4O5FA

Crystal structure of type iii pantothenate kinase from burkholderia thailandensis in complex with pantothenate and phosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
MSGVCLLIDAGNSRIKWALADTGRHFVTSGAFEHADDTPDWSTLPAPRGAWISNVAGDAAAARIDALIDAHWPALPRTVVRACAAQCGVTNGYAEPARLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRSLGMHTAQLPTVSIDAATSLLDELAANDAHAPFAIDTPHALSAGCLQAQAGLIERAWRDLEKAWKAPVRLVLSGGAADAIVRALTVPHTRHDTLVLTGLALIAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal structure of Type III pantothenate kinase from Burkholderia thailandensis in complex with pantothenate and phosphate
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o5fA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o5fA02
3SMPA 2Q0UA 1KXPA 3SJHA 5BPLA 3RSEA 2CH5A 5EX5A 4XH1A 1K8KB 3I33A 1RGIA 3AARA 5KPZA 2AP1A 5BPNA 4ISEA 1MA9B 4FOIA 2QWRA 3KHYA 1NGFA 3UKUB 5BRDA 2NZTA 3R6MA 3J8AA 2I7NA 3VGKA 4KBOA 5KQDA 2BUPA 2QWOA 2IVOA 4H0YB 3WT0A 1X3MA 3AAPA 3A5LC 1BOTO 2YHYA 4MO4A 3R9PA 2CGKA 1SZ2A 4BRMA 2Q1NA 4GNIA 4CZEA 2E2NA 3VGMA 4CZGA 2I7PA 2E20A 3ATUA 4PKHA 4BGAA 3H3OB 1QZ5A 2W40A 1NGEA 4K43A 3FZHA 1IJJA 5AQRA 4BR7A 3LM9A 3VESA 2GUPA 1TUUA 2FXUA 1WOQA 5AQUA 3MN7A 3WEEA 4B1VA 3DWLA 1T6CA 5KQ8A 4PKGA 2FSKA 5AQPA 3WXJA 3CETA 2V52B 4QS7A 3ENOA 4BGBA 4IJAA 2P9IB 2HF3A 3L0QA 3GE1A 2YJFA 3L6QA 1RDWX 3FFKB 2A3ZA 3C0BA 4A2BA 1E4FT 3GOIA 4MLHA 2ASOA 4ISFA 4DQ8A 1NLVA 4NO7A 1TUYA 4BRGA 3AY9A 4CBUA 5I9EB 2P9LB 4BC2A 3JXUA 1U2VB 3KVGA 5AQSA 2HF4A 4PL7A 4BG9A 3IFRA 3O80A 1D4XA 3CQYA 5AQGA 3RSEB 1P8ZA 1NGHA 2Q36A 4BR5A 4MO5A 5FPMA 1NGAA 5LJWA 1U6ZA 5AQQA 5AZIA 4BRHA 3ZX3A 2CGLA 3LL3A 4CJ7A 1HJOA 1HLUA 2D0PA 3D7EO 4BR9A 1GLLO 4A62A 4BROA 4H0PA 1CZAN 2QXLA 5EVZA 3GBTA 3QFPA 1T6DA 2E2PA 4GY2B 5F0XA 3S41A 3JS6A 4A61A 2QWNA 1ATSA 3LDPA 1XUPO 2E2OA 3WEEB 3H46O 5BN9A 4QS9A 3KZBA 4BR2A 3A8YA 4FWKA 4CD3A 1ZXOA 4XEIA 4BRCA 3U9ZA 4L3QA 3UKRA 4Z94A 4AM7A 2YJEA 3WXKA 1JCGA 2A42A 4JAXA 5JMVA 2H3GX 3VF4A 4LC9B 5AQHA 1QHAA 3HM8A 2ZGZA 5AQXA 3ZX2A 5LJVA 3IMXA 4ISGA 3EO3A 3HZ6A 3M3ZA 2D1KA 3R8EA 1NGIA 4FWQA 3O4WA 5FPNA 3U8XA 5BRHA 2ASMA 4WQ5A 5AQFA 2CH6A 4WQ5C 1T44A 2VYPA 1HKBA 2GTDA 3FR0A 4K25A 4M7YA 1GLCG 2WUSA 2V51B 2A40A 4YDUA 5AQLA 3WUHA 1GLJO 1J6ZA 5AQNA 1JCFA 2BTFA 3DXMA 5EY4A 1HUXA 1KAZA 4BRQA 4CZKA 1EQYA 3VF2A 2W41A 5AZIB 1MDUB 3D2EA 4H0OA 3QDKA 4CI6A 1NWKA 4BRKA 3BEXA 1ATRA 4EHTA 1OKJA 2J4RA 3I8BA 5BPMA 2PAVA 1SAZA 4H5VA 3IDHA 4JN4A 1BUPA 1HPMA 4B9QA 3CJAA 4FWSA 3EN9A 3VETA 2ZGYA 5AQWA 3VEOA 4H0XB 4K41A 3H6EA 3SK3A 3FGUA 3EL2A 4H0VB 3BF1A 1TYQA 3QBWA 4DCHA 3LM2A 1ZC6A 4IWVA 5AQIA 3UB5A 2D0OA 5AQOA 3B8AX 2OANA 4O8KA 4B1WB 4M63C 4DB3A 4C23A 2GWJA 3VEVA 2VWBA 3FE1A 4PL8A 3H45C 1YUWA 2QWPA 5E26A 3ZEUA 1NGDA 4CZMA 1LCUA 4FWOA 4IXCA 4RCHA 3QB0A 3A5NC 3H1QA 3O1BA 3CJ9A 4RTFD 3GG4A 3LDNA 4O5FA 1YVNA 3VERA 2YHWA 5BN8A 3DXMB 5AQZA 3VOVA 3MK6A 3L4IA 1ESVA 2Q31A 4BG8A 2DPNA 4BC5A 4CD1A 2YCHA 3CIPA 4FWRA 3MDQA 3D2EB 2PBDA 4H5RA 2E2QA 3MMVA 1BA1A 2CGJA 4RWTA 1WUAA 4HWIA 3UE5A 3BUZB 3CJ7A 1DEJA 5F2RA 3EKSA 1V4SA 2P9KA 4BVOA 2E1ZA 3WQTA 1NGJA 4B1ZA 3FZKA 3VEZA 4JD2A 1S22A 4FWPA 2P9PA 3BF3A 3H3NO 5F1XA 4IZ9A 5JICA 3A5OC 3DXKA 4M7XA 3VEXA 5AQVA 4F9OA 1C0GA 1X9JA 1TYQB 3AAQA 3QICA 5FPEA 4H5NA 5AQMA 4H5TA 5CE3A 4B1YB 2EWSA 3CJ1A 1DKGD 3P4IA 5AQJA 1QZ6A 1QQOA 2P9IA 4FWNA 3W3DA 4XH4A 4B1XB 1QQNA 1BDGA 2GELA 2AA4A 4FO0A 1GLDG 5ELZA 3IUCA 4I6MA 4BC4A 3QMLA 3CQXA 3M1FA 4WQ4A 4YDUC 3VEWA 5EXWA 4BRLA 3F9MA 4WYBA 1X3NA 3ZEUB 2IVNA 4EIAA 3MN5A 2F9WA 3DAWA 2KHOA 2FLOA 2HOEA 1IG8A 4MLEA 1GLBG 2Q0RA 3MN9A 4DHYA 1RFQA 3H1VX 1ZBSA 4E1JA 1KAYA 3HI0A 1BA0A 1HKGA 2NRHA 2P9UA 5LY3A 3EKUA 2GEMA 4FPBA 3FZLA 2QM1A 4H0TB 5JLHA 2QWQA 3CJCA 4BRFA 4CZFA 2QWMA 1NM1A 4FPAA 2UYTA 3O5BA 4BC3A 1KAXA 4NB4A 5BR9A 4K42A 2ASPA 5AFUA 3O8MA 3ZETA 3CI5A 1S3XA 3FLCO 3HTVA 4CZLA 5KPRA 2P9NA 1NGBA 3O6WA 4BR0A 2P9KB 2Q2RA 3VENA 1R59O 1NBWA 4H5WA 3UKRB 2E8AA 3D2FA 4JD2B 3HBTA 1Z05A 3CERA 4EAHD 5JLFA 1XC3A 1DGKN 2P9PB 4FWLA 5AFUH 2P9SA 3DXKB 3TU5A 5AZJA 1LOTB 3O08A 5E84A 1ATNA 3BP8A 3FZMA 3DJCA 3A0IX 2QWLA 3C7NA 2ITMA 2HMPA 1NMDA 3OHRA 2IVPA 3GDQA 1C0FA 4JHDA 4BRPA 4H03B 1YAGA 3MN6A 2A6AA 1HKCA 3U4LA 2E1YA 2YI1A 4FSVA 2V7YA 3O1WA 4EFHA 4I6MB 4A2AA 2V7ZA 1JCEA 2QW9A 3EZWA 3TPQA 3ULEA 1GLAG 4CBWA 1H1VA 3A5MC 3QFUA 4FWMA 4BREA 2ZWHA 4B1UB 4BQZA 3W0LA 5BREA 4HTLA 3WQUA 3ATVA 1G99A 4BQLA 1GLEG 1K8KA 4BRNA 1BG3A 1XQSC 2F9TA 2YHXA 3LDLA 4J8FA 3ZX0A 3WXIA 5KPTA 4JNEA 3UKUA 5BRFA 1GLFO 1MWKA 1BO5O 2FSJA 2VCPA 5ADXA 1MWMA 2P9UB 1Y64A 2A5XA 2FF3B 4EHUA 5FPDA 1SQKA 1NGCA 4CBXA 4BR4A 3MCPA 1V4TA 3QBXA 4CZHA 2FF6A 1BWFO 2ZF5O 5AQKA 1BU6O 1NGGA 4FL9A 4IJNA 4IO8A 1E4GT 3ZETB 2E88A 3WXLA 2IIRA 4Y0WA 5ADXH 3HSCA 2P9NB 3SMSA 3CJBA 4BRDA 4FOEA 4QS8A 4XH5A 3M6GA 5B8HA 3VGLA 3FZFA 2NLXA 3VF6A 3D2FB 4AM6A 1YXQA 1HX1A 2A41A 3CHWA 3GL1A 5AQYA 3SLCA 2P9SB 5AQTA 5AZJB 1QQMA 2Q97A 5TKYA 2FSNA 4BRIA 3C7NB 3G25A 3LDOA 1Z6RA 4BRAA 3VPZA 2D4WA 3VEYA 3LDQA 4JHDB 4WQ4C 2GWKA 4PKIA 3ID8A 5EOYA 5AR0A 2P9LA 4BVPA 4CZJA 4CZIA 1U2VA 3U9DA 1Q18A 3ENHA 3ULEB
chains in the Genus database with same CATH superfamily
2VWKA 3OJSA 3SJHA 4DLGA 4XH1A 5KRTA 1RBVA 5KGWA 3WXMB 1A5WA 3J7AP 2RHKA 4ISEA 4KAZA 4JRPA 2QWRA 2BANA 3UKUB 2NZTA 3R6MA 3HL8A 2YNIA 3AVFA 4KBOA 4PUOA 3TSUA 2BUPA 2QWOA 1VQPN 1X3MA 3AAPA 1SZ2A 3EY1A 4JS4A 4DQSA 2E2NA 2QI2A 4NCGA 1ASVA 4PKHA 3CCEN 5IT9O 3WNHA 3NH1A 2W40A 2X6SA 1NGEA 4DR5K 3TANA 4M3WA 4BR7A 3LM9A 1E3MA 5J2NA 3MECA 4DQRA 2UUBK 3SV4A 1CXUA 4KHYA 1T6CA 3V6DA 1T05A 1HNVA 3KK1A 1UA1A 3WXJA 3THYA 4KHQA 3TAEA 4O0IA 2HF3A 3U3GA 3CFRA 4FLVA 4LF4K 4JKFA 3C6HA 4JYAK 1VQON 4B9UA 4GV3A 4DTUA 1EX4A 3CCRN 1OVYA 2WBNA 4B8AB 4FM0A 3GOIA 4DQ8A 3AY9A 3EE8A 3L2UA 3QO9A 5I9EB 1QSYA 2P9LB 3HPOA 5D3GA 4F2RA 4BC2A 3PV8A 3KVGA 5AQSA 1NU0A 2HF4A 2QXFA 3U3YA 1JLCA 1NG9A 1RT3A 4JI8K 4Z0UA 3V9UA 1JLQA 1D4XA 4NXMK 3RSEB 1P8ZA 2KQ2A 1XNQK 5C15A 3NCIA 3DYAA 3M8SA 4MDAA 2YKNA 3OYLA 5FRNA 5AZIA 1S72N 3ZX3A 3ITHA 1Q7YO 1JL1A 3SQ1A 1KFSA 2UXBK 1HJOA 1HLUA 4U7BA 2XO7A 3ZT3A 4HUEA 4BROA 3DLKA 3I8DA 1VSIA 3QFPA 4DF4A 5GIPA 4IOAL 3CC4N 2DFEA 4C1NI 4B3OA 3CMEN 3HPGA 1RDBA 4A61A 4WFBL 4W5NA 3SYZA 1XUPO 2E2OA 3H46O 4W5OA 3AA2A 3QERA 4BR2A 5DM6L 1LAVA 3M8QA 1FXXA 1O13A 1KD1O 1HQEA 1KQSM 4AM7A 3QEIA 3V9XA 4JAXA 1WN7A 1I39A 5JMVA 4DV7K 1DTTA 2VG5A 3SUQA 3HM8A 2ZGZA 3HZ6A 2O8FA 2E6LA 3QEPA 4N76A 1KVBA 3C65A 2ASMA 5AQFA 1C0UA 4W5QA 4DSIA 2VYPA 3FR0A 4K25A 4M7YA 3T7ZA 3JSMA 5DM7L 3K0SA 2V51B 1S5JA 2VQEK 3K9JA 2HHUA 2KKZA 4Y1CA 3OYBA 1RILA 3DXMA 4FZXC 4BRQA 4BDPA 3SQ2A 3DLHA 4A5AA 1L3UA 4KFBA 3D0PA 3D2EA 3LPTA 3HPHA 4KB0A 3QDKA 1NWKA 5C12A 4HCBA 4CHOA 1IO2A 1NK7A 2J4RA 5BPMA 4DTPA 1SAZA 4BE1A 4EZ9A 4DR7K 1RBSA 2OZMA 4F3OA 2F4VK 3EN9A 2HNDA 5J1EA 3VEOA 4H0XB 4K41A 4ZHRA 2PFUA 4E7KA 4LF6K 3Q7BA 1W0HA 4GV9A 4H0VB 2HBLA 4K8ZA 3NF7A 4B9VA 1NJXA 2KZMA 4BDZA 4FLUA 5IWAK 4KKOA 1BCOA 2BE2A 2D0OA 5AQOA 1SKWA 2OANA 2NUBA 4MDBA 4M63C 4Z4GA 4C23A 1SKSA 3H45C 4LY7A 4ELUA 3G10A 2ZD1A 1NGDA 4CZMA 4B9MA 1LCUA 4YOUA 3A2FA 2HNZA 4IFVA 2FBTA 3ASMA 3V81A 3T1HK 1YVNA 1T3VA 3NAEA 5BN8A 5AQZA 3VQCA 4M42A 3VOVA 3L4IA 3NE6A 4BG8A 1ILYA 4CD1A 2D5RA 3LDSA 1S9EA 3MDQA 1YTUA 3G0ZA 1O1WA 2CGJA 4X64K 4DV0K 2P51A 1IKWA 4C8KA 1EETA 4IDKA 4NCAA 2WTUA 4KREA 3UE5A 1RDDA 1DEJA 3RRGA 5C2FA 3NBPA 5F2RA 1EP4A 2P9KA 4CECA 3F9KA 4JS5A 3THWB 4JK9A 4IFEA 1WSJA 4CEZA 4AHUA 1S22A 3SBGA 2QA4N 4FWPA 1U04A 3OW2M 1RCHA 3BF3A 5F1XA 3DXKA 3MXMA 1YJ9N 3VEXA 1X9JA 4CFBA 2KFNA 4WFAL 4JKDA 4B1YB 3TSQA 4FWNA 4B3TK 4XH4A 3NHGA 2GELA 1NKCA 5ELZA 3IUCA 2RF2A 3M1FA 4ZTFA 2FBYA 4BRLA 4C8OA 1X3NA 3G4SN 2G8FA 2KHOA 3TR8A 4DG1A 3KWGA 1ZBHA 5HBMA 1WSIA 1RTIA 5H1SQ 4DHYA 3OYMA 2ZJQL 1L3SA 4CZFA 1Q82O 1NM1A 2UYTA 4CGGA 4CF9A 2GBZA 4DWIA 2ITGA 2ASPA 3HTVA 1U49A 1WLJA 3O9SA 1D8YA 