4O7HA

Crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
222
structure length
222
Chain Sequence
MRRLYHHGLSPAARKVRVALAEKRLDYEAVIEETWIRNESFLAMNPEGEVPVLVEADGLTITDGWAICEYLEEVYPEPSLLGGPAAMRAEVRRLVAWFDRKFNREVTEPLVREKLLKRVISGGAPDSRQIRAGRANVHTHLRYISWLIDRRRWLAGDMLTYADITAACHLSLIDYAGDVPWEDHPQAKEWYALVKSRPSFRPLLTETISPIRPPRHYADLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a glutathione S-transferase from Rhodospirillum rubrum F11, Target EFI-507460
rcsb
source organism Rhodospirillum rubrum f11
molecule tags Transferase
molecule keywords Glutathione S-transferase
total genus 92
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4o7hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4o7hA01
3MDKA 1OC3A 5G2ZA 4MZBA 4AJ8A 2TRXA 4K0GA 1AAZA 1E2YA 3TDGA 1T4YA 1VF4A 2B7JA 2O87A 3US3A 1F2EA 1GLPA 4MJEA 1TP9A 1Q4JA 4NWYA 5G5EA 4XS1A 5G30A 3TKQA 5COHA 3DVXA 4I6XA 2RLIA 4MF6A 4K7NA 4TXOA 3GRXA 4JU5A 3RHCA 2BMXA 4TRXA 1G6WA 4DVCA 4DSQA 2V2GA 4OCFA 4F0CA 2X8CA 5F07A 1M9BA 2AUVA 2H8LA 5DQYA 2HSMB 4HUAA 3APQA 1HNAA 5ECIB 1M2AA 1T4ZA 3PGTA 2H73A 2YJ7A 3IA1A 4MPGA 3PH9A 1B9XC 1A0RP 4PX1A 2GSRA 4KX4A 5IOXA 3M9KA 3AY8A 5HFKA 1PMTA 2L6CA 2OBIA 1F3AA 1SK2A 3VK9A 4QL7A 2NBSA 5CRGA 4OFNA 3LFLA 3CMIA 3DD3A 3VPTA 4K7IA 5DVBA 2X8HA 2VCXA 4O32A 5ABRA 1OKDA 2GT6A 1GSFA 1SKRB 2GSSA 4MZCA 2L4QA 4K9ZA 3GYKA 5J41A 3FZ4A 1AXDA 3F3RA 1SYXA 4WBRD 4K6XA 1T1VA 1SKSB 2RUEA 4KF9A 2HZEA 17GSA 1FB6A 3L4NA 2YJHA 3D0ZA 2VIMA 1E6BA 2GSTA 1GP1A 2GVPA 2IMEA 4MH3A 4WR5A 1B8XA 1T3BA 5ECSA 1JLVA 1FHEA 2FHEA 1O8WA 3Q74A 2E0QA 4OMVA 1PKWA 3LGCA 2I1UA 1TDIA 1ZYEA 2MMAA 3O6TA 1DUGA 1K0AA 2N5FA 2LUSA 4KDXA 4XS6A 4D73A 2UZ8A 3HA9A 2OACA 4FYUA 4IGJA 5IMZA 1UVZA 3VI5A 1A2JA 3DMLA 2R3XA 1ZCPA 4F82A 1R5PA 3QFBC 2JACA 2X64A 13GSA 2TIRA 2GQMA 5IQYA 2GSQA 4L0WA 4KSOA 4TR1A 4EF0A 4EDYA 3IC8A 1BYEA 5F8BA 1NW2A 5ID2B 2QC7A 2DMLA 2QGVA 4EDZA 3EE2A 3FR3A 1B4PA 3BCKA 5AGYA 1EGRA 1WWJA 4IBPA 3FY7A 5KEJA 1ON4A 2XC2A 3HJOA 4MDCA 1PD21 2AJQB 1GUKA 3L78A 3D4TA 3CSHA 4PNGA 1XW5A 2K8SA 3R2QA 2M72A 1FW1A 4JRRA 5IMVA 3ZYWA 2VLTA 1ERUA 5IPGA 1DBYA 3KJYA 1AQWA 1X0RA 2V1MA 2V32A 2VCZA 4EXJA 5DCGA 4NV5A 2DJ3A 3GHAA 1GSEA 1RK4A 1YF0A 1SK1A 1GUMA 4NAXA 3KP8A 2H0IA 3HYPA 4N0ZA 4OWYA 2VD1A 1H4OA 4ZL9A 4JR6A 4N30A 3BCIA 1JZWA 1IYIA 1G7OA 4IHUA 2VM2A 3L0HA 3EC3A 3HKRA 2HXKA 2B1LA 