDPA 3G6XA 5KFOA 4DFJA 4ECXA 2R8GA 9ICNA 2P6RA 8ICGA 5C5JA 5KG7A 3GILA 2VANA 2FMPA 2R8JA 9ICTA 4FHPA 4E80A 1NOMA 5HP4A 2ZH5A 1ZQHA 3ZDCA 3RAXA 1ZJNA 4XQ8A 1ZQWA 3GIIA 4KLTA 5D46A 5HRDA 4RQ0A 4O5KA 3E2EA 4TQRA 2O5AA 2UVVA 4DEZA 5HRGA 3K4GA 4ED1A 3TFSA 4XRHA 2IHMA 5KFYA 4O0IA 1NK6A 9ICFA 9ICQA 2DR9A 2ZTEA 5EOZA 5EWEA 4RQ2A 3HJ4A 3GV8B 1MIVA 4O3OA 5DB8A 1UEVA 4E8FA 1COOA 4FHVA 3ZD9A 1ZQKA 2BKEA 2ID1A 4G3IA 4FS1A 4KN4A 1K1SA 1TV9A 4DF4A 1LB2B 3LQCB 4C8MA 2FLNA 5KFKA 2W9CA 1KLNA 3H3AA 4YR2A 3PW2A 4NLNA 3OUYB 2I1QA 2PXIA 1L3VA 4PHEA 4O5EA 5DLGA 1SL2A 4O5CA 2DR7A 2NRXA 4F4YA 4J9PA 4NY8A 9ICXA 5HMLA 2BQUA 1QTMA 5DDMA 2BCSA 4IRDA 1TFRA 1JQRA 2F1IA 4ECSA 8ICSA 4E0DA 5EWGA 4DSFA 3TAPA 1UEUA 4DL6A 9ICHA 2FPLA 2ZJ8A 2AQ4A 5F9LA 4KLDA 3EW9A 4M2YA 4YMMA 2ZTCA 1VFGA 3RJFA 2HHXA 1ZQVA 4J9QA 3H7IA 4TUSA 2DPIA 2PFNA 5KFUA 1KDHA 3EYZA 5J0XA 4B9UA 8ICCA 4KLFA 4QWBA 1S10A 7ICLA 4K4IA 1UT8A 4KLLA 2O1PA 4GXIA 4F91B 1XS9D 1BPZA 2XC9A 4M9NA 1ZQMA 3V6KA 3EWAA 5DG8A 1IM4A 2V4RA 3JPOA 2FPMA 2V4QA 3JPSA 4RPXA 3JPRA 5KFLA 3JPNA 4PHPA 4F5PA 3PW7A 5KT4A 1D9DA 2M2WA 2NRKA 2VA2A 1HJPA 3MGHA 5HREA 1UETA 4EEYA 4WC6A 2ZH3A 2ZH4A 4RUAA 2BQ3A 3H8SA 4Z6EA 4DLEA 3HX0A 3OVAA 3RJEA 3H38A 3RH6A 2W9BA 7ICMA 9ICVA 2BPCA 1KSPA 1ZQYA 1TK5A 5HNKA 3EZ5A 1JX4A 4P4MA 3OJUA 4UAZA 1S0VA 2AGOA 3QZ7A 1MQ3A 1ZQQA 1BPBA 3QE9Y 2PI5A 1NKEA 4F2RA 4X4SA 3OSNA 4NXZA 4O3QA 2ASLA 3JPPA 3HPOA 2OWOA 4ELUA 4ATBA 4X4PA 2XY5A 2ZHAA 5KG4A 8ICMA 3PMLA 4QWDA 1XC9A 4J9MA 4IQWA 3GIKA 8ICFA 4XUSA 1ZQSA 4TUPA 5DBCA 4QZFA 1L3UA 4MF8A 4AT7A 1MSWD 2NRWA 5KG1A 9ICSA 2M2VA 4PHAA 4QZ8A 5F9NA 5L1KA 4LT6A 4DL5A 1NJWA 3RJIA 3GQCA 5J0PA 3TFRA 5DQGA 3MBYA 3V7JA 2BQRA 1ZQEA 5IIKA 3NYBA 2BR0A 4KLSA 4F5NA 4B9SA 4B9LA 5J0OA 5KFXA 1NK5A 4RWPA 4BWJA 4KLOA 5KFJA 1Q79A 2C2EA 9ICGA 4X0AA 4QZDA 1Z00A 4FO6A 3PX6A 4KMUA 4Z6DA 3MFHA 4R8UA 1N56A 4RQ3A 4EBCA 1RPLA 1BPXA 3GIJA 4FH5A 3OHBA 3ORYA 4DOAA 1JXLA 1MIWA 5HC9A 3UXPA 7ICOA 5DGBA 4YCXA 4FH3A 2DVIA 3PNCA 3SI8A 3RJKA 8ICZA 4F4XA 4F50A 4F5RA 5TZVA 3C21A 4HYKA 2J6UA 4UD4A 4R65A 1DOQA 3C23A 3K75D 5CA7A 1UT5A 5KFEA 5KG5A 4RQ6A 5CP2A 3M8RA 2JZBA 4DFMA 3AU6A 4DLGA 2H5XA 3RBDA 2C2DA 3LWMA 1MQ2A 2IA6A 1CUKA 3C5GA 7ICHA 9ICKA 3LWLA 3HP6A 2W9AA 5J0SA 4DFPA 2W9CB 4I2AA 4Q8FA 3OV7A 2ZH7A 4PGXA 1SL0A 1S0NA 2BCRA 7ICPA 1JXEA 1WCNA 4QZGA 4I2CA 2JEGA 4BWMA 4MEXA 2F1JA 4IG8A 2NRZA 4FS2A 4DSJA 7ICVA 4KLUA 3WFQE 4DL2A 3TAQA 1DK3A 4EZ6A 7ICNA 1NK4A 8ICNA 5KT5A 4JWMA 5JUMA 1R8AA 7ICQA 4UB4A 8ICAA 5KFRA 3C18A 2ZH1A 1D8YA 4MEYA 4MF2A 3RH5A 4KLGA 2ASJA 1T3NA 3RRGA 5EWFA 1UA1A 4K4GA 3SZ2A 1BPYA 8ICKA 4J9LA 4WC1A 4B9NA 1ZQXA 5DG9A 2R8IA 5J29A 2V9WA 3ZDAA 5IILA 3RJJA 2M9NA 3EPIA 1RXWA 4DWIA 1U48A 3ETLA 4UBBA 2DFLA 5KFMA 4IQTA 2XGQA 4FBUA 2ALZA 4I2BA 4Q8EA 3H37A 1WCLA 4KLEA 4WC7A 3L9DA 2KN7A 4J9RA 3BQ1A 1BNPA 5DBBA 4RT3A 3ISDA 4C8NA 1S0OA 4UD5A 3BQTA 1D9FA 4JV1A 1D8LA 4LVSA 3Q8KA 4WC0A 3UXNA 4M6WA 4UB1A 3AQNA 4RNOA 1XSPA 4FHXA 4AT9A 2HHPA 3RB4A 4ELTA 2W9BB 5F2VO 4F4WA 2GWSA 4NLKA 1KFDA 9ICBA 3TI0A 3MABA 3OHAA 1ZYQA 3H8JA 5HRFA 1NO5A 1X2IA 4ATBB 4F2SA 8ICLA 4I2GA 4IR9A 4DL7A 8ICWA 2PFQA 4F4ZA 4DL4A 4FHYA 1L3TA 4PGQA 4K4HA 4DO9A 4QZBA 2AQ0A 5KT2A 1ZETA 2C28A 3MR5A 4YD2A 8ICTA 2FLPA 4YG2A 5J2JA 1U4BA 4QW9A 2FMSA 4AT7B 4UQGA 1N48A 3WFRE 1NJXA 5HMMA 4RQ4A 5DQHA 4ECTA 3HJ1A 3RTVA 3HIYA 1QLNA 4PH5A 5J2FA 1PX5A 4EBJA 3PX4A 4WBYA 3SV4A 3PY8A 1AROP 5IINA 4O3NA 4X0BA 2HVHA 1Z00B 2IMWP 4YR0A 3WFOA 4R8UB 4M0AA 4FHWA 1S76D 3RAQA 4RZRA 1XO1A 4Z6FA 4XA5A 8ICJA 4F5OA 7ICIA 1KEJA 5DDYA 4P4OA 1MIYA 4I2IA 4TQSA 3TANA 1TKDA 4DOCA 3FYHA 3BJYA 5HHIA 3C2KA 8ICVA 3H4BA 3C66A 1NJYA 4QW8A 4IQUA 8ICUA 7ICUA 2JZBB 2RDIA 4ELVA 3RB0A 1RXVA 1NJZA 4RQ8A 4DQQA 3PVXA 4P2HA 4UAYA 3HT3A 2MAXA 4DS5A 4EBDA 1KRPA 1CEZA 4QWEA 2ZJ5A 7ICFA 1SL1A 5J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JPQ A;  2LYH A;  3HW8 A;  1HUZ A;  5L9X A;  1BPE A;  4PGY A;  5BPC A;  4DOB A;  3RR7 A;  5HR9 A;  5DG7 A;  1IXR A;  1C7Y A;  9ICU A;  5KFT A;  5KFP A;  4RNN A;  4KLM A;  1NK7 A;  2FPK A;  4KN7 A;  4YP3 A;  3UPQ A;  2NRV A;  4TUR A;  4MFC A;  2KZM A;  4TUQ A;  4EZ9 A;  4QZH A;  1EXN A;  4WC4 A;  1ZQR A;  4O9M A;  4AT8 A;  5KFD A;  4R64 A;  4I28 A;  9ICP A;  4EP7 A;  5J2G A;  2HHU A;  5KFF A;  2HHW A;  7ICE A;  1Z3E B;  7ICG A;  4J9O A;  3THV A;  2BHN A;  4KIT B;  1TK0 A;  5CJ7 A;  4I29 A;  3UPS A;  2J6S A;  7ICR A;  3H40 A;  2HHV A;  5HRL A;  3PW5 A;  4B9T A;  2R8K A;  4RWQ A;  1TFW A;  9ICI A;  2UVW A;  4QWC A;  2P6U A;  2VA3 A;  4KTQ A;  1ZQJ A;  5L1J A;  4RQ5 A;  5DLF A;  1ZQI A;  3ISB A;  3KTQ A;  9ICW A;  5III A;  3ZDD A;  2M2T A;  4GC6 A;  3MFI A;  1SKR A;  2MUT A;  1HUO A;  3KHH A;  2ZH8 A;  1SZP A;  2ISO A;  4M6W B;  1NKB A;  3MDC A;  4NLZ A;  8ICY A;  3GIM A;  4O3P A;  4AT9 B;  4MFF A;  2HVI A;  1F5A A;  1ZQZ A;  3IM1 A;  5IIJ A;  3WFP A;  3AQM A;  4RNM A;  1TK8 A;  2BPF A;  1VJ7 A;  3QEB Z;  8ICB A;  4NM1 A;  4I2J A;  1R89 A;  3TAR A;  4ZH4 A;  4ECU A;  3T5K A;  8ICH A;  4X4U A;  2DR5 A;  5CWR A;  3RH4 A;  1ZQA A;  2B21 A;  2NRT A;  2UVU A;  9ICR A;  4M47 A;  4O3S A;  2ZUD A;  3T5J A;  5KG2 A;  5IIO A;  5J2I A;  2I9G A;  2C2R A;  3C1Y A;  4F8R A;  5HRH A;  3PW4 A;  5HHH A;  3MGI A;  3JPT A;  2BDP A;  4QZC A;  3OVS A;  1U49 A;  3PO5 A;  5L1L A;  4XQ7 A;  4DL3 A;  2ZH6 A;  1BPD A;  4P4P A;  3GDX A;  1ZQD A;  4MFA A;  4RWN A;  4X4R A;  4IR1 A;  3UQ2 A;  4ECV A;  2JEF A;  5DQI A;  4YMN A;  5J0R A;  2XY6 A;  4DF8 A;  1RYR A;  3TQ1 A;  5J0T A;  2RFF A;  2HHT A;  1A76 A;  3RB3 A;  2AGQ A;  1TAQ A;  4GXJ A;  4GC7 A;  4F93 B;  3PX0 A;  1ZQN A;  3G6V A;  2A1J A;  1ZQC A;  2UVR A;  5KFG A;  4KLI A;  3B0Y A;  4Q43 A;  4J9S A;  4I2E A;  1ZQT A;  1A77 A;  5KT3 A;  1QSY A;  4I2D A;  4JV0 A;  1ZQU A;  