4O60A

Structure of ankyrin repeat protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
230
structure length
230
Chain Sequence
SMDIGKKLLEAARAGHDDSVEVLLKKGADINAKDNVGVTPLHLAAVNGHLELVKLLLEKGADINATDLFGLTPLHFAATNGHLELVKLLLEKGADINAVDDVGVTPLHFAARNGHLELVKLLLEKGADINAMDMVGPTPLHFAAKNGHLELVKLLLEKDADINAEDHFGSTPLHSAAENGHLELVKLLLEKGADINARDKFGKTPFDLAIDNGNEDIAEVLQKAARSHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANK-N5C-317
publication title A transcription blocker isolated from a designed repeat protein combinatorial library by in vivo functional screen.
pubmed doi rcsb
molecule tags De novo protein
total genus 70
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4o60A00
5AN8A 3W9FA 1YCSB 3V2OA 4O1PA 4U8YD 2XENA 1YYHA 4U8VD 3UI2A 3B95A 5D66A 2BKKB 2JABA 3EHRA 5AARA 4Z68A 5CERB 2DVWA 4HB5A 4BESA 3J5QB 2Y1LE 3ZUVB 4ZFHA 4HQDA 3NOCD 5AQAA 3UTMA 4HLLA 1BI8B 2AJAA 1OT8A 2QYJA 2V5QC 1BLXB 1K1BA 4QQIA 1BD8A 3TWVA 5CBNA 3Q9UC 1S70B 1UOHA 1K1AA 1N11A 3TWTA 3TWXA 3TWWA 1QYMA 3AAAC 2DZNA 4DX2A 4HI9A 1IHBA 2F8YA 5ITZF 2KBXA 1MJ0A 1NFIE 2ZGDA 3HG0D 5CBOA 3V79K 4U95D 4TUMA 3W9GA 4K5AB 5KNGA 2RFAA 5EILA 4CYMD 3ZU7B 4A63B 5ENQD 1WG0A 1IXVA 1MX6A 4K5CA 4O60A 3T8KA 3EHQA 5ENRD 2FO1E 4RLYA 4BEPA 4LSZE 2F37A 3SO8A 2ZGGA 1BI7B 4K5BA 4NIKA 3TWQA 3TWRA 1D9SA 4ATZD 4LG6A 3D9HA 4J7WA 5HRYA 5ENSD 5ENOD 4YDWA 5EYLA 3V2XA 2ETCA 1OY3D 3ZKJA 3C5RA 2XZTG 1N0RA 5AQ7A 2PNNA 4F6RD 3V31A 4OAUC 1SW6A 1G3NB 3DEOA 4DX6D 1YMPA 2DWZA 2NYJA 2VGEA 4GPMA 1DCQA 4HBDA 3UXGA 5JMND 5CECB 3NBNB 2QC9A 5FINA 4DUIA 3JXIA 1N0QA 5KWDA 1K3ZD 3KEAA 5EIBE 2ETAA 5ENPD 2ETBA 3B7BA 1BU9A 4BERA 2DZOA 4UUCA 2KXPC 3Q9NC 4DX1A 3AJIA 2MYOA 3LJNA 1AP7A 2V4HC 3TWSA 1MYOA 2B0OE 4DRXE 2XZDG 5CEDB 4O1OA 2A5EA 4GMRA 1A5EA 2P2CP 3IXEA 4HI8A 5EIDA 2BKGA 5KNHD 4DX7D 4HRNA 5EYPF 3TWUA 4G8LA 2XEHA 2F8XK 5ENTD 4ZHBA 1DC2A 5KBAA 3HRAA 5AQ9A 4JB8P 4U96D 5HS0A 5JA4D 1WDYA 1MX2A 4BSZB 4C48B 3V30A 5BXUA 3ZNGA 3DEPA 4HNAD 3JUEA 4G8KA 4N5QA 3NOGD 4OAVB 5BXOA 3JXJA 4QFVA 4BETA 1AWCB 1IKND 4J8YA 5AQBA 5HKPA 3EU9A 4F1PA 3F6QA 4YDYA 5AAOA 4LNUD 2HE0A 2J8SD 3J5PA 1TR4A 3T9KA 2XEEA 4HRLA 5CEAA 2Y0BG 1MX4A 4DX5D 4HRMB 1SVXA 5FIOA 2L6BA 5EN5D 2RFMA 4B93B 4CZ2D
chains in the Genus database with same CATH superfamily
3FUMA 2R05A 4FU3A 3LY7A 3EHRA 3G2SA 4MBGA 4QQIA 2VGXB 3KSLA 3MGBA 4DX2A 2QFCA 1HH8A 4XIFA 4GTPA 3QB2A 3HG0D 4FJZA 4GZCA 3ZPJA 1OWPA 3EHQA 3FTVA 3APCA 2A5UA 4WWPA 1QBQA 3S7FA 2P58C 1VDYA 2VTBA 4APOA 3IKOB 4F3VA 3DSUA 3MEKA 1Z3YA 1G3NB 2WB2A 1DCQA 3CHMA 1IHGA 4XI0A 3FU5A 3D3MA 4R7LA 3EJNA 2MYOA 4WNEA 3VLDA 4JVSA 1PY1A 3DBSA 4HI8A 3IBEA 2LSVA 2XEHA 3CSTA 2I1JA 2WXKA 3JUEA 2LAHA 4U07A 1QQEA 1WAO1 3Q78A 3UX4A 3E34A 3HXEA 3LCAA 2L6BA 5FQ7A 4U7EB 5M72A 3FY4A 5CMYA 4HOSA 4UQYA 2PQRA 2CHXA 1EYHA 4BX9A 3ZYMA 2HM8A 4NURA 2FEZA 5ENNA 3Q49B 1E90A 3JYSA 5KCMA 3E30A 3PH0C 2ZGDA 2HYZA 5CRVA 3ZEFA 3HHMA 3AG2E 3UPVA 4XI9A 4CDMA 2RFAA 1XGWA 2MOWA 2A4ZA 1WG0A 4BT9A 2DYRE 2JEKA 3MCXA 1OWMA 1GW6A 2XCCA 4FJYA 2WXQA 4LSZE 4J7WA 1N0RA 2R5SA 3BQOA 3ASGA 4ANWA 2QC9A 3RRNB 4EZJA 1N0QA 3LVQE 3FH8A 2X6FA 3FP3A 3KS2A 4BERA 5KJKA 3KAEA 3ML8A 3Q47B 3TWSA 4H7YA 3KEZA 3EDTB 1FVHA 5DIZA 2AXUA 4GMRA 2Y4UA 3ULEG 4G23A 1P5QA 4N3BA 4JA9A 2EIJE 3CEQA 4WNDA 3CVYA 3URZA 5CRUA 3F6QA 2VGYA 5AAOA 2ZIRA 1TR4A 1BPOA 1H2VC 2V5FA 4JC8A 3UT8A 1MX4A 1TNBA 2WQHA 3Q7AA 4U0ZA 5IY5E 2JABA 4BESA 3BG1B 2J4DA 2FO7A 2FULA 3U66A 2E2EA 4JPSA 2X6IA 1D8EA 3G2VA 3O4ZA 4GMLA 2I1KA 1D8DA 3HVEB 5B1BE 4GA0A 3FTUA 4J8SA 1UN9A 4K5CA 4AJWA 2FO1E 3L54A 2ZGGA 3ZFWA 2GGFA 3IHYA 3D9HA 4CCAA 3CHOA 5ENOD 2QY7A 3CKCA 5ANLA 4YDEA 2KCKA 4EPZA 3RJVA 3IV0A 2R17C 3GW4A 1TN7A 3ZIMA 5JJ7A 4OYSA 4G24A 3LJNA 3FH7A 3UT7A 4BTBA 5CEDB 3AG1E 1DNPA 5KNHD 2WXJA 3ASHA 1JWFA 4ZHBA 1JUQA 3P1UA 1TJCA 4U96D 1KPSB 4I43A 3E37A 5AQBA 