2NPBA 2G0FA 1N2AA 3J7Yk 4OO5A 3TRXA 5KN0A 1GSDA 3RPPA 3GH6A 3GL3A 3RAZA 3O76A 2K8VA 3RDWA 2Z9SA 2MMOA 2B1KA 4ZBDA 4IKHA 2C0GA 4E8EA 2MMZA 5ENUA 2A4VA 5DALB 2H72A 4I97A 4F9ZA 2HRFA 4XHMA 7GSSA 5IPHA 4G2EA 3IAS2 1JZRA 2OBKA 2CZ3A 6GSUA 1QK8A 2C80A 5CREA 3QOUA 1GRXA 19GSA 1XW6A 1FO5A 2H1AA 2YWOA 2DIYA 3W8SA 1SK0A 1SJZA 2E2GA 4KNDA 1UC7A 2FD3A 2QKEA 3VPQA 3GTUA 1TK8B 5ID2A 3TJFA 4XTSA 2O8VB 3F4RA 3GTUB 4POLA 1I5GA 2KP1A 3EINA 3GKNA 2R2JA 2EIQA 3O3TA 1LJRA 2IIYA 3F8UA 1O81A 1U88A 3N9JA 1WP0A 1HNCA 5CYYA 2XBIA 4K1FA 5HR3A 3G9BA 4XRDA 1WMJA 3GSTA 1MDIA 2VD0A 3EMXA 4H86A 1F37A 2NDOA 4F03A 2N5BA 3PPUA 1VF2A 4ECBA 2ON7A 1URMA 5HR1A 2CT6A 3MAKA 5A4UA 3FZ9A 1T8EB 4V1Ap 5ELAA 3U6VA 4EUYA 4G0LA 4WETA 1TI3A 5J4UA 2IWTA 5JWRB 4OO4A 4K7OA 1CQHA 1HQOA 2ZUPA 3DVWA 5ECPB 2LJKA 4HEA2 3TGZA 3LJRA 1O6JA 2YWMA 4TOPA 1W89A 4GRFA 3LXTA 3UBLA 4ECJA 2VUPA 2HSMA 5DAKA 3LG6A 5JWQB 3LXZA 1PA3A 3GX8A 3KTBA 4MJCA 2WJUA 2KUCA 4G0KA 4GTUA 3D4MA 3ZL5A 3EVIA 1FAAA 4BA7A 1BQ7A 3KCMA 2C1YA 3ZLPA 1F6MC 1AW9A 1XCCA 3G7YA 1A8YA 1VGLA 3HZ8A 2DJ0A 3ZITA 2PMTA 4YQMA 1SD8A 2REMA 2DSAA 2CVBA 4LMWA 4MP4A 2PPTA 3C1RA 1TRWA 4YAVA 2X8GA 2VCQA 2GZYA 4MJAA 5D8IA 3D5JA 2WDUA 1TRSA 3HXSA 4J56E 1V9WA 4ZL7A 4RI6A 1TJDA 1LU4A 2DJKA 1X9MB 4TN8A 2HLSA 3TKPA 5CP1A 2J9HA 2C0DA 1IYHA 2YPMA 5JCWA 1XOBA 4BVYB 12GSA 5F0GA 2K18A 1TK5B 5A4WA 5ECOB 2N5AA 3FW2A 4I8BA 2LRCA 3D6IA 2IFQA 3TJJA 1JLWA 2F8FA 4RQRA 3LSZA 2P5QA 1K3LA 2H0GA 1OYJA 5DCHA 3IC4A 1AQXA 1ABAA 4Q5QA 4GCIA 2H75A 1YKAA 4HOJA 1W4VA 3C1SA 3LWAA 3DKSA 4CHSA 1X5EA 4N11A 4DEJA 3WGXA 1B9YC 2KLXA 3ZIVA 4DSSB 3CSJA 3G7JA 1ILOA 1PX6A 2F3MA 1ZZYA 3KZQA 4LL1B 3ZMKA 4MK3A 2R37A 1ACVA 4TR0A 4XCSA 4MF5A 4ZB9A 4TR3A 3P2AA 1SJ6A 4KDYA 3SBCA 2HQTA 3ZIJA 1FOVA 4MH2A 3F0IA 2OA7A 4ZILA 2XHFA 3FHKA 2HFDA 3QCPA 5J9BA 2GTUA 2LV3A 1XW9A 2HSYA 4EL1A 3ZRDA 3W8JA 11GSA 4E8HA 3UOMA 5HR2A 4RQXA 1Y25A 1GTIA 5IMCA 4PUFC 5EVOA 2I9HA 2LQOA 2VL9A 4KDUA 3M0FA 1GULA 1UN2A 3IR4A 1A23A 2VCTA 3RPNA 1FVKA 1A8LA 2YZHA 2O7KA 2IMKA 1NHYA 3KGKA 4RI7A 1EP8A 3UMAA 3TB2A 2PVQA 3I6AA 5AIVA 4BWQA 4IS0A 2HRNA 4ACSA 4KH7A 4MLYA 1XFLA 3LYKA 2H19A 4TW5A 4HU7A 1Z9HA 1HYUA 2JADA 1K3YA 2GS3A 3KD0A 3KMNA 2VL2C 3WT2A 3GKKA 2AHEA 2XPDA 3KTLA 4PQ1A 4HQSA 2IMDA 1EP7A 2C3TA 1NSWA 3PR8A 1XIYA 1LBKA 5FWGA 2FWFA 1N8JA 1PRXA 3IV4A 4JBBA 1XOAA 3QDNA 3HDCA 5AISA 