3PR4 A;  8ICX A;  4DQI A;  5J2C A;  4UB2 A;  4YR3 A;  2Q0Z X;  1T4G A;  2AGP A;  9ICO A;  4ED0 A;  4F3O A;  4ECY A;  5HRK A;  3M9M B;  2PFP A;  4M9H A;  3PW0 A;  4S3N A;  4DSE A;  3ISC A;  2KZ3 A;  4IQV A;  1LV5 A;  1BNO A;  3KHL A;  1NZP A;  5J0Q A;  4YMO A;  4KLQ A;  1T8E A;  1KFT A;  3Q8M A;  5DEC A;  1XU4 A;  4YXM A;  4DSI A;  1QSL A;  2ZUB A;  4WC3 A;  2JEJ A;  5KFB A;  2C22 A;  3PO4 A;  3Q8P B;  7ICJ A;  8ICQ A;  2XCP A;  2DPJ A;  3RJG A;  2AJQ A;  5J2D A;  5KTQ A;  5BOL A;  2IBK A;  3RR8 A;  3AU2 A;  2WTF A;  4BXO A;  2IHN A;  5BOM A;  4M9L A;  1R8C A;  4UBC A;  3NTU A;  3OJS A;  1X9W A;  4F5Q A;  5DB6 A;  1TAU A;  1TFY A;  1S77 D;  4NM2 A;  2ZH9 A;  3OGU A;  1KTQ A;  1XWL A;  2KFN A;  3MR3 A;  2KZZ A;  2HW3 A;  4NKT A;  4AT8 B;  9ICJ A;  3EPG A;  4JUZ A;  1ZQF A;  1NK9 A;  4GXK A;  4DQP A;  2ZUC A;  3KHR A;  5DGA A;  1ZQG A;  2BCU A;  2BCV A;  2P66 A;  4LZD A;  4YVZ A;  3V6J A;  2W9M A;  4LZG A;  2BGW A;  4NKU A;  1V9P A;  5J2B A;  4WC5 A;  5D4B A;  4DQR A;  1B22 A;  5KG6 A;  2ASD A;  2ZJA A;  5HRB A;  4DFK A;  1JAJ A;  2XY7 A;  1RZT A;  3GFK B;  5J2E A;  5KFS A;  3KHG A;  4R63 A;  3RB6 A;  4M5D A;  3FDS A;  1BGX T;  3PR5 B;  2HHQ A;  3SV3 A;  4X4T A;  2BCQ A;  2W8K A;  3B0X A;  3LDA A;  3SYZ A;  4R66 A;  3AQK A;  1U45 A;  5IIM A;  5DB7 A;  4RPY A;  4PHD A;  2ZTD A;  2R8H A;  3RJH A;  4I27 A;  5J0U A;  2MUT B;  8ICP A;  3T3F A;  4JWN A;  4BGD A;  3MDA A;  1JN3 A;  9ICC A;  1U47 A;  3Q8L A;  4WCW A;  2BE3 A;  4DQS A;  4X4O A;  3M9N B;  4DS4 A;  2BPG A;  4RU9 A;  5KFN A;  3G6Y A;  7ICK A;  1OU5 A;  4JK1 A;  4RT2 A;  2XCA A;  2W8L A;  3V72 A;  4ECR A;  3C2L A;  3RRH A;  1XSL A;  1ZQB A;  1L3S A;  1T7P A;  3BDP A;  4M04 A;  1KFS A;  4X4Q A;  3PMN A;  2DRB A;  1ZJM A;  4FBT A;  9ICL A;  4X4N A;  5CB1 A;  3C2M A;  4Z6C A;  2ISP A;  5KFI A;  1DK2 A;  1KNY A;  4F92 B;  2PFO A;  3OVB A;  4KLJ A;  4PPX A;  1ZQP A;  1YLQ A;  5CHG A;  4RQ1 A;  9ICM A;  3AQL A;  3PV8 A;  3N97 B;  2XO7 A;  1X9S A;  4C8L A;  5KFA A;  4Q44 A;  3NGD A;  3Q8Q B;  5J2H A;  4ED2 A;  3RBE A;  1X9M A;  1SKW A;  3JYY A;  4UB3 A;  1B43 A;  3UQ0 A;  3T5H A;  1TVA A;  4B9M A;  3M9O B;  3HWT A;  2DRA A;  3OUY A;  3LK9 A;  4WC2 A;  4EYH B;  1SKS A;  2F1H A;  2VA8 A;  4X5V A;  4X4V A;  4NLG A;  2KP7 A;  3GV5 B;  4YFK A;  2KTQ A;  2JEI A;  1MC8 A;  4QZ9 A;  9ICE A;  5DKW A;  8ICR A;  4O3R A;  2A1J B;  1S0M A;  1H38 A;  1JIH A;  4J9K A;  4YD1 A;  4RUC A;  2Y1J A;  4C8K A;  1BVS A;  5KG0 A;  4YN4 A;  3OSP A;  4EBE A;  1NK0 A;  4M9J A;  1V4A A;  2HHS A;  2Q66 A;  4GLX A;  8ICE A;  4RQ7 A;  4ED8 A;  3H4D A;  1NKC A;  5KFW A;  4YQW A;  3BQ2 A;  4Q45 A;  3V7K A;  4F4K A;  5DED A;  3V7L A;  1ZQL A;  5HRI A;  2DR8 A;  4UB5 A;  3MR2 A;  4RPZ A;  1S9F A;  4B9V A;  3H39 A;  3Q8S B;  2ZH2 A;  1RYS A;  5KFQ A;  3WFS C;  1DGS A;  4ECQ A;  3IHQ B;  4E7X A;  7ICT A;  5KT6 A;  4ED6 A;  5J2A A;  4QZI A;  1Q78 A;  5DBA A;  3N4M B;  1K1Q A;  3UXO A;  3AUO A;  1XSN A;  4IRC A;  4KLH A;  7ICS A;  1NK8 A;  4BXO B;  2J6T A;  2KFZ A;  8ICI A;  4DSL A;  4WBZ A;  4I2F A;  4EBK A;  3ZD8 A;  4M9G A;  4UAW A;  3JZ0 A;  3ZDE A;  4ED3 A;  3T5L A;  4ED7 A;  5KG3 A;  2M2U A;  2AU0 A;  1ZQO A;  3BQ0 A;  4EYI B;  2RDJ A;  4ECW A;  1U9L A;  5L1I A;  4QZA A;  1QSS A;  4QWA A;  5D49 A;  1UA0 A;  1S97 A;  3MR6 A;  2FMQ A;  4I2H A;  4RWO A;  1WOT A;  5KFV A;  5KT7 A;  3Q8R B;  3M8S A;  1JMS A;  2ATL A;  1FA0 A;  1R8B A;  2PBE A;  4CCH A;  8ICO A;  4ECZ A;  3GV7 B;  4C8O A;  2FLL A;  4IRK A;  5KFH A;  2XGP A;  3C5F A;  4JV2 A;  2PI4 A;  1Y88 A;  1PZN A;  5J0Y A;  5KFZ A;  3ZDB A;  3C1Z A;  4YXJ A;  3QEA Z;  2Y1I A;  3QZ8 A;  5KFC A;  1L5U A;  4QZE A;  2ZHB A;  5J2K A;  4J9N A;  3V6H A;  5CR0 A;  4DSK A;  9ICA A;  3H8W A;  5DB9 A;  4BDP A;  3G6X A;  5KFO A;  4DFJ A;  4ECX A;  2R8G A;  9ICN A;  2P6R A;  8ICG A;  5C5J A;  5KG7 A;  3GIL A;  2VAN A;  2FMP A;  2R8J A;  9ICT A;  4FHP A;  4E80 A;  1NOM A;  5HP4 A;  2ZH5 A;  1ZQH A;  3ZDC A;  3RAX A;  1ZJN A;  4XQ8 A;  1ZQW A;  3GII A;  4KLT A;  5D46 A;  5HRD A;  4RQ0 A;  4O5K A;  3E2E A;  4TQR A;  2O5A A;  2UVV A;  4DEZ A;  5HRG A;  3K4G A;  4ED1 A;  3TFS A;  4XRH A;  2IHM A;  5KFY A;  4O0I A;  1NK6 A;  9ICF A;  9ICQ A;  2DR9 A;  2ZTE A;  5EOZ A;  5EWE A;  4RQ2 A;  3HJ4 A;  3GV8 B;  1MIV A;  4O3O A;  5DB8 A;  1UEV A;  4E8F A;  1COO A;  4FHV A;  3ZD9 A;  1ZQK A;  2BKE A;  2ID1 A;  4G3I A;  4FS1 A;  4KN4 A;  1K1S A;  1TV9 A;  4DF4 A;  1LB2 B;  3LQC B;  4C8M A;  2FLN A;  5KFK A;  2W9C A;  1KLN A;  3H3A A;  4YR2 A;  3PW2 A;  4NLN A;  3OUY B;  2I1Q A;  2PXI A;  1L3V A;  4PHE A;  4O5E A;  5DLG A;  1SL2 A;  4O5C A;  2DR7 A;  2NRX A;  4F4Y A;  4J9P A;  4NY8 A;  9ICX A;  5HML A;  2BQU A;  1QTM A;  5DDM A;  2BCS A;  4IRD A;  1TFR A;  1JQR A;  2F1I A;  4ECS A;  8ICS A;  4E0D A;  5EWG A;  4DSF A;  3TAP A;  1UEU A;  4DL6 A;  9ICH A;  2FPL A;  2ZJ8 A;  2AQ4 A;  5F9L A;  4KLD A;  3EW9 A;  4M2Y A;  4YMM A;  2ZTC A;  1VFG A;  3RJF A;  2HHX A;  1ZQV A;  4J9Q A;  3H7I A;  4TUS A;  2DPI A;  2PFN A;  5KFU A;  1KDH A;  3EYZ A;  5J0X A;  4B9U A;  8ICC A;  4KLF A;  4QWB A;  1S10 A;  7ICL A;  4K4I A;  1UT8 A;  4KLL A;  2O1P A;  4GXI A;  4F91 B;  1XS9 D;  1BPZ A;  2XC9 A;  4M9N A;  1ZQM A;  3V6K A;  3EWA A;  5DG8 A;  1IM4 A;  2V4R A;  3JPO A;  2FPM A;  2V4Q A;  3JPS A;  4RPX A;  3JPR A;  5KFL A;  3JPN A;  4PHP A;  4F5P A;  3PW7 A;  5KT4 A;  1D9D A;  2M2W A;  2NRK A;  2VA2 A;  1HJP A;  3MGH A;  5HRE A;  1UET A;  4EEY A;  4WC6 A;  2ZH3 A;  2ZH4 A;  4RUA A;  2BQ3 A;  3H8S A;  4Z6E A;  4DLE A;  3HX0 A;  3OVA A;  3RJE A;  3H38 A;  3RH6 A;  2W9B A;  7ICM A;  9ICV A;  2BPC A;  1KSP A;  1ZQY A;  1TK5 A;  5HNK A;  3EZ5 A;  1JX4 A;  4P4M A;  