4LERA 5G05C 2ZXWE 2XEEA 1HS6A 5BPPA 4URKA 3HXBA 3V2OA 2WXMA 4U8VD 5G2NA 2OEVA 4M3OA 3B7RL 3J5QB 4ZFHA 2XS1A 3NOCD 2LXMA 1Y8MA 3AS8A 3MKQA 4KT6B 3APFA 4N3CA 2GRQB 1O1TA 5ANRA 4E6HA 4GZ5A 2LUHA 4F53A 3ZU7B 1ELKA 4EZLA 3PZ4A 2L0TB 1H2TC 4JHRA 1S0PA 4H7XA 1NP7A 3NF1A 5AJLA 3I5PA 3ZGQA 4LG6A 3QARA 2H6HA 1KLXA 3CIAA 3ZKJA 2H6FA 3D9PA 3CVQA 5FTPA 3D9IA 2R2LA 2L6JA 2DIWA 4XKCA 3QWVA 1OWOA 3FEYA 4Y6WA 3S7BA 3PE3A 2VJ8A 4JL0A 2FI7A 3MJWA 1W3BA 4UWHA 1B89A 2J49A 4GTSA 2P9KG 3FUNA 4B8CB 3FWVA 2F8XK 4CDNA 5HI7A 3UUXA 2WXOA 1MX2A 4JD2G 3SY2A 4BETA 3HXCA 3MKQB 2X6JA 4RG6A 3DXMG 3SQVA 2UY1A 5FJYA 2GRLA 2EQXA 4GTVA 1SVXA 2WXRA 3UKRG 5EN5D 4WAFA 4YVOA 1HX8A 1JCRA 3OAWA 3DWLG 2UWJG 2BKKB 2L9BA 5EX0A 4Y6CA 4YNDA 3FULA 3PREA 1HF8A 1HU3A 3ABKE 3ISMC 1K1AA 4I9CA 4L9PA 5T4YA 3C3OA 2I2OA 4KXKB 1IQUA 4DPRA 4U0SA 4N2SA 3W9GA 4WWOA 3ZXSA 4CDRA 2H6IA 4FHKA 3LKUA 1D9SA 4GTOA 2AW6A 5AQ7A 4F6RD 5J08A 4O6FA 4GPMA 5B1AE 3SNXA 1O1RA 2OV8A 4GTMA 1QNFA 2L0IA 2VGXA 4HOQA 1ZBPA 4G11A 1JCQA 1UN8A 3ESLA 4I6EA 1A5EA 4U04A 4X8QA 3CVXA 3GYZA 3HRAA 3QAQA 3ZN3A 4KYOB 5AIJA 3CLJA 1WY6A 4UQXA 4LNUD 1LD7A 2IJGX 2YHEA 3CHQA 2XCBA 3DSVA 4AP2A 3SFYA 1ELRA 3CK7A 1OCCE 3BU8A 4GZ3A 4O1PA 2XENA 4F7AA 3B95A 5D66A 4L7TA 4ILHB 4XEIG 3TGOA 2IO3C 1H19A 3EU5A 1V55E 3UQ3A 3WG7E 4RQIA 5C2YA 3D9JA 5CBNA 1BD8A 3Q15A 4PS3A 3VTYA 1HO8A 4LRZA 2LXLA 2BUGA 2LNIA 3SHFA 3MZLB 1HFAA 3MX3A 4UI9K 2GRMA 3MV2B 1NA0A 4IN3B 4APFA 3PNTB 4KMOA 3PEUB 3V31A 1OCZE 4HVBA 4GYWA 1RW2A 4UWGA 3KEAA 4A1GA 3RRUA 4HOTA 3TAXA 2A5EA 2V4LA 5EIDA 2XRYA 4FADA 4HRNA 5EYPF 4RVBA 1OXJA 4GA2A 4IYPA 1N4PA 3KD7A 2CG3A 2P9LG 2NC9A 2AXVA 5HKPA 4GYYA 4EZKA 3G2TA 5E75A 2Y0BG 4NQ0A 1N4RA 2EIME 3OXGA 3I3NA 1IQRA 2WMNA 1MQSA 2GRPB 5AARA 5EKQD 2Y1LE 2M63A 4G1TA 2LO6A 1BLXB 4I2ZA 3TWVA 3FUEA 2WXPA 3Q9UC 1UOHA 2WXGA 5A6CA 2P9IG 4GCNA 1N9AA 3CV0A 3LDZA 3ASFA 3EHMA 1Z5SC 4J0UA 4ACKA 2HR2A 2VQ2A 3CVNA 2YINA 3R9MA 4ILIA 2NYJA 3OXLA 1U3DA 2DZOA 3KSQA 4WUYA 1TNOA 3FEXA 3GZSA 2MRIA 5J90A 2KZTB 4EECA 3HVEA 5KBAA 3V30A 3JXJA 4A1SA 1AWCB 3PVLA 3EU9A 3SBTB 1UW4B 1N54A 3PUJA 2WM9A 5AENA 2GW1A 4TXQA 3R7RA 2CFZA 4IRUA 4WNGA 1QZ2A 3EIJA 1U2VG 4WWNA 4PDXA 2V5QC 1K1BA 3CQGB 3VTXA 3LS8A 3D9KA 3ML9A 2XEVA 5LP0A 1S70B 2WQ6A 2YNQA 2DZNA 3WXXA 4BTAA 5C1DA 5CCMA 2WMOA 1TJFA 3U4TA 1N52A 4CGVA 4FC8A 2J09A 2J07A 3T8KA 3DXKG 3ONKA 3AS5A 3I4RB 4JEUA 3N71A 4K5BA 4NIKA 1U3CA 4KBQA 3TWRA 5HRYA 2MHKA 1OY3D 1X5BA 1E8XA 3ZYLA 4TRQA 3ASOE 1TN8A 4EQFA 4HORA 1K3ZD 4Q69A 3HXFA 5FZQA 3FUKA 3Q9NC 4AIFA 3ZVVA 3EHNA 3L9TA 4DRXE 3ULYA 1E8YA 3LXUX 4UWLA 2RKKA 4GCOA 5AJDA 4C0EA 4FLHA 4RSYA 4C48B 3ZNGA 1Z3XA 3LEWA 3UM2A 4FHJA 3CVVA 3QNKA 4XKBA 3T9KA 3L16A 4CT0A 3C98A 5CEAA 3UM1A 1OWNA 1Y6IA 3IEGA 3UINC 1EF1C 5G55A 5KJMA 4ANUA 1DCEA 3UIPC 5BNWA 4HS2A 4I6JA 1TNZA 1JCSA 2J08A 3CVLA 3ZUVB 3FTSA 3UM3A 5G04J 5FQ6A 1IYGA 2LAIA 2HO1A 3RKVA 5AYWD 1QYMA 2X6KA 1TN6A 2IOSA 3V79K 1OCOE 4DJAA 4TUMA 4GA1A 3PZ1A 4KZCA 3G2WA 1SA4A 3PZ3A 3X2QE 1HG2A 3SI5A 2F37A 3SO8A 4B8AA 1PC2A 4N39A 4B0ZA 1TEZA 3SF4A 5EYLA 2ETCA 3L82A 3QKYA 4JHJA 4AY5A 2Y4TA 3K9IA 5FINA 4J8FA 1UG3A 2XPZA 5FQ4A 3B7BA 4U0UA 1JPLA 3FU0A 3SGHA 4EHMA 2F0YA 3ABME 2AWIA 4A3TA 2B0OE 2VYIA 2QZAA 4MRUA 3ZXPA 1TNUA 2J9QA 1FVFA 5FQ8A 5JA4D 4AXHA 3AU5A 4OAVB 1Z6TA 3NZSA 2VSOE 5A23A 5D0QD 3J5PA 3T8MA 3CHSA 3D9NA 2NXPA 4A55A 2R03A 5LOZA 3R7QA 2XPIA 3E4BA 2LSUA 3MV3B 1A17A 3TWTA 2CG2A 4XX5A 1IHBA 2IY0C 2GRNB 1MJ0A 1V54E 2DCPA 3MKRA 4U95D 4UI9J 3FDHA 4YVQC 2OVFA 5BV1A 4K0RA 2P9SG 4G25A 4AY6A 2J4BA 4C0MA 4LUNU 3SFZA 2Q7FA 4HBDA 3UM0A 3UXGA 1OCRE 3LJ3A 2EIKE 4GTTA 1OUVA 3FUFA 1UJKA 3GZ2A 2WXLA 5HQ8A 4UUCA 3L13A 3RSEG 4ME2A 2I6HA 3NB2A 2WQ7A 3RAUA 4Q96A 3I4GA 4WNFA 3CVUA 3IXEA 3HXDA 1L5JA 4DX7D 3VLEA 2OOEA 3P2BA 5AQ9A 4I1OB 1WDYA 4BFRA 2RD0A 5BXUA 4BT8A 4N5QA 3TJPA 1N95A 4HRLA 4HLEA 