6GSTA 5G1KA 2R4VA 3H4KA 5GAPD 1YY7A 2WB9A 1EEJA 5B8AA 2OE0A 2H1BA 3E3EA 3EU4A 2VCVA 3FEUA 4HI7A 2JZSA 5H5QA 1YEPA 5CRHA 2C3NA 3HJMA 2HZFA 4LMVA 3F9UA 4BVYA 2BTOT 2EIRA 1BAYA 2RM6A 5J9CA 1FG4A 1GNEA 3APOA 1BG5A 3D21A 2AYTA 1OC8A 5G5FA 2F8AA 3CXGA 2H1DA 3DYRA 3KH7A 3D22A 1X5DA 4ISDA 2H6ZA 1MDKA 4AF2A 1EZKA 5IMDA 4LLRA 2F9SA 4NHWA 1KNGA 2CQ9A 1TRVA 1YJ6A 2B7KA 4LA1A 1Q98A 1R5AA 3FZAA 4ZXGA 3BD2A 2PGTA 3GFKA 1ZYQB 2OJLA 3Q19A 1Y6EA 1TKDB 3ERGA 1J9BA 3MWHA 4KA0A 2CAQA 4K8MA 2OKAA 1O7UA 2MBTA 6GSXA 1PN9A 1GH2A 1U3AA 1SL0B 3ZZXA 2HYXA 5ECKB 2P5RA 4OCEA 2A2RA 3E0UA 3LORA 5D9VA 4V2NA 4YH2A 2JSYA 1QQ2A 1EWXA 3MSZA 4JE1A 2ALBA 4EC0A 3HVSA 4WXTA 3J7Yb 1Z7PA 5INYA 2H74A 3TKSA 3A2VA 3TKSE 4J57E 4MPFA 2V6OA 3F4TA 1J08A 5J3RA 2P31A 1V98A 1A24A 3QMXA 2K6VA 1EV9A 1RQMA 2DJ2A 1ZGNA 2J23A 3GN3A 3ZVJA 2JZTA 3VWUA 4FO5A 4HJMA 2GQKA 2H1GA 5KN1A 1G7EA 3GSSA 3EU3A 4IP1A 5H5RA 4DSRA 1AQVA 2VL3A 1VF3A 1O8XA 2BJXA 2YANA 5IO2A 2WRTA 2VL2A 1AUCA 2C0EA 2B5XA 4NMUA 4N10A 3KH9A 3A2WA 4TXOB 1JFUA 2B5YA 4OFMA 3C71A 2DJ1A 1DE2A 5GSSA 5E4WA 1GSSA 4WF5A 14GSA 2JU5A 10GSA 4PQHA 2G2QA 5ECLB 2GDRA 4GSNA 3VWWA 2FWEA 2HRAA 3UEMA 4ZIJA 5JCGA 3S9FA 3VFIA 2YWIA 3F63A 1TK0B 2DC5A 2DBCA 5A4VA 3VI7A 2YN1A 3QAGA 1PL1A 2MBSA 4WR4A 3GUSA 2C3QA 4BWSA 2X99A 1G0TA 2KOKA 3IK7A 4ZBBA 3KEBA 2L5LA 4CW9A 4PGTA 1H75A 2DMMA 5AN1A 3CTGA 5CNWA 2R6KA 1HD2A 4X1UA 2DLXA 2XBQA 3UVHA 1OC9A 4ID0A 2JSZA 5IMAA 3TOUA 1GSQA 1PKZA 3ME8A 18GSA 3PINA 3TOTA 4D73B 4GQFA 3UJ1A 3NZNA 3H8QA 1TOFA 1K0NA 1F9MA 2ZCTA 4I5QA 5B7CA 2HNLA 5BMUA 16GSA 3HCZA 1GTBA 3H79A 2YV7A 3U5RE 3A5WA 1MD3A 1PGTA 2ES7A 4Q5RA 1M2DA 4OFTA 5G31A 4BL7A 1PQNA 3FKFA 9GSSA 1O73A 1VRSD 4EO3A 1K0BA 3FK8A 5E59A 3CBUA 3W6GA 4POBA 3QR6A 3QPMA 4ZBAA 3ME7A 1JHBA 4ILFA 2H6XA 20GSA 4BL7B 3QD9A 1ST9A 4RUVA 2LQQA 4ZB8A 4ECCA 1A0FA 2AB6A 3BOAA 4GF0A 2CX3A 4XS4B 1EOHA 5IOWA 5GAND 2LJAA 3N5OA 2C4JA 4N0VA 4F0BA 3ZMLA 3WGEA 3KM6A 1Z5YE 4FH8A 5ECQB 1JZDA 2EIOA 3ZREA 2HRKA 3CSIA 2GZPA 4XS4A 6GSYA 5B6MA 1BJXA 5ECNB 4K2DA 5DAKB 3JCML 1QUWA 3LEFA 2GZZA 4IJIA 1WOUA 2VOCA 2H70A 1V57A 5D93A 1R4WA 3EURA 4KB3A 4MMMA 1RW1A 3KMOA 1EV4A 5ECRB 4ML1A 2NVLA 1UA5A 3GV1A 3RHBA 3TCOA 2JZRA 4EE0A 2H66A 1ERVA 5DJMA 3IAM2 2RIIA 2HI7A 5EY6A 2I81A 4POMA 1GNWA 3FRCA 2GT5A 3ED3A 3F4SA 1WRYA 4AGSA 5D9WA 3V1WA 3CYNA 4FQUA 3WGDA 3GMFA 3GA4A 2CA8A 5C00A 