3OJU A;  4UAZ A;  1S0V A;  2AGO A;  3QZ7 A;  1MQ3 A;  1ZQQ A;  1BPB A;  3QE9 Y;  2PI5 A;  1NKE A;  4F2R A;  4X4S A;  3OSN A;  4NXZ A;  4O3Q A;  2ASL A;  3JPP A;  3HPO A;  2OWO A;  4ELU A;  4ATB A;  4X4P A;  2XY5 A;  2ZHA A;  5KG4 A;  8ICM A;  3PML A;  4QWD A;  1XC9 A;  4J9M A;  4IQW A;  3GIK A;  8ICF A;  4XUS A;  1ZQS A;  4TUP A;  5DBC A;  4QZF A;  1L3U A;  4MF8 A;  4AT7 A;  1MSW D;  2NRW A;  5KG1 A;  9ICS A;  2M2V A;  4PHA A;  4QZ8 A;  5F9N A;  5L1K A;  4LT6 A;  4DL5 A;  1NJW A;  3RJI A;  3GQC A;  5J0P A;  3TFR A;  5DQG A;  3MBY A;  3V7J A;  2BQR A;  1ZQE A;  5IIK A;  3NYB A;  2BR0 A;  4KLS A;  4F5N A;  4B9S A;  4B9L A;  5J0O A;  5KFX A;  1NK5 A;  4RWP A;  4BWJ A;  4KLO A;  5KFJ A;  1Q79 A;  2C2E A;  9ICG A;  4X0A A;  4QZD A;  1Z00 A;  4FO6 A;  3PX6 A;  4KMU A;  4Z6D A;  3MFH A;  4R8U A;  1N56 A;  4RQ3 A;  4EBC A;  1RPL A;  1BPX A;  3GIJ A;  4FH5 A;  3OHB A;  3ORY A;  4DOA A;  1JXL A;  1MIW A;  5HC9 A;  3UXP A;  7ICO A;  5DGB A;  4YCX A;  4FH3 A;  2DVI A;  3PNC A;  3SI8 A;  3RJK A;  8ICZ A;  4F4X A;  4F50 A;  4F5R A;  5TZV A;  3C21 A;  4HYK A;  2J6U A;  4UD4 A;  4R65 A;  1DOQ A;  3C23 A;  3K75 D;  5CA7 A;  1UT5 A;  5KFE A;  5KG5 A;  4RQ6 A;  5CP2 A;  3M8R A;  2JZB A;  4DFM A;  3AU6 A;  4DLG A;  2H5X A;  3RBD A;  2C2D A;  3LWM A;  1MQ2 A;  2IA6 A;  1CUK A;  3C5G A;  7ICH A;  9ICK A;  3LWL A;  3HP6 A;  2W9A A;  5J0S A;  4DFP A;  2W9C B;  4I2A A;  4Q8F A;  3OV7 A;  2ZH7 A;  4PGX A;  1SL0 A;  1S0N A;  2BCR A;  7ICP A;  1JXE A;  1WCN A;  4QZG A;  4I2C A;  2JEG A;  4BWM A;  4MEX A;  2F1J A;  4IG8 A;  2NRZ A;  4FS2 A;  4DSJ A;  7ICV A;  4KLU A;  3WFQ E;  4DL2 A;  3TAQ A;  1DK3 A;  4EZ6 A;  7ICN A;  1NK4 A;  8ICN A;  5KT5 A;  4JWM A;  5JUM A;  1R8A A;  7ICQ A;  4UB4 A;  8ICA A;  5KFR A;  3C18 A;  2ZH1 A;  1D8Y A;  4MEY A;  4MF2 A;  3RH5 A;  4KLG A;  2ASJ A;  1T3N A;  3RRG A;  5EWF A;  1UA1 A;  4K4G A;  3SZ2 A;  1BPY A;  8ICK A;  4J9L A;  4WC1 A;  4B9N A;  1ZQX A;  5DG9 A;  2R8I A;  5J29 A;  2V9W A;  3ZDA A;  5IIL A;  3RJJ A;  2M9N A;  3EPI A;  1RXW A;  4DWI A;  1U48 A;  3ETL A;  4UBB A;  2DFL A;  5KFM A;  4IQT A;  2XGQ A;  4FBU A;  2ALZ A;  4I2B A;  4Q8E A;  3H37 A;  1WCL A;  4KLE A;  4WC7 A;  3L9D A;  2KN7 A;  4J9R A;  3BQ1 A;  1BNP A;  5DBB A;  4RT3 A;  3ISD A;  4C8N A;  1S0O A;  4UD5 A;  3BQT A;  1D9F A;  4JV1 A;  1D8L A;  4LVS A;  3Q8K A;  4WC0 A;  3UXN A;  4M6W A;  4UB1 A;  3AQN A;  4RNO A;  1XSP A;  4FHX A;  4AT9 A;  2HHP A;  3RB4 A;  4ELT A;  2W9B B;  5F2V O;  4F4W A;  2GWS A;  4NLK A;  1KFD A;  9ICB A;  3TI0 A;  3MAB A;  3OHA A;  1ZYQ A;  3H8J A;  5HRF A;  1NO5 A;  1X2I A;  4ATB B;  4F2S A;  8ICL A;  4I2G A;  4IR9 A;  4DL7 A;  8ICW A;  2PFQ A;  4F4Z A;  4DL4 A;  4FHY A;  1L3T A;  4PGQ A;  4K4H A;  4DO9 A;  4QZB A;  2AQ0 A;  5KT2 A;  1ZET A;  2C28 A;  3MR5 A;  4YD2 A;  8ICT A;  2FLP A;  4YG2 A;  5J2J A;  1U4B A;  4QW9 A;  2FMS A;  4AT7 B;  4UQG A;  1N48 A;  3WFR E;  1NJX A;  5HMM A;  4RQ4 A;  5DQH A;  4ECT A;  3HJ1 A;  3RTV A;  3HIY A;  1QLN A;  4PH5 A;  5J2F A;  1PX5 A;  4EBJ A;  3PX4 A;  4WBY A;  3SV4 A;  3PY8 A;  1ARO P;  5IIN A;  4O3N A;  4X0B A;  2HVH A;  1Z00 B;  2IMW P;  4YR0 A;  3WFO A;  4R8U B;  4M0A A;  4FHW A;  1S76 D;  3RAQ A;  4RZR A;  1XO1 A;  4Z6F A;  4XA5 A;  8ICJ A;  4F5O A;  7ICI A;  1KEJ A;  5DDY A;  4P4O A;  1MIY A;  4I2I A;  4TQS A;  3TAN A;  1TKD A;  4DOC A;  3FYH A;  3BJY A;  5HHI A;  3C2K A;  8ICV A;  3H4B A;  3C66 A;  1NJY A;  4QW8 A;  4IQU A;  8ICU A;  7ICU A;  2JZB B;  2RDI A;  4ELV A;  3RB0 A;  1RXV A;  1NJZ A;  4RQ8 A;  4DQQ A;  3PVX A;  4P2H A;  4UAY A;  3HT3 A;  2MAX A;  4DS5 A;  4EBD A;  1KRP A;  1CEZ A;  4QWE A;  2ZJ5 A;  7ICF A;  1SL1 A;  5J0W A; 
#chains in the Genus database with same CATH topology
 3RR7 A;  4PGY A;  4DOB A;  2HBK A;  5ALQ A;  4K97 A;  2ZIW A;  1IXR A;  1C7Y A;  1V97 A;  1B4F A;  4EGW A;  2AHO B;  4RNN A;  2Y9U A;  1SWW A;  2FPK A;  4YP3 A;  4KLM A;  4MFC A;  2KZM A;  4WC4 A;  1EXN A;  4O9M A;  9ICP A;  5J2G A;  1Z3E B;  2FCL A;  7ICG A;  1TK0 A;  4OAG A;  5HRL A;  3H40 A;  2HHV A;  1J2N A;  3PW5 A;  3M1Y A;  2R8K A;  4RQ5 A;  3ZDD A;  1NKB A;  1Q3U A;  4UAU A;  4MFF A;  2HVI A;  2LYA A;  2F3N A;  1WYG A;  1VJ7 A;  3QEB Z;  2HCF A;  2KVS A;  5ALT A;  5B5E U;  2WB1 F;  4ZH4 A;  5ALV A;  4ECU A;  2E5S A;  3RH4 A;  4C4R A;  1ZQA A;  2NRT A;  2UVU A;  5ALO A;  2ZUD A;  3T5J A;  5J2I A;  5AM3 A;  2C2R A;  4F8R A;  2GOL A;  4EX6 A;  2G07 A;  4QZC A;  1U49 A;  3OVS A;  2ZH6 A;  1BPD A;  4RWN A;  4ECV A;  3CRX A;  2XY6 A;  4DF8 A;  5CFS A;  1DGJ A;  2RFF A;  2DUY A;  1QH9 A;  4OD0 A;  1A76 A;  4F71 A;  1TAQ A;  5KFG A;  5KAI U;  4I2E A;  1ZQT A;  5KT3 A;  4I2D A;  1ZQU A;  3JCF A;  1ZOL A;  1KN5 A;  2AGP A;  4K99 A;  1NNL A;  2KZ3 A;  1LV5 A;  1T8E A;  3QU2 A;  1QSL A;  3PO4 A;  2Q4T A;  3LVW A;  3IV6 A;  4BXO A;  2IHN A;  3TAD C;  4OJO A;  5DB6 A;  1TFY A;  1SXD A;  1XWL A;  5AK4 A;  4NKT A;  9ICJ A;  1NI3 A;  2BZF A;  1ZQF A;  5CHE A;  2ZUC A;  1ZQG A;  5DGA A;  2P66 A;  3V6J A;  2W9M A;  2BGW A;  4WC5 A;  2YMM A;  4DQR A;  5D4B A;  1GPJ A;  3IDW A;  5HRB A;  1RYU A;  5KFS A;  4R63 A;  1SV0 A;  2HHQ A;  4X4T A;  2PMZ F;  2BCQ A;  3B0X A;  3LDA A;  2W55 A;  4JWN A;  4WCW A;  4BGD A;  5ALR A;  3Q8L A;  3EF2 A;  2EAP A;  3G6Y A;  1OU5 A;  1L7M A;  1TFW A;  3BDP A;  4M04 A;  1ZQB A;  3MGV A;  1L3S A;  1KFS A;  4X4N A;  2G09 A;  4F92 B;  4PPX A;  1ZQP A;  5C0Y A;  4RQ1 A;  3PV8 A;  3N97 B;  5J2H A;  4Q44 A;  4ED2 A;  4UB3 A;  3M9O B;  3HWT A;  3LK9 A;  1M6Y A;  2AXT U;  4X5V A;  5AKJ A;  4YFK A;  2KTQ A;  2KIV A;  4QZ9 A;  4G9B A;  2Y1J A;  1FFV A;  2K89 A;  1BVS A;  3C29 A;  4YN4 A;  5AHX A;  4GLX A;  8ICE A;  4ED8 A;  5AM1 A;  