1TL1A 2OPSA 3NVKA 3V9SA 1NGBA 3OYNA 1REVA 3KLIA 1R59O 4H5WA 1NJYA 4CF0A 4GVEA 3HT3A 3L2QA 5JLFA 3NDKA 3CM6A 2P9SA 1VSHA 5TKWA 1LOTB 3O08A 4Q5VA 1ATNA 5J2QA 2BH1A 3OHRA 3AVLA 3TAQA 2UUCK 4JHDA 4H03B 1YAGA 2O4GA 2O8EB 2P5OA 2YI1A 4FSVA 1NJIO 2HSTA 2YHAA 1SUQA 3O4NA 3ZSXA 2QW9A 1DLOA 4OPAA 3OYJA 1J5OA 4FJ9A 3TPQA 3ULEA 1ZBLA 3QFUA 4IOXA 1B9FA 1JL2A 1NK8A 4GKKK 4HTLA 3WQUA 3ATVA 1G99A 2Q3SA 1GLEG 1W9HA 4YOWA 4FJLA 2QK9A 4CHZA 2OTLN 4CJKA 4I2PA 1GLFO 1HNZK 5ADXA 2ZJRL 1CLQA 5M1PA 2FF3B 2W6LA 3RTVA 1NGCA 2E6MA 3L2RA 4CZHA 4M41A 1BU6O 2GV9A 4FL9A 4IJNA 1N36K 1I3AA 2RE2A 2P9NB 3SMSA 3LP0A 4F2SA 4QS8A 3DM2A 3M6GA 5B8HA 3AVJA 4CJ3A 1K73O 3GL1A 3SLCA 1YF5L 4DU4A 1VQ4N 4JKEA 2VGMA 4E7HA 4JI1K 4LH5A 4CEAA 1QSSA 3VEYA 3O9QA 4LH4A 1WNSA 3AVAA 1YJWN 3CD6N 4AHSA 2E5LK 2WFBA 2HHTA 4CIEA 4CZIA 4DR4K 1Q18A 4CVNE 2OPPA 5EX5A 1BCMA 3RWUA 4EP4A 1RGIA 3AARA 5KPZA 4FK0A 2ZQBA 1NGFA 3V9ZA 3J8AA 4FJ7A 3S3NA 4H0YB 3WT0A 3ZCMA 1BOTO 1BI4A 4MO4A 2G8WA 4KHNA 4RW6A 2Q1NA 4CZGA 2I7PA 3DRRA 3ATUA 4DU3A 1QZ5A 3LPUA 3FZHA 1IJJA 3HK2A 2GUPA 5AQUA 1WOQA 1HPZA 3CCLN 3AVHA 5C42A 4PKGA 4TSXA 2HB5A 4JKGA 3CPWM 3NF9A 3MXIA 4QS7A 2P9IB 3GE1A 4BWJA 3L6QA 1RDWX 4JI6K 4RG8A 2OPRA 4CJVA 3OYAA 4NO7A 4BRGA 1TGOA 3DRPA 1QVFM 3ALYA 1RTDA 4KHSA 3SJJA 4CJPA 3AVGA 5SZTA 3M8PA 4KPYA 1KRPA 3VQ6A 4DSEA 2DTUA 3RR8A 1VSFA 1UWBA 3OYFA 3SUOA 2OZSA 3IFRA 3CYMA 5KI6A 4CEDA 3ZT1A 4DFKA 4MO5A 4LF8K 4NXNK 5FPMA 3ZYYX 3DLEA 1U45A 1XHZA 3HXMA 4JKBA 5LJWA 5AQQA 2HVIA 3OS1A 3CQ8A 4BRHA 3PIPL 5J2MA 1JLBA 4FM2A 4BR9A 1GLLO 3S3OA 4A62A 4H0PA 2G8VA 1WSFA 1CZAN 1HRHA 4N56A 1T6DA 3C94A 3QEVA 1FK9A 4ILHA 5M1QA 3HM9A 4IEIA 3JS6A 4DR2K 3LDPA 3WEEB 3LZJA 3S3MA 4HTUA 4G1QA 5BN9A 1OH8A 1LWCA 3KZBA 2YKMA 4DMNA 5LL6Z 3VTHA 4L3QA 4Z94A 4FZYA 2YJEA 3P31A 3WXKA 5I42A 1VSMA 3DLLL 2A1RA 3VQPA 1I94K 2Z1JA 4EZ6A 4LC9B 1QHAA 5AQXA 1TKDA 5JS1A 3U8XA 3AO5A 3O4WA 1ITGA 4N47A 1GOBA 3V1RA 3C6AA 1EWRA 2WUSA 4C8LA 2A40A 4YDUA 4DTRA 1KCFA 2IAJA 4NLBA 3AA4A 1G15A 1GLJO 4M45A 1D9DA 1JCFA 2BTFA 1NOYA 3ZSQA 4FW2A 3LP1A 1YHQN 3HJFA 4AHRA 3SQ0A 1TL3A 1KAZA 3DLBA 3TTFA 1MDUB 4CEFA 3ISNC 4H0OA 3QIOA 4BRKA 4FVMA 1ATRA 4EHTA 1OKJA 4J2BA 4DU1A 2IDOA 4FWSA 4N5SA 3OYIA 2ZGYA 1RT4A 3THXA 1YIJN 4JI7K 4CK3A 4H4OA 4CHQA 3FGUA 4BE0A 5JS2A 1BQMA 4DCHA 1DTQA 4DTSA 4FCYA 4DFJA 5AQIA 3JAMO 3AA5X 5LMUK 4CCHA 3B8AX 1LV5A 2ETJA 2HBKA 4O8KA 3K5MA 1XNRK 1EKEA 4DB3A 2GWJA 3VEVA 2VWBA 4DR3K 2BGGA 4FJMA 4AHTA 4CJTA 4ID1A 4F8RA 2JLEA 1JLFA 4AF1A 3OY9A 5KTQA 2NRWA 3H1QA 3OS2A 4DV2K 1RNHA 3CJ9A 3VERA 4O5FA 1S6PA 1HNXK 1S6QA 4IDHA 1JXBA 3PSFA 4CFAA 4FLZA 1C1BA 2Q31A 3CCSN 2DPNA 5GAHP 3CIPA 3IKMA 5M1KA 2PBDA 3KD1E 1BA1A 3MEGA 4N41A 4GV6A 4HUGA 3CJ7A 2YV0X 4DV3K 4I9QA 4E7LA 3EKSA 2FBVA 1OH6A 5FROA 4M3YA 2E1ZA 3WQTA 5J2PA 4FLWA 1NGJA 4B1ZA 4JV5K 3FZKA 3VEZA 4JD2A 2EHGA 4DV6K 2P9PA 4IZ9A 3A5OC 4CHNA 3OYHA 1C0GA 1TYQB 5FPEA 3E9LA 3OS0A 1VSKA 1BIUA 2EWSA 2P9IA 3W3DA 3DOLA 4JI2K 3T3FA 3PSIA 1GLDG 3HP6A 5CZ1A 1F21A 4DR1K 5EXWA 1IV0A 3F9MA 5AJ3K 1RT7A 5C25A 1C1AA 3ZEUB 4EIAA 1Y97A 5FLXO 4DQIA 3TI0A 1IG8A 4MLEA 2W6KA 4R5PA 3SV3A 2Q0RA 3MN9A 1TK5A 2O8BA 1VQ9N 3CF5L 2O8CB 1HKGA 2P9UA 1WB9A 4OVLA 3OYKA 2QKBA 2KZZA 3MEEA 1KAXA 1HYVA 4O0JA 4NB4A 1XMQK 3VQ7A 3VQ9A 3ZETA 3CI5A 4FJGA 3VMFB 4CZLA 5KPRA 1BISA 5HROA 1BQNA 3KK7A 3OA9A 5CHIA 4HHTA 4FK4A 3UKRB 1B92A 3HBTA 4YHHK 3CERA 4EAHD 1XC3A 4I9LA 5K14A 5AFUH 2RN2A 3TU5A 5AZJA 3CC2N 5HRSA 1N32K 3AVKA 3FZMA 3C7NA 1WSHA 4CJEA 3KLGA 4IEEA 4FW1A 1BGXT 4DSKA 2JGUA 1HKCA 2F96A 1RDAA 3O1WA 1HJRA 3WNFA 4I6MB 1VK0A 4LF5K 4DS5A 1H1VA 3A5MC 5E41A 2ZM6K 1JLEA 3TAGA 4E3SA 4BQLA 2Y1JA 3PX6A 1XQSC 3SNNA 4M3TA 3LDLA 4CK1A 4J8FA 5KPTA 3UKUA 3OJUA 3K58A 1C0MA 1MWKA 1W97L 2FBXA 2FSJA 4DSJA 4CF8A 4OLAA 3K5LA 1NKEA 4DUZK 4KTQA 2QKKA 4DFMA 1SQKA 4KRFA 4CHYA 4GKJK 4BR4A 2NRZA 3MCPA 4R79A 2FF6A 1BWFO 3LP3A 2ZF5O 4OGEA 3V4IA 4IO8A 4FJKA 1TVRA 2KLAA 1E4GT 3MAQA 2E88A 3HSCA 4ELTA 4BRDA 3MCAB 1Q86O 1IBKK 2VQFK 3IRXA 2NLXA 5A2QO 3D2FB 4AM6A 3B6PA 4OKJA 1WBBA 3CHWA 5AQYA 2WOMA 2P5GA 3OYGA 1QQMA 2Q97A 4RW4A 2X74A 2FSNA 4BRIA 1VRUA 3G25A 1Z6RA 3SAHA 4BRAA 4YOYA 2HVHA 3L3UA 3QETA 2D4WA 5HRPA 1RBTA 3LDQA 1SL0A 1KVCA 2GWKA 3ID8A 2NNWA 4CIGA 5EOYA 3G71N 4FVUA 2P9LA 4DTXA 4NYFA 3P1GA 3U9DA 3ENHA 3SMPA 4O5BA 3TSPA 5BPLA 3RSEA 4IKFA 3PX4A 1YITN 3E9PA 1K8KB 4NCBA 3TABA 1DT9A 2AP1A 5BPNA 3PO4A 1MA9B 4FOIA 4B9NA 3VGKA 2I7NA 5KQDA 2Z1IA 1JLAA 3A5LC 3R9PA 2YHYA 2CGKA 4BRMA 4AHVA 4CZEA 3RR7A 2E20A 1ZYQA 4BGAA 3H3OB 1VRTA 5AQRA 3DLGA 3VESA 5HOOA 3EZ5A 2DY4A 3MN7A 3DWLA 5T7BA 3K59A 4RW8A 3T1YK 3LANA 3SPYA 1NK6A 1FW6A 5DK5A 3IAYA 2FSKA 5AQPA 3CETA 4NLCA 3CPEA 1VQLN 3ENOA 3L0QA 4KB1A 2YJFA 3FFKB 4W5RA 3SI6A 2A3ZA 3C0BA 4CGDA 4E1MA 4A2BA 1E4FT 2HHVA 1NK0A 1IKXA 2ASOA 4ISFA 4CGJA 1TUYA 3L4QA 4KH5A 3HRGA 5GINA 1X9MA 1KSPA 1X9WA 5CR4A 1U2VB 5KGXA 3DOKA 2HHHK 4PL7A 4BG9A 1N33K 2B5JA 3QLHA 4FLTA 3CQYA 4H8KA 2O8DB 1NGHA 2Q36A 4BR5A 1VSDA 3CXCM 1C0TA 5I3UA 3THVA 2VG7A 3LL3A 4IOCL 4K0KK 2YNFA 4CJ7A 1IBLK 1QVGM 2D0PA 3TTCA 4HVJA 4J2AA 4OPJA 3PIOL 3ZLJA 3GBTA 1IG9A 3K9KA 3TAPA 5F0XA 3AVNA 1EWQA 3S41A 1OVQA 1ATSA 4DTMA 3SAGA 4M3XA 4QS9A 4FWKA 4OKEA 4O4GA 4B08A 1ZXOA 2VGNA 4XEIA 4BRCA 4CW7B 3UKRA 3THYB 5CYQA 4CE9A 1JCGA 1RDCA 4QCLA 3VF4A 1QE1A 2HHWA 5AQHA 3VN5A 4MFBA 5HP1A 2O4IA 5LJVA 3ZX2A 4ISGA 4GMJB 3EO3A 3ZSYA 3M3ZA 1HQUA 2D1KA 5FPNA 4FWQA 4WQ5A 3L8BA 2CH6A 4WQ5C 3ZSRA 4IG3A 1T44A 2OYQA 3MX5A 2IOCA 1UAXA 1S1VA 3WUHA 4Q0BA 2Y1IA 4F3TA 5EY4A 3L2VA 4KI4A 3P83D 1KC8O 2W41A 2EX3A 5AZIB 2PZSA 2P1JA 4CJSA 1SL2A 4WF9L 3BEXA 1CZ9A 1J9AA 2PAVA 1L3VA 1Z26A 3VQBA 3IDHA 1ASUA 1J53A 3QEWA 4FZZA 2GX9A 2NRRA 1HPMA 4B9QA 4DV5K 2UXCK 1RBUA 2G8KA 3OTOK 3PX0A 1TKXA 3AO2A 3THWA 4YY3K 3KWIA 4ELVA 2HHSA 1C1CA 1JXEA 3SK3A 3EL2A 3AVCA 1NJZA 1JJ2M 4CFCA 1ZC6A 3ZSWA 3UB5A 4C8NA 3NMUA 1LAWA 3J80O 2R7YA 4PL8A 2O8FB 3E9OA 2B6AA 5CYMA 2Z1HA 2LSNA 1YUWA 4AQYK 4IFYA 1FJGK 2BDPA 3WNGA 4FWOA 4IXCA 4J2DA 3QB0A 1HMVA 4CJ4A 3P5JA 1XHXA 5SWMA 3PO5A 1A5XA 1D5AA 3DXMB 3NF8A 1IBMK 2F8TA 3MK6A 1IKYA 1ESVA 1S1XA 4BC5A 2YCHA 4FJXA 1S1TA 3SCXA 4OLBA 4FWRA 3K57A 3D2EB 4JEPA 2E2QA 1NOZA 4CIFA 4RWTA 4FJHA 4FJNA 1S1WA 1WUAA 4HWIA 4X66K 3L3VA 3BUZB 4KI6A 3MXJA 2W42A 3NGIA 2XY7A 3ZSZA 3HSTB 3JYTA 4M7XA 3SAFA 5AQVA 4F9OA 5M1FA 3AAQA 3QICA 2PYJA 4H5NA 2KW4A 1M90O 4IO9L 1UA0A 4KHUA 3CJ1A 3P4IA 1QZ6A 1VSEA 4B1XB 3CMAN 4DQQA 4LF9K 2O8EA 2AA4A 4JRQA 4B3RK 3HP9A 5GAGP 4KTZA 4WQ4A 5LMNK 4YDUC 3VEWA 2VWJA 3DLRA 4A59A 3O9UA 3LP2A 4B3SK 4JK7A 1RT6A 3DAWA 4JI3K 2FLOA 2IC3A 2HOEA 4I2QA 5C0YA 1TAUA 1Z25A 2O8DA 3H1VX 3B6OA 3ID6A 4OKKA 2NRXA 4E1JA 5LY3A 1BA0A 2NRHA 4BY9C 2GEMA 1LWFA 3V9WA 3FZLA 4H0TB 2QWQA 1YT3A 3CJCA 4BRFA 3EYZA 3FFIA 3AO3A 2QWMA 4LFAK 4WE1A 5HLFA 3SBTA 1KTQA 1TKZA 3BGRA 3FLCO 1S3XA 1WSGA 3I0SA 3LAMA 2P9NA 1Q9YA 3J7ZO 4JKCA 3O6WA 3AVBA 4E1NA 4FJIA 3KLHA 1VSJA 2P9KB 4PA1A 3J7YP 1XI1A 3PLAA 2D0CA 1NBWA 2FC0A 3OBWA 1Z05A 1NNEA 3HOTA 3TAFA 1DGKN 1W2BM 1U47A 3KIOA 4FWLA 3DXKB 4RW7A 4BE2A 4CESA 2HBJA 5E84A 4M3RA 4YFUA 3DJCA 4JK8A 2QWLA 2ITMA 2HMPA 1NMDA 2XY6A 3GDQA 1C0FA 1QQCA 3M8RA 4E89A 4UY8O 4U67L 3AO1A 1KFDA 3ZSOA 1VSLA 3MN6A 2A6AA 4KV8A 3CFOA 4PQUA 1CXQA 1X1PA 2V7YA 4EFHA 5JVHL 1JCEA 3EZWA 4K8XA 1EXQA 4CBWA 3AGRA 4FWMA 4BREA 2ZWHA 4B1UB 4BQZA 2PYLA 1ZBIA 5BREA 1N34K 4O55A 1RT1A 4BRNA 1BG3A 4BWMA 3OYCA 1XMOK 3LZIA 4GVMA 1OH7A 1ZBUA 3C6TA 3TWHA 1SV5A 5CZ2A 4BDYA 1LWEA 2WONA 4DTNA 4OPHA 1T03A 2JWKA 1NK5A 1RTHA 1Y64A 2A5XA 3AO4A 2PY5A 2Z1GA 1N8RO 3D45A 1K6YA 4EHUA 2KFZA 1NK4A 4XIUA 3VQQA 3SQ4A 4OPKA 4DFPA 4CEEA 2X78A 3QIPA 5AQKA 3DI6A 2WC9A 4PHTX 5ADXH 3WXLA 2IIRA 4FJJA 1SKRA 3VTIA 1FKPA 3ULDA 3CJBA 1RBRA 4FOEA 1KLMA 4ILGB 4FYDA 1QHTA 3VF6A 2QEXN 3EE9A 2IGIA 4A57A 1HX1A 2A41A 1WAFA 4JI5K 2OCEA 2P9SB 4DR6K 3QNOA 3AGKA 3WNEA 3CCJN 3VPZA 4EP5A 4JHDB 4PKIA 3K5OA 4HCCA 