1K8KG 3C3RA 4CZ2D 4D10C 3L08A 4RG9A 1O1SA 3FFLA 3JUIA 3ENEA 2GROB 1OT8A 2QYJA 4N2QA 4I9EA 3L17A 2KBXA 4NACA 2IO2C 2BEDA 2X3MA 4CT4A 2QYUA 2C0MA 1IXVA 4GTQA 5DBKA 1E8WA 2CFUA 4RLYA 1KZPA 3VLFA 1BI7B 3G2UA 4A3VA 2B6CA 3QC1A 4YDWA 3ZHEA 4AM9A 3PDNA 1SQMA 3UT4A 1YMPA 1PAQA 1NA3A 4CGWA 3E33A 4PUCA 4L2LA 3CKBA 3CR3A 3CQCB 3AG3E 3QJZA 1FT2A 3IHVA 4BWRA 2WPVA 1AP7A 2V4HC 1FPPA 4M7CA 4O1OA 2XGMA 3D9LA 3U3WA 2VSYA 2XQ0A 3MYVA 5HS0A 4DLQA 4DI4A 4W9RA 4G8KA 5EX3A 5LCWJ 1IKND 2X6HA 4F1PA 2E0IA 4GZDA 4IULA 3DSXA 1E96B 3LY9A 1Q2ZA 4HRMB 3B13A 3HIZA 2EILE 1UJJA 3FUHA 2WXHA 3TL5A 5CERB 1H2UA 5T8IA 3AG4E 1HXIA 5AQAA 4Q94A 4LNBA 3QWPA 4G26A 1N11A 3ZW3A 3AU4A 3ZHEB 2Y3AA 5ITZF 4N3AA 4TXPA 2KZTA 3RRMB 5A7DB 3QDNA 2XHEA 4LCTA 4BX8A 4V3IA 3BUAA 4K5AB 4GTRA 4KVOA 1WM5A 2WXIA 4ABNA 5EILA 3SZ7A 1MX6A 4XE0A 5FT9A 3ESKA 4BEPA 3L6AA 3FU3A 2KCLA 3UKUG 3S2AA 2R59A 3C5RA 3TXMA 5KJLA 4OAUC 5CECB 2WXFA 2ONDA 3NBNB 2PM6A 4GMJA 3CSFA 5ARGA 3FUIA 4UWFA 1LF8A 1O5MA 3JCKC 3RIBA 4B94A 2ETBA 2YQ8A 4GB9A 3DPYA 4UWKA 2KXPC 4LNGA 3O48A 3T5XA 3NZUA 4E85A 5LCWC 3HDXA 2BF0X 3BG0B 2P2CP 2Y69E 4U63A 4F1SA 2FBNA 2BKGA 4MS6A 4JEHA 3QK0A 3RO3A 4JB8P 3PS6A 3RK6A 3NOGD 5BXOA 5D0OD 4I1AA 1N4QA 3FTXA 4JHKA 2VTBB 2GRRB 4J6IA 5D2MC 3FHEA 3DSSA 4N5CA 2CHZA 3CHRA 4XZ4A 3Q5MA 1YCSB 1S63A 2JLBA 3UI2A 5FWQA 3JQ1A 3U9WA 3T5VA 4Z68A 1H0AA 3LPZA 1N94A 3UTMA 4HLLA 3R9AB 1SZ9A 5EDSA 3CGHA 2WVIA 5CMWA 4FA6A 3BEEA 3CHPA 4CRWA 4ILGA 5JHBA 4I6GA 4CYMD 4A63B 4PS8A 5ENQD 2XRZA 3Q4AB 1DVPA 3FTZA 4JXTA 3TWQA 2YHCA 3PE4A 4ACLA 4DX6D 1KZOA 4DUIA 4AEZC 4JZYA 5KWDA 4GZ6A 3ZYQA 4I2WA 2PL2A 2ILRA 5B3SE 2IOLA 1E8ZA 1LTXA 1MYOA 3EUVA 1KT1A 2DBAA 4DI3A 3SFXA 4TXRA 3ZYKA 4G2VA 3FUDA 2EINE 5ENTD 3LYAA 2I9CA 5G05J 2OVBA 5CCLA 3E32A 1NI1A 1E7VA 4EBAA 2V8SE 3EIQC 3TG4A 4DX5D 5BV0A 1SA5A 1YYHA 3APDA 2KATA 3QWWA 2DVWA 5FZRA 4I1MA 3S7JA 5T3RA 4HQDA 2C2LA 3FTWA 2KM4A 4OVVA 4HXIA 3C72A 5KJNA 3TWWA 3AAAC 3UMVA 2F8YA 1SZAA 3LVRE 3D9OA 5CBOA 5CHEE 2KCVA 4EBAG 1TNYA 2VSXE 3GZ1A 1YA0A 3ASDA 3NQPA 3V2XA 4ANXA 2IONA 4HOUA 2PNNA 3Q7FA 1S64A 1HG5A 3DEOA 1NL4A 2VGEA 2CHWA 5EIBE 2PM7A 2AVPA 1BU9A 4NRHB 2DYSE 2P9UG 3DRAA 4GU5A 1ELWA 4JW1A 2XGOA 3QOUA 3S7DA 3Q79A 3TWUA 4ANVA 2P9PG 4I17A 3MA5A 1H6PA 4BSZB 3RU0A 3U64A 5JJTA 2OCCE 3CVPA 2WXNA 5LX8A 4CEMA 3NAWA 4B93B 5AN8A 3W9FA 4TV3A 4U8YD 3ASNE 4AOFA 1HZ4A 2IQCA 3ONLA 5JHAA 3FU6A 4L23A 1BI8B 4FLBA 2AJAA 5H7PA 4TUUA 3JQ0A 4MKTA 4B89A 3TWXA 4AVXA 2AXZA 3UIOC 4HI9A 3SBSA 5G04C 3Q75A 2OEWA 3DSWA 1FT1A 1HE8A 3C3QA 4K03A 2C0LA 2R02A 5E76A 3PZ2A 4MLPA 4OVUA 2PZIA 3OTNA 3AS4A 3ABLE 3PEVB 3PUKA 1ZU2A 1EPUA 2XS8A 1H6KA 3PZDA 5JMND 4GPKA 3PNLB 1MZCA 3Q73A 2ETAA 3DSTA 1EDUA 3FUJA 3HYMB 4FP7A 2KC7A 4DLOA 1RZ4A 5BT1A 3RO2A 2XZDG 3B7SA 4PH4B 4JA7A 2ZISA 1TYQG 2BTDA 3TXNA 2XGSA 4YDOA 5ARFA 1H6OA 4QFVA 1JWGA 4BSXA 2HE0A 3OXFA 4J8DA 1NZNA 1N4SA 4LEUA 4J8EA 5LFAA 5FIOA 5FZSA 3CVWA 5BUZA 4L1BA 3CK9A 2FF4A 3B7TA 3PRZA 4AV7A 1LD8A 4HB5A 1ZB1A 5BW8C 4BY6A 2V0PA 4C9BB 4GYOA 2XPYA 2P9NG 3CK8A 2X38A 3TG5A 3DPDA 3FH5A 4KVMA 1NFIE 3ZRHA 5KNGA 3SD5A 3B7UX 4O60A 4UI9C 2VSNA 2H6GA 4HFGA 5ENRD 1FCHA 2IEJA 3ULQA 2UY1B 4ATZD 5ENSD 2ZU6B 1KT0A 3D9MA 4GAAA 2XZTG 1X81A 1SW6A 2DWZA 2RG8A 4DK5A 3JXIA 1XNFA 1INZA 5ENPD 2IF4A 4DX1A 3AJIA 4L2YA 4P29A 4ATGA 4KZ0A 2IU1A 4G8LA 1DC2A 3FTYA 3DEPA 4HNAD 4PS7A 5JJ6A 1E7UA 4UQZA 4J8YA 2IFUA 4YDYA 2J8SD 3LY8A 4FULA 4U8HA 3L22A 1MHQA 2PQNA 1OWLA 2NSZA 2RFMA
chains in the Genus database with same CATH topology