2DF4 B;  5D61 A;  2KE7 A;  3UMB A;  4UB5 A;  1RYS A;  1DGS A;  4E7X A;  5KT6 A;  2KHV A;  4QZI A;  2ZIU B;  3N4M B;  4QIW C;  1MN8 A;  3UXO A;  1NK8 A;  2J6T A;  2KFZ A;  1ZD2 P;  1O08 A;  4RQM A;  1XO0 A;  1ZQO A;  2RDJ A;  1U9L A;  1YZ6 A;  2K8B B;  4QZA A;  5D49 A;  5B3Q A;  1UA0 A;  1S97 A;  3AQF A;  2FMQ A;  3I1Y A;  4RWO A;  1AQ6 A;  4CE6 A;  2KMD A;  3HKZ C;  4C8O A;  2FLL A;  3L3F X;  3N7S C;  1RM6 C;  1Y88 A;  2B56 A;  5KFZ A;  4YXJ A;  1SXE A;  4FZN A;  5KFC A;  1L5U A;  2ZHB A;  5AK3 A;  5J2K A;  3H8M A;  2R8G A;  5KFO A;  4K9A A;  1LKY B;  5C5J A;  1FO4 A;  3PSI A;  2HOQ A;  2BBJ A;  5GTH U;  4WQL A;  4ED1 A;  4XRH A;  2IHM A;  1NK6 A;  9ICQ A;  4RQ2 A;  5EWE A;  2YB1 A;  3IG5 A;  3F5E A;  4ZOH C;  1MIV A;  4E8F A;  1COO A;  2HBJ A;  3ZD9 A;  2JH7 A;  2BKE A;  4G3I A;  4KN4 A;  4YR2 A;  4IS7 A;  2PXI A;  4NLC A;  4PHE A;  4WH5 A;  2NRX A;  4J9P A;  1JRP A;  2E1F A;  4E0D A;  3TAP A;  1UEU A;  5F9L A;  4IL6 U;  2ZTC A;  1VFG A;  2HHX A;  4JB3 A;  2PFN A;  4EEL A;  1JUD A;  3M6K A;  4KLF A;  1DRG A;  4KLL A;  4GXI A;  2XC9 A;  1L7P A;  2FJ6 A;  2RP5 A;  3BZC A;  2JMG A;  3JPO A;  1PK3 A;  2V4Q A;  3JPS A;  5KAF U;  3JPR A;  4AP9 A;  4PHP A;  2KJ9 A;  5HRE A;  4EEY A;  5AI8 A;  4RUA A;  3H8S A;  4Z6E A;  4DLE A;  2O6K A;  7ICM A;  2WFA A;  1GO3 F;  4CRX A;  1S0V A;  2AGO A;  3QZ7 A;  4O3Q A;  2ZHA A;  2D8C A;  4ELU A;  1DXS A;  8ICM A;  4Y2T A;  5AKZ A;  3SAF A;  5H2F U;  3ZI4 A;  4TUP A;  1L3U A;  4MF8 A;  5ALY A;  9ICS A;  1S8O A;  1T94 A;  4PHA A;  2M2V A;  5F9N A;  2CXY A;  1NJW A;  4ACO A;  5J0P A;  3GQC A;  3PSF A;  1SWV A;  4B9L A;  2C2E A;  9ICG A;  4X0A A;  4FO6 A;  3TAD A;  3PX6 A;  3MFH A;  1FFU A;  4FH5 A;  1JXL A;  1MIW A;  3PNC A;  3RJK A;  8ICZ A;  4F50 A;  3M6Z A;  4UB6 U;  5CA7 A;  1ZQJ A;  3I76 A;  1YLQ A;  4IC9 A;  3C5G A;  2K4P A;  3T79 A;  4DFP A;  2W9C B;  5J8Y A;  1SL0 A;  3NAS A;  1WCN A;  4I2C A;  2KV2 A;  4IG8 A;  2QB0 B;  1C20 A;  1NK4 A;  5KT5 A;  4EV6 A;  4JWM A;  5JUM A;  4F72 A;  4UB4 A;  1D8Y A;  4KLG A;  5EWF A;  3A0B U;  1UA1 A;  2LMR A;  3SZ2 A;  3NRW A;  5AM0 A;  3ZDA A;  4DWI A;  3K1Z A;  4UBB A;  3KOO A;  4I2B A;  4Q8E A;  1WCL A;  2ZXI A;  1BNP A;  3KKA A;  1N62 A;  5AKG A;  3CK6 A;  2NO4 A;  4RNO A;  3AL0 B;  9ICB A;  3MAB A;  3OHA A;  1UQV A;  2LM1 A;  1VDV A;  3H8J A;  3CP8 A;  4F2S A;  3CNH A;  4IR9 A;  4DL7 A;  4OJ5 A;  1P7D A;  8ICW A;  4PGQ A;  4K4H A;  4QZB A;  5KT2 A;  2WB1 C;  2C28 A;  3NVO A;  2FMS A;  1Z1V A;  4QW9 A;  3WFR E;  5HMM A;  2YN4 A;  4ECT A;  3RTV A;  3HJ1 A;  2A1A A;  1L7N A;  4EBJ A;  3PY8 A;  1ARO P;  4O3N A;  3QUT A;  1Q8K A;  4R8U B;  4OJL A;  8ICJ A;  2IHO A;  4P4O A;  2F76 X;  4I2I A;  2NYV A;  3H4B A;  3WKB A;  2RDI A;  1S5L U;  4NL9 C;  1CEZ A;  2MAX A;  3SMV A;  4QWE A;  4N7R A;  5L9X A;  1BPE A;  5BPC A;  5DG7 A;  2EZZ A;  3QU9 A;  5KFP A;  2Y0S F;  1X6J A;  3VCB A;  4TUQ A;  4EZ9 A;  3OWG A;  4EP7 A;  2HHU A;  2HHW A;  7ICE A;  3D2S A;  4J9O A;  4UAS A;  5CJ7 A;  4U6P A;  4I29 A;  3H0L B;  4QWC A;  2P6U A;  5DLF A;  3F5A A;  9ICW A;  3ISB A;  3KTQ A;  4GC6 A;  1HUO A;  2ISO A;  2AH5 A;  4M6W B;  4K8V A;  3WFP A;  3AQM A;  1TK8 A;  2NO5 A;  2BPF A;  2D6F C;  1WUD A;  4I2J A;  2IOF A;  4WJ3 B;  1R89 A;  3TAR A;  4X4U A;  2KSO B;  2B21 A;  1K5O A;  1PUZ A;  2KG5 A;  3AQE A;  3ALR A;  3C1Y A;  3PW4 A;  4XQ7 A;  4DL3 A;  5AM4 A;  2JEF A;  2WAQ F;  1ZRN A;  3TQ1 A;  5J0T A;  2HHT A;  3N7P D;  3PX0 A;  4Q43 A;  1OW5 A;  1A77 A;  1KW4 A;  5AI0 A;  4ED0 A;  4J03 A;  4ECY A;  5HRK A;  4S3N A;  4DSE A;  4IQV A;  2XID A;  1KFT A;  3Q8M A;  5DEC A;  1XU4 A;  2K60 A;  2F2A B;  2C22 A;  3Q8P B;  2ZIU A;  2EH9 A;  2DPJ A;  3RJG A;  5J2D A;  5KTQ A;  2IBK A;  3KBB A;  2GH1 A;  5BOM A;  3NTU A;  1TAU A;  3QUB A;  1S77 D;  4NM2 A;  2ZH9 A;  3OGU A;  2KZZ A;  4Y2V A;  4EX7 A;  1Z19 A;  2G5H B;  3EPG A;  3KHR A;  2JV3 A;  3NUQ A;  5KG6 A;  4DFK A;  1RZT A;  3GFK B;  5J2E A;  4M5D A;  5AIC A;  1X66 A;  4KX5 A;  1Z4N A;  3QYP A;  3WU2 U;  5IIM A;  4PHD A;  4KM5 A;  2ZTD A;  2R8H A;  5J0U A;  2MUT B;  1LKY A;  2K8A A;  3TAC B;  3WKC A;  2BE3 A;  4USA A;  3M9N B;  4DS4 A;  2BPG A;  3WKA A;  4BX9 C;  5AKY A;  1WG8 A;  5KFN A;  7ICK A;  3NYB A;  4ECR A;  3V72 A;  4X4Q A;  2DRB A;  4FBT A;  9ICL A;  4Z6C A;  1DK2 A;  3BS5 A;  1L7O A;  4O6A A;  3OVB A;  3QXG A;  3AQL A;  3SEI A;  4C8L A;  4DCC A;  4GFJ A;  1X9M A;  1SKW A;  3JYY A;  3RBE A;  5ALL A;  3UQ0 A;  3T5H A;  2DRA A;  2LPE A;  5T14 A;  5ALH A;  1MC8 A;  4O3R A;  2A1J B;  1S0M A;  1H38 A;  1JIH A;  3QU7 A;  2E8N A;  5KG0 A;  1NK0 A;  1V4A A;  2F77 X;  3H4D A;  1N5W A;  4Q45 A;  3UMG A;  3V7L A;  3FAH A;  3MR2 A;  4RPZ A;  3QUQ A;  1ED1 A;  4NXX A;  3IHQ B;  4JLZ A;  1COK A;  4ED6 A;  4NXV A;  7ICS A;  8ICI A;  2KHQ A;  5EE9 A;  2YMQ A;  4DSL A;  3ZD8 A;  4UAW A;  1ZRM A;  2D3D A;  5ALU A;  4ED3 A;  3QU5 A;  4ED7 A;  4UW9 A;  5L1I A;  1QSS A;  4QWA A;  3MR6 A;  5KFV A;  5KT7 A;  1JMS A;  2ATL A;  1FA0 A;  1R8B A;  4C0Z A;  2WF6 A;  1HIW A;  3GV7 B;  2FE9 A;  1PZN A;  3ZDB A;  1WWU A;  2WF5 A;  3C28 A;  4J9N A;  3V6H A;  4DSK A;  4BDP A;  5DB9 A;  3G6X A;  2H3I A;  3GIL A;  1NOM A;  3ZDC A;  3NKU A;  2EQY A;  5AKH A;  5JTG A;  4TQR A;  5HRG A;  2PBE A;  4Y2P A;  3TFS A;  5KFY A;  2VIX A;  3S6J A;  5EOZ A;  5AI6 A;  4O3M A;  2GA9 D;  4O3O A;  3ONN A;  4FHV A;  4BUG A;  1ZQK A;  1O03 A;  1TV9 A;  1LB2 B;  3LQC B;  5KFK A;  2W9C A;  1KLN A;  3WK7 A;  3PW2 A;  3OUY B;  1SL2 A;  2QB0 A;  4CF5 A;  1TFR A;  1JRO A;  3ED5 A;  4ECS A;  5EWG A;  4DSF A;  5JU5 A;  2E8M A;  1QQ7 A;  9ICH A;  2FPL A;  2ZJ8 A;  4YMM A;  3RJF A;  1ZQV A;  4J9Q A;  4TUS A;  4B9U A;  1KDH A;  