5BR8K 1BIZA 4CZJA 3IS9A 3ULEB 5CY4A 2OA8A 4DTJA 4E7IA 2Q0UA 1KXPA 3H08A 4ILJA 3RRHA 2CH5A 4DUYK 4WFNL 3I33A 3RVCA 3T1AA 4PWDA 1LW0A 2XRIA 1RTJA 3KHYA 1U4BA 5BRDA 1VQKN 2AJQA 3MX2A 4DLEA 4AH9A 4CGIA 4B9LA 1P90A 3KKRA 1UOCA 2IVOA 3EEQA 3BDPA 1XC9A 1KVAA 4GNIA 4FJ5A 3VGMA 4UQGA 2YHBA 2F7TA 4K43A 3R1XA 1VHXA 3VQEA 1JLGA 1TUUA 2FXUA 3WEEA 4B1VA 1HR0K 4NYNA 5KQ8A 3N4PA 5EU7A 4B9TA 4MQ3A 4CGFA 4LSNA 4LD0A 1KLNA 2V52B 5M1OA 4DV4K 4BGBA 3RMDA 4IJAA 1R0AA 5JVGL 3HOSA 3KD5E 3QINA 1VQ7N 4E0DA 3K2PA 2ATQA 4MLHA 3QNNA 3KK2A 2HHQA 1NLVA 1K8AO 4IG0A 3NGZA 1QSLA 3HVTA 4CBUA 4OO1J 3QEXA 4C8MA 4LFBK 3JXUA 4YNQA 3F2KA 4CJFA 5C10A 1TKTA 3O80A 1U48A 5AQGA 3Q7CA 3CM5A 3V1QA 1NGAA 3P38A 3TARA 4Z4IA 1MU2A 1U6ZA 3NGYA 2NRVA 2RPIA 5FRMA 3VA3A 2CGLA 4YOXA 4DKWA 4O44A 3C95A 2OPQA 3D7EO 1BI4B 2QXLA 5EVZA 3RMAA 2E2PA 4A5BA 4GY2B 3OBYA 3T69A 3M5RA 1LW2A 4O8UA 2QWNA 2A1SA 3RMBA 1QTMA 4YOVA 3F73A 2UU9K 3A8YA 2NRTA 4CD3A 3U9ZA 4JKGB 1VQ6N 3PUFA 3AV9A 3HO1A 2A42A 1GOAA 4B9SA 2H3GX 3LWLA 1TK0A 3LALA 3AVIA 1K9MO 5FDLA 4KHPK 1BL3A 3KKSA 2UXDK 3IMXA 4AILC 3ZT0A 1XWLA 2G8IA 4FLXA 3R8EA 1NGIA 5BRHA 4CJRA 4JI4K 4Y1DA 4B3MK 5GAEP 1T7PA 1HKBA 2GTDA 1GLCG 5AQLA 2HMIA 1SL1A 4CK2A 1J6ZA 1IKVA 5AQNA 1A5VA 1L5UA 1C6VA 2DFHA 1HUXA 3KK3A 5MLCQ 3CCMN 4CZKA 1EQYA 3VF2A 3ZT2A 3SPZA 3VQ8A 4ICLA 1BHLA 4CI6A 3I8BA 3I55N 4H5VA 4PY5A 4JN4A 1BUPA 3CJAA 3HYFA 3VETA 3NVMA 5AQWA 3LWMA 3G6EN 3DMJA 1N5YA 3UIQA 3H6EA 1VQMN 4G9ZA 2QTDA 3O4QA 3KLFA 3BF1A 2F8SA 1VQNN 3BZKA 3QESA 1TYQA 3QBWA 3VA0A 3LM2A 4IWVA 4LSLA 1WBDA 4DV1K 4FLYA 4B1WB 4CEQA 3J81O 4QAGA 3FE1A 3E1YA 4FM1A 5KRSA 5GADP 3D6RA 3MWPA 2QWPA 5E26A 3ZEUA 4CHPA 1NK9A 1JKHA 1D9FA 1YVUA 2HBMA 1HNWK 4RCHA 3A5NC 1CZBA 3TTDA 1GOCA 3O1BA 4CF1A 1ASWA 4YORA 3MEDA 4RTFD 3GG4A 3LDNA 4FXDA 2YHWA 5HRRA 4JI0K 1VQ8N 2O8CA 4Z4HA 4DQPA 4DF8A 1RDUA 4OGCA 3O3GA 1S9GA 4H5RA 3MMVA 2YNGA 4JLHA 4KH4A 4LF7K 4DSFA 2G8UA 3CC7N 2B4JA 3T19A 4B8CA 3V1OA 1N6QA 1WAJA 1WSEA 1V4SA 2XY5A 4CERA 3NFAA 3AA3A 4ZTJA 4BVOA 1Q9XA 3THXB 4H4MA 3KTQA 1HYSA 2ZJPL 1J54A 3KLEA 2IS3A 4CGHA 1OH5A 4J2EA 3H3NO 5JICA 1ZBFA 1X9SA 3F5TA 5AQMA 4Z4CA 3E66A 3NF6A 4H5TA 5CE3A 3O3FA 1J5EK 1DKGD 2I5JA 5AQJA 4HUFA 1QQOA 3CCVN 1QQNA 3N4QA 1BDGA 4CJQA 3NH0A 4E7JA 3BZCA 4FO0A 4Z4EA 4I6MA 4BC4A 3QMLA 3VQ5A 1VAZA 3AVMA 3CQXA 4JKHA 4GW6A 4KTWA 4M3UA 1HNIA 2UUAK 1TV6A 4ID5A 4WYBA 3K5NA 2IVNA 3MN5A 4C1NK 2F9WA 4X62K 3S9HA 1YJNN 3BY5A 3IG1A 3VQAA 1GLBG 4X65K 1RFQA 4CEBA 1ZBSA 3ZSVA 1KAYA 3HI0A 3EKUA 4CJUA 4FPBA 2D0AA 3SZ2A 2QM1A 5JLHA 2D0BA 4FPAA 2XHBA 1NMNA 3O5BA 4KH6A 4BC3A 2OTJN 1VQ5N 3RMCA 5BR9A 4K42A 4L8RB 3VQDA 5AFUA 3O8MA 2KTQA 4KO0A 3CCQN 2XY8A 1Q8IA 5HL7L 5DMRA 1M1KO 3OYDA 3ENBA 3O3HA 4BR0A 2X6NA 2Q2RA 1SS6A 3KJVA 4IBNA 4I7FA 3VENA 2E8AA 3D2FA 2GUIA 4JD2B 3ZT4A 4YOTA 4F4KA 2P9PB 3C6UA 2ZE2A 4AHCA 3MWTA 3BP8A 3SUPA 4LFCK 3A0IX 4FK2A 2IVPA 4V19S 4DS4A 4BRPA 5GIOA 1EO1A 3HVRA 1HYZA 3U4LA 2E1YA 3OYEA 4WCEL 1YI2N 4A2AA 3O9TA 2V7ZA 4DSLA 4M3ZA 2HW3A 1L3TA 1GLAG 5HRNA 3O9RA 3OVNA 3W0LA 4CJLA 4Z4FA 2YX6A 1S1UA 1K8KA 4W5TA 1YTAA 3PY8A 2F9TA 2YHXA 1RT5A 1IH7A 1NKBA 1FKOA 3DRSA 2E4LA 4OJRA 2HNYA 3ZX0A 3WXIA 4CJ5A 4JNEA 5BRFA 3VQ4A 2O8BB 1BO5O 4BACA 2VCPA 1NJWA 1MWMA 3I56N 2P9UB 1QS4A 3I0RA 3E01A 4CEOA 5FPDA 1RT2A 3U6FA 3CFPA 3SUNA 4QOZB 3R3LA 4CBXA 1V4TA 3QBXA 5M1NA 1NGGA 5C24A 3L2WA 3ZETB 4Y0WA 3CCUN 1B9DA 1TAQA 4XH5A 2DFFA 5C2DA 3LAKA 4FJ8A 3VGLA 3FZFA 1TK8A 4E19A 1YXQA 1Q81O 1T8EA 5AQTA 2JWLA 3NH2A 5AZJB 4CJWA 2HHXA 5TKYA 3TAMA 4JKAA 3C7NB 2RKIA 3LDOA 2G8HA 4CFDA 2VG6A 4WQ4C 3P39A 5AR0A 4OX9K 4BVPA 1W7AA 4DTOA 4RW9A 1U2VA 4KHWA 3CG7A 2YNHA 4CF2A
chains in the Genus database with same CATH topology
3SMPA 2Q0UA 1KXPA 4ILJA 3TSPA 3SJHA 5BPLA 3RSEA 2CH5A 5EX5A 4XH1A 3E9PA 1YITN 1K8KB 4WFNL 3I33A 3RVCA 3WXMB 1RGIA 1DT9A 3AARA 5KPZA 2AP1A 5BPNA 2RHKA 4ISEA 1MA9B 4FOIA 2QWRA 3KHYA 1NGFA 3UKUB 5BRDA 2NZTA 3R6MA 1VQKN 3MX2A 3J8AA 2I7NA 3VGKA 4KBOA 1P90A 5KQDA 3TSUA 2BUPA 2QWOA 1VQPN 2IVOA 4H0YB 3WT0A 1X3MA 3AAPA 3A5LC 1BOTO 2YHYA 4MO4A 3R9PA 2CGKA 1SZ2A 4BRMA 2Q1NA 4GNIA 4CZEA 2E2NA 3VGMA 2QI2A 2I7PA 2E20A 4CZGA 3ATUA 4PKHA 3CCEN 4BGAA 3H3OB 2F7TA 1QZ5A 2W40A 1NGEA 4K43A 3FZHA 1IJJA 3R1XA 5AQRA 3LM9A 3VESA 4BR7A 5HOOA 2GUPA 1TUUA 2FXUA 1WOQA 5AQUA 3MN7A 3WEEA 4B1VA 3DWLA 3CCLN 1T6CA 5KQ8A 3N4PA 4PKGA 4JKGA 2FSKA 5AQPA 3WXJA 3CETA 4NLCA 2V52B 5M1OA 3CPWM 3CPEA 4QS7A 3ENOA 4BGBA 4IJAA 2P9IB 2HF3A 3L0QA 3GE1A 1VQLN 2YJFA 3L6QA 4JKFA 5JVGL 1RDWX 3C6HA 3HOSA 3FFKB 1VQON 4GV3A 1VQ7N 2A3ZA 3CCRN 1OVYA 3C0BA 2WBNA 4A2BA 1E4FT 3GOIA 4MLHA 2ASOA 4ISFA 4DQ8A 1NLVA 1K8AO 4NO7A 1TUYA 3L4QA 4KH5A 3HRGA 5GINA 4BRGA 1QVFM 3AY9A 3EE8A 4CBUA 5I9EB 4OO1J 2P9LB 4BC2A 5CR4A 3JXUA 1U2VB 3KVGA 5AQSA 2HF4A 3F2KA 4PL7A 5C10A 4BG9A 3IFRA 3O80A 1D4XA 3CQYA 5AQGA 3RSEB 1P8ZA 3Q7CA 1NGHA 2Q36A 4BR5A 5C15A 4MO5A 3CXCM 5FPMA 3ZYYX 1NGAA 3P38A 4MDAA 4JKBA 5LJWA 1U6ZA 2NRVA 5AQQA 5AZIA 1S72N 4BRHA 3ZX3A 3PIPL 2CGLA 4YOXA 3LL3A 4IOCL 4DKWA 4CJ7A 1Q7YO 1QVGM 1HJOA 1HLUA 4U7BA 2D0PA 3D7EO 4BR9A 3TTCA 1GLLO 4A62A 4BROA 4H0PA 1CZAN 2QXLA 5EVZA 3PIOL 3GBTA 3QFPA 1T6DA 5GIPA 2E2PA 3K9KA 3CC4N 4IOAL 4C1NI 4A5BA 4ILHA 4GY2B 5M1QA 3OBYA 5F0XA 3T69A 3CMEN 3M5RA 4IEIA 3S41A 3JS6A 4O8UA 4A61A 2QWNA 1ATSA 4WFBL 3LDPA 1XUPO 2E2OA 3WEEB 3H46O 3SAGA 5BN9A 4YOVA 4QS9A 3KZBA 4BR2A 3A8YA 4FWKA 5DM6L 2NRTA 4CD3A 1ZXOA 2VGNA 4XEIA 1O13A 3VTHA 3U9ZA 4BRCA 1KD1O 4JKGB 4L3QA 3UKRA 4Z94A 1VQ6N 1KQSM 4AM7A 2YJEA 3P31A 3WXKA 1JCGA 3DLLL 2A42A 4JAXA 5JMVA 2H3GX 3VF4A 4LC9B 1K9MO 5AQHA 1QHAA 3HM8A 2ZGZA 5AQXA 3ZX2A 5LJVA 3IMXA 4ISGA 3EO3A 3HZ6A 3M3ZA 2D1KA 3R8EA 1NGIA 4FWQA 3O4WA 5FPNA 3U8XA 5BRHA 3C65A 2ASMA 4WQ5A 5AQFA 2CH6A 4WQ5C 1T44A 5GAEP 2VYPA 1HKBA 2GTDA 3FR0A 3MX5A 4K25A 4M7YA 3C6AA 1GLCG 3T7ZA 2WUSA 5DM7L 2V51B 2A40A 4YDUA 5AQLA 4NLBA 3K9JA 3WUHA 1GLJO 1J6ZA 5AQNA 2KKZA 1JCFA 2BTFA 3DXMA 5EY4A 1YHQN 1HUXA 5MLCQ 3CCMN 1KAZA 4BRQA 4CZKA 1KC8O 1EQYA 3VF2A 2W41A 3TTFA 4A5AA 5AZIB 1MDUB 3D2EA 4H0OA 3QDKA 4CI6A 1NWKA 4BRKA 5C12A 4WF9L 3BEXA 1ATRA 4EHTA 1OKJA 2J4RA 3I8BA 5BPMA 2PAVA 1SAZA 3I55N 4H5VA 3IDHA 4JN4A 2GX9A 1BUPA 1HPMA 2NRRA 4B9QA 3CJAA 4FWSA 3EN9A 3VETA 3NVMA 2ZGYA 5AQWA 3G6EN 1YIJN 3VEOA 4H0XB 4K41A 3H6EA 3KWIA 1VQMN 2PFUA 4G9ZA 3Q7BA 2QTDA 3SK3A 3FGUA 3EL2A 4H0VB 4GV9A 2HBLA 3BF1A 1VQNN 1JJ2M 1TYQA 3QBWA 4DCHA 3LM2A 1ZC6A 4IWVA 5AQIA 3UB5A 2D0OA 5AQOA 3B8AX 2OANA 2HBKA 4MDBA 4O8KA 4M63C 4B1WB 4DB3A 4C23A 3NMUA 2GWJA 3VEVA 2VWBA 3FE1A 3E1YA 4PL8A 5GADP 3D6RA 3E9OA 3H45C 1YUWA 3MWPA 2QWPA 5E26A 3ZEUA 1NGDA 4AF1A 4CZMA 1LCUA 4FWOA 2HBMA 4IXCA 4YOUA 4RCHA 2NRWA 3QB0A 3A5NC 3TTDA 3H1QA 3O1BA 4YORA 3CJ9A 4RTFD 3GG4A 3LDNA 4O5FA 1YVNA 3VERA 2YHWA 1T3VA 5BN8A 3DXMB 5AQZA 1VQ8N 4IDHA 3VOVA 3MK6A 3L4IA 1ESVA 2Q31A 4BG8A 3CCSN 1ILYA 2DPNA 4BC5A 4CD1A 5GAHP 2YCHA 1RDUA 3CIPA 3IKMA 5M1KA 4FWRA 3MDQA 3D2EB 2PBDA 4H5RA 4JEPA 2E2QA 3MMVA 1BA1A 2CGJA 4RWTA 4KH4A 1WUAA 4HWIA 4GV6A 3CC7N 3UE5A 3BUZB 3CJ7A 1DEJA 5C2FA 5F2RA 3EKSA 1V4SA 2P9KA 4BVOA 2E1ZA 3WQTA 4JK9A 1NGJA 4B1ZA 2ZJPL 3FZKA 3VEZA 4IFEA 4JD2A 1S22A 3SBGA 2QA4N 4FWPA 3OW2M 2P9PA 3BF3A 3H3NO 5F1XA 4IZ9A 5JICA 3A5OC 3DXKA 3F5TA 4M7XA 3VEXA 3SAFA 1YJ9N 5AQVA 4F9OA 1C0GA 5M1FA 1X9JA 1TYQB 3AAQA 3E9LA 3QICA 5FPEA 4WFAL 4H5NA 5AQMA 4JKDA 3E66A 4H5TA 5CE3A 4IO9L 4B1YB 1M90O 2EWSA 3CJ1A 3TSQA 1DKGD 3P4IA 5AQJA 1QZ6A 1QQOA 2P9IA 4FWNA 3W3DA 4XH4A 4B1XB 1QQNA 3CCVN 3N4QA 3CMAN 1BDGA 2GELA 2AA4A 4FO0A 1GLDG 5GAGP 5ELZA 3IUCA 4I6MA 4BC4A 3QMLA 1VAZA 3CQXA 3M1FA 4JKHA 4WQ4A 4YDUC 3VEWA 5EXWA 4A59A 3F9MA 4BRLA 4WYBA 3O9UA 1X3NA 3ZEUB 4JK7A 3G4SN 2IVNA 4EIAA 3MN5A 4C1NK 2F9WA 3DAWA 2KHOA 1YJNN 2FLOA 3KWGA 2HOEA 1IG8A 4MLEA 5C0YA 1GLBG 2Q0RA 5H1SQ 3MN9A 4DHYA 1RFQA 3H1VX 3ID6A 1ZBSA 1VQ9N 2NRXA 4E1JA 1KAYA 3HI0A 1BA0A 1HKGA 2NRHA 2P9UA 5LY3A 2ZJQL 3CF5L 