2E2MA 4PUAA 2LRNA 2PN8A 1OKTA 4L8EA 6GSWA 3NIVA 4POKA 2RUFA 1SD9A 1K3OA 2LRTA 1SL2B 1M0UA 1WPIA 3EWLA 3QFAC 3TJKA 4KAEA 2I4AA 3IOSA 4PXOA 1V58A 4FYBA 4IN0A 4KUNA 2F51A 3IHQA 1ERTA 1J0FA 3F6FA 2VLVA 1GWCA 3FR6A 6GSSA 1M7TA 4I2TA 3TRQA 3M3MA 4KGIA 1MTCA 2O89A 1TI1A 1DE1A 3GH9A 2H6YA 1YDKA 2O85A 2LNTA 5D9XA 4TXVA 1ML6A 3VURA 3HHVA 1HNBA 2B6MA 3DRNA 4YAPA 3TUEA 1QXHA 1FVJA 1OAZA 3FR9A 4ZB6A 2HRKB 1SL1B 1WE0A 4JEDA 4USSA 3KXOA 4Q5FA 4IP6A 4Z7XA 1Z6NA 4BPYA 5DALA 2YP6A 1AC1A 2IPAA 2FNOA 4MF7A 1THXA 2EC4A 5CO3A 4LL4B 3BBYA 2YZUA 4GQCA 1T00A 5LNKe 1CQGA 1C72A 1GSUA 3ISOA 4IVFA 1B4QA 3IK9A 1EEMA 4PNFA 2M80A 5LCZA 1XWKA 3HD5A 1KTEA 2GQLA 5L71A 2R5GA 2HSNB 2K9FA 3KIJA 3DGQA 3G7IA 2H01A 2E7PA 2VCWA 3A2XA 4NV2A 2ON5A 2PWJA 2HT9A 1TW9A 2LSTA 1SYRA 4ECIA 1B48A 1USBA 5FHIA 3RBTA 1V40A 4O92A 5HFGA 3FYGA 2D2ZA 1OE7A 4MA9A 5CRDA 1TU8A 5J5NA 1BX9A 1U6TA 4KSMA 3MNGA 2KP2A 2IJYA 1I9DA 2OADA 3IXRA 1EGOA 4TVEA 4V2LA 2IFQB 1XBSA 1SENA 4AJ6A 2LEGA 8GSSA 5A5KA 1Z6MA 5ECMB 1X9SB 4YQVA 2V6KA 2L4CA 3ZFLA 4GSSA 4O5RA 3P90A 4EKZA 2JL4A 1GSYA 4QL9A 2VO4A 2FWGA 3CRTA 4IQAA 3BJ5A 1GLQA 5EPFA 3NOFA 2LKUA 2FWHA 1GUHA 3UIWA 3DWVA 1A2MA 4OD7A 3ZTLA 1G6YA 2HZEB 2LS5A 4G0IA 1U3IA 4IW9A 2L5OA 1U87A 4V2MA 3P8WA 4HS1A 3A3TA 4L0UA 4TR4A 3R3EA 3C8EA 1X5CA 4Q5NA 2M46A 2WULA 3VLNA 2P0GA 3VWVA 3DEXA 4ULXA 5DQSA 2PBJA 4J2FA 4F2IA 4MZWA 4X43A 4HQZA 4KCAA 5GZZB 3FZ5A 2NTOA 1YZXA 1KEBA 3EYTA 4ZL8A 2FCHA 2CVKA 4WEYA 1MEKA 3I43A 1YQ1A 3C7MA 5D73A 3CTFA 4NXIA 1PX7A 4G19A 3F6DA 2DIZA 3SWLA 2VM1A 1F3BA 1PSQA 2QSIA 3H93A 2C8UA 2MYGA 1QMVA 5HFIA 1OVNA 3GURA 4XIHA 2VAFA 4HU9A 2YWNA 2HSHA 2LNSA 5IM9A 2OE1A 1T7PB 2B5EA 4EVMA 4QQ7A 4NHZA 4G10A 1PL2A 3I9V2 2WFCA 3M9JA 1TU7A 2FY6A 5C04A 3ERWA 4WF4A 1M9AA 2A2SA 1K0MA 1XPVA 1QGVA 1XWBA 5KN2A 2DJJA 2YNXA 2IMIA 1R26A 2WS2A 5DDLA 4TR1B 5IMFA 4GXZA 3GNJA 3TJGA 4BVXB 2WZ9A 1QFNA 1YKCA 1R7HA 2H0HA 2WGRA 2XPEA 2HE3A 1YF1A 1ERWA 2OE3A 3L9SA 1GL8A 1GTUA 2FA8A 2L6DA 5H5SA 2H30A 4PTSA 4WKWA 4FIWA 3APSA 1OE8A 3DXBA 6GSVA 3P7XA 3UBKA 5GSTA 1S3CA 3HJPA 1XVQA 4L5LA 3UARA 3GIXA 5IO0A 2CV4A 4JR4A 1WJKA 5FT3A 4HZ2A 4KCEA 3ZFBA 1M99A 3M1GA 1XXUA 1S3AA 3KP9A 3GKMA 2IL3A 1TTZA 4HZ4A 3TKRA 3F3QA 2LTKA 4G9HA 3EMPA 4O7HA 2B3SA 1THOA 3WD6A 4V1Ag 3UAPA 4MCUA 3HVXA 3UL3A 1JZOA 5JWOB 5F05A 2GLRA 2KHPA 1NM3A 5JCUA 2FUG2 1SJIA 1ZOFA 4MJBA 4IJ3A 