3EYZ A;  5J0X A;  7ICL A;  4PZN A;  1BPZ A;  4M9N A;  1ZQM A;  3V6K A;  5DG8 A;  3PHZ A;  2FPM A;  2W04 A;  2NV3 A;  4ICA A;  4RPX A;  2DWQ A;  2QAR B;  5KFL A;  2M2W A;  2Q66 A;  2A3V A;  2NRK A;  2VA2 A;  1HJP A;  1UET A;  2OM6 A;  2BQ3 A;  3HX0 A;  3RJE A;  2MA1 A;  1N63 A;  1ZD4 A;  2BPC A;  1KSP A;  3NVV A;  5AKK A;  3EZ5 A;  1JX4 A;  1MQ3 A;  1ZQQ A;  1BPB A;  3QE9 Y;  1UCV A;  4UAR A;  3WK9 A;  4F2R A;  4OAH A;  3OSN A;  1RQL A;  1J2M A;  5CFU A;  4NXZ A;  5KL8 B;  3JPP A;  5KG4 A;  3PML A;  2KD1 A;  8ICF A;  1SV4 A;  4XUS A;  3WK4 A;  4LT6 A;  1X9X A;  3TFR A;  2BQR A;  4NJ8 A;  1UPH A;  2XIC A;  2BR0 A;  4F5N A;  4QJF B;  4RQN A;  4KLO A;  1N5X A;  3FM9 A;  1Q79 A;  1N56 A;  2AJQ A;  4Z6D A;  4R8U A;  4CF3 A;  4EBC A;  2GO7 A;  3GIJ A;  3ORY A;  5DGB A;  4YCX A;  1IG6 A;  3SI8 A;  2WF8 A;  4NWI A;  5TZV A;  4UD4 A;  2J6U A;  3K75 D;  1UT5 A;  5KFE A;  3M8R A;  4RQ6 A;  4DFM A;  2YML A;  1MQ2 A;  3F2B A;  3LWM A;  4OJP A;  2CN1 A;  1RQN A;  4I2A A;  5JRT A;  3L5K A;  4XJE A;  3OV7 A;  2ZH7 A;  2OYY A;  1S0N A;  7ICP A;  1JXE A;  4QZG A;  4EEK A;  1IIP A;  4FS2 A;  4DSJ A;  2LBO A;  1DK3 A;  8ICN A;  4FZM A;  4DFD A;  1R8A A;  7ICQ A;  2W7P A;  2I6X A;  4MEY A;  4MF2 A;  3RH5 A;  2ASJ A;  2Y0S C;  4WC1 A;  1ZQX A;  2KK0 A;  3NWI A;  5J29 A;  2V9W A;  2JH1 A;  2M9N A;  2LKY A;  3ETL A;  2EWR A;  4FBU A;  5KFM A;  3N28 A;  4IQT A;  2XGQ A;  2ALZ A;  5G5H A;  2KN7 A;  2YX8 A;  4RT3 A;  3ISD A;  4UD5 A;  1D9F A;  5AIA A;  4WC0 A;  2FDR A;  4M6W A;  5AI9 A;  1SIJ A;  3AQN A;  2QKQ A;  1XSP A;  4FHX A;  4EEB A;  4ELT A;  1SGG A;  5KL1 B;  2W9B B;  5F2V O;  4F4W A;  2GWS A;  2P35 A;  2ZG6 A;  1ZYQ A;  2KSO A;  4UAT A;  8ICL A;  4FHY A;  2PFQ A;  4DL4 A;  2AQ0 A;  4YG2 A;  1U4B A;  4CDG A;  3NVZ A;  1N48 A;  1RG6 A;  2BDU A;  5ALS A;  1NJX A;  5DQH A;  3HIY A;  2KVC A;  4LJX A;  4PH5 A;  5J2F A;  1PX5 A;  4LEW A;  3PX4 A;  4A8E A;  5IIN A;  4P0Q B;  4YR0 A;  1S76 D;  3RAQ A;  2WAQ C;  4RZR A;  1XO1 A;  4F5O A;  2JR5 A;  2VKQ A;  3FC4 A;  4DOC A;  8ICV A;  3CW2 C;  4IQU A;  8ICU A;  2JZB B;  4ELV A;  1RXV A;  1NJZ A;  4DQQ A;  3U26 A;  2YY6 A;  4O68 A;  1KRP A;  3RF9 A;  2ODG A;  4HAI A;  4F3O A;  2LYH A;  5ALW A;  5HR9 A;  3RFA A;  9ICU A;  1RDF A;  4P0P B;  2G0A A;  2NRV A;  2GLE A;  5HR6 A;  1UHU A;  4R64 A;  5KFF A;  1MA7 A;  3THV A;  4KIT B;  4B6J A;  1Q3V A;  4Y2Q A;  1ECW A;  2E8P A;  4O69 A;  4US8 A;  4B9T A;  4RWQ A;  2UVW A;  2OCE A;  1ZQI A;  2M2T A;  1SKR A;  2MUT A;  3KHH A;  2ZH8 A;  1SZP A;  2ZIV B;  3QUC A;  4O3P A;  1F5A A;  3IM1 A;  1A6S A;  4RNM A;  5AK5 A;  4AYB F;  3ERC C;  8ICH A;  3H0R B;  2RQ5 A;  2DR5 A;  3M7D A;  5KG2 A;  5HRH A;  3SQI A;  2EZX A;  3MGI A;  3JPT A;  2BDP A;  2OEH A;  2ES6 A;  3OTQ A;  4P4P A;  1V38 A;  4MFA A;  1SB3 C;  2M0N A;  4IR1 A;  4WQK A;  2KNJ A;  4YMN A;  3WKE A;  2AGQ A;  2ZXH A;  4GC7 A;  2UVR A;  4F93 B;  4KLI A;  2A1J A;  4JV0 A;  3PR4 A;  5J2C A;  5EE3 A;  4YR3 A;  1T4G A;  9ICO A;  3D2N A;  2G08 A;  1F0M A;  2LHT A;  4M9H A;  2HI0 A;  5GTI U;  3KHL A;  4YMO A;  4KLQ A;  4DSI A;  2ZUB A;  5KFB A;  3WKD A;  1KBU A;  3AMZ A;  5BOL A;  4M9L A;  1R8C A;  1F5S A;  3OJS A;  3MR3 A;  3KZI U;  5AM5 A;  1VLB A;  3B9J A;  4AT8 B;  4JUZ A;  4DQP A;  1NK9 A;  4GXK A;  4LZD A;  5ALN A;  4NLB A;  4YVZ A;  4LZG A;  4LEV A;  2ASD A;  3KHG A;  3FDS A;  3SV3 A;  3SYZ A;  2G5I B;  1U45 A;  5DB7 A;  4I27 A;  1Q46 A;  3NVY A;  1JN3 A;  1V85 A;  4DQS A;  2EAO A;  2YB4 A;  4Y2Y A;  4RU9 A;  3F53 A;  3RRH A;  3C2L A;  1T7P A;  3PMN A;  3DV9 A;  1ZJM A;  5CB1 A;  3C2M A;  2Y9T A;  2K4H A;  1Z1B A;  5CHG A;  9ICM A;  2KEY A;  2XO7 A;  1X9S A;  3PSP A;  5KFA A;  3K7D A;  3Q8Q B;  2KIC A;  4EED A;  1B0X A;  1TVA A;  3D6J A;  3OUY A;  2KKP A;  4WC2 A;  3WK8 A;  4EYH B;  1SKS A;  2VA8 A;  2DGZ A;  2JEI A;  3BZK A;  1PK1 B;  4J9K A;  5TIS U;  4C8K A;  3OSP A;  4EBE A;  4RQ7 A;  1NKC A;  4F4K A;  3V7K A;  3ER9 B;  3H0M B;  4B9V A;  2L5Y A;  3H39 A;  3DEE A;  5KFQ A;  4ECQ A;  1Q78 A;  1K1Q A;  4IRC A;  2QAR A;  4EBK A;  4WBZ A;  4US9 A;  3SAH A;  4I2F A;  1ZQ1 C;  3ZDE A;  3T5L A;  2M2U A;  4CGZ A;  3BQ0 A;  1SV0 C;  4C7Y A;  3ICX A;  3N7R C;  4I2H A;  5AIB A;  3M8S A;  8ICO A;  2YTU A;  4JV2 A;  2PI4 A;  2OHF A;  5J0Y A;  3C1Z A;  3QEA Z;  5JTI A;  2JHD A;  3QZ8 A;  2Y1I A;  4PL1 A;  4QZE A;  4FHP A;  2FMP A;  9ICT A;  4E80 A;  5HP4 A;  2VJ5 A;  1ZQH A;  5E79 U;  1ZJN A;  3GII A;  1ZQW A;  4RQ0 A;  4O5K A;  3E2E A;  2O5A A;  2UVV A;  4DEZ A;  3K4G A;  9ICF A;  2ZTE A;  3GV8 B;  4CF4 A;  5DB8 A;  1UEV A;  2ID1 A;  1K1S A;  3LYS A;  4C8M A;  2FLN A;  2MRL A;  4Y2S A;  1L3V A;  4O5E A;  5DLG A;  4O5C A;  3J81 j;  1ZXI A;  9ICX A;  1QTM A;  2BQU A;  4Y2U A;  2BCS A;  4IRD A;  2W3S A;  1JQR A;  2F1I A;  8ICS A;  1YZ7 A;  4DL6 A;  2AQ4 A;  4KLD A;  3EW9 A;  8ICB A;  2DPI A;  5KFU A;  8ICC A;  2EAN A;  5K4L A;  4K4I A;  2O1P A;  1N60 A;  1URJ A;  3EWA A;  1IM4 A;  5HR7 A;  2MSN A;  3K1R B;  5ALX A;  1PVP A;  3PW7 A;  1NZB A;  2ZH4 A;  3F2D A;  3OVA A;  2W3R A;  4JMU A;  3ETR A;  4KX3 A;  2W9B A;  5HNK A;  2KJ5 A;  4P4M A;  3OJU A;  4UAZ A;  2PI5 A;  3R9K A;  1NKE A;  4X4P A;  4C4S A;  1X42 A;  2QB1 A;  2XY5 A;  3UMC A;  4QWD A;  3GIK A;  1ZQS A;  5DBC A;  2DKZ A;  4QZF A;  1VJ5 A;  5KNI A;  1MSW D;  5L1K A;  3RJI A;  1ZQE A;  4K9B A;  5DQG A;  3MBY A;  3V7J A;  5IIK A;  2G06 A;  4KLS A;  2IOH A;  5KFX A;  5J0O A;  1NK5 A;  4BWJ A;  4RWP A;  5KFJ A;  4P0Q A;  4KMU A;  1BPX A;  1RPL A;  5HC9 A;  2W03 A;  5EE0 A;  3OHB A;  4DOA A;  2RLT A;  3C21 A;  1DOQ A;  3C23 A;  5KG5 A;  3KFU F;  2JZB A;  3AU6 A;  2JGA A;  5CFT A;  2H5X A;  3LWL A;  2YMP A;  3HP6 A;  