4BY9C 3EKUA 2GEMA 4FPBA 3FZLA 2QM1A 4H0TB 5JLHA 2QWQA 3CJCA 4BRFA 4CZFA 1Q82O 2QWMA 1NM1A 4FPAA 2UYTA 3O5BA 4KH6A 3SBTA 4BC3A 1KAXA 2OTJN 1VQ5N 4NB4A 5BR9A 4K42A 2ASPA 5AFUA 3O8MA 3ZETA 3CI5A 1S3XA 3FLCO 3HTVA 3O9SA 3VMFB 4CZLA 5KPRA 2P9NA 5HL7L 3CCQN 3NVKA 1M1KO 3J7ZO 3ENBA 4JKCA 1NGBA 3O6WA 4BR0A 3KK7A 2P9KB 3PLAA 2Q2RA 3OA9A 1SS6A 5CHIA 3VENA 1R59O 1NBWA 4H5WA 3UKRB 2E8AA 3D2FA 4GVEA 4JD2B 3HBTA 3OBWA 1Z05A 3CERA 4YOTA 3HOTA 4EAHD 5JLFA 1XC3A 1DGKN 2P9PB 1W2BM 4FWLA 5AFUH 2P9SA 3DXKB 5TKWA 3TU5A 5AZJA 3CC2N 1LOTB 3O08A 2HBJA 3MWTA 1ATNA 3BP8A 3FZMA 5E84A 3DJCA 3A0IX 2QWLA 3C7NA 4JK8A 2BH1A 2ITMA 2HMPA 1NMDA 3OHRA 2IVPA 3GDQA 1C0FA 4IEEA 4UY8O 4JHDA 4BRPA 4U67L 5GIOA 4H03B 1EO1A 1YAGA 3MN6A 2A6AA 1HKCA 3U4LA 2E1YA 4WCEL 2YI1A 1YI2N 4FSVA 2V7YA 3O1WA 1NJIO 4EFHA 4I6MB 2HSTA 4A2AA 3O9TA 2V7ZA 1JCEA 2QW9A 4OPAA 5JVHL 3EZWA 3TPQA 3ULEA 1GLAG 4CBWA 1H1VA 3A5MC 3AGRA 3QFUA 4FWMA 4BREA 3O9RA 2ZWHA 4IOXA 4B1UB 4BQZA 3W0LA 5BREA 2YX6A 4HTLA 3WQUA 3ATVA 1G99A 4BQLA 1GLEG 1K8KA 4BRNA 1BG3A 1XQSC 2F9TA 2YHXA 4YOWA 3LDLA 4J8FA 3ZX0A 3WXIA 2OTLN 5KPTA 4JNEA 3UKUA 5BRFA 1GLFO 1MWKA 1BO5O 1W97L 2FSJA 2VCPA 4OPHA 5ADXA 2JWKA 2ZJRL 1MWMA 3I56N 2P9UB 5M1PA 1Y64A 2A5XA 2FF3B 1N8RO 4EHUA 5FPDA 1SQKA 1NGCA 3R3LA 4CBXA 4BR4A 2NRZA 3MCPA 1V4TA 3QBXA 4R79A 4CZHA 2FF6A 1BWFO 5M1NA 2ZF5O 5AQKA 1BU6O 1NGGA 4FL9A 4IJNA 4IO8A 2KLAA 1E4GT 3ZETB 2RE2A 2WC9A 2E88A 3WXLA 2IIRA 4Y0WA 4PHTX 5ADXH 3HSCA 3CCUN 2P9NB 3SMSA 3VTIA 3CJBA 4BRDA 3MCAB 4FOEA 4QS8A 4XH5A 1Q86O 5C2DA 3M6GA 5B8HA 4ILGB 3VGLA 3FZFA 2NLXA 3VF6A 3D2FB 3EE9A 4AM6A 2QEXN 1YXQA 1HX1A 2A41A 3CHWA 3GL1A 4A57A 5AQYA 1K73O 3SLCA 1YF5L 1Q81O 1VQ4N 2P9SB 5AQTA 2JWLA 2VGMA 4JKEA 5AZJB 1QQMA 2Q97A 3AGKA 5TKYA 4JKAA 2FSNA 4BRIA 3C7NB 3G25A 3CCJN 3LDOA 1Z6RA 3SAHA 4BRAA 4YOYA 3VPZA 2D4WA 3VEYA 3LDQA 4JHDB 4WQ4C 2GWKA 3O9QA 4PKIA 3P39A 3ID8A 2NNWA 1YJWN 5EOYA 5AR0A 3G71N 2P9LA 2WFBA 3CD6N 4FVUA 4BVPA 4CZJA 4CZIA 1U2VA 3U9DA 1Q18A 3ENHA 3ULEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SMP A;  2Q0U A;  1KXP A;  3SJH A;  5BPL A;  3RSE A;  2CH5 A;  5EX5 A;  4XH1 A;  1K8K B;  3I33 A;  1RGI A;  3AAR A;  5KPZ A;  2AP1 A;  5BPN A;  4ISE A;  1MA9 B;  4FOI A;  2QWR A;  3KHY A;  1NGF A;  3UKU B;  5BRD A;  2NZT A;  3R6M A;  3J8A A;  2I7N A;  3VGK A;  4KBO A;  5KQD A;  2BUP A;  2QWO A;  2IVO A;  4H0Y B;  3WT0 A;  1X3M A;  3AAP A;  3A5L C;  1BOT O;  2YHY A;  4MO4 A;  3R9P A;  2CGK A;  1SZ2 A;  4BRM A;  2Q1N A;  4GNI A;  4CZE A;  2E2N A;  3VGM A;  4CZG A;  2I7P A;  2E20 A;  3ATU A;  4PKH A;  4BGA A;  3H3O B;  1QZ5 A;  2W40 A;  1NGE A;  4K43 A;  3FZH A;  1IJJ A;  5AQR A;  4BR7 A;  3LM9 A;  3VES A;  2GUP A;  1TUU A;  2FXU A;  1WOQ A;  5AQU A;  3MN7 A;  3WEE A;  4B1V A;  3DWL A;  1T6C A;  5KQ8 A;  4PKG A;  2FSK A;  5AQP A;  3WXJ A;  3CET A;  2V52 B;  4QS7 A;  3ENO A;  4BGB A;  4IJA A;  2P9I B;  2HF3 A;  3L0Q A;  3GE1 A;  2YJF A;  3L6Q A;  1RDW X;  3FFK B;  2A3Z A;  3C0B A;  4A2B A;  1E4F T;  3GOI A;  4MLH A;  2ASO A;  4ISF A;  4DQ8 A;  1NLV A;  4NO7 A;  1TUY A;  4BRG A;  3AY9 A;  4CBU A;  5I9E B;  2P9L B;  4BC2 A;  3JXU A;  1U2V B;  3KVG A;  5AQS A;  2HF4 A;  4PL7 A;  4BG9 A;  3IFR A;  3O80 A;  1D4X A;  3CQY A;  5AQG A;  3RSE B;  1P8Z A;  1NGH A;  2Q36 A;  4BR5 A;  4MO5 A;  5FPM A;  1NGA A;  5LJW A;  1U6Z A;  5AQQ A;  5AZI A;  4BRH A;  3ZX3 A;  2CGL A;  3LL3 A;  4CJ7 A;  1HJO A;  1HLU A;  2D0P A;  3D7E O;  4BR9 A;  1GLL O;  4A62 A;  4BRO A;  4H0P A;  1CZA N;  2QXL A;  5EVZ A;  3GBT A;  3QFP A;  1T6D A;  2E2P A;  4GY2 B;  5F0X A;  3S41 A;  3JS6 A;  4A61 A;  2QWN A;  1ATS A;  3LDP A;  1XUP O;  2E2O A;  3WEE B;  3H46 O;  5BN9 A;  4QS9 A;  3KZB A;  4BR2 A;  3A8Y A;  4FWK A;  4CD3 A;  1ZXO A;  4XEI A;  4BRC A;  3U9Z A;  4L3Q A;  3UKR A;  4Z94 A;  4AM7 A;  2YJE A;  3WXK A;  1JCG A;  2A42 A;  4JAX A;  5JMV A;  2H3G X;  3VF4 A;  4LC9 B;  5AQH A;  1QHA A;  3HM8 A;  2ZGZ A;  5AQX A;  3ZX2 A;  5LJV A;  3IMX A;  4ISG A;  3EO3 A;  3HZ6 A;  3M3Z A;  2D1K A;  3R8E A;  1NGI A;  4FWQ A;  3O4W A;  5FPN A;  3U8X A;  5BRH A;  2ASM A;  4WQ5 A;  5AQF A;  2CH6 A;  4WQ5 C;  1T44 A;  2VYP A;  1HKB A;  2GTD A;  3FR0 A;  4K25 A;  4M7Y A;  1GLC G;  2WUS A;  2V51 B;  2A40 A;  4YDU A;  5AQL A;  3WUH A;  1GLJ O;  1J6Z A;  5AQN A;  1JCF A;  2BTF A;  3DXM A;  5EY4 A;  1HUX A;  1KAZ A;  4BRQ A;  4CZK A;  1EQY A;  3VF2 A;  2W41 A;  5AZI B;  1MDU B;  3D2E A;  4H0O A;  3QDK A;  4CI6 A;  1NWK A;  4BRK A;  3BEX A;  1ATR A;  4EHT A;  1OKJ A;  2J4R A;  3I8B A;  5BPM A;  2PAV A;  1SAZ A;  4H5V A;  3IDH A;  4JN4 A;  1BUP A;  1HPM A;  4B9Q A;  3CJA A;  4FWS A;  3EN9 A;  3VET A;  2ZGY A;  5AQW A;  3VEO A;  4H0X B;  4K41 A;  3H6E A;  3SK3 A;  3FGU A;  3EL2 A;  4H0V B;  3BF1 A;  1TYQ A;  3QBW A;  4DCH A;  3LM2 A;  1ZC6 A;  4IWV A;  5AQI A;  3UB5 A;  2D0O A;  5AQO A;  3B8A X;  2OAN A;  4O8K A;  4B1W B;  4M63 C;  4DB3 A;  4C23 A;  2GWJ A;  3VEV A;  2VWB A;  3FE1 A;  4PL8 A;  3H45 C;  1YUW A;  2QWP A;  5E26 A;  3ZEU A;  1NGD A;  4CZM A;  1LCU A;  4FWO A;  4IXC A;  4RCH A;  3QB0 A;  3A5N C;  3H1Q A;  3O1B A;  3CJ9 A;  4RTF D;  3GG4 A;  3LDN A;  4O5F A;  1YVN A;  3VER A;  2YHW A;  5BN8 A;  3DXM B;  5AQZ A;  3VOV A;  3MK6 A;  3L4I A;  1ESV A;  2Q31 A;  4BG8 A;  2DPN A;  4BC5 A;  4CD1 A;  2YCH A;  3CIP A;  4FWR A;  3MDQ A;  3D2E B;  2PBD A;  4H5R A;  2E2Q A;  3MMV A;  1BA1 A;  2CGJ A;  4RWT A;  1WUA A;  4HWI A;  3UE5 A;  3BUZ B;  3CJ7 A;  1DEJ A;  5F2R A;  3EKS A;  1V4S A;  2P9K A;  4BVO A;  2E1Z A;  3WQT A;  1NGJ A;  4B1Z A;  3FZK A;  3VEZ A;  4JD2 A;  1S22 A;  4FWP A;  2P9P A;  3BF3 A;  3H3N O;  5F1X A;  4IZ9 A;  5JIC A;  3A5O C;  3DXK A;  4M7X A;  3VEX A;  5AQV A;  4F9O A;  1C0G A;  1X9J A;  1TYQ B;  3AAQ A;  3QIC A;  5FPE A;  4H5N A;  5AQM A;  4H5T A;  5CE3 A;  4B1Y B;  2EWS A;  3CJ1 A;  1DKG D;  3P4I A;  5AQJ A;  1QZ6 A;  1QQO A;  2P9I A;  4FWN A;  3W3D A;  4XH4 A;  4B1X B;  1QQN A;  1BDG A;  2GEL A;  2AA4 A;  4FO0 A;  1GLD G;  5ELZ A;  3IUC A;  4I6M A;  4BC4 A;  3QML A;  3CQX A;  3M1F A;  4WQ4 A;  4YDU C;  3VEW A;  5EXW A;  4BRL A;  3F9M A;  4WYB A;  1X3N A;  3ZEU B;  2IVN A;  4EIA A;  3MN5 A;  2F9W A;  3DAW A;  2KHO A;  2FLO A;  2HOE A;  1IG8 A;  4MLE A;  1GLB G;  2Q0R A;  3MN9 A;  4DHY A;  1RFQ A;  3H1V X;  1ZBS A;  4E1J A;  1KAY A;  3HI0 A;  1BA0 A;  1HKG A;  2NRH A;  2P9U A;  5LY3 A;  3EKU A;  2GEM A;  4FPB A;  3FZL A;  2QM1 A;  4H0T B;  5JLH A;  2QWQ A;  3CJC A;  4BRF A;  4CZF A;  2QWM A;  1NM1 A;  4FPA A;  2UYT A;  3O5B A;  4BC3 A;  1KAX A;  4NB4 A;  5BR9 A;  4K42 A;  2ASP A;  5AFU A;  3O8M A;  3ZET A;  3CI5 A;  1S3X A;  3FLC O;  3HTV A;  4CZL A;  5KPR A;  2P9N A;  1NGB A;  3O6W A;  4BR0 A;  2P9K B;  2Q2R A;  3VEN A;  1R59 O;  1NBW A;  4H5W A;  3UKR B;  2E8A A;  3D2F A;  4JD2 B;  3HBT A;  1Z05 A;  3CER A;  4EAH D;  5JLF A;  1XC3 A;  1DGK N;  2P9P B;  4FWL A;  5AFU H;  2P9S A;  3DXK B;  3TU5 A;  5AZJ A;  1LOT B;  3O08 A;  5E84 A;  1ATN A;  3BP8 A;  3FZM A;  3DJC A;  3A0I X;  2QWL A;  3C7N A;  2ITM A;  2HMP A;  1NMD A;  3OHR A;  2IVP A;  3GDQ A;  1C0F A;  4JHD A;  4BRP A;  4H03 B;  1YAG A;  3MN6 A;  2A6A A;  1HKC A;  3U4L A;  2E1Y A;  2YI1 A;  4FSV A;  2V7Y A;  3O1W A;  4EFH A;  4I6M B;  4A2A A;  2V7Z A;  1JCE A;  2QW9 A;  3EZW A;  3TPQ A;  3ULE A;  1GLA G;  4CBW A;  1H1V A;  3A5M C;  3QFU A;  4FWM A;  4BRE A;  2ZWH A;  4B1U B;  4BQZ A;  3W0L A;  5BRE A;  4HTL A;  3WQU A;  3ATV A;  1G99 A;  4BQL A;  1GLE G;  1K8K A;  4BRN A;  1BG3 A;  1XQS C;  2F9T A;  2YHX A;  3LDL A;  4J8F A;  3ZX0 A;  3WXI A;  5KPT A;  4JNE A;  3UKU A;  5BRF A;  1GLF O;  1MWK A;  1BO5 O;  2FSJ A;  2VCP A;  5ADX A;  1MWM A;  2P9U B;  1Y64 A;  2A5X A;  2FF3 B;  4EHU A;  5FPD A;  1SQK A;  1NGC A;  4CBX A;  4BR4 A;  3MCP A;  1V4T A;  3QBX A;  4CZH A;  2FF6 A;  1BWF O;  2ZF5 O;  5AQK A;  1BU6 O;  1NGG A;  4FL9 A;  4IJN A;  4IO8 A;  1E4G T;  3ZET B;  2E88 A;  3WXL A;  2IIR A;  4Y0W A;  5ADX H;  3HSC A;  2P9N B;  3SMS A;  3CJB A;  4BRD A;  4FOE A;  4QS8 A;  4XH5 A;  3M6G A;  5B8H A;  3VGL A;  3FZF A;  2NLX A;  3VF6 A;  3D2F B;  4AM6 A;  1YXQ A;  1HX1 A;  2A41 A;  3CHW A;  3GL1 A;  5AQY A;  3SLC A;  2P9S B;  5AQT A;  5AZJ B;  1QQM A;  2Q97 A;  5TKY A;  2FSN A;  4BRI A;  3C7N B;  3G25 A;  3LDO A;  1Z6R A;  4BRA A;  3VPZ A;  2D4W A;  3VEY A;  3LDQ A;  4JHD B;  4WQ4 C;  2GWK A;  4PKI A;  3ID8 A;  5EOY A;  5AR0 A;  2P9L A;  4BVP A;  4CZJ A;  4CZI A;  1U2V A;  3U9D A;  1Q18 A;  3ENH A;  3ULE B; 