2CAIA 3LQ7A 1XWCA 2CVDA 1OC9B 1K0CA 2C0FA 4YQUA 3ERFA 5DJLA 1MDJA 3TJBA 2YCDA 5ECHB 3L9VA 3M8NA 3TKSC 4HJ2A 5D9TA 4I2UA 4L5OA 3VWXA 5HR0A 5G1LA 4X0XA 1O85A 4GSTA 3I69A 1ZMAA 4JZQA 4MABA 1M2BA 5CRWA 3HVVA 2MZCA 2AAWA 4NPBA 2I3YA 2VLUA 3C73A 2RM5A 4KW6A 5B8BA 3GX0A 3HZ4A 2H76A 4TKYA 3Q6OA 5KN3A 3IDVA 3K8NA 3Q18A 2AV4A 4XRAA 1GTAA 4P3YB 5B6NA 2TRCP 1K0DA 2WCIA 2FLSA 4K0NA 3IE3A 2H71A 1XWGA 3HY2A 5CAXA 1NHOA 4KE3A 3LYPA 2PU9C 5LD0A 4BVXA 3GKXA 3IPZA 4PURA 1SU9A 3DIEA 3GL5A 4AJ7A 3L9UA 3QAWA 3QAVA 1TXXA 5ELGA 4ML6A 4HDEA 1XWAA 1WIKA 1Z3EA 3ZVJD 3IBHA 4PQIA 2PERA 2YV9A 3E9JB 4IQ1A 2L59A 2PVOC 4WBJA 4GWRA 4DSSA 2MMNA 2CX4A 5DBQA 4IELA 3IRAA 5D96A 5AIXA 5F06A 1SKWB 5HQPA 2FGXA 1A2LA 1V2AA 3OR5A 2IN3A 1BEDA 2IMFA 3TRPA 2LJRA 3H1NA 1ZL9A 2V41A 1K0OA 1DSBA 1EOGA 1Z7RA 3CRUA 2L57A 3UVTA 1YEXA 3WT1A 1FB0A 1AIUA 1S3DA 2GGTA 22GSA 3WYWA 1MD4A 1XVWA 2CZ2A 2ZNMA 5EL8A 1VF1A 1X9WB 1TRUA 1KBNA 4GLTA 4FYCA 2PUKC 1XZOA 2YOIA 4CDOA 2FA4A 5IIZA
chains in the Genus database with same CATH superfamily
3MDKA 1OC3A 5G2ZA 4MZBA 4AJ8A 2TRXA 4K0GA 1AAZA 1E2YA 3TDGA 1T4YA 1VF4A 5KOWA 2B7JA 2O87A 3US3A 1F2EA 1GLPA 4MJEA 1TP9A 1Q4JA 4NWYA 5G5EA 4XS1A 5G30A 3TKQA 5COHA 3DVXA 4I6XA 2RLIA 4MF6A 4K7NA 4TXOA 3GRXA 4JU5A 3RHCA 2BMXA 4TRXA 1S3RA 1G6WA 4DVCA 4DSQA 2V2GA 4OCFA 4F0CA 1M3IA 2X8CA 5F07A 1M9BA 2AUVA 2H8LA 5DQYA 2HSMB 4HUAA 3APQA 1HNAA 5A5HA 5ECIB 1M2AA 1T4ZA 3PGTA 2H73A 2YJ7A 3IA1A 4MPGA 3PH9A 1B9XC 1A0RP 4PX1A 2GSRA 4KX4A 5IOXA 3M9KA 3AY8A 5HFKA 1PMTA 2L6CA 2OBIA 1F3AA 1SK2A 3VK9A 4QL7A 1N25A 2NBSA 5CRGA 4OFNA 3LFLA 3CMIA 3DD3A 3VPTA 4K7IA 5DVBA 2X8HA 2VCXA 4O32A 5ABRA 1M3JA 4FXYP 1OKDA 2GT6A 1GSFA 1SKRB 2GSSA 4MZCA 2L4QA 4K9ZA 3GYKA 5J41A 3FZ4A 1AXDA 3F3RA 1SYXA 4WBRD 4K6XA 1T1VA 1SKSB 2RUEA 4KF9A 2HZEA 17GSA 1FB6A 3L4NA 2YJHA 3D0ZA 2VIMA 1E6BA 2GSTA 1GP1A 2GVPA 2IMEA 4MH3A 4WR5A 1B8XA 1T3BA 5ECSA 1JLVA 1FHEA 2FHEA 1O8WA 3Q74A 2E0QA 4OMVA 1PKWA 3LGCA 2I1UA 1TDIA 1ZYEA 2MMAA 3O6TA 1DUGA 1K0AA 2N5FA 2O5VA 2LUSA 4KDXA 4XS6A 4D73A 2UZ8A 3HA9A 2OACA 4FYUA 4IGJA 5J47A 5IMZA 1UVZA 3DMLA 3VI5A 1A2JA 2R3XA 1ZCPA 4A5PA 4F82A 1R5PA 3QFBC 2JACA 2X64A 13GSA 2TIRA 2GQMA 5IQYA 2GSQA 4L0WA 1ZYNA 4KSOA 4TR1A 4EF0A 4EDYA 4AI6A 3IC8A 1BYEA 5F8BA 1NW2A 5ID2B 2QC7A 2DMLA 2QGVA 4EDZA 3EE2A 3FR3A 1B4PA 3BCKA 5AGYA 1EGRA 4O5UA 1WWJA 4IBPA 3FY7A 5KEJA 