4MHV A;  2B0C A;  2KJ8 A;  4Y2R A;  4PGX A;  2E3T A;  3BQ7 A;  5ALG A;  1CI4 A;  7ICV A;  3TAQ A;  5FP0 A;  1F44 A;  4P0P A;  3SR6 A;  5CRX A;  1OUQ A;  8ICA A;  4NL9 A;  5KFR A;  1Z4O A;  3PST A;  1BPY A;  4J9L A;  1WWV A;  3PZP A;  2R8I A;  3RJJ A;  4FZL A;  1RXW A;  4NV0 A;  4X4S A;  4Y2X A;  4WC7 A;  4KLE A;  3OPX A;  1FEZ A;  2B51 A;  4J9R A;  2HMX A;  5DBB A;  4C8N A;  3BQT A;  4JV1 A;  1D8L A;  2MU2 A;  3UXN A;  4UB1 A;  2ZIV A;  2A19 A;  2HHP A;  3RB4 A;  5ALK A;  3SEN A;  3QX7 A;  1D8B A;  1X2I A;  2RHF A;  4ATB B;  4I2G A;  1QCK A;  4AYB C;  4DO9 A;  4AT7 B;  2FLP A;  2HOI A;  4UQG A;  4RQ4 A;  1QLN A;  4LEY A;  3SV4 A;  2ESE A;  1A0P A;  1J97 A;  1Z00 B;  2ZIX B;  2W7O A;  3WFO A;  4M0A A;  5J8Y C;  4Z6F A;  1KEJ A;  5DDY A;  1XNS A;  4OO1 J;  3TAN A;  5B66 U;  3BJY A;  1OXJ A;  1T3Q A;  5HHI A;  3C66 A;  1NJY A;  4QW8 A;  4U7C A;  2H3Z A;  3PVX A;  4P2H A;  4UAY A;  4DS5 A;  2F44 A;  2ZJ5 A;  7ICF A;  4NY8 A;  4WC3 A;  4OJ6 A;  3JPQ A;  3HW8 A;  1HUZ A;  3E0F A;  3TKA A;  5KFT A;  1NK7 A;  4KN7 A;  3UPQ A;  1CRX A;  4TUR A;  3KKA C;  4QZH A;  1ZQR A;  4AT8 A;  5KFD A;  3WK6 A;  2BHN A;  3UPS A;  2J6S A;  7ICR A;  1JI7 A;  9ICI A;  2VA3 A;  4KTQ A;  5L1J A;  5III A;  3MFI A;  4HX0 A;  3HIL A;  4NLZ A;  8ICY A;  3MDC A;  3GIM A;  4AT9 B;  4UB8 U;  1ZQZ A;  2EZY A;  5IIJ A;  2GAF D;  1L8O A;  4NM1 A;  3T5K A;  2DL0 A;  5CWR A;  1QQ5 A;  9ICR A;  4M47 A;  4O3S A;  4K96 A;  5IIO A;  2KKV A;  2I9G A;  5HHH A;  2W11 A;  3PO5 A;  5L1L A;  2E1E A;  2RRD A;  1ZQD A;  3GDX A;  2F8K A;  4X4R A;  5AI4 A;  2E8O A;  3UQ2 A;  5DQI A;  4OAI Z;  3HRD D;  5J0R A;  1RYR A;  5B3P A;  3RB3 A;  3IRU A;  3F2C A;  1PK1 A;  4GXJ A;  9ICA A;  1ZQN A;  3G6V A;  1ZQC A;  3B0Y A;  5CEH A;  4J9S A;  1QSY A;  8ICX A;  4DQI A;  4UB2 A;  2Q0Z X;  1ZD5 A;  3M9M B;  2PFP A;  3PW0 A;  1BNO A;  3ISC A;  1NZP A;  2WF9 A;  5J0Q A;  4Y2J A;  4YXM A;  2JEJ A;  1JAL A;  4FFD A;  1TE2 A;  7ICJ A;  8ICQ A;  2XCP A;  3RR8 A;  3AU2 A;  2WTF A;  2ZIW B;  3WK5 A;  4UBC A;  1X9W A;  4F5Q A;  4NXT A;  4K98 A;  3BS5 B;  1KTQ A;  2KFN A;  2HW3 A;  1X40 A;  2K4E A;  5ALP A;  2HBM A;  2PFO A;  7ICI A;  2BCU A;  5L1M A;  2BCV A;  1SZH A;  4LEZ A;  4OCZ A;  3KD3 A;  1V9P A;  5J2B A;  4NKU A;  1B22 A;  2ZJA A;  1JAJ A;  2XY7 A;  3RB6 A;  3IP4 B;  1N61 A;  1BGX T;  3PR5 B;  2W8K A;  1KKX A;  1PVQ A;  4R66 A;  3SAG A;  3AQK A;  4I0U A;  4RPY A;  3RJH A;  9ICC A;  2K8C B;  3T3F A;  8ICP A;  3MDA A;  1U47 A;  4FE3 A;  2H3V A;  4X4O A;  2JRZ A;  2HOF A;  4JK1 A;  4RT2 A;  2XCA A;  2W8L A;  1XSL A;  2I5H A;  2ISP A;  5KFI A;  1KNY A;  1TAM A;  4KLJ A;  1QQ6 A;  5ALJ A;  2XI9 A;  3NGD A;  1B43 A;  4B9M A;  3O0F A;  2F1H A;  4X4V A;  2B4V A;  2KP7 A;  4NLG A;  3GV5 B;  9ICE A;  5DKW A;  8ICR A;  4YD1 A;  4RUC A;  5F3X B;  4M9J A;  2HHS A;  5KFW A;  4YQW A;  3D2Q A;  3BQ2 A;  5DED A;  1ZQL A;  5HRI A;  2DR8 A;  1S9F A;  3Q8S B;  2ZH2 A;  3WFS C;  2H3F A;  7ICT A;  5J2A A;  5DBA A;  3AUO A;  1XSN A;  4KLH A;  4BXO B;  5AKL A;  1X6I A;  4M9G A;  5AM2 A;  3JZ0 A;  1KQQ A;  2F8L A;  5KG3 A;  2AU0 A;  4EYI B;  2DKX A;  1HEK A;  4ECW A;  2HSZ A;  1ZD3 A;  2XVT A;  1WOT A;  3Q8R B;  2FI1 A;  5AKX A;  2JXJ A;  4CCH A;  4ECZ A;  4IRK A;  5KFH A;  2XGP A;  3C5F A;  3A0H U;  4C7Z A;  3GZF A;  5CR0 A;  3AEV A;  3H8W A;  9ICN A;  4DFJ A;  4ECX A;  2P6R A;  8ICG A;  5KG7 A;  2VAN A;  2R8J A;  1FIQ A;  1N2X A;  2H3Q A;  2ZH5 A;  2CPR A;  3RAX A;  4KLT A;  4XQ8 A;  4C80 A;  2R18 A;  2B6G A;  5D46 A;  5HRD A;  5ALE A;  3AM9 A;  2VJ4 A;  4O0I A;  2LYB A;  2DR9 A;  3HJ4 A;  2K4I A;  3GU3 A;  4GIB A;  4FS1 A;  2PKE A;  4UAV A;  4DF4 A;  3H3A A;  4NLN A;  1YT3 A;  2I1Q A;  2KIW A;  2LI6 A;  2DR7 A;  4F4Y A;  5HML A;  5DDM A;  3MCR A;  2DQN B;  2N1R A;  5AKI A;  3MC1 A;  4M2Y A;  3HJE A;  4C4T A;  3H7I A;  4QNL A;  2DBY A;  4QIW F;  4QWB A;  1S10 A;  2LM4 A;  2YQE A;  1UT8 A;  3E58 A;  4F91 B;  1XS9 D;  3QNM A;  5D63 A;  2V4R A;  2OH2 A;  3L4P A;  2EAM A;  3NS1 A;  3JPN A;  1D9D A;  4F5P A;  5KT4 A;  4WC6 A;  2ZH3 A;  3MGH A;  4NXW A;  4JLX A;  1L6N A;  3H38 A;  2W43 A;  3RH6 A;  4CNQ A;  3HKZ F;  9ICV A;  1ZQY A;  1TK5 A;  4PZO A;  2OWO A;  2ASL A;  3HPO A;  4ATB A;  1KL9 A;  3BS7 A;  3EUB 2;  1L8L A;  1XC9 A;  4J9M A;  4IQW A;  2KOB A;  4NXU A;  3NVW A;  2Z7J A;  5ALD A;  4AT7 A;  2NRW A;  3SD7 A;  5KG1 A;  4QZ8 A;  4DL5 A;  4B9S A;  5A0L A;  2IUB A;  4QZD A;  1Z00 A;  2ZIX A;  4I28 A;  3DDH A;  5AK6 A;  4RQ3 A;  3UXP A;  7ICO A;  4FH3 A;  2DVI A;  4F4X A;  3KZX A;  4F5R A;  5EE1 A;  4HYK A;  4R65 A;  1IV8 A;  3RBD A;  5CP2 A;  2C2D A;  2IA6 A;  4DLG A;  7ICH A;  9ICK A;  1CUK A;  2PMZ C;  3AN1 A;  2W9A A;  5J0S A;  4Q8F A;  2W54 A;  2BCR A;  4PL2 A;  2JEG A;  4BWM A;  4MEX A;  2F1J A;  2NRZ A;  4KLU A;  2BBH A;  4DL2 A;  3WFQ E;  4EZ6 A;  7ICN A;  3NRZ A;  5ALI A;  3C18 A;  2ZH1 A;  3ER8 C;  4OAF A;  1T3N A;  3RRG A;  3IG8 A;  4K4G A;  4FO1 A;  8ICK A;  4KMO B;  4B9N A;  5DG9 A;  1PVR A;  5AKE A;  5IIL A;  2WHE A;  3EPI A;  1U48 A;  5ALF A;  2DFL A;  4PJ0 U;  3H37 A;  3L9D A;  3BQ1 A;  5ALM A;  1S0O A;  4LVS A;  3Q8K A;  4MKP A;  5D62 A;  4AT9 A;  5ALZ A;  2CRX A;  4O67 A;  4NLK A;  1KFD A;  3TI0 A;  5HRF A;  1NO5 A;  2WF7 A;  3VC8 A;  2HN2 A;  4WOY A;  4F4Z A;  1L3T A;  2HBL A;  1ZET A;  2HDO A;  3MR5 A;  4YD2 A;  8ICT A;  5J2J A;  2OXO A;  4BJQ A;  3LVV A;  3QU4 A;  4WBY A;  4EEN A;  4X0B A;  2HVH A;  5AI5 A;  2IMW P;  3IN5 A;  2HN1 A;  4FHW A;  4XA5 A;  5G5G A;  3UM9 A;  1MIY A;  4TQS A;  1TKD A;  3FYH A;  3C2K A;  1LVH A;  7ICU A;  4KB6 A;  3RB0 A;  4RQ8 A;  3I28 A;  2EDU A;  3HT3 A;  4EBD A;  2IOF K;  3CYM A;  2QLT A;  1SL1 A;  5J0W A; 