#chains in the Genus database with same CATH topology
 2VWK A;  3OJS A;  3SJH A;  4DLG A;  4XH1 A;  5KRT A;  1RBV A;  5KGW A;  3WXM B;  1A5W A;  3J7A P;  2RHK A;  4ISE A;  4KAZ A;  4JRP A;  2QWR A;  2BAN A;  3UKU B;  2NZT A;  3R6M A;  3HL8 A;  2YNI A;  3AVF A;  4KBO A;  4PUO A;  3TSU A;  2BUP A;  2QWO A;  1VQP N;  1X3M A;  3AAP A;  1SZ2 A;  3EY1 A;  4JS4 A;  4DQS A;  2E2N A;  2QI2 A;  4NCG A;  1ASV A;  4PKH A;  3CCE N;  5IT9 O;  3WNH A;  3NH1 A;  2W40 A;  2X6S A;  1NGE A;  4DR5 K;  3TAN A;  4M3W A;  4BR7 A;  3LM9 A;  1E3M A;  5J2N A;  3MEC A;  4DQR A;  2UUB K;  3SV4 A;  1CXU A;  4KHY A;  1T6C A;  3V6D A;  1T05 A;  1HNV A;  3KK1 A;  1UA1 A;  3WXJ A;  3THY A;  4KHQ A;  3TAE A;  4O0I A;  2HF3 A;  3U3G A;  3CFR A;  4FLV A;  4LF4 K;  4JKF A;  3C6H A;  4JYA K;  1VQO N;  4B9U A;  4GV3 A;  4DTU A;  1EX4 A;  3CCR N;  1OVY A;  2WBN A;  4B8A B;  4FM0 A;  3GOI A;  4DQ8 A;  3AY9 A;  3EE8 A;  3L2U A;  3QO9 A;  5I9E B;  1QSY A;  2P9L B;  3HPO A;  5D3G A;  4F2R A;  4BC2 A;  3PV8 A;  3KVG A;  5AQS A;  1NU0 A;  2HF4 A;  2QXF A;  3U3Y A;  1JLC A;  1NG9 A;  1RT3 A;  4JI8 K;  4Z0U A;  3V9U A;  1JLQ A;  1D4X A;  4NXM K;  3RSE B;  1P8Z A;  2KQ2 A;  1XNQ K;  5C15 A;  3NCI A;  3DYA A;  3M8S A;  4MDA A;  2YKN A;  3OYL A;  5FRN A;  5AZI A;  1S72 N;  3ZX3 A;  3ITH A;  1Q7Y O;  1JL1 A;  3SQ1 A;  1KFS A;  2UXB K;  1HJO A;  1HLU A;  4U7B A;  2XO7 A;  3ZT3 A;  4HUE A;  4BRO A;  3DLK A;  3I8D A;  1VSI A;  3QFP A;  4DF4 A;  5GIP A;  4IOA L;  3CC4 N;  2DFE A;  4C1N I;  4B3O A;  3CME N;  3HPG A;  1RDB A;  4A61 A;  4WFB L;  4W5N A;  3SYZ A;  1XUP O;  2E2O A;  3H46 O;  4W5O A;  3AA2 A;  3QER A;  4BR2 A;  5DM6 L;  1LAV A;  3M8Q A;  1FXX A;  1O13 A;  1KD1 O;  1HQE A;  1KQS M;  4AM7 A;  3QEI A;  3V9X A;  4JAX A;  1WN7 A;  1I39 A;  5JMV A;  4DV7 K;  1DTT A;  2VG5 A;  3SUQ A;  3HM8 A;  2ZGZ A;  3HZ6 A;  2O8F A;  2E6L A;  3QEP A;  4N76 A;  1KVB A;  3C65 A;  2ASM A;  5AQF A;  1C0U A;  4W5Q A;  4DSI A;  2VYP A;  3FR0 A;  4K25 A;  4M7Y A;  3T7Z A;  3JSM A;  5DM7 L;  3K0S A;  2V51 B;  1S5J A;  2VQE K;  3K9J A;  2HHU A;  2KKZ A;  4Y1C A;  3OYB A;  1RIL A;  3DXM A;  4FZX C;  4BRQ A;  4BDP A;  3SQ2 A;  3DLH A;  4A5A A;  1L3U A;  4KFB A;  3D0P A;  3D2E A;  3LPT A;  3HPH A;  4KB0 A;  3QDK A;  1NWK A;  5C12 A;  4HCB A;  4CHO A;  1IO2 A;  1NK7 A;  2J4R A;  5BPM A;  4DTP A;  1SAZ A;  4BE1 A;  4EZ9 A;  4DR7 K;  1RBS A;  2OZM A;  4F3O A;  2F4V K;  3EN9 A;  2HND A;  5J1E A;  3VEO A;  4H0X B;  4K41 A;  4ZHR A;  2PFU A;  4E7K A;  4LF6 K;  3Q7B A;  1W0H A;  4GV9 A;  4H0V B;  2HBL A;  4K8Z A;  3NF7 A;  4B9V A;  1NJX A;  2KZM A;  4BDZ A;  4FLU A;  5IWA K;  4KKO A;  1BCO A;  2BE2 A;  2D0O A;  5AQO A;  1SKW A;  2OAN A;  2NUB A;  4MDB A;  4M63 C;  4Z4G A;  4C23 A;  1SKS A;  3H45 C;  4LY7 A;  4ELU A;  3G10 A;  2ZD1 A;  1NGD A;  4CZM A;  4B9M A;  1LCU A;  4YOU A;  3A2F A;  2HNZ A;  4IFV A;  2FBT A;  3ASM A;  3V81 A;  3T1H K;  1YVN A;  1T3V A;  3NAE A;  5BN8 A;  5AQZ A;  3VQC A;  4M42 A;  3VOV A;  3L4I A;  3NE6 A;  4BG8 A;  1ILY A;  4CD1 A;  2D5R A;  3LDS A;  1S9E A;  3MDQ A;  1YTU A;  3G0Z A;  1O1W A;  2CGJ A;  4X64 K;  4DV0 K;  2P51 A;  1IKW A;  4C8K A;  1EET A;  4IDK A;  4NCA A;  2WTU A;  4KRE A;  3UE5 A;  1RDD A;  1DEJ A;  3RRG A;  5C2F A;  3NBP A;  5F2R A;  1EP4 A;  2P9K A;  4CEC A;  3F9K A;  4JS5 A;  3THW B;  4JK9 A;  4IFE A;  1WSJ A;  4CEZ A;  4AHU A;  1S22 A;  3SBG A;  2QA4 N;  4FWP A;  1U04 A;  3OW2 M;  1RCH A;  3BF3 A;  5F1X A;  3DXK A;  3MXM A;  1YJ9 N;  3VEX A;  1X9J A;  4CFB A;  2KFN A;  4WFA L;  4JKD A;  4B1Y B;  3TSQ A;  4FWN A;  4B3T K;  4XH4 A;  3NHG A;  2GEL A;  1NKC A;  5ELZ A;  3IUC A;  2RF2 A;  3M1F A;  4ZTF A;  2FBY A;  4BRL A;  4C8O A;  1X3N A;  3G4S N;  2G8F A;  2KHO A;  3TR8 A;  4DG1 A;  3KWG A;  1ZBH A;  5HBM A;  1WSI A;  1RTI A;  5H1S Q;  4DHY A;  3OYM A;  2ZJQ L;  1L3S A;  4CZF A;  1Q82 O;  1NM1 A;  2UYT A;  4CGG A;  4CF9 A;  2GBZ A;  4DWI A;  2ITG A;  2ASP A;  3HTV A;  1U49 A;  1WLJ A;  3O9S A;  1D8Y A;  1TL1 A;  2OPS A;  3NVK A;  3V9S A;  1NGB A;  3OYN A;  1REV A;  3KLI A;  1R59 O;  4H5W A;  1NJY A;  4CF0 A;  4GVE A;  3HT3 A;  3L2Q A;  5JLF A;  3NDK A;  3CM6 A;  2P9S A;  1VSH A;  5TKW A;  1LOT B;  3O08 A;  4Q5V A;  1ATN A;  5J2Q A;  2BH1 A;  3OHR A;  3AVL A;  3TAQ A;  2UUC K;  4JHD A;  4H03 B;  1YAG A;  2O4G A;  2O8E B;  2P5O A;  2YI1 A;  4FSV A;  1NJI O;  2HST A;  2YHA A;  1SUQ A;  3O4N A;  3ZSX A;  2QW9 A;  1DLO A;  4OPA A;  3OYJ A;  1J5O A;  4FJ9 A;  3TPQ A;  3ULE A;  1ZBL A;  3QFU A;  4IOX A;  1B9F A;  1JL2 A;  1NK8 A;  4GKK K;  4HTL A;  3WQU A;  3ATV A;  1G99 A;  2Q3S A;  1GLE G;  1W9H A;  4YOW A;  4FJL A;  2QK9 A;  4CHZ A;  2OTL N;  4CJK A;  4I2P A;  1GLF O;  1HNZ K;  5ADX A;  2ZJR L;  1CLQ A;  5M1P A;  2FF3 B;  2W6L A;  3RTV A;  1NGC A;  2E6M A;  3L2R A;  4CZH A;  4M41 A;  1BU6 O;  2GV9 A;  4FL9 A;  4IJN A;  1N36 K;  1I3A A;  2RE2 A;  2P9N B;  3SMS A;  3LP0 A;  4F2S A;  4QS8 A;  3DM2 A;  3M6G A;  5B8H A;  3AVJ A;  4CJ3 A;  1K73 O;  3GL1 A;  3SLC A;  1YF5 L;  4DU4 A;  1VQ4 N;  4JKE A;  2VGM A;  4E7H A;  4JI1 K;  4LH5 A;  4CEA A;  1QSS A;  3VEY A;  3O9Q A;  4LH4 A;  1WNS A;  3AVA A;  1YJW N;  3CD6 N;  4AHS A;  2E5L K;  2WFB A;  2HHT A;  4CIE A;  4CZI A;  4DR4 K;  1Q18 A;  4CVN E;  2OPP A;  5EX5 A;  1BCM A;  3RWU A;  4EP4 A;  1RGI A;  3AAR A;  5KPZ A;  4FK0 A;  2ZQB A;  1NGF A;  3V9Z A;  3J8A A;  4FJ7 A;  3S3N A;  4H0Y B;  3WT0 A;  3ZCM A;  1BOT O;  1BI4 A;  4MO4 A;  2G8W A;  4KHN A;  4RW6 A;  2Q1N A;  4CZG A;  2I7P A;  3DRR A;  3ATU A;  4DU3 A;  1QZ5 A;  3LPU A;  3FZH A;  1IJJ A;  3HK2 A;  2GUP A;  5AQU A;  1WOQ A;  1HPZ A;  3CCL N;  3AVH A;  5C42 A;  4PKG A;  4TSX A;  2HB5 A;  4JKG A;  3CPW M;  3NF9 A;  3MXI A;  4QS7 A;  2P9I B;  3GE1 A;  4BWJ A;  3L6Q A;  1RDW X;  4JI6 K;  4RG8 A;  2OPR A;  4CJV A;  3OYA A;  4NO7 A;  4BRG A;  1TGO A;  3DRP A;  1QVF M;  3ALY A;  1RTD A;  4KHS A;  3SJJ A;  4CJP A;  3AVG A;  5SZT A;  3M8P A;  4KPY A;  1KRP A;  3VQ6 A;  4DSE A;  2DTU A;  3RR8 A;  1VSF A;  1UWB A;  3OYF A;  3SUO A;  2OZS A;  3IFR A;  3CYM A;  5KI6 A;  4CED A;  3ZT1 A;  4DFK A;  4MO5 A;  4LF8 K;  4NXN K;  5FPM A;  3ZYY X;  3DLE A;  1U45 A;  1XHZ A;  3HXM A;  4JKB A;  5LJW A;  5AQQ A;  2HVI A;  3OS1 A;  3CQ8 A;  4BRH A;  3PIP L;  5J2M A;  1JLB A;  4FM2 A;  4BR9 A;  1GLL O;  3S3O A;  4A62 A;  4H0P A;  2G8V A;  1WSF A;  1CZA N;  1HRH A;  4N56 A;  1T6D A;  3C94 A;  3QEV A;  1FK9 A;  4ILH A;  5M1Q A;  3HM9 A;  4IEI A;  3JS6 A;  4DR2 K;  3LDP A;  3WEE B;  3LZJ A;  3S3M A;  4HTU A;  4G1Q A;  5BN9 A;  1OH8 A;  1LWC A;  3KZB A;  2YKM A;  4DMN A;  5LL6 Z;  3VTH A;  4L3Q A;  4Z94 A;  4FZY A;  2YJE A;  3P31 A;  3WXK A;  5I42 A;  1VSM A;  3DLL L;  2A1R A;  3VQP A;  1I94 K;  2Z1J A;  4EZ6 A;  4LC9 B;  1QHA A;  5AQX A;  1TKD A;  5JS1 A;  3U8X A;  3AO5 A;  3O4W A;  1ITG A;  4N47 A;  1GOB A;  3V1R A;  3C6A A;  1EWR A;  2WUS A;  4C8L A;  2A40 A;  4YDU A;  4DTR A;  1KCF A;  2IAJ A;  4NLB A;  3AA4 A;  1G15 A;  1GLJ O;  4M45 A;  1D9D A;  