5AN8A 3W9FA 1YCSB 3V2OA 4O1PA 4U8YD 2XENA 1YYHA 4U8VD 3UI2A 3B95A 5D66A 2BKKB 2JABA 3EHRA 5AARA 4Z68A 5CERB 2DVWA 4HB5A 4BESA 3J5QB 2Y1LE 3ZUVB 4ZFHA 4HQDA 3NOCD 5AQAA 3UTMA 4HLLA 1BI8B 2AJAA 1OT8A 2QYJA 2V5QC 1BLXB 1K1BA 4QQIA 1BD8A 3TWVA 5CBNA 3Q9UC 1S70B 1UOHA 1K1AA 1N11A 3TWTA 3TWXA 3TWWA 1QYMA 3AAAC 2DZNA 4DX2A 4HI9A 1IHBA 2F8YA 5ITZF 2KBXA 1MJ0A 1NFIE 2ZGDA 3HG0D 5CBOA 3V79K 4U95D 4TUMA 3W9GA 4K5AB 5KNGA 2RFAA 5EILA 4CYMD 3ZU7B 4A63B 5ENQD 1WG0A 1IXVA 1MX6A 4K5CA 4O60A 3T8KA 3EHQA 5ENRD 2FO1E 4RLYA 4BEPA 4LSZE 2F37A 3SO8A 2ZGGA 1BI7B 4K5BA 4NIKA 3TWQA 3TWRA 1D9SA 4ATZD 4LG6A 3D9HA 4J7WA 5HRYA 5ENSD 5ENOD 4YDWA 5EYLA 3V2XA 2ETCA 1OY3D 3ZKJA 3C5RA 2XZTG 1N0RA 5AQ7A 2PNNA 4F6RD 3V31A 4OAUC 1SW6A 1G3NB 3DEOA 4DX6D 1YMPA 2DWZA 2NYJA 2VGEA 4GPMA 1DCQA 4HBDA 3UXGA 5JMND 5CECB 3NBNB 2QC9A 5FINA 4DUIA 3JXIA 1N0QA 5KWDA 1K3ZD 3KEAA 5EIBE 2ETAA 5ENPD 2ETBA 3B7BA 1BU9A 4BERA 2DZOA 4UUCA 2KXPC 3Q9NC 4DX1A 3AJIA 2MYOA 3LJNA 1AP7A 2V4HC 3TWSA 1MYOA 2B0OE 4DRXE 2XZDG 5CEDB 4O1OA 2A5EA 4GMRA 1A5EA 2P2CP 3IXEA 4HI8A 5EIDA 2BKGA 5KNHD 4DX7D 4HRNA 5EYPF 3TWUA 4G8LA 2XEHA 2F8XK 5ENTD 4ZHBA 1DC2A 5KBAA 3HRAA 5AQ9A 4JB8P 4U96D 5HS0A 5JA4D 1WDYA 1MX2A 4BSZB 4C48B 3V30A 5BXUA 3ZNGA 3DEPA 4HNAD 3JUEA 4G8KA 4N5QA 3NOGD 4OAVB 5BXOA 3JXJA 4QFVA 4BETA 1AWCB 1IKND 4J8YA 5AQBA 5HKPA 3EU9A 4F1PA 3F6QA 4YDYA 5AAOA 4LNUD 2HE0A 2J8SD 3J5PA 1TR4A 3T9KA 2XEEA 4HRLA 5CEAA 2Y0BG 1MX4A 4DX5D 4HRMB 1SVXA 5FIOA 2L6BA 5EN5D 2RFMA 4B93B 4CZ2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN8 A;  3W9F A;  1YCS B;  3V2O A;  4O1P A;  4U8Y D;  2XEN A;  1YYH A;  4U8V D;  3UI2 A;  3B95 A;  5D66 A;  2BKK B;  2JAB A;  3EHR A;  5AAR A;  4Z68 A;  5CER B;  2DVW A;  4HB5 A;  4BES A;  3J5Q B;  2Y1L E;  3ZUV B;  4ZFH A;  4HQD A;  3NOC D;  5AQA A;  3UTM A;  4HLL A;  1BI8 B;  2AJA A;  1OT8 A;  2QYJ A;  2V5Q C;  1BLX B;  1K1B A;  4QQI A;  1BD8 A;  3TWV A;  5CBN A;  3Q9U C;  1S70 B;  1UOH A;  1K1A A;  1N11 A;  3TWT A;  3TWX A;  3TWW A;  1QYM A;  3AAA C;  2DZN A;  4DX2 A;  4HI9 A;  1IHB A;  2F8Y A;  5ITZ F;  2KBX A;  1MJ0 A;  1NFI E;  2ZGD A;  3HG0 D;  5CBO A;  3V79 K;  4U95 D;  4TUM A;  3W9G A;  4K5A B;  5KNG A;  2RFA A;  5EIL A;  4CYM D;  3ZU7 B;  4A63 B;  5ENQ D;  1WG0 A;  1IXV A;  1MX6 A;  4K5C A;  4O60 A;  3T8K A;  3EHQ A;  5ENR D;  2FO1 E;  4RLY A;  4BEP A;  4LSZ E;  2F37 A;  3SO8 A;  2ZGG A;  1BI7 B;  4K5B A;  4NIK A;  3TWQ A;  3TWR A;  1D9S A;  4ATZ D;  4LG6 A;  3D9H A;  4J7W A;  5HRY A;  5ENS D;  5ENO D;  4YDW A;  5EYL A;  3V2X A;  2ETC A;  1OY3 D;  3ZKJ A;  3C5R A;  2XZT G;  1N0R A;  5AQ7 A;  2PNN A;  4F6R D;  3V31 A;  4OAU C;  1SW6 A;  1G3N B;  3DEO A;  4DX6 D;  1YMP A;  2DWZ A;  2NYJ A;  2VGE A;  4GPM A;  1DCQ A;  4HBD A;  3UXG A;  5JMN D;  5CEC B;  3NBN B;  2QC9 A;  5FIN A;  4DUI A;  3JXI A;  1N0Q A;  5KWD A;  1K3Z D;  3KEA A;  5EIB E;  2ETA A;  5ENP D;  2ETB A;  3B7B A;  1BU9 A;  4BER A;  2DZO A;  4UUC A;  2KXP C;  3Q9N C;  4DX1 A;  3AJI A;  2MYO A;  3LJN A;  1AP7 A;  2V4H C;  3TWS A;  1MYO A;  2B0O E;  4DRX E;  2XZD G;  5CED B;  4O1O A;  2A5E A;  4GMR A;  1A5E A;  2P2C P;  3IXE A;  4HI8 A;  5EID A;  2BKG A;  5KNH D;  4DX7 D;  4HRN A;  5EYP F;  3TWU A;  4G8L A;  2XEH A;  2F8X K;  5ENT D;  4ZHB A;  1DC2 A;  5KBA A;  3HRA A;  5AQ9 A;  4JB8 P;  4U96 D;  5HS0 A;  5JA4 D;  1WDY A;  1MX2 A;  4BSZ B;  4C48 B;  3V30 A;  5BXU A;  3ZNG A;  3DEP A;  4HNA D;  3JUE A;  4G8K A;  4N5Q A;  3NOG D;  4OAV B;  5BXO A;  3JXJ A;  4QFV A;  4BET A;  1AWC B;  1IKN D;  4J8Y A;  5AQB A;  5HKP A;  3EU9 A;  4F1P A;  3F6Q A;  4YDY A;  5AAO A;  4LNU D;  2HE0 A;  2J8S D;  3J5P A;  1TR4 A;  3T9K A;  2XEE A;  4HRL A;  5CEA A;  2Y0B G;  1MX4 A;  4DX5 D;  4HRM B;  1SVX A;  5FIO A;  2L6B A;  5EN5 D;  2RFM A;  4B93 B;  4CZ2 D; 
#chains in the Genus database with same CATH topology