#chains in the Genus database with same CATH homology
 3JPQ A;  2LYH A;  3HW8 A;  1HUZ A;  5L9X A;  1BPE A;  4PGY A;  5BPC A;  4DOB A;  3RR7 A;  5HR9 A;  5DG7 A;  1IXR A;  1C7Y A;  9ICU A;  5KFT A;  5KFP A;  4RNN A;  4KLM A;  1NK7 A;  2FPK A;  4KN7 A;  4YP3 A;  3UPQ A;  2NRV A;  4TUR A;  4MFC A;  2KZM A;  4TUQ A;  4EZ9 A;  4QZH A;  1EXN A;  4WC4 A;  1ZQR A;  4O9M A;  4AT8 A;  5KFD A;  4R64 A;  4I28 A;  9ICP A;  4EP7 A;  5J2G A;  2HHU A;  5KFF A;  2HHW A;  7ICE A;  1Z3E B;  7ICG A;  4J9O A;  3THV A;  2BHN A;  4KIT B;  1TK0 A;  5CJ7 A;  4I29 A;  3UPS A;  2J6S A;  7ICR A;  3H40 A;  2HHV A;  5HRL A;  3PW5 A;  4B9T A;  2R8K A;  4RWQ A;  1TFW A;  9ICI A;  2UVW A;  4QWC A;  2P6U A;  2VA3 A;  4KTQ A;  1ZQJ A;  5L1J A;  4RQ5 A;  5DLF A;  1ZQI A;  3ISB A;  3KTQ A;  9ICW A;  5III A;  3ZDD A;  2M2T A;  4GC6 A;  3MFI A;  1SKR A;  2MUT A;  1HUO A;  3KHH A;  2ZH8 A;  1SZP A;  2ISO A;  4M6W B;  1NKB A;  3MDC A;  4NLZ A;  8ICY A;  3GIM A;  4O3P A;  4AT9 B;  4MFF A;  2HVI A;  1F5A A;  1ZQZ A;  3IM1 A;  5IIJ A;  3WFP A;  3AQM A;  4RNM A;  1TK8 A;  2BPF A;  1VJ7 A;  3QEB Z;  8ICB A;  4NM1 A;  4I2J A;  1R89 A;  3TAR A;  4ZH4 A;  4ECU A;  3T5K A;  8ICH A;  4X4U A;  2DR5 A;  5CWR A;  3RH4 A;  1ZQA A;  2B21 A;  2NRT A;  2UVU A;  9ICR A;  4M47 A;  4O3S A;  2ZUD A;  3T5J A;  5KG2 A;  5IIO A;  5J2I A;  2I9G A;  2C2R A;  3C1Y A;  4F8R A;  5HRH A;  3PW4 A;  5HHH A;  3MGI A;  3JPT A;  2BDP A;  4QZC A;  3OVS A;  1U49 A;  3PO5 A;  5L1L A;  4XQ7 A;  4DL3 A;  2ZH6 A;  1BPD A;  4P4P A;  3GDX A;  1ZQD A;  4MFA A;  4RWN A;  4X4R A;  4IR1 A;  3UQ2 A;  4ECV A;  2JEF A;  5DQI A;  4YMN A;  5J0R A;  2XY6 A;  4DF8 A;  1RYR A;  3TQ1 A;  5J0T A;  2RFF A;  2HHT A;  1A76 A;  3RB3 A;  2AGQ A;  1TAQ A;  4GXJ A;  4GC7 A;  4F93 B;  3PX0 A;  1ZQN A;  3G6V A;  2A1J A;  1ZQC A;  2UVR A;  5KFG A;  4KLI A;  3B0Y A;  4Q43 A;  4J9S A;  4I2E A;  1ZQT A;  1A77 A;  5KT3 A;  1QSY A;  4I2D A;  4JV0 A;  1ZQU A;  3PR4 A;  8ICX A;  4DQI A;  5J2C A;  4UB2 A;  4YR3 A;  2Q0Z X;  1T4G A;  2AGP A;  9ICO A;  4ED0 A;  4F3O A;  4ECY A;  5HRK A;  3M9M B;  2PFP A;  4M9H A;  3PW0 A;  4S3N A;  4DSE A;  3ISC A;  2KZ3 A;  4IQV A;  1LV5 A;  1BNO A;  3KHL A;  1NZP A;  5J0Q A;  4YMO A;  4KLQ A;  1T8E A;  1KFT A;  3Q8M A;  5DEC A;  1XU4 A;  4YXM A;  4DSI A;  1QSL A;  2ZUB A;  4WC3 A;  2JEJ A;  5KFB A;  2C22 A;  3PO4 A;  3Q8P B;  7ICJ A;  8ICQ A;  2XCP A;  2DPJ A;  3RJG A;  2AJQ A;  5J2D A;  5KTQ A;  5BOL A;  2IBK A;  3RR8 A;  3AU2 A;  2WTF A;  4BXO A;  2IHN A;  5BOM A;  4M9L A;  1R8C A;  4UBC A;  3NTU A;  3OJS A;  1X9W A;  4F5Q A;  5DB6 A;  1TAU A;  1TFY A;  1S77 D;  4NM2 A;  2ZH9 A;  3OGU A;  1KTQ A;  1XWL A;  2KFN A;  3MR3 A;  2KZZ A;  2HW3 A;  4NKT A;  4AT8 B;  9ICJ A;  3EPG A;  4JUZ A;  1ZQF A;  1NK9 A;  4GXK A;  4DQP A;  2ZUC A;  3KHR A;  5DGA A;  1ZQG A;  2BCU A;  2BCV A;  2P66 A;  4LZD A;  4YVZ A;  3V6J A;  2W9M A;  4LZG A;  2BGW A;  4NKU A;  1V9P A;  5J2B A;  4WC5 A;  5D4B A;  4DQR A;  1B22 A;  5KG6 A;  2ASD A;  2ZJA A;  5HRB A;  4DFK A;  1JAJ A;  2XY7 A;  1RZT A;  3GFK B;  5J2E A;  5KFS A;  3KHG A;  4R63 A;  3RB6 A;  4M5D A;  3FDS A;  1BGX T;  3PR5 B;  2HHQ A;  3SV3 A;  4X4T A;  2BCQ A;  2W8K A;  3B0X A;  3LDA A;  3SYZ A;  4R66 A;  3AQK A;  1U45 A;  5IIM A;  5DB7 A;  4RPY A;  4PHD A;  2ZTD A;  2R8H A;  3RJH A;  4I27 A;  5J0U A;  2MUT B;  8ICP A;  3T3F A;  4JWN A;  4BGD A;  3MDA A;  1JN3 A;  9ICC A;  1U47 A;  3Q8L A;  4WCW A;  2BE3 A;  4DQS A;  4X4O A;  3M9N B;  4DS4 A;  2BPG A;  4RU9 A;  5KFN A;  3G6Y A;  7ICK A;  1OU5 A;  4JK1 A;  4RT2 A;  2XCA A;  2W8L A;  3V72 A;  4ECR A;  3C2L A;  3RRH A;  1XSL A;  1ZQB A;  1L3S A;  1T7P A;  3BDP A;  4M04 A;  1KFS A;  4X4Q A;  3PMN A;  2DRB A;  1ZJM A;  4FBT A;  9ICL A;  4X4N A;  5CB1 A;  3C2M A;  4Z6C A;  2ISP A;  5KFI A;  1DK2 A;  1KNY A;  4F92 B;  2PFO A;  3OVB A;  4KLJ A;  4PPX A;  1ZQP A;  1YLQ A;  5CHG A;  4RQ1 A;  9ICM A;  3AQL A;  3PV8 A;  3N97 B;  2XO7 A;  1X9S A;  4C8L A;  5KFA A;  4Q44 A;  3NGD A;  3Q8Q B;  5J2H A;  4ED2 A;  3RBE A;  1X9M A;  1SKW A;  3JYY A;  4UB3 A;  1B43 A;  3UQ0 A;  3T5H A;  1TVA A;  4B9M A;  3M9O B;  3HWT A;  2DRA A;  3OUY A;  3LK9 A;  4WC2 A;  4EYH B;  1SKS A;  2F1H A;  2VA8 A;  4X5V A;  4X4V A;  4NLG A;  2KP7 A;  3GV5 B;  4YFK A;  2KTQ A;  2JEI A;  1MC8 A;  4QZ9 A;  9ICE A;  5DKW A;  8ICR A;  4O3R A;  2A1J B;  1S0M A;  1H38 A;  1JIH A;  4J9K A;  4YD1 A;  4RUC A;  2Y1J A;  4C8K A;  1BVS A;  5KG0 A;  4YN4 A;  3OSP A;  4EBE A;  1NK0 A;  4M9J A;  1V4A A;  2HHS A;  2Q66 A;  4GLX A;  8ICE A;  4RQ7 A;  4ED8 A;  3H4D A;  1NKC A;  5KFW A;  4YQW A;  3BQ2 A;  4Q45 A;  3V7K A;  4F4K A;  5DED A;  3V7L A;  1ZQL A;  5HRI A;  2DR8 A;  4UB5 A;  3MR2 A;  4RPZ A;  1S9F A;  4B9V A;  3H39 A;  3Q8S B;  2ZH2 A;  1RYS A;  5KFQ A;  3WFS C;  1DGS A;  4ECQ A;  3IHQ B;  4E7X A;  7ICT A;  5KT6 A;  4ED6 A;  5J2A A;  4QZI A;  1Q78 A;  5DBA A;  3N4M B;  1K1Q A;  3UXO A;  3AUO A;  1XSN A;  4IRC A;  4KLH A;  7ICS A;  1NK8 A;  4BXO B;  2J6T A;  2KFZ A;  8ICI A;  4DSL A;  4WBZ A;  4I2F A;  4EBK A;  3ZD8 A;  4M9G A;  4UAW A;  3JZ0 A;  3ZDE A;  4ED3 A;  3T5L A;  4ED7 A;  5KG3 A;  2M2U A;  2AU0 A;  1ZQO A;  3BQ0 A;  4EYI B;  2RDJ A;  4ECW A;  1U9L A;  5L1I A;  4QZA A;  1QSS A;  4QWA A;  5D49 A;  1UA0 A;  1S97 A;  3MR6 A;  2FMQ A;  4I2H A;  4RWO A;  1WOT A;  5KFV A;  5KT7 A;  3Q8R B;  3M8S A;  1JMS A;  2ATL A;  1FA0 A;  1R8B A;  2PBE A;  4CCH A;  8ICO A;  4ECZ A;  3GV7 B;  4C8O A;  2FLL A;  4IRK A;  5KFH A;  2XGP A;  3C5F A;  4JV2 A;  2PI4 A;  1Y88 A;  1PZN A;  5J0Y A;  5KFZ A;  3ZDB A;  3C1Z A;  4YXJ A;  3QEA Z;  2Y1I A;  3QZ8 A;  5KFC A;  1L5U A;  4QZE A;  2ZHB A;  5J2K A;  4J9N A;  3V6H A;  5CR0 A;  4DSK A;  9ICA