1JCF A;  2BTF A;  1NOY A;  3ZSQ A;  4FW2 A;  3LP1 A;  1YHQ N;  3HJF A;  4AHR A;  3SQ0 A;  1TL3 A;  1KAZ A;  3DLB A;  3TTF A;  1MDU B;  4CEF A;  3ISN C;  4H0O A;  3QIO A;  4BRK A;  4FVM A;  1ATR A;  4EHT A;  1OKJ A;  4J2B A;  4DU1 A;  2IDO A;  4FWS A;  4N5S A;  3OYI A;  2ZGY A;  1RT4 A;  3THX A;  1YIJ N;  4JI7 K;  4CK3 A;  4H4O A;  4CHQ A;  3FGU A;  4BE0 A;  5JS2 A;  1BQM A;  4DCH A;  1DTQ A;  4DTS A;  4FCY A;  4DFJ A;  5AQI A;  3JAM O;  3AA5 X;  5LMU K;  4CCH A;  3B8A X;  1LV5 A;  2ETJ A;  2HBK A;  4O8K A;  3K5M A;  1XNR K;  1EKE A;  4DB3 A;  2GWJ A;  3VEV A;  2VWB A;  4DR3 K;  2BGG A;  4FJM A;  4AHT A;  4CJT A;  4ID1 A;  4F8R A;  2JLE A;  1JLF A;  4AF1 A;  3OY9 A;  5KTQ A;  2NRW A;  3H1Q A;  3OS2 A;  4DV2 K;  1RNH A;  3CJ9 A;  3VER A;  4O5F A;  1S6P A;  1HNX K;  1S6Q A;  4IDH A;  1JXB A;  3PSF A;  4CFA A;  4FLZ A;  1C1B A;  2Q31 A;  3CCS N;  2DPN A;  5GAH P;  3CIP A;  3IKM A;  5M1K A;  2PBD A;  3KD1 E;  1BA1 A;  3MEG A;  4N41 A;  4GV6 A;  4HUG A;  3CJ7 A;  2YV0 X;  4DV3 K;  4I9Q A;  4E7L A;  3EKS A;  2FBV A;  1OH6 A;  5FRO A;  4M3Y A;  2E1Z A;  3WQT A;  5J2P A;  4FLW A;  1NGJ A;  4B1Z A;  4JV5 K;  3FZK A;  3VEZ A;  4JD2 A;  2EHG A;  4DV6 K;  2P9P A;  4IZ9 A;  3A5O C;  4CHN A;  3OYH A;  1C0G A;  1TYQ B;  5FPE A;  3E9L A;  3OS0 A;  1VSK A;  1BIU A;  2EWS A;  2P9I A;  3W3D A;  3DOL A;  4JI2 K;  3T3F A;  3PSI A;  1GLD G;  3HP6 A;  5CZ1 A;  1F21 A;  4DR1 K;  5EXW A;  1IV0 A;  3F9M A;  5AJ3 K;  1RT7 A;  5C25 A;  1C1A A;  3ZEU B;  4EIA A;  1Y97 A;  5FLX O;  4DQI A;  3TI0 A;  1IG8 A;  4MLE A;  2W6K A;  4R5P A;  3SV3 A;  2Q0R A;  3MN9 A;  1TK5 A;  2O8B A;  1VQ9 N;  3CF5 L;  2O8C B;  1HKG A;  2P9U A;  1WB9 A;  4OVL A;  3OYK A;  2QKB A;  2KZZ A;  3MEE A;  1KAX A;  1HYV A;  4O0J A;  4NB4 A;  1XMQ K;  3VQ7 A;  3VQ9 A;  3ZET A;  3CI5 A;  4FJG A;  3VMF B;  4CZL A;  5KPR A;  1BIS A;  5HRO A;  1BQN A;  3KK7 A;  3OA9 A;  5CHI A;  4HHT A;  4FK4 A;  3UKR B;  1B92 A;  3HBT A;  4YHH K;  3CER A;  4EAH D;  1XC3 A;  4I9L A;  5K14 A;  5AFU H;  2RN2 A;  3TU5 A;  5AZJ A;  3CC2 N;  5HRS A;  1N32 K;  3AVK A;  3FZM A;  3C7N A;  1WSH A;  4CJE A;  3KLG A;  4IEE A;  4FW1 A;  1BGX T;  4DSK A;  2JGU A;  1HKC A;  2F96 A;  1RDA A;  3O1W A;  1HJR A;  3WNF A;  4I6M B;  1VK0 A;  4LF5 K;  4DS5 A;  1H1V A;  3A5M C;  5E41 A;  2ZM6 K;  1JLE A;  3TAG A;  4E3S A;  4BQL A;  2Y1J A;  3PX6 A;  1XQS C;  3SNN A;  4M3T A;  3LDL A;  4CK1 A;  4J8F A;  5KPT A;  3UKU A;  3OJU A;  3K58 A;  1C0M A;  1MWK A;  1W97 L;  2FBX A;  2FSJ A;  4DSJ A;  4CF8 A;  4OLA A;  3K5L A;  1NKE A;  4DUZ K;  4KTQ A;  2QKK A;  4DFM A;  1SQK A;  4KRF A;  4CHY A;  4GKJ K;  4BR4 A;  2NRZ A;  3MCP A;  4R79 A;  2FF6 A;  1BWF O;  3LP3 A;  2ZF5 O;  4OGE A;  3V4I A;  4IO8 A;  4FJK A;  1TVR A;  2KLA A;  1E4G T;  3MAQ A;  2E88 A;  3HSC A;  4ELT A;  4BRD A;  3MCA B;  1Q86 O;  1IBK K;  2VQF K;  3IRX A;  2NLX A;  5A2Q O;  3D2F B;  4AM6 A;  3B6P A;  4OKJ A;  1WBB A;  3CHW A;  5AQY A;  2WOM A;  2P5G A;  3OYG A;  1QQM A;  2Q97 A;  4RW4 A;  2X74 A;  2FSN A;  4BRI A;  1VRU A;  3G25 A;  1Z6R A;  3SAH A;  4BRA A;  4YOY A;  2HVH A;  3L3U A;  3QET A;  2D4W A;  5HRP A;  1RBT A;  3LDQ A;  1SL0 A;  1KVC A;  2GWK A;  3ID8 A;  2NNW A;  4CIG A;  5EOY A;  3G71 N;  4FVU A;  2P9L A;  4DTX A;  4NYF A;  3P1G A;  3U9D A;  3ENH A;  3SMP A;  4O5B A;  3TSP A;  5BPL A;  3RSE A;  4IKF A;  3PX4 A;  1YIT N;  3E9P A;  1K8K B;  4NCB A;  3TAB A;  1DT9 A;  2AP1 A;  5BPN A;  3PO4 A;  1MA9 B;  4FOI A;  4B9N A;  3VGK A;  2I7N A;  5KQD A;  2Z1I A;  1JLA A;  3A5L C;  3R9P A;  2YHY A;  2CGK A;  4BRM A;  4AHV A;  4CZE A;  3RR7 A;  2E20 A;  1ZYQ A;  4BGA A;  3H3O B;  1VRT A;  5AQR A;  3DLG A;  3VES A;  5HOO A;  3EZ5 A;  2DY4 A;  3MN7 A;  3DWL A;  5T7B A;  3K59 A;  4RW8 A;  3T1Y K;  3LAN A;  3SPY A;  1NK6 A;  1FW6 A;  5DK5 A;  3IAY A;  2FSK A;  5AQP A;  3CET A;  4NLC A;  3CPE A;  1VQL N;  3ENO A;  3L0Q A;  4KB1 A;  2YJF A;  3FFK B;  4W5R A;  3SI6 A;  2A3Z A;  3C0B A;  4CGD A;  4E1M A;  4A2B A;  1E4F T;  2HHV A;  1NK0 A;  1IKX A;  2ASO A;  4ISF A;  4CGJ A;  1TUY A;  3L4Q A;  4KH5 A;  3HRG A;  5GIN A;  1X9M A;  1KSP A;  1X9W A;  5CR4 A;  1U2V B;  5KGX A;  3DOK A;  2HHH K;  4PL7 A;  4BG9 A;  1N33 K;  2B5J A;  3QLH A;  4FLT A;  3CQY A;  4H8K A;  2O8D B;  1NGH A;  2Q36 A;  4BR5 A;  1VSD A;  3CXC M;  1C0T A;  5I3U A;  3THV A;  2VG7 A;  3LL3 A;  4IOC L;  4K0K K;  2YNF A;  4CJ7 A;  1IBL K;  1QVG M;  2D0P A;  3TTC A;  4HVJ A;  4J2A A;  4OPJ A;  3PIO L;  3ZLJ A;  3GBT A;  1IG9 A;  3K9K A;  3TAP A;  5F0X A;  3AVN A;  1EWQ A;  3S41 A;  1OVQ A;  1ATS A;  4DTM A;  3SAG A;  4M3X A;  4QS9 A;  4FWK A;  4OKE A;  4O4G A;  4B08 A;  1ZXO A;  2VGN A;  4XEI A;  4BRC A;  4CW7 B;  3UKR A;  3THY B;  5CYQ A;  4CE9 A;  1JCG A;  1RDC A;  4QCL A;  3VF4 A;  1QE1 A;  2HHW A;  5AQH A;  3VN5 A;  4MFB A;  5HP1 A;  2O4I A;  5LJV A;  3ZX2 A;  4ISG A;  4GMJ B;  3EO3 A;  3ZSY A;  3M3Z A;  1HQU A;  2D1K A;  5FPN A;  4FWQ A;  4WQ5 A;  3L8B A;  2CH6 A;  4WQ5 C;  3ZSR A;  4IG3 A;  1T44 A;  2OYQ A;  3MX5 A;  2IOC A;  1UAX A;  1S1V A;  3WUH A;  4Q0B A;  2Y1I A;  4F3T A;  5EY4 A;  3L2V A;  4KI4 A;  3P83 D;  1KC8 O;  2W41 A;  2EX3 A;  5AZI B;  2PZS A;  2P1J A;  4CJS A;  1SL2 A;  4WF9 L;  3BEX A;  1CZ9 A;  1J9A A;  2PAV A;  1L3V A;  1Z26 A;  3VQB A;  3IDH A;  1ASU A;  1J53 A;  3QEW A;  4FZZ A;  2GX9 A;  2NRR A;  1HPM A;  4B9Q A;  4DV5 K;  2UXC K;  1RBU A;  2G8K A;  3OTO K;  3PX0 A;  1TKX A;  3AO2 A;  3THW A;  4YY3 K;  3KWI A;  4ELV A;  2HHS A;  1C1C A;  1JXE A;  3SK3 A;  3EL2 A;  3AVC A;  1NJZ A;  1JJ2 M;  4CFC A;  1ZC6 A;  3ZSW A;  3UB5 A;  4C8N A;  3NMU A;  1LAW A;  3J80 O;  2R7Y A;  4PL8 A;  2O8F B;  3E9O A;  2B6A A;  5CYM A;  2Z1H A;  2LSN A;  1YUW A;  4AQY K;  4IFY A;  1FJG K;  2BDP A;  3WNG A;  4FWO A;  4IXC A;  4J2D A;  3QB0 A;  1HMV A;  4CJ4 A;  3P5J A;  1XHX A;  5SWM A;  3PO5 A;  1A5X A;  1D5A A;  3DXM B;  3NF8 A;  1IBM K;  2F8T A;  3MK6 A;  1IKY A;  1ESV A;  1S1X A;  4BC5 A;  2YCH A;  4FJX A;  1S1T A;  3SCX A;  4OLB A;  4FWR A;  3K57 A;  3D2E B;  4JEP A;  2E2Q A;  1NOZ A;  4CIF A;  4RWT A;  4FJH A;  4FJN A;  1S1W A;  1WUA A;  4HWI A;  4X66 K;  3L3V A;  3BUZ B;  4KI6 A;  3MXJ A;  2W42 A;  3NGI A;  2XY7 A;  3ZSZ A;  3HST B;  3JYT A;  4M7X A;  3SAF A;  5AQV A;  4F9O A;  5M1F A;  3AAQ A;  3QIC A;  2PYJ A;  4H5N A;  2KW4 A;  1M90 O;  4IO9 L;  1UA0 A;  4KHU A;  3CJ1 A;  3P4I A;  1QZ6 A;  1VSE A;  4B1X B;  3CMA N;  4DQQ A;  4LF9 K;  2O8E A;  2AA4 A;  4JRQ A;  4B3R K;  3HP9 A;  5GAG P;  4KTZ A;  4WQ4 A;  5LMN K;  4YDU C;  3VEW A;  2VWJ A;  3DLR A;  4A59 A;  3O9U A;  3LP2 A;  4B3S K;  4JK7 A;  1RT6 A;  3DAW A;  4JI3 K;  2FLO A;  2IC3 A;  2HOE A;  4I2Q A;  5C0Y A;  1TAU A;  1Z25 A;  2O8D A;  3H1V X;  3B6O A;  3ID6 A;  4OKK A;  2NRX A;  4E1J A;  5LY3 A;  1BA0 A;  2NRH A;  4BY9 C;  2GEM A;  1LWF A;  3V9W A;  3FZL A;  4H0T B;  2QWQ A;  1YT3 A;  3CJC A;  4BRF A;  3EYZ A;  3FFI A;  3AO3 A;  2QWM A;  4LFA K;  4WE1 A;  5HLF A;  3SBT A;  1KTQ A;  1TKZ A;  3BGR A;  3FLC O;  1S3X A;  1WSG A;  3I0S A;  3LAM A;  2P9N A;  1Q9Y A;  3J7Z O;  4JKC A;  3O6W A;  3AVB A;  4E1N A;  4FJI A;  3KLH A;  1VSJ A;  2P9K B;  4PA1 A;  3J7Y P;  1XI1 A;  3PLA A;  2D0C A;  1NBW A;  2FC0 A;  3OBW A;  1Z05 A;  1NNE A;  3HOT A;  3TAF A;  1DGK N;  1W2B M;  1U47 A;  3KIO A;  4FWL A;  3DXK B;  4RW7 A;  4BE2 A;  4CES A;  2HBJ A;  5E84 A;  4M3R A;  4YFU A;  3DJC A;  4JK8 A;  2QWL A;  2ITM A;  2HMP A;  1NMD A;  2XY6 A;  3GDQ A;  1C0F A;  1QQC A;  3M8R A;  4E89 A;  4UY8 O;  4U67 L;  3AO1 A;  1KFD A;  3ZSO A;  1VSL A;  3MN6 A;  2A6A A;  4KV8 A;  3CFO A;  4PQU A;  1CXQ A;  1X1P A;  2V7Y A;  4EFH A;  5JVH L;  1JCE A;  3EZW A;  4K8X A;  1EXQ A;  4CBW A;  3AGR A;  4FWM A;  4BRE