1ON4A 2XC2A 2WW1A 3HJOA 4MDCA 1PD21 2AJQB 1GUKA 3EPTA 3L78A 3D4TA 3CSHA 4PNGA 1XW5A 2K8SA 3R2QA 2M72A 1FW1A 4JRRA 5IMVA 3ZYWA 2VLTA 1ERUA 5IPGA 3MYDA 1DBYA 3KJYA 1AQWA 1X0RA 2V1MA 2V32A 2VCZA 4EXJA 5DCGA 4QMKA 4NV5A 2DJ3A 3GHAA 1GSEA 1RK4A 1YF0A 1SK1A 1GUMA 4NAXA 3KP8A 1PFOA 2H0IA 3HYPA 4N0ZA 4OWYA 2VD1A 4YKGA 1H4OA 4ZL9A 4JR6A 4N30A 3BCIA 1YVLA 1JZWA 3LW9A 1IYIA 1G7OA 4IHUA 2VM2A 3L0HA 3EC3A 3HKRA 2HXKA 2B1LA 2NPBA 2G0FA 1N2AA 3J7Yk 4OO5A 3TRXA 5KN0A 1GSDA 3RPPA 3GH6A 2WVZA 4AKIA 3GL3A 3RAZA 3O76A 2K8VA 3RDWA 2Z9SA 2MMOA 2B1KA 4ZBDA 4IKHA 2C0GA 4E8EA 2MMZA 5ENUA 2A4VA 2EFDA 5DALB 2H72A 4I97A 4F9ZA 2HRFA 4XHMA 7GSSA 5IPHA 4G2EA 3IAS2 1JZRA 2OBKA 2CZ3A 6GSUA 1QK8A 2C80A 5CREA 3QOUA 1GRXA 19GSA 1XW6A 1FO5A 2H1AA 2YWOA 2DIYA 3W8SA 1SK0A 1SJZA 2E2GA 4KNDA 1SVMA 1UC7A 2FD3A 2QKEA 3VPQA 1S4BP 3GTUA 1TK8B 5ID2A 3TJFA 4XTSA 2O8VB 3F4RA 3GTUB 4POLA 1I5GA 2KP1A 3EINA 3GKNA 2R2JA 2EIQA 3O3TA 1LJRA 2IIYA 3F8UA 1O81A 1U88A 3N9JA 1WP0A 1HNCA 5CYYA 2XBIA 4K1FA 5HR3A 3G9BA 4XRDA 1WMJA 3GSTA 5A1NA 1MDIA 2VD0A 3EMXA 4H86A 1F37A 2NDOA 4F03A 2N5BA 3PPUA 1VF2A 4ECBA 2ON7A 1URMA 5HR1A 2CT6A 2WW0A 3MAKA 5A4UA 3FZ9A 1T8EB 4V1Ap 5ELAA 3U6VA 4EUYA 4G0LA 4WETA 1TI3A 5J4UA 2IWTA 5JWRB 4OO4A 4K7OA 1CQHA 1HQOA 2ZUPA 3DVWA 5ECPB 2H1LA 2LJKA 4HEA2 3TGZA 3LJRA 1O6JA 2YWMA 4TOPA 1W89A 4GRFA 3LXTA 3UBLA 2O36A 4ECJA 2VUPA 2HSMA 5DAKA 3LG6A 5JWQB 3LXZA 1PA3A 2R0CA 3GX8A 3KTBA 4MJCA 2WJUA 2KUCA 4G0KA 4GTUA 3D4MA 3ZL5A 3EVIA 1FAAA 4BA7A 1BQ7A 3KCMA 2C1YA 3ZLPA 1F6MC 1AW9A 3MIXA 1XG8A 1XCCA 3G7YA 1A8YA 1VGLA 3HZ8A 2DJ0A 3ZITA 2PMTA 4YQMA 1SD8A 2REMA 2DSAA 2CVBA 4LMWA 4MP4A 2PPTA 3C1RA 1TRWA 4YAVA 2X8GA 2VCQA 2GZYA 4PI2C 4MJAA 5D8IA 3D5JA 2WDUA 1TRSA 3HXSA 4BIKA 4J56E 1V9WA 4ZL7A 2QA1A 4RI6A 1TJDA 1LU4A 2DJKA 1X9MB 4TN8A 2HLSA 3TKPA 5CP1A 2DKHA 2J9HA 2C0DA 1IYHA 2YPMA 5JCWA 3RFRC 1XOBA 4BVYB 12GSA 5F0GA 2K18A 1TK5B 5A4WA 5ECOB 2N5AA 3FW2A 4I8BA 2LRCA 3D6IA 2IFQA 3TJJA 1JLWA 2F8FA 4RQRA 3LSZA 2P5QA 1K3LA 2H0GA 2R0GA 1OYJA 5DCHA 5J4YA 3IC4A 1AQXA 1ABAA 4Q5QA 4GCIA 2H75A 1YKAA 4HOJA 1W4VA 3C1SA 3LWAA 3DKSA 4CHSA 1X5EA 4N11A 4DEJA 3WGXA 1B9YC 2KLXA 3ZIVA 4DSSB 3CSJA 3G7JA 1ILOA 1PX6A 2F3MA 2X4AA 1ZZYA 3KZQA 4LL1B 3ZMKA 4MK3A 2R37A 1ACVA 4TR0A 4N3ZA 4XCSA 4MF5A 4ZB9A 4TR3A 3P2AA 1SJ6A 4KDYA 3SBCA 2HQTA 3ZIJA 1FOVA 4MH2A 3F0IA 2OA7A 4ZILA 