 3FUM A;  2R05 A;  4FU3 A;  3LY7 A;  3EHR A;  3G2S A;  4MBG A;  4QQI A;  2VGX B;  3KSL A;  3MGB A;  4DX2 A;  2QFC A;  1HH8 A;  4XIF A;  4GTP A;  3QB2 A;  3HG0 D;  4FJZ A;  4GZC A;  3ZPJ A;  1OWP A;  3EHQ A;  3FTV A;  3APC A;  2A5U A;  4WWP A;  1QBQ A;  3S7F A;  2P58 C;  1VDY A;  2VTB A;  4APO A;  3IKO B;  4F3V A;  3DSU A;  3MEK A;  1Z3Y A;  1G3N B;  2WB2 A;  1DCQ A;  3CHM A;  1IHG A;  4XI0 A;  3FU5 A;  3D3M A;  4R7L A;  3EJN A;  2MYO A;  4WNE A;  3VLD A;  4JVS A;  1PY1 A;  3DBS A;  4HI8 A;  3IBE A;  2LSV A;  2XEH A;  3CST A;  2I1J A;  2WXK A;  3JUE A;  2LAH A;  4U07 A;  1QQE A;  1WAO 1;  3Q78 A;  3UX4 A;  3E34 A;  3HXE A;  3LCA A;  2L6B A;  5FQ7 A;  4U7E B;  5M72 A;  3FY4 A;  5CMY A;  4HOS A;  4UQY A;  2PQR A;  2CHX A;  1EYH A;  4BX9 A;  3ZYM A;  2HM8 A;  4NUR A;  2FEZ A;  5ENN A;  3Q49 B;  1E90 A;  3JYS A;  5KCM A;  3E30 A;  3PH0 C;  2ZGD A;  2HYZ A;  5CRV A;  3ZEF A;  3HHM A;  3AG2 E;  3UPV A;  4XI9 A;  4CDM A;  2RFA A;  1XGW A;  2MOW A;  2A4Z A;  1WG0 A;  4BT9 A;  2DYR E;  2JEK A;  3MCX A;  1OWM A;  1GW6 A;  2XCC A;  4FJY A;  2WXQ A;  4LSZ E;  4J7W A;  1N0R A;  2R5S A;  3BQO A;  3ASG A;  4ANW A;  2QC9 A;  3RRN B;  4EZJ A;  1N0Q A;  3LVQ E;  3FH8 A;  2X6F A;  3FP3 A;  3KS2 A;  4BER A;  5KJK A;  3KAE A;  3ML8 A;  3Q47 B;  3TWS A;  4H7Y A;  3KEZ A;  3EDT B;  1FVH A;  5DIZ A;  2AXU A;  4GMR A;  2Y4U A;  3ULE G;  4G23 A;  1P5Q A;  4N3B A;  4JA9 A;  2EIJ E;  3CEQ A;  4WND A;  3CVY A;  3URZ A;  5CRU A;  3F6Q A;  2VGY A;  5AAO A;  2ZIR A;  1TR4 A;  1BPO A;  1H2V C;  2V5F A;  4JC8 A;  3UT8 A;  1MX4 A;  1TNB A;  2WQH A;  3Q7A A;  4U0Z A;  5IY5 E;  2JAB A;  4BES A;  3BG1 B;  2J4D A;  2FO7 A;  2FUL A;  3U66 A;  2E2E A;  4JPS A;  2X6I A;  1D8E A;  3G2V A;  3O4Z A;  4GML A;  2I1K A;  1D8D A;  3HVE B;  5B1B E;  4GA0 A;  3FTU A;  4J8S A;  1UN9 A;  4K5C A;  4AJW A;  2FO1 E;  3L54 A;  2ZGG A;  3ZFW A;  2GGF A;  3IHY A;  3D9H A;  4CCA A;  3CHO A;  5ENO D;  2QY7 A;  3CKC A;  5ANL A;  4YDE A;  2KCK A;  4EPZ A;  3RJV A;  3IV0 A;  2R17 C;  3GW4 A;  1TN7 A;  3ZIM A;  5JJ7 A;  4OYS A;  4G24 A;  3LJN A;  3FH7 A;  3UT7 A;  4BTB A;  5CED B;  3AG1 E;  1DNP A;  5KNH D;  2WXJ A;  3ASH A;  1JWF A;  4ZHB A;  1JUQ A;  3P1U A;  1TJC A;  4U96 D;  1KPS B;  4I43 A;  3E37 A;  5AQB A;  4LER A;  5G05 C;  2ZXW E;  2XEE A;  1HS6 A;  5BPP A;  4URK A;  3HXB A;  3V2O A;  2WXM A;  4U8V D;  5G2N A;  2OEV A;  4M3O A;  3B7R L;  3J5Q B;  4ZFH A;  2XS1 A;  3NOC D;  2LXM A;  1Y8M A;  3AS8 A;  3MKQ A;  4KT6 B;  3APF A;  4N3C A;  2GRQ B;  1O1T A;  5ANR A;  4E6H A;  4GZ5 A;  2LUH A;  4F53 A;  3ZU7 B;  1ELK A;  4EZL A;  3PZ4 A;  2L0T B;  1H2T C;  4JHR A;  1S0P A;  4H7X A;  1NP7 A;  3NF1 A;  5AJL A;  3I5P A;  3ZGQ A;  4LG6 A;  3QAR A;  2H6H A;  1KLX A;  3CIA A;  3ZKJ A;  2H6F A;  3D9P A;  3CVQ A;  5FTP A;  3D9I A;  2R2L A;  2L6J A;  2DIW A;  4XKC A;  3QWV A;  1OWO A;  3FEY A;  4Y6W A;  3S7B A;  3PE3 A;  2VJ8 A;  4JL0 A;  2FI7 A;  3MJW A;  1W3B A;  4UWH A;  1B89 A;  2J49 A;  4GTS A;  2P9K G;  3FUN A;  4B8C B;  3FWV A;  2F8X K;  4CDN A;  5HI7 A;  3UUX A;  2WXO A;  1MX2 A;  4JD2 G;  3SY2 A;  4BET A;  3HXC A;  3MKQ B;  2X6J A;  4RG6 A;  3DXM G;  3SQV A;  2UY1 A;  5FJY A;  2GRL A;  2EQX A;  4GTV A;  1SVX A;  2WXR A;  3UKR G;  5EN5 D;  4WAF A;  4YVO A;  1HX8 A;  1JCR A;  3OAW A;  3DWL G;  2UWJ G;  2BKK B;  2L9B A;  5EX0 A;  4Y6C A;  4YND A;  3FUL A;  3PRE A;  1HF8 A;  1HU3 A;  3ABK E;  3ISM C;  1K1A A;  4I9C A;  4L9P A;  5T4Y A;  3C3O A;  2I2O A;  4KXK B;  1IQU A;  4DPR A;  4U0S A;  4N2S A;  3W9G A;  4WWO A;  3ZXS A;  4CDR A;  2H6I A;  4FHK A;  3LKU A;  1D9S A;  4GTO A;  2AW6 A;  5AQ7 A;  4F6R D;  5J08 A;  4O6F A;  4GPM A;  5B1A E;  3SNX A;  1O1R A;  2OV8 A;  4GTM A;  1QNF A;  2L0I A;  2VGX A;  4HOQ A;  1ZBP A;  4G11 A;  1JCQ A;  1UN8 A;  3ESL A;  4I6E A;  1A5E A;  4U04 A;  4X8Q A;  3CVX A;  3GYZ A;  3HRA A;  3QAQ A;  3ZN3 A;  4KYO B;  5AIJ A;  3CLJ A;  1WY6 A;  4UQX A;  4LNU D;  1LD7 A;  2IJG X;  2YHE A;  3CHQ A;  2XCB A;  3DSV A;  4AP2 A;  3SFY A;  1ELR A;  3CK7 A;  1OCC E;  