A;  2ZWH A;  4B1U B;  4BQZ A;  2PYL A;  1ZBI A;  5BRE A;  1N34 K;  4O55 A;  1RT1 A;  4BRN A;  1BG3 A;  4BWM A;  3OYC A;  1XMO K;  3LZI A;  4GVM A;  1OH7 A;  1ZBU A;  3C6T A;  3TWH A;  1SV5 A;  5CZ2 A;  4BDY A;  1LWE A;  2WON A;  4DTN A;  4OPH A;  1T03 A;  2JWK A;  1NK5 A;  1RTH A;  1Y64 A;  2A5X A;  3AO4 A;  2PY5 A;  2Z1G A;  1N8R O;  3D45 A;  1K6Y A;  4EHU A;  2KFZ A;  1NK4 A;  4XIU A;  3VQQ A;  3SQ4 A;  4OPK A;  4DFP A;  4CEE A;  2X78 A;  3QIP A;  5AQK A;  3DI6 A;  2WC9 A;  4PHT X;  5ADX H;  3WXL A;  2IIR A;  4FJJ A;  1SKR A;  3VTI A;  1FKP A;  3ULD A;  3CJB A;  1RBR A;  4FOE A;  1KLM A;  4ILG B;  4FYD A;  1QHT A;  3VF6 A;  2QEX N;  3EE9 A;  2IGI A;  4A57 A;  1HX1 A;  2A41 A;  1WAF A;  4JI5 K;  2OCE A;  2P9S B;  4DR6 K;  3QNO A;  3AGK A;  3WNE A;  3CCJ N;  3VPZ A;  4EP5 A;  4JHD B;  4PKI A;  3K5O A;  4HCC A;  5BR8 K;  1BIZ A;  4CZJ A;  3IS9 A;  3ULE B;  5CY4 A;  2OA8 A;  4DTJ A;  4E7I A;  2Q0U A;  1KXP A;  3H08 A;  4ILJ A;  3RRH A;  2CH5 A;  4DUY K;  4WFN L;  3I33 A;  3RVC A;  3T1A A;  4PWD A;  1LW0 A;  2XRI A;  1RTJ A;  3KHY A;  1U4B A;  5BRD A;  1VQK N;  2AJQ A;  3MX2 A;  4DLE A;  4AH9 A;  4CGI A;  4B9L A;  1P90 A;  3KKR A;  1UOC A;  2IVO A;  3EEQ A;  3BDP A;  1XC9 A;  1KVA A;  4GNI A;  4FJ5 A;  3VGM A;  4UQG A;  2YHB A;  2F7T A;  4K43 A;  3R1X A;  1VHX A;  3VQE A;  1JLG A;  1TUU A;  2FXU A;  3WEE A;  4B1V A;  1HR0 K;  4NYN A;  5KQ8 A;  3N4P A;  5EU7 A;  4B9T A;  4MQ3 A;  4CGF A;  4LSN A;  4LD0 A;  1KLN A;  2V52 B;  5M1O A;  4DV4 K;  4BGB A;  3RMD A;  4IJA A;  1R0A A;  5JVG L;  3HOS A;  3KD5 E;  3QIN A;  1VQ7 N;  4E0D A;  3K2P A;  2ATQ A;  4MLH A;  3QNN A;  3KK2 A;  2HHQ A;  1NLV A;  1K8A O;  4IG0 A;  3NGZ A;  1QSL A;  3HVT A;  4CBU A;  4OO1 J;  3QEX A;  4C8M A;  4LFB K;  3JXU A;  4YNQ A;  3F2K A;  4CJF A;  5C10 A;  1TKT A;  3O80 A;  1U48 A;  5AQG A;  3Q7C A;  3CM5 A;  3V1Q A;  1NGA A;  3P38 A;  3TAR A;  4Z4I A;  1MU2 A;  1U6Z A;  3NGY A;  2NRV A;  2RPI A;  5FRM A;  3VA3 A;  2CGL A;  4YOX A;  4DKW A;  4O44 A;  3C95 A;  2OPQ A;  3D7E O;  1BI4 B;  2QXL A;  5EVZ A;  3RMA A;  2E2P A;  4A5B A;  4GY2 B;  3OBY A;  3T69 A;  3M5R A;  1LW2 A;  4O8U A;  2QWN A;  2A1S A;  3RMB A;  1QTM A;  4YOV A;  3F73 A;  2UU9 K;  3A8Y A;  2NRT A;  4CD3 A;  3U9Z A;  4JKG B;  1VQ6 N;  3PUF A;  3AV9 A;  3HO1 A;  2A42 A;  1GOA A;  4B9S A;  2H3G X;  3LWL A;  1TK0 A;  3LAL A;  3AVI A;  1K9M O;  5FDL A;  4KHP K;  1BL3 A;  3KKS A;  2UXD K;  3IMX A;  4AIL C;  3ZT0 A;  1XWL A;  2G8I A;  4FLX A;  3R8E A;  1NGI A;  5BRH A;  4CJR A;  4JI4 K;  4Y1D A;  4B3M K;  5GAE P;  1T7P A;  1HKB A;  2GTD A;  1GLC G;  5AQL A;  2HMI A;  1SL1 A;  4CK2 A;  1J6Z A;  1IKV A;  5AQN A;  1A5V A;  1L5U A;  1C6V A;  2DFH A;  1HUX A;  3KK3 A;  5MLC Q;  3CCM N;  4CZK A;  1EQY A;  3VF2 A;  3ZT2 A;  3SPZ A;  3VQ8 A;  4ICL A;  1BHL A;  4CI6 A;  3I8B A;  3I55 N;  4H5V A;  4PY5 A;  4JN4 A;  1BUP A;  3CJA A;  3HYF A;  3VET A;  3NVM A;  5AQW A;  3LWM A;  3G6E N;  3DMJ A;  1N5Y A;  3UIQ A;  3H6E A;  1VQM N;  4G9Z A;  2QTD A;  3O4Q A;  3KLF A;  3BF1 A;  2F8S A;  1VQN N;  3BZK A;  3QES A;  1TYQ A;  3QBW A;  3VA0 A;  3LM2 A;  4IWV A;  4LSL A;  1WBD A;  4DV1 K;  4FLY A;  4B1W B;  4CEQ A;  3J81 O;  4QAG A;  3FE1 A;  3E1Y A;  4FM1 A;  5KRS A;  5GAD P;  3D6R A;  3MWP A;  2QWP A;  5E26 A;  3ZEU A;  4CHP A;  1NK9 A;  1JKH A;  1D9F A;  1YVU A;  2HBM A;  1HNW K;  4RCH A;  3A5N C;  1CZB A;  3TTD A;  1GOC A;  3O1B A;  4CF1 A;  1ASW A;  4YOR A;  3MED A;  4RTF D;  3GG4 A;  3LDN A;  4FXD A;  2YHW A;  5HRR A;  4JI0 K;  1VQ8 N;  2O8C A;  4Z4H A;  4DQP A;  4DF8 A;  1RDU A;  4OGC A;  3O3G A;  1S9G A;  4H5R A;  3MMV A;  2YNG A;  4JLH A;  4KH4 A;  4LF7 K;  4DSF A;  2G8U A;  3CC7 N;  2B4J A;  3T19 A;  4B8C A;  3V1O A;  1N6Q A;  1WAJ A;  1WSE A;  1V4S A;  2XY5 A;  4CER A;  3NFA A;  3AA3 A;  4ZTJ A;  4BVO A;  1Q9X A;  3THX B;  4H4M A;  3KTQ A;  1HYS A;  2ZJP L;  1J54 A;  3KLE A;  2IS3 A;  4CGH A;  1OH5 A;  4J2E A;  3H3N O;  5JIC A;  1ZBF A;  1X9S A;  3F5T A;  5AQM A;  4Z4C A;  3E66 A;  3NF6 A;  4H5T A;  5CE3 A;  3O3F A;  1J5E K;  1DKG D;  2I5J A;  5AQJ A;  4HUF A;  1QQO A;  3CCV N;  1QQN A;  3N4Q A;  1BDG A;  4CJQ A;  3NH0 A;  4E7J A;  3BZC A;  4FO0 A;  4Z4E A;  4I6M A;  4BC4 A;  3QML A;  3VQ5 A;  1VAZ A;  3AVM A;  3CQX A;  4JKH A;  4GW6 A;  4KTW A;  4M3U A;  1HNI A;  2UUA K;  1TV6 A;  4ID5 A;  4WYB A;  3K5N A;  2IVN A;  3MN5 A;  4C1N K;  2F9W A;  4X62 K;  3S9H A;  1YJN N;  3BY5 A;  3IG1 A;  3VQA A;  1GLB G;  4X65 K;  1RFQ A;  4CEB A;  1ZBS A;  3ZSV A;  1KAY A;  3HI0 A;  3EKU A;  4CJU A;  4FPB A;  2D0A A;  3SZ2 A;  2QM1 A;  5JLH A;  2D0B A;  4FPA A;  2XHB A;  1NMN A;  3O5B A;  4KH6 A;  4BC3 A;  2OTJ N;  1VQ5 N;  3RMC A;  5BR9 A;  4K42 A;  4L8R B;  3VQD A;  5AFU A;  3O8M A;  2KTQ A;  4KO0 A;  3CCQ N;  2XY8 A;  1Q8I A;  5HL7 L;  5DMR A;  1M1K O;  3OYD A;  3ENB A;  3O3H A;  4BR0 A;  2X6N A;  2Q2R A;  1SS6 A;  3KJV A;  4IBN A;  4I7F A;  3VEN A;  2E8A A;  3D2F A;  2GUI A;  4JD2 B;  3ZT4 A;  4YOT A;  4F4K A;  2P9P B;  3C6U A;  2ZE2 A;  4AHC A;  3MWT A;  3BP8 A;  3SUP A;  4LFC K;  3A0I X;  4FK2 A;  2IVP A;  4V19 S;  4DS4 A;  4BRP A;  5GIO A;  1EO1 A;  3HVR A;  1HYZ A;  3U4L A;  2E1Y A;  3OYE A;  4WCE L;  1YI2 N;  4A2A A;  3O9T A;  2V7Z A;  4DSL A;  4M3Z A;  2HW3 A;  1L3T A;  1GLA G;  5HRN A;  3O9R A;  3OVN A;  3W0L A;  4CJL A;  4Z4F A;  2YX6 A;  1S1U A;  1K8K A;  4W5T A;  1YTA A;  3PY8 A;  2F9T A;  2YHX A;  1RT5 A;  1IH7 A;  1NKB A;  1FKO A;  3DRS A;  2E4L A;  4OJR A;  2HNY A;  3ZX0 A;  3WXI A;  4CJ5 A;  4JNE A;  5BRF A;  3VQ4 A;  2O8B B;  1BO5 O;  4BAC A;  2VCP A;  1NJW A;  1MWM A;  3I56 N;  2P9U B;  1QS4 A;  3I0R A;  3E01 A;  4CEO A;  5FPD A;  1RT2 A;  3U6F A;  3CFP A;  3SUN A;  4QOZ B;  3R3L A;  4CBX A;  1V4T A;  3QBX A;  5M1N A;  1NGG A;  5C24 A;  3L2W A;  3ZET B;  4Y0W A;  3CCU N;  1B9D A;  1TAQ A;  4XH5 A;  2DFF A;  5C2D A;  3LAK A;  4FJ8 A;  3VGL A;  3FZF A;  1TK8 A;  4E19 A;  1YXQ A;  1Q81 O;  1T8E A;  5AQT A;  2JWL A;  3NH2 A;  5AZJ B;  4CJW A;  2HHX A;  5TKY A;  3TAM A;  4JKA A;  3C7N B;  2RKI A;  3LDO A;  2G8H A;  4CFD A;  2VG6 A;  4WQ4 C;  3P39 A;  5AR0 A;  4OX9 K;  4BVP A;  1W7A A;  4DTO A;  4RW9 A;  1U2V A;  4KHW A;  3CG7 A;  2YNH A;  4CF2 A; 
#chains in the Genus database with same CATH homology
 3SMP A;  2Q0U A;  1KXP A;  4ILJ A;  3TSP A;  3SJH A;  5BPL A;  3RSE A;  2CH5 A;  5EX5 A;  4XH1 A;  3E9P A;  1YIT N;  1K8K B;  4WFN L;  3I33 A;  3RVC A;  3WXM B;  1RGI A;  1DT9 A;  3AAR A;  5KPZ A;  2AP1 A;  5BPN A;  2RHK A;  4ISE A;  1MA9 B;  4FOI A;  2QWR A;  3KHY A;  1NGF A;  3UKU B;  5BRD A;  2NZT A;  3R6M A;  1VQK N;  3MX2 A;  3J8A A;  2I7N A;  3VGK A;  4KBO A;  1P90 A;  5KQD A;  3TSU A;  2BUP A;  2QWO A;  1VQP N;  2IVO A;  4H0Y B;  3WT0 A;  1X3M A;  3AAP A;  3A5L C;  1BOT O;  2YHY A;  4MO4 A;  3R9P A;  2CGK A;  1SZ2 A;  4BRM A;  2Q1N A;  4GNI A;  4CZE A;  2E2N A;  3VGM A;  2QI2 A;  2I7P A;  2E20 A;  4CZG A;  3ATU A;  4PKH A;  3CCE N;  4BGA A;  3H3O B;  2F7T A;  1QZ5 A;  2W40 A;  1NGE A;  4K43 A;  3FZH A;  1IJJ A;  3R1X A;  5AQR A;  3LM9 A;  3VES A;  4BR7 A;  5HOO A;  2GUP A;  1TUU A;  2FXU A;  1WOQ A;  5AQU A;  3MN7 A;  3WEE A;  4B1V A;  3DWL A;  3CCL N;  1T6C A;  5KQ8 A;  3N4P A;  4PKG A;  4JKG A;  2FSK A;  5AQP A;  3WXJ A;  3CET A;  4NLC A;  2V52 B;  5M1O A;  3CPW M;  3CPE A;  4QS7 A;  3ENO A;  4BGB A;  4IJA A;  2P9I B;  2HF3 A;  3L0Q A;  3GE1 A;  1VQL N;  2YJF A;  3L6Q A;  4JKF A;  5JVG L;  1RDW X;  3C6H A;  3HOS A;  3FFK B;  1VQO N;  4GV3 A;  1VQ7 N;  2A3Z A;  3CCR N;  1OVY A;  3C0B A;  2WBN A;  4A2B A;  1E4F T;  3GOI A;  4MLH A;  2ASO A;  4ISF A;  4DQ8 A;  1NLV A;  1K8A O;  4NO7 A;  1TUY A;  3L4Q A;  4KH5 A;  3HRG A;  5GIN A;  4BRG