2XHFA 3FHKA 2HFDA 3QCPA 4EIPA 5J9BA 2GTUA 2LV3A 1XW9A 2HSYA 4EL1A 3ZRDA 3W8JA 11GSA 4E8HA 3UOMA 5HR2A 4RQXA 1Y25A 1GTIA 5IMCA 4PUFC 5EVOA 2I9HA 2LQOA 2VL9A 4KDUA 3M0FA 1GULA 1UN2A 3IR4A 1A23A 2VCTA 3RPNA 1TXUA 1FVKA 1A8LA 2YZHA 2O7KA 2IMKA 1NHYA 3KGKA 4RI7A 1EP8A 3UMAA 3TB2A 2PVQA 3I6AA 5AIVA 4BWQA 4IS0A 1I1IP 2A4HA 2HRNA 4ACSA 4KH7A 4MLYA 1XFLA 3LYKA 2H19A 4TW5A 4HU7A 1Z9HA 1HYUA 3HVNA 2JADA 1K3YA 2GS3A 3KD0A 3KMNA 2VL2C 3WT2A 3GKKA 2AHEA 2XPDA 3KTLA 4PQ1A 4HQSA 2IMDA 1EP7A 2C3TA 1NSWA 3PR8A 1XIYA 1LBKA 5FWGA 2FWFA 1N8JA 1PRXA 2EFEA 3IV4A 4JBBA 1XOAA 3QDNA 3HDCA 5AISA 6GSTA 5G1KA 2R4VA 3H4KA 5GAPD 1YY7A 2WB9A 1EEJA 5B8AA 2OE0A 2H1BA 3E3EA 3EU4A 2VCVA 3FEUA 4HI7A 2JZSA 2WW3A 5H5QA 1YEPA 5CRHA 2C3NA 3HJMA 2HZFA 4LMVA 3F9UA 4W66A 4BVYA 4PHZC 2BTOT 2EIRA 1BAYA 2RM6A 5J9CA 1FG4A 1GNEA 3APOA 1BG5A 3D21A 2AYTA 1OC8A 5G5FA 2F8AA 3CXGA 2H1DA 3DYRA 3KH7A 3IHGA 3D22A 1X5DA 4ISDA 2H6ZA 1MDKA 4AF2A 1EZKA 5IMDA 4LLRA 2F9SA 4NHWA 1KNGA 2CQ9A 1TRVA 1YJ6A 4AKHA 2B7KA 4LA1A 1Q98A 1R5AA 3FZAA 4ZXGA 4ICYA 3BD2A 2PGTA 3GFKA 1ZYQB 2OJLA 3Q19A 1Y6EA 1TKDB 3ERGA 1J9BA 3MWHA 4KA0A 2CAQA 4K8MA 2OKAA 1O7UA 2MBTA 6GSXA 1PN9A 1GH2A 1U3AA 1SL0B 3ZZXA 2HYXA 5ECKB 2P5RA 4OCEA 2A2RA 3E0UA 3LORA 5D9VA 4V2NA 4YH2A 2JSYA 1QQ2A 1EWXA 3MSZA 5BRTA 4JE1A 2ALBA 4EC0A 3HVSA 4WXTA 3J7Yb 1Z7PA 5INYA 2H74A 3TKSA 3A2VA 3TKSE 4J57E 4MPFA 2V6OA 3F4TA 1J08A 5J3RA 2P31A 1V98A 1A24A 3QMXA 2K6VA 1EV9A 1RQMA 2DJ2A 4PI0C 1ZGNA 2J23A 3GN3A 3ZVJA 2JZTA 3VWUA 4FO5A 4HJMA 2GQKA 2H1GA 5KN1A 1G7EA 3GSSA 3EU3A 4IP1A 5H5RA 4DSRA 1AQVA 2VL3A 2R0PA 1VF3A 1O8XA 2BJXA 2YANA 5IO2A 2WRTA 2VL2A 1AUCA 2C0EA 2B5XA 4NMUA 4N10A 3KH9A 3A2WA 4TXOB 4YKFA 1JFUA 2B5YA 4OFMA 3C71A 2DJ1A 1DE2A 5GSSA 5E4WA 1GSSA 3HMJG 4WF5A 14GSA 2JU5A 10GSA 4PQHA 2G2QA 5ECLB 2GDRA 4GSNA 3VWWA 2FWEA 2HRAA 3UEMA 4ZIJA 5JCGA 3S9FA 3VFIA 2YWIA 3F63A 1Y1UA 1TK0B 2DC5A 2DBCA 5A4VA 3VI7A 2YN1A 3QAGA 1PL1A 2MBSA 4WR4A 3GUSA 2C3QA 4BWSA 2X99A 1G0TA 2KOKA 3IK7A 4ZBBA 3KEBA 2L5LA 4CW9A 5BMUB 4PGTA 1H75A 2DMMA 5AN1A 3CTGA 5CNWA 2R6KA 1HD2A 2X49A 4X1UA 2DLXA 2XBQA 3UVHA 1OC9A 4ID0A 2JSZA 5IMAA 3TOUA 1GSQA 1PKZA 3ME8A 18GSA 3PINA 3TOTA 4D73B 4GQFA 3UJ1A 3NZNA 3H8QA 1TOFA 1K0NA 1F9MA 2ZCTA 4I5QA 3RGBC 5B7CA 2HNLA 5BMUA 16GSA 3HCZA 1GTBA 3H79A 2YV7A 3U5RE 3A5WA 3TU3B 1MD3A 1PGTA 2ES7A 4Q5RA 1M2DA 4OFTA 5G31A 