3BU8 A;  4GZ3 A;  4O1P A;  2XEN A;  4F7A A;  3B95 A;  5D66 A;  4L7T A;  4ILH B;  4XEI G;  3TGO A;  2IO3 C;  1H19 A;  3EU5 A;  1V55 E;  3UQ3 A;  3WG7 E;  4RQI A;  5C2Y A;  3D9J A;  5CBN A;  1BD8 A;  3Q15 A;  4PS3 A;  3VTY A;  1HO8 A;  4LRZ A;  2LXL A;  2BUG A;  2LNI A;  3SHF A;  3MZL B;  1HFA A;  3MX3 A;  4UI9 K;  2GRM A;  3MV2 B;  1NA0 A;  4IN3 B;  4APF A;  3PNT B;  4KMO A;  3PEU B;  3V31 A;  1OCZ E;  4HVB A;  4GYW A;  1RW2 A;  4UWG A;  3KEA A;  4A1G A;  3RRU A;  4HOT A;  3TAX A;  2A5E A;  2V4L A;  5EID A;  2XRY A;  4FAD A;  4HRN A;  5EYP F;  4RVB A;  1OXJ A;  4GA2 A;  4IYP A;  1N4P A;  3KD7 A;  2CG3 A;  2P9L G;  2NC9 A;  2AXV A;  5HKP A;  4GYY A;  4EZK A;  3G2T A;  5E75 A;  2Y0B G;  4NQ0 A;  1N4R A;  2EIM E;  3OXG A;  3I3N A;  1IQR A;  2WMN A;  1MQS A;  2GRP B;  5AAR A;  5EKQ D;  2Y1L E;  2M63 A;  4G1T A;  2LO6 A;  1BLX B;  4I2Z A;  3TWV A;  3FUE A;  2WXP A;  3Q9U C;  1UOH A;  2WXG A;  5A6C A;  2P9I G;  4GCN A;  1N9A A;  3CV0 A;  3LDZ A;  3ASF A;  3EHM A;  1Z5S C;  4J0U A;  4ACK A;  2HR2 A;  2VQ2 A;  3CVN A;  2YIN A;  3R9M A;  4ILI A;  2NYJ A;  3OXL A;  1U3D A;  2DZO A;  3KSQ A;  4WUY A;  1TNO A;  3FEX A;  3GZS A;  2MRI A;  5J90 A;  2KZT B;  4EEC A;  3HVE A;  5KBA A;  3V30 A;  3JXJ A;  4A1S A;  1AWC B;  3PVL A;  3EU9 A;  3SBT B;  1UW4 B;  1N54 A;  3PUJ A;  2WM9 A;  5AEN A;  2GW1 A;  4TXQ A;  3R7R A;  2CFZ A;  4IRU A;  4WNG A;  1QZ2 A;  3EIJ A;  1U2V G;  4WWN A;  4PDX A;  2V5Q C;  1K1B A;  3CQG B;  3VTX A;  3LS8 A;  3D9K A;  3ML9 A;  2XEV A;  5LP0 A;  1S70 B;  2WQ6 A;  2YNQ A;  2DZN A;  3WXX A;  4BTA A;  5C1D A;  5CCM A;  2WMO A;  1TJF A;  3U4T A;  1N52 A;  4CGV A;  4FC8 A;  2J09 A;  2J07 A;  3T8K A;  3DXK G;  3ONK A;  3AS5 A;  3I4R B;  4JEU A;  3N71 A;  4K5B A;  4NIK A;  1U3C A;  4KBQ A;  3TWR A;  5HRY A;  2MHK A;  1OY3 D;  1X5B A;  1E8X A;  3ZYL A;  4TRQ A;  3ASO E;  1TN8 A;  4EQF A;  4HOR A;  1K3Z D;  4Q69 A;  3HXF A;  5FZQ A;  3FUK A;  3Q9N C;  4AIF A;  3ZVV A;  3EHN A;  3L9T A;  4DRX E;  3ULY A;  1E8Y A;  3LXU X;  4UWL A;  2RKK A;  4GCO A;  5AJD A;  4C0E A;  4FLH A;  4RSY A;  4C48 B;  3ZNG A;  1Z3X A;  3LEW A;  3UM2 A;  4FHJ A;  3CVV A;  3QNK A;  4XKB A;  3T9K A;  3L16 A;  4CT0 A;  3C98 A;  5CEA A;  3UM1 A;  1OWN A;  1Y6I A;  3IEG A;  3UIN C;  1EF1 C;  5G55 A;  5KJM A;  4ANU A;  1DCE A;  3UIP C;  5BNW A;  4HS2 A;  4I6J A;  1TNZ A;  1JCS A;  2J08 A;  3CVL A;  3ZUV B;  3FTS A;  3UM3 A;  5G04 J;  5FQ6 A;  1IYG A;  2LAI A;  2HO1 A;  3RKV A;  5AYW D;  1QYM A;  2X6K A;  1TN6 A;  2IOS A;  3V79 K;  1OCO E;  4DJA A;  4TUM A;  4GA1 A;  3PZ1 A;  4KZC A;  3G2W A;  1SA4 A;  3PZ3 A;  3X2Q E;  1HG2 A;  3SI5 A;  2F37 A;  3SO8 A;  4B8A A;  1PC2 A;  4N39 A;  4B0Z A;  1TEZ A;  3SF4 A;  5EYL A;  2ETC A;  3L82 A;  3QKY A;  4JHJ A;  4AY5 A;  2Y4T A;  3K9I A;  5FIN A;  4J8F A;  1UG3 A;  2XPZ A;  5FQ4 A;  3B7B A;  4U0U A;  1JPL A;  3FU0 A;  3SGH A;  4EHM A;  2F0Y A;  3ABM E;  2AWI A;  4A3T A;  2B0O E;  2VYI A;  2QZA A;  4MRU A;  3ZXP A;  1TNU A;  2J9Q A;  1FVF A;  5FQ8 A;  5JA4 D;  4AXH A;  3AU5 A;  4OAV B;  1Z6T A;  3NZS A;  2VSO E;  5A23 A;  5D0Q D;  3J5P A;  3T8M A;  3CHS A;  3D9N A;  2NXP A;  4A55 A;  2R03 A;  5LOZ A;  3R7Q A;  2XPI A;  3E4B A;  2LSU A;  3MV3 B;  1A17 A;  3TWT A;  2CG2 A;  4XX5 A;  1IHB A;  2IY0 C;  2GRN B;  1MJ0 A;  1V54 E;  2DCP A;  3MKR A;  4U95 D;  4UI9 J;  3FDH A;  4YVQ C;  2OVF A;  5BV1 A;  4K0R A;  2P9S G;  4G25 A;  4AY6 A;  2J4B A;  4C0M A;  4LUN U;  3SFZ A;  2Q7F A;  4HBD A;  3UM0 A;  3UXG A;  1OCR E;  3LJ3 A;  2EIK E;  4GTT A;  1OUV A;  3FUF A;  1UJK A;  3GZ2 A;  2WXL A;  5HQ8 A;  4UUC A;  3L13 A;  3RSE G;  4ME2 A;  2I6H A;  3NB2 A;  2WQ7 A;  3RAU A;  4Q96 A;  3I4G A;  4WNF A;  3CVU A;  3IXE A;  3HXD A;  1L5J A;  4DX7 D;  3VLE A;  2OOE A;  3P2B