A;  1QVF M;  3AY9 A;  3EE8 A;  4CBU A;  5I9E B;  4OO1 J;  2P9L B;  4BC2 A;  5CR4 A;  3JXU A;  1U2V B;  3KVG A;  5AQS A;  2HF4 A;  3F2K A;  4PL7 A;  5C10 A;  4BG9 A;  3IFR A;  3O80 A;  1D4X A;  3CQY A;  5AQG A;  3RSE B;  1P8Z A;  3Q7C A;  1NGH A;  2Q36 A;  4BR5 A;  5C15 A;  4MO5 A;  3CXC M;  5FPM A;  3ZYY X;  1NGA A;  3P38 A;  4MDA A;  4JKB A;  5LJW A;  1U6Z A;  2NRV A;  5AQQ A;  5AZI A;  1S72 N;  4BRH A;  3ZX3 A;  3PIP L;  2CGL A;  4YOX A;  3LL3 A;  4IOC L;  4DKW A;  4CJ7 A;  1Q7Y O;  1QVG M;  1HJO A;  1HLU A;  4U7B A;  2D0P A;  3D7E O;  4BR9 A;  3TTC A;  1GLL O;  4A62 A;  4BRO A;  4H0P A;  1CZA N;  2QXL A;  5EVZ A;  3PIO L;  3GBT A;  3QFP A;  1T6D A;  5GIP A;  2E2P A;  3K9K A;  3CC4 N;  4IOA L;  4C1N I;  4A5B A;  4ILH A;  4GY2 B;  5M1Q A;  3OBY A;  5F0X A;  3T69 A;  3CME N;  3M5R A;  4IEI A;  3S41 A;  3JS6 A;  4O8U A;  4A61 A;  2QWN A;  1ATS A;  4WFB L;  3LDP A;  1XUP O;  2E2O A;  3WEE B;  3H46 O;  3SAG A;  5BN9 A;  4YOV A;  4QS9 A;  3KZB A;  4BR2 A;  3A8Y A;  4FWK A;  5DM6 L;  2NRT A;  4CD3 A;  1ZXO A;  2VGN A;  4XEI A;  1O13 A;  3VTH A;  3U9Z A;  4BRC A;  1KD1 O;  4JKG B;  4L3Q A;  3UKR A;  4Z94 A;  1VQ6 N;  1KQS M;  4AM7 A;  2YJE A;  3P31 A;  3WXK A;  1JCG A;  3DLL L;  2A42 A;  4JAX A;  5JMV A;  2H3G X;  3VF4 A;  4LC9 B;  1K9M O;  5AQH A;  1QHA A;  3HM8 A;  2ZGZ A;  5AQX A;  3ZX2 A;  5LJV A;  3IMX A;  4ISG A;  3EO3 A;  3HZ6 A;  3M3Z A;  2D1K A;  3R8E A;  1NGI A;  4FWQ A;  3O4W A;  5FPN A;  3U8X A;  5BRH A;  3C65 A;  2ASM A;  4WQ5 A;  5AQF A;  2CH6 A;  4WQ5 C;  1T44 A;  5GAE P;  2VYP A;  1HKB A;  2GTD A;  3FR0 A;  3MX5 A;  4K25 A;  4M7Y A;  3C6A A;  1GLC G;  3T7Z A;  2WUS A;  5DM7 L;  2V51 B;  2A40 A;  4YDU A;  5AQL A;  4NLB A;  3K9J A;  3WUH A;  1GLJ O;  1J6Z A;  5AQN A;  2KKZ A;  1JCF A;  2BTF A;  3DXM A;  5EY4 A;  1YHQ N;  1HUX A;  5MLC Q;  3CCM N;  1KAZ A;  4BRQ A;  4CZK A;  1KC8 O;  1EQY A;  3VF2 A;  2W41 A;  3TTF A;  4A5A A;  5AZI B;  1MDU B;  3D2E A;  4H0O A;  3QDK A;  4CI6 A;  1NWK A;  4BRK A;  5C12 A;  4WF9 L;  3BEX A;  1ATR A;  4EHT A;  1OKJ A;  2J4R A;  3I8B A;  5BPM A;  2PAV A;  1SAZ A;  3I55 N;  4H5V A;  3IDH A;  4JN4 A;  2GX9 A;  1BUP A;  1HPM A;  2NRR A;  4B9Q A;  3CJA A;  4FWS A;  3EN9 A;  3VET A;  3NVM A;  2ZGY A;  5AQW A;  3G6E N;  1YIJ N;  3VEO A;  4H0X B;  4K41 A;  3H6E A;  3KWI A;  1VQM N;  2PFU A;  4G9Z A;  3Q7B A;  2QTD A;  3SK3 A;  3FGU A;  3EL2 A;  4H0V B;  4GV9 A;  2HBL A;  3BF1 A;  1VQN N;  1JJ2 M;  1TYQ A;  3QBW A;  4DCH A;  3LM2 A;  1ZC6 A;  4IWV A;  5AQI A;  3UB5 A;  2D0O A;  5AQO A;  3B8A X;  2OAN A;  2HBK A;  4MDB A;  4O8K A;  4M63 C;  4B1W B;  4DB3 A;  4C23 A;  3NMU A;  2GWJ A;  3VEV A;  2VWB A;  3FE1 A;  3E1Y A;  4PL8 A;  5GAD P;  3D6R A;  3E9O A;  3H45 C;  1YUW A;  3MWP A;  2QWP A;  5E26 A;  3ZEU A;  1NGD A;  4AF1 A;  4CZM A;  1LCU A;  4FWO A;  2HBM A;  4IXC A;  4YOU A;  4RCH A;  2NRW A;  3QB0 A;  3A5N C;  3TTD A;  3H1Q A;  3O1B A;  4YOR A;  3CJ9 A;  4RTF D;  3GG4 A;  3LDN A;  4O5F A;  1YVN A;  3VER A;  2YHW A;  1T3V A;  5BN8 A;  3DXM B;  5AQZ A;  1VQ8 N;  4IDH A;  3VOV A;  3MK6 A;  3L4I A;  1ESV A;  2Q31 A;  4BG8 A;  3CCS N;  1ILY A;  2DPN A;  4BC5 A;  4CD1 A;  5GAH P;  2YCH A;  1RDU A;  3CIP A;  3IKM A;  5M1K A;  4FWR A;  3MDQ A;  3D2E B;  2PBD A;  4H5R A;  4JEP A;  2E2Q A;  3MMV A;  1BA1 A;  2CGJ A;  4RWT A;  4KH4 A;  1WUA A;  4HWI A;  4GV6 A;  3CC7 N;  3UE5 A;  3BUZ B;  3CJ7 A;  1DEJ A;  5C2F A;  5F2R A;  3EKS A;  1V4S A;  2P9K A;  4BVO A;  2E1Z A;  3WQT A;  4JK9 A;  1NGJ A;  4B1Z A;  2ZJP L;  3FZK A;  3VEZ A;  4IFE A;  4JD2 A;  1S22 A;  3SBG A;  2QA4 N;  4FWP A;  3OW2 M;  2P9P A;  3BF3 A;  3H3N O;  5F1X A;  4IZ9 A;  5JIC A;  3A5O C;  3DXK A;  3F5T A;  4M7X A;  3VEX A;  3SAF A;  1YJ9 N;  5AQV A;  4F9O A;  1C0G A;  5M1F A;  1X9J A;  1TYQ B;  3AAQ A;  3E9L A;  3QIC A;  5FPE A;  4WFA L;  4H5N A;  5AQM A;  4JKD A;  3E66 A;  4H5T A;  5CE3 A;  4IO9 L;  4B1Y B;  1M90 O;  2EWS A;  3CJ1 A;  3TSQ A;  1DKG D;  3P4I A;  5AQJ A;  1QZ6 A;  1QQO A;  2P9I A;  4FWN A;  3W3D A;  4XH4 A;  4B1X B;  1QQN A;  3CCV N;  3N4Q A;  3CMA N;  1BDG A;  2GEL A;  2AA4 A;  4FO0 A;  1GLD G;  5GAG P;  5ELZ A;  3IUC A;  4I6M A;  4BC4 A;  3QML A;  1VAZ A;  3CQX A;  3M1F A;  4JKH A;  4WQ4 A;  4YDU C;  3VEW A;  5EXW A;  4A59 A;  3F9M A;  4BRL A;  4WYB A;  3O9U A;  1X3N A;  3ZEU B;  4JK7 A;  3G4S N;  2IVN A;  4EIA A;  3MN5 A;  4C1N K;  2F9W A;  3DAW A;  2KHO A;  1YJN N;  2FLO A;  3KWG A;  2HOE A;  1IG8 A;  4MLE A;  5C0Y A;  1GLB G;  2Q0R A;  5H1S Q;  3MN9 A;  4DHY A;  1RFQ A;  3H1V X;  3ID6 A;  1ZBS A;  1VQ9 N;  2NRX A;  4E1J A;  1KAY A;  3HI0 A;  1BA0 A;  1HKG A;  2NRH A;  2P9U A;  5LY3 A;  2ZJQ L;  3CF5 L;  4BY9 C;  3EKU A;  2GEM A;  4FPB A;  3FZL A;  2QM1 A;  4H0T B;  5JLH A;  2QWQ A;  3CJC A;  4BRF A;  4CZF A;  1Q82 O;  2QWM A;  1NM1 A;  4FPA A;  2UYT A;  3O5B A;  4KH6 A;  3SBT A;  4BC3 A;  1KAX A;  2OTJ N;  1VQ5 N;  4NB4 A;  5BR9 A;  4K42 A;  2ASP A;  5AFU A;  3O8M A;  3ZET A;  3CI5 A;  1S3X A;  3FLC O;  3HTV A;  3O9S A;  3VMF B;  4CZL A;  5KPR A;  2P9N A;  5HL7 L;  3CCQ N;  3NVK A;  1M1K O;  3J7Z O;  3ENB A;  4JKC A;  1NGB A;  3O6W A;  4BR0 A;  3KK7 A;  2P9K B;  3PLA A;  2Q2R A;  3OA9 A;  1SS6 A;  5CHI A;  3VEN A;  1R59 O;  1NBW A;  4H5W A;  3UKR B;  2E8A A;  3D2F A;  4GVE A;  4JD2 B;  3HBT A;  3OBW A;  1Z05 A;  3CER A;  4YOT A;  3HOT A;  4EAH D;  5JLF A;  1XC3 A;  1DGK N;  2P9P B;  1W2B M;  4FWL A;  5AFU H;  2P9S A;  3DXK B;  5TKW A;  3TU5 A;  5AZJ A;  3CC2 N;  1LOT B;  3O08 A;  2HBJ A;  3MWT A;  1ATN A;  3BP8 A;  3FZM A;  5E84 A;  3DJC A;  3A0I X;  2QWL A;  3C7N A;  4JK8 A;  2BH1 A;  2ITM A;  2HMP A;  1NMD A;  3OHR A;  2IVP A;  3GDQ A;  1C0F A;  4IEE A;  4UY8 O;  4JHD A;  4BRP A;  4U67 L;  5GIO A;  4H03 B;  1EO1 A;  1YAG A;  3MN6 A;  2A6A A;  1HKC A;  3U4L A;  2E1Y A;  4WCE L;  2YI1 A;  1YI2 N;  4FSV A;  2V7Y A;  3O1W A;  1NJI O;  4EFH A;  4I6M B;  2HST A;  4A2A A;  3O9T A;  2V7Z A;  1JCE A;  2QW9 A;  4OPA A;  5JVH L;  3EZW A;  3TPQ A;  3ULE A;  1GLA G;  4CBW A;  1H1V A;  3A5M C;  3AGR A;  3QFU A;  4FWM A;  4BRE A;  3O9R A;  2ZWH A;  4IOX A;  4B1U B;  4BQZ A;  3W0L A;  5BRE A;  2YX6 A;  4HTL A;  3WQU A;  3ATV A;  1G99 A;  4BQL A;  1GLE G;  1K8K A;  4BRN A;  1BG3 A;  1XQS C;  2F9T A;  2YHX A;  4YOW A;  3LDL A;  4J8F A;  3ZX0 A;  3WXI A;  2OTL N;  5KPT A;  4JNE A;  3UKU A;  5BRF A;  1GLF O;  1MWK A;  1BO5 O;  1W97 L;  2FSJ A;  2VCP A;  4OPH A;  5ADX A;  2JWK A;  2ZJR L;  1MWM A;  3I56 N;  2P9U B;  5M1P A;  1Y64 A;  2A5X A;  2FF3 B;  1N8R O;  4EHU A;  5FPD A;  1SQK A;  1NGC A;  3R3L A;  4CBX A;  4BR4 A;  2NRZ A;  3MCP A;  1V4T A;  3QBX A;  4R79 A;  4CZH A;  2FF6 A;  1BWF O;  5M1N A;  2ZF5 O;  5AQK A;  1BU6 O;  1NGG A;  4FL9 A;  4IJN A;  4IO8 A;  2KLA A;  1E4G T;  3ZET B;  2RE2 A;  2WC9 A;  2E88 A;  3WXL A;  2IIR A;  4Y0W A;  4PHT X;  5ADX H;  3HSC A;  3CCU N;  2P9N B;  3SMS A;  3VTI A;  3CJB A;  4BRD A;  3MCA B;  4FOE A;  4QS8 A;  4XH5 A;  1Q86 O;  5C2D A;  3M6G A;  5B8H A;  4ILG B;  3VGL A;  3FZF A;  2NLX A;  3VF6 A;  3D2F B;  3EE9 A;  4AM6 A;  2QEX N;  1YXQ A;  1HX1 A;  2A41 A;  3CHW A;  3GL1 A;  4A57 A;  5AQY A;  1K73 O;  3SLC A;  1YF5 L;  1Q81 O;  1VQ4 N;  2P9S B;  5AQT A;  2JWL A;  2VGM A;  4JKE A;  5AZJ B;  1QQM A;  2Q97 A;  3AGK A;  5TKY A;  4JKA A;  2FSN A;  4BRI A;  3C7N B;  3G25 A;  3CCJ N;  3LDO A;  1Z6R A;  3SAH A;  4BRA A;  4YOY A;  3VPZ A;  2D4W A;  3VEY A;  3LDQ A;  4JHD B;  4WQ4 C;  2GWK A;  3O9Q A;  4PKI A;  3P39 A;  3ID8 A;  2NNW A;  1YJW N;  5EOY A;  5AR0 A;  3G71 N;  2P9L A;  2WFB A;  3CD6 N;  4FVU A;  4BVP A;  4CZJ A;  4CZI A;  1U2V A;  3U9D A;  1Q18 A;  3ENH A;  3ULE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...