A;  3H8W A;  5DB9 A;  4BDP A;  3G6X A;  5KFO A;  4DFJ A;  4ECX A;  2R8G A;  9ICN A;  2P6R A;  8ICG A;  5C5J A;  5KG7 A;  3GIL A;  2VAN A;  2FMP A;  2R8J A;  9ICT A;  4FHP A;  4E80 A;  1NOM A;  5HP4 A;  2ZH5 A;  1ZQH A;  3ZDC A;  3RAX A;  1ZJN A;  4XQ8 A;  1ZQW A;  3GII A;  4KLT A;  5D46 A;  5HRD A;  4RQ0 A;  4O5K A;  3E2E A;  4TQR A;  2O5A A;  2UVV A;  4DEZ A;  5HRG A;  3K4G A;  4ED1 A;  3TFS A;  4XRH A;  2IHM A;  5KFY A;  4O0I A;  1NK6 A;  9ICF A;  9ICQ A;  2DR9 A;  2ZTE A;  5EOZ A;  5EWE A;  4RQ2 A;  3HJ4 A;  3GV8 B;  1MIV A;  4O3O A;  5DB8 A;  1UEV A;  4E8F A;  1COO A;  4FHV A;  3ZD9 A;  1ZQK A;  2BKE A;  2ID1 A;  4G3I A;  4FS1 A;  4KN4 A;  1K1S A;  1TV9 A;  4DF4 A;  1LB2 B;  3LQC B;  4C8M A;  2FLN A;  5KFK A;  2W9C A;  1KLN A;  3H3A A;  4YR2 A;  3PW2 A;  4NLN A;  3OUY B;  2I1Q A;  2PXI A;  1L3V A;  4PHE A;  4O5E A;  5DLG A;  1SL2 A;  4O5C A;  2DR7 A;  2NRX A;  4F4Y A;  4J9P A;  4NY8 A;  9ICX A;  5HML A;  2BQU A;  1QTM A;  5DDM A;  2BCS A;  4IRD A;  1TFR A;  1JQR A;  2F1I A;  4ECS A;  8ICS A;  4E0D A;  5EWG A;  4DSF A;  3TAP A;  1UEU A;  4DL6 A;  9ICH A;  2FPL A;  2ZJ8 A;  2AQ4 A;  5F9L A;  4KLD A;  3EW9 A;  4M2Y A;  4YMM A;  2ZTC A;  1VFG A;  3RJF A;  2HHX A;  1ZQV A;  4J9Q A;  3H7I A;  4TUS A;  2DPI A;  2PFN A;  5KFU A;  1KDH A;  3EYZ A;  5J0X A;  4B9U A;  8ICC A;  4KLF A;  4QWB A;  1S10 A;  7ICL A;  4K4I A;  1UT8 A;  4KLL A;  2O1P A;  4GXI A;  4F91 B;  1XS9 D;  1BPZ A;  2XC9 A;  4M9N A;  1ZQM A;  3V6K A;  3EWA A;  5DG8 A;  1IM4 A;  2V4R A;  3JPO A;  2FPM A;  2V4Q A;  3JPS A;  4RPX A;  3JPR A;  5KFL A;  3JPN A;  4PHP A;  4F5P A;  3PW7 A;  5KT4 A;  1D9D A;  2M2W A;  2NRK A;  2VA2 A;  1HJP A;  3MGH A;  5HRE A;  1UET A;  4EEY A;  4WC6 A;  2ZH3 A;  2ZH4 A;  4RUA A;  2BQ3 A;  3H8S A;  4Z6E A;  4DLE A;  3HX0 A;  3OVA A;  3RJE A;  3H38 A;  3RH6 A;  2W9B A;  7ICM A;  9ICV A;  2BPC A;  1KSP A;  1ZQY A;  1TK5 A;  5HNK A;  3EZ5 A;  1JX4 A;  4P4M A;  3OJU A;  4UAZ A;  1S0V A;  2AGO A;  3QZ7 A;  1MQ3 A;  1ZQQ A;  1BPB A;  3QE9 Y;  2PI5 A;  1NKE A;  4F2R A;  4X4S A;  3OSN A;  4NXZ A;  4O3Q A;  2ASL A;  3JPP A;  3HPO A;  2OWO A;  4ELU A;  4ATB A;  4X4P A;  2XY5 A;  2ZHA A;  5KG4 A;  8ICM A;  3PML A;  4QWD A;  1XC9 A;  4J9M A;  4IQW A;  3GIK A;  8ICF A;  4XUS A;  1ZQS A;  4TUP A;  5DBC A;  4QZF A;  1L3U A;  4MF8 A;  4AT7 A;  1MSW D;  2NRW A;  5KG1 A;  9ICS A;  2M2V A;  4PHA A;  4QZ8 A;  5F9N A;  5L1K A;  4LT6 A;  4DL5 A;  1NJW A;  3RJI A;  3GQC A;  5J0P A;  3TFR A;  5DQG A;  3MBY A;  3V7J A;  2BQR A;  1ZQE A;  5IIK A;  3NYB A;  2BR0 A;  4KLS A;  4F5N A;  4B9S A;  4B9L A;  5J0O A;  5KFX A;  1NK5 A;  4RWP A;  4BWJ A;  4KLO A;  5KFJ A;  1Q79 A;  2C2E A;  9ICG A;  4X0A A;  4QZD A;  1Z00 A;  4FO6 A;  3PX6 A;  4KMU A;  4Z6D A;  3MFH A;  4R8U A;  1N56 A;  4RQ3 A;  4EBC A;  1RPL A;  1BPX A;  3GIJ A;  4FH5 A;  3OHB A;  3ORY A;  4DOA A;  1JXL A;  1MIW A;  5HC9 A;  3UXP A;  7ICO A;  5DGB A;  4YCX A;  4FH3 A;  2DVI A;  3PNC A;  3SI8 A;  3RJK A;  8ICZ A;  4F4X A;  4F50 A;  4F5R A;  5TZV A;  3C21 A;  4HYK A;  2J6U A;  4UD4 A;  4R65 A;  1DOQ A;  3C23 A;  3K75 D;  5CA7 A;  1UT5 A;  5KFE A;  5KG5 A;  4RQ6 A;  5CP2 A;  3M8R A;  2JZB A;  4DFM A;  3AU6 A;  4DLG A;  2H5X A;  3RBD A;  2C2D A;  3LWM A;  1MQ2 A;  2IA6 A;  1CUK A;  3C5G A;  7ICH A;  9ICK A;  3LWL A;  3HP6 A;  2W9A A;  5J0S A;  4DFP A;  2W9C B;  4I2A A;  4Q8F A;  3OV7 A;  2ZH7 A;  4PGX A;  1SL0 A;  1S0N A;  2BCR A;  7ICP A;  1JXE A;  1WCN A;  4QZG A;  4I2C A;  2JEG A;  4BWM A;  4MEX A;  2F1J A;  4IG8 A;  2NRZ A;  4FS2 A;  4DSJ A;  7ICV A;  4KLU A;  3WFQ E;  4DL2 A;  3TAQ A;  1DK3 A;  4EZ6 A;  7ICN A;  1NK4 A;  8ICN A;  5KT5 A;  4JWM A;  5JUM A;  1R8A A;  7ICQ A;  4UB4 A;  8ICA A;  5KFR A;  3C18 A;  2ZH1 A;  1D8Y A;  4MEY A;  4MF2 A;  3RH5 A;  4KLG A;  2ASJ A;  1T3N A;  3RRG A;  5EWF A;  1UA1 A;  4K4G A;  3SZ2 A;  1BPY A;  8ICK A;  4J9L A;  4WC1 A;  4B9N A;  1ZQX A;  5DG9 A;  2R8I A;  5J29 A;  2V9W A;  3ZDA A;  5IIL A;  3RJJ A;  2M9N A;  3EPI A;  1RXW A;  4DWI A;  1U48 A;  3ETL A;  4UBB A;  2DFL A;  5KFM A;  4IQT A;  2XGQ A;  4FBU A;  2ALZ A;  4I2B A;  4Q8E A;  3H37 A;  1WCL A;  4KLE A;  4WC7 A;  3L9D A;  2KN7 A;  4J9R A;  3BQ1 A;  1BNP A;  5DBB A;  4RT3 A;  3ISD A;  4C8N A;  1S0O A;  4UD5 A;  3BQT A;  1D9F A;  4JV1 A;  1D8L A;  4LVS A;  3Q8K A;  4WC0 A;  3UXN A;  4M6W A;  4UB1 A;  3AQN A;  4RNO A;  1XSP A;  4FHX A;  4AT9 A;  2HHP A;  3RB4 A;  4ELT A;  2W9B B;  5F2V O;  4F4W A;  2GWS A;  4NLK A;  1KFD A;  9ICB A;  3TI0 A;  3MAB A;  3OHA A;  1ZYQ A;  3H8J A;  5HRF A;  1NO5 A;  1X2I A;  4ATB B;  4F2S A;  8ICL A;  4I2G A;  4IR9 A;  4DL7 A;  8ICW A;  2PFQ A;  4F4Z A;  4DL4 A;  4FHY A;  1L3T A;  4PGQ A;  4K4H A;  4DO9 A;  4QZB A;  2AQ0 A;  5KT2 A;  1ZET A;  2C28 A;  3MR5 A;  4YD2 A;  8ICT A;  2FLP A;  4YG2 A;  5J2J A;  1U4B A;  4QW9 A;  2FMS A;  4AT7 B;  4UQG A;  1N48 A;  3WFR E;  1NJX A;  5HMM A;  4RQ4 A;  5DQH A;  4ECT A;  3HJ1 A;  3RTV A;  3HIY A;  1QLN A;  4PH5 A;  5J2F A;  1PX5 A;  4EBJ A;  3PX4 A;  4WBY A;  3SV4 A;  3PY8 A;  1ARO P;  5IIN A;  4O3N A;  4X0B A;  2HVH A;  1Z00 B;  2IMW P;  4YR0 A;  3WFO A;  4R8U B;  4M0A A;  4FHW A;  1S76 D;  3RAQ A;  4RZR A;  1XO1 A;  4Z6F A;  4XA5 A;  8ICJ A;  4F5O A;  7ICI A;  1KEJ A;  5DDY A;  4P4O A;  1MIY A;  4I2I A;  4TQS A;  3TAN A;  1TKD A;  4DOC A;  3FYH A;  3BJY A;  5HHI A;  3C2K A;  8ICV A;  3H4B A;  3C66 A;  1NJY A;  4QW8 A;  4IQU A;  8ICU A;  7ICU A;  2JZB B;  2RDI A;  4ELV A;  3RB0 A;  1RXV A;  1NJZ A;  4RQ8 A;  4DQQ A;  3PVX A;  4P2H A;  4UAY A;  3HT3 A;  2MAX A;  4DS5 A;  4EBD A;  1KRP A;  1CEZ A;  4QWE A;  2ZJ5 A;  7ICF A;  1SL1 A;  5J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...