A;  5AQ9 A;  4I1O B;  1WDY A;  4BFR A;  2RD0 A;  5BXU A;  4BT8 A;  4N5Q A;  3TJP A;  1N95 A;  4HRL A;  4HLE A;  1K8K G;  3C3R A;  4CZ2 D;  4D10 C;  3L08 A;  4RG9 A;  1O1S A;  3FFL A;  3JUI A;  3ENE A;  2GRO B;  1OT8 A;  2QYJ A;  4N2Q A;  4I9E A;  3L17 A;  2KBX A;  4NAC A;  2IO2 C;  2BED A;  2X3M A;  4CT4 A;  2QYU A;  2C0M A;  1IXV A;  4GTQ A;  5DBK A;  1E8W A;  2CFU A;  4RLY A;  1KZP A;  3VLF A;  1BI7 B;  3G2U A;  4A3V A;  2B6C A;  3QC1 A;  4YDW A;  3ZHE A;  4AM9 A;  3PDN A;  1SQM A;  3UT4 A;  1YMP A;  1PAQ A;  1NA3 A;  4CGW A;  3E33 A;  4PUC A;  4L2L A;  3CKB A;  3CR3 A;  3CQC B;  3AG3 E;  3QJZ A;  1FT2 A;  3IHV A;  4BWR A;  2WPV A;  1AP7 A;  2V4H C;  1FPP A;  4M7C A;  4O1O A;  2XGM A;  3D9L A;  3U3W A;  2VSY A;  2XQ0 A;  3MYV A;  5HS0 A;  4DLQ A;  4DI4 A;  4W9R A;  4G8K A;  5EX3 A;  5LCW J;  1IKN D;  2X6H A;  4F1P A;  2E0I A;  4GZD A;  4IUL A;  3DSX A;  1E96 B;  3LY9 A;  1Q2Z A;  4HRM B;  3B13 A;  3HIZ A;  2EIL E;  1UJJ A;  3FUH A;  2WXH A;  3TL5 A;  5CER B;  1H2U A;  5T8I A;  3AG4 E;  1HXI A;  5AQA A;  4Q94 A;  4LNB A;  3QWP A;  4G26 A;  1N11 A;  3ZW3 A;  3AU4 A;  3ZHE B;  2Y3A A;  5ITZ F;  4N3A A;  4TXP A;  2KZT A;  3RRM B;  5A7D B;  3QDN A;  2XHE A;  4LCT A;  4BX8 A;  4V3I A;  3BUA A;  4K5A B;  4GTR A;  4KVO A;  1WM5 A;  2WXI A;  4ABN A;  5EIL A;  3SZ7 A;  1MX6 A;  4XE0 A;  5FT9 A;  3ESK A;  4BEP A;  3L6A A;  3FU3 A;  2KCL A;  3UKU G;  3S2A A;  2R59 A;  3C5R A;  3TXM A;  5KJL A;  4OAU C;  5CEC B;  2WXF A;  2OND A;  3NBN B;  2PM6 A;  4GMJ A;  3CSF A;  5ARG A;  3FUI A;  4UWF A;  1LF8 A;  1O5M A;  3JCK C;  3RIB A;  4B94 A;  2ETB A;  2YQ8 A;  4GB9 A;  3DPY A;  4UWK A;  2KXP C;  4LNG A;  3O48 A;  3T5X A;  3NZU A;  4E85 A;  5LCW C;  3HDX A;  2BF0 X;  3BG0 B;  2P2C P;  2Y69 E;  4U63 A;  4F1S A;  2FBN A;  2BKG A;  4MS6 A;  4JEH A;  3QK0 A;  3RO3 A;  4JB8 P;  3PS6 A;  3RK6 A;  3NOG D;  5BXO A;  5D0O D;  4I1A A;  1N4Q A;  3FTX A;  4JHK A;  2VTB B;  2GRR B;  4J6I A;  5D2M C;  3FHE A;  3DSS A;  4N5C A;  2CHZ A;  3CHR A;  4XZ4 A;  3Q5M A;  1YCS B;  1S63 A;  2JLB A;  3UI2 A;  5FWQ A;  3JQ1 A;  3U9W A;  3T5V A;  4Z68 A;  1H0A A;  3LPZ A;  1N94 A;  3UTM A;  4HLL A;  3R9A B;  1SZ9 A;  5EDS A;  3CGH A;  2WVI A;  5CMW A;  4FA6 A;  3BEE A;  3CHP A;  4CRW A;  4ILG A;  5JHB A;  4I6G A;  4CYM D;  4A63 B;  4PS8 A;  5ENQ D;  2XRZ A;  3Q4A B;  1DVP A;  3FTZ A;  4JXT A;  3TWQ A;  2YHC A;  3PE4 A;  4ACL A;  4DX6 D;  1KZO A;  4DUI A;  4AEZ C;  4JZY A;  5KWD A;  4GZ6 A;  3ZYQ A;  4I2W A;  2PL2 A;  2ILR A;  5B3S E;  2IOL A;  1E8Z A;  1LTX A;  1MYO A;  3EUV A;  1KT1 A;  2DBA A;  4DI3 A;  3SFX A;  4TXR A;  3ZYK A;  4G2V A;  3FUD A;  2EIN E;  5ENT D;  3LYA A;  2I9C A;  5G05 J;  2OVB A;  5CCL A;  3E32 A;  1NI1 A;  1E7V A;  4EBA A;  2V8S E;  3EIQ C;  3TG4 A;  4DX5 D;  5BV0 A;  1SA5 A;  1YYH A;  3APD A;  2KAT A;  3QWW A;  2DVW A;  5FZR A;  4I1M A;  3S7J A;  5T3R A;  4HQD A;  2C2L A;  3FTW A;  2KM4 A;  4OVV A;  4HXI A;  3C72 A;  5KJN A;  3TWW A;  3AAA C;  3UMV A;  2F8Y A;  1SZA A;  3LVR E;  3D9O A;  5CBO A;  5CHE E;  2KCV A;  4EBA G;  1TNY A;  2VSX E;  3GZ1 A;  1YA0 A;  3ASD A;  3NQP A;  3V2X A;  4ANX A;  2ION A;  4HOU A;  2PNN A;  3Q7F A;  1S64 A;  1HG5 A;  3DEO A;  1NL4 A;  2VGE A;  2CHW A;  5EIB E;  2PM7 A;  2AVP A;  1BU9 A;  4NRH B;  2DYS E;  2P9U G;  3DRA A;  4GU5 A;  1ELW A;  4JW1 A;  2XGO A;  3QOU A;  3S7D A;  3Q79 A;  3TWU A;  4ANV A;  2P9P G;  4I17 A;  3MA5 A;  1H6P A;  4BSZ B;  3RU0 A;  3U64 A;  5JJT A;  2OCC E;  3CVP A;  2WXN A;  5LX8 A;  4CEM A;  3NAW A;  4B93 B;  5AN8 A;  3W9F A;  4TV3 A;  4U8Y D;  3ASN E;  4AOF A;  1HZ4 A;  2IQC A;  3ONL A;  5JHA A;  3FU6 A;  4L23 A;  1BI8 B;  4FLB A;  2AJA A;  5H7P A;  4TUU A;  3JQ0 A;  4MKT A;  4B89 A;  3TWX A;  4AVX A;  2AXZ A;  3UIO C;  