4BL7A 1PQNA 3FKFA 9GSSA 3CHXC 4GDFA 1O73A 1VRSD 4EO3A 1K0BA 1SVLA 3FK8A 5E59A 2A2PA 3CBUA 3W6GA 4POBA 3QR6A 3QPMA 4ZBAA 3ME7A 1JHBA 4ILFA 2H6XA 20GSA 4BL7B 3QD9A 1SVOA 1ST9A 4RUVA 2LQQA 4ZB8A 4ECCA 1A0FA 2AB6A 4E68A 3BOAA 4GF0A 2CX3A 4XS4B 1EOHA 5IOWA 5GAND 2LJAA 3N5OA 2C4JA 4N0VA 4F0BA 4K5RA 3ZMLA 3WGEA 3KM6A 4EIQA 1Z5YE 4FH8A 5ECQB 1JZDA 2EIOA 3ZREA 2HRKA 2UV8G 3CSIA 5A34B 2GZPA 4XS4A 6GSYA 5B6MA 1BJXA 5ECNB 4K2DA 5DAKB 3JCML 1QUWA 3LEFA 2GZZA 5A1NB 4IJIA 1WOUA 2VOCA 2H70A 1V57A 5D93A 1R4WA 3EURA 4KB3A 2QA2A 4MMMA 1RW1A 3KMOA 1EV4A 5ECRB 4ML1A 2NVLA 1UA5A 3GV1A 1BG1A 3RHBA 3TCOA 2JZRA 4EE0A 2H66A 1ERVA 5DJMA 3IAM2 2RIIA 5J4VA 2HI7A 5EY6A 2I81A 4POMA 1GNWA 4Z2TA 3FRCA 2GT5A 3ED3A 3F4SA 1WRYA 4AGSA 5D9WA 3V1WA 3CYNA 4FQUA 3WGDA 3GMFA 3GA4A 2CA8A 5C00A 2E2MA 4PUAA 2LRNA 2PN8A 5J40A 1OKTA 4L8EA 6GSWA 3NIVA 4POKA 2RUFA 1SD9A 1K3OA 2LRTA 1SL2B 1M0UA 1WPIA 3EWLA 3QFAC 4MNNA 3TJKA 4KAEA 2I4AA 2O3EA 4PXOA 1V58A 3IOSA 4FYBA 4IN0A 4KUNA 4CY8A 2F51A 3IHQA 1ERTA 1J0FA 3F6FA 2VLVA 1GWCA 3FR6A 6GSSA 1M7TA 4I2TA 3TRQA 3M3MA 4KGIA 1MTCA 2O89A 1TI1A 1DE1A 3GH9A 2H6YA 1YDKA 2O85A 2LNTA 5D9XA 4TXVA 1ML6A 3VURA 3HHVA 1HNBA 2B6MA 3DRNA 4YAPA 3TUEA 1QXHA 1FVJA 1OAZA 3FR9A 4ZB6A 2HRKB 1SL1B 1WE0A 4JEDA 4USSA 3KXOA 4Q5FA 4IP6A 4Z7XA 2WVYA 1Z6NA 4BPYA 5DALA 2YP6A 1AC1A 2IPAA 2FNOA 4MF7A 1THXA 2EC4A 5CO3A 4LL4B 3BBYA 2YZUA 4GQCA 1T00A 5LNKe 1CQGA 1C72A 1GSUA 3ISOA 4IVFA 1B4QA 3IK9A 1EEMA 4PNFA 2M80A 5LCZA 1XWKA 3HD5A 1KTEA 2GQLA 4G01A 2R5GA 5L71A 2HSNB 2K9FA 3KIJA 4AKXB 3DGQA 3G7IA 2H01A 2E7PA 2VCWA 3A2XA 4NV2A 2ON5A 2PWJA 2HT9A 1TW9A 2LSTA 1SYRA 4ECIA 1B48A 1USBA 4AKGA 5FHIA 3RBTA 1V40A 4O92A 5HFGA 3FYGA 1FOHA 2D2ZA 1OE7A 4MA9A 5CRDA 1TU8A 5J5NA 1BX9A 1U6TA 4KSMA 3MNGA 2KP2A 2IJYA 1I9DA 2OADA 3IXRA 3A5IA 1EGOA 4TVEA 4V2LA 2IFQB 1XBSA 1SENA 4AJ6A 2LEGA 8GSSA 5A5KA 1Z6MA 5ECMB 1X9SB 4YQVA 2V6KA 2L4CA 2WVXB 3ZFLA 4GSSA 4O5RA 3P90A 4EKZA 2JL4A 1GSYA 4QL9A 2VO4A 2FWGA 3CRTA 1BF5A 4IQAA 3BJ5A 1GLQA 5EPFA 3NOFA 2LKUA 2FWHA 1GUHA 3UIWA 5KOXA 3DWVA 1A2MA 4OD7A 3ZTLA 1G6YA 2HZEB 2LS5A 4G0IA 1U3IA 4IW9A 2L5OA 1U87A 3CQFA 4V2MA 3P8WA 4HS1A 3A3TA 4L0UA 4TR4A 3R3EA 2EFCA 3C8EA 1X5CA 4Q5NA 2M46A 2WULA 3VLNA 2P0GA 3VWVA 3DEXA 2VKZG 4ULXA 5DQSA 2PBJA 4J2FA 4F2IA 4MZWA 4X43A 4CY6A 4HQZA 4KCAA 5GZZB 3FZ5A 2NTOA 1YZXA 1KEBA 3EYTA 4ZL8A 2FCHA 2