4HI9 A;  3SBS A;  5G04 C;  3Q75 A;  2OEW A;  3DSW A;  1FT1 A;  1HE8 A;  3C3Q A;  4K03 A;  2C0L A;  2R02 A;  5E76 A;  3PZ2 A;  4MLP A;  4OVU A;  2PZI A;  3OTN A;  3AS4 A;  3ABL E;  3PEV B;  3PUK A;  1ZU2 A;  1EPU A;  2XS8 A;  1H6K A;  3PZD A;  5JMN D;  4GPK A;  3PNL B;  1MZC A;  3Q73 A;  2ETA A;  3DST A;  1EDU A;  3FUJ A;  3HYM B;  4FP7 A;  2KC7 A;  4DLO A;  1RZ4 A;  5BT1 A;  3RO2 A;  2XZD G;  3B7S A;  4PH4 B;  4JA7 A;  2ZIS A;  1TYQ G;  2BTD A;  3TXN A;  2XGS A;  4YDO A;  5ARF A;  1H6O A;  4QFV A;  1JWG A;  4BSX A;  2HE0 A;  3OXF A;  4J8D A;  1NZN A;  1N4S A;  4LEU A;  4J8E A;  5LFA A;  5FIO A;  5FZS A;  3CVW A;  5BUZ A;  4L1B A;  3CK9 A;  2FF4 A;  3B7T A;  3PRZ A;  4AV7 A;  1LD8 A;  4HB5 A;  1ZB1 A;  5BW8 C;  4BY6 A;  2V0P A;  4C9B B;  4GYO A;  2XPY A;  2P9N G;  3CK8 A;  2X38 A;  3TG5 A;  3DPD A;  3FH5 A;  4KVM A;  1NFI E;  3ZRH A;  5KNG A;  3SD5 A;  3B7U X;  4O60 A;  4UI9 C;  2VSN A;  2H6G A;  4HFG A;  5ENR D;  1FCH A;  2IEJ A;  3ULQ A;  2UY1 B;  4ATZ D;  5ENS D;  2ZU6 B;  1KT0 A;  3D9M A;  4GAA A;  2XZT G;  1X81 A;  1SW6 A;  2DWZ A;  2RG8 A;  4DK5 A;  3JXI A;  1XNF A;  1INZ A;  5ENP D;  2IF4 A;  4DX1 A;  3AJI A;  4L2Y A;  4P29 A;  4ATG A;  4KZ0 A;  2IU1 A;  4G8L A;  1DC2 A;  3FTY A;  3DEP A;  4HNA D;  4PS7 A;  5JJ6 A;  1E7U A;  4UQZ A;  4J8Y A;  2IFU A;  4YDY A;  2J8S D;  3LY8 A;  4FUL A;  4U8H A;  3L22 A;  1MHQ A;  2PQN A;  1OWL A;  2NSZ A;  2RFM A; 
#chains in the Genus database with same CATH homology
 5AN8 A;  3W9F A;  1YCS B;  3V2O A;  4O1P A;  4U8Y D;  2XEN A;  1YYH A;  4U8V D;  3UI2 A;  3B95 A;  5D66 A;  2BKK B;  2JAB A;  3EHR A;  5AAR A;  4Z68 A;  5CER B;  2DVW A;  4HB5 A;  4BES A;  3J5Q B;  2Y1L E;  3ZUV B;  4ZFH A;  4HQD A;  3NOC D;  5AQA A;  3UTM A;  4HLL A;  1BI8 B;  2AJA A;  1OT8 A;  2QYJ A;  2V5Q C;  1BLX B;  1K1B A;  4QQI A;  1BD8 A;  3TWV A;  5CBN A;  3Q9U C;  1S70 B;  1UOH A;  1K1A A;  1N11 A;  3TWT A;  3TWX A;  3TWW A;  1QYM A;  3AAA C;  2DZN A;  4DX2 A;  4HI9 A;  1IHB A;  2F8Y A;  5ITZ F;  2KBX A;  1MJ0 A;  1NFI E;  2ZGD A;  3HG0 D;  5CBO A;  3V79 K;  4U95 D;  4TUM A;  3W9G A;  4K5A B;  5KNG A;  2RFA A;  5EIL A;  4CYM D;  3ZU7 B;  4A63 B;  5ENQ D;  1WG0 A;  1IXV A;  1MX6 A;  4K5C A;  4O60 A;  3T8K A;  3EHQ A;  5ENR D;  2FO1 E;  4RLY A;  4BEP A;  4LSZ E;  2F37 A;  3SO8 A;  2ZGG A;  1BI7 B;  4K5B A;  4NIK A;  3TWQ A;  3TWR A;  1D9S A;  4ATZ D;  4LG6 A;  3D9H A;  4J7W A;  5HRY A;  5ENS D;  5ENO D;  4YDW A;  5EYL A;  3V2X A;  2ETC A;  1OY3 D;  3ZKJ A;  3C5R A;  2XZT G;  1N0R A;  5AQ7 A;  2PNN A;  4F6R D;  3V31 A;  4OAU C;  1SW6 A;  1G3N B;  3DEO A;  4DX6 D;  1YMP A;  2DWZ A;  2NYJ A;  2VGE A;  4GPM A;  1DCQ A;  4HBD A;  3UXG A;  5JMN D;  5CEC B;  3NBN B;  2QC9 A;  5FIN A;  4DUI A;  3JXI A;  1N0Q A;  5KWD A;  1K3Z D;  3KEA A;  5EIB E;  2ETA A;  5ENP D;  2ETB A;  3B7B A;  1BU9 A;  4BER A;  2DZO A;  4UUC A;  2KXP C;  3Q9N C;  4DX1 A;  3AJI A;  2MYO A;  3LJN A;  1AP7 A;  2V4H C;  3TWS A;  1MYO A;  2B0O E;  4DRX E;  2XZD G;  5CED B;  4O1O A;  2A5E A;  4GMR A;  1A5E A;  2P2C P;  3IXE A;  4HI8 A;  5EID A;  2BKG A;  5KNH D;  4DX7 D;  4HRN A;  5EYP F;  3TWU A;  4G8L A;  2XEH A;  2F8X K;  5ENT D;  4ZHB A;  1DC2 A;  5KBA A;  3HRA A;  5AQ9 A;  4JB8 P;  4U96 D;  5HS0 A;  5JA4 D;  1WDY A;  1MX2 A;  4BSZ B;  4C48 B;  3V30 A;  5BXU A;  3ZNG A;  3DEP A;  4HNA D;  3JUE A;  4G8K A;  4N5Q A;  3NOG D;  4OAV B;  5BXO A;  3JXJ A;  4QFV A;  4BET A;  1AWC B;  1IKN D;  4J8Y A;  5AQB A;  5HKP A;  3EU9 A;  4F1P A;  3F6Q A;  4YDY A;  5AAO A;  4LNU D;  2HE0 A;  2J8S D;  3J5P A;  1TR4 A;  3T9K A;  2XEE A;  4HRL A;  5CEA A;  2Y0B G;  1MX4 A;  4DX5 D;  4HRM B;  1SVX A;  5FIO A;  2L6B A;  5EN5 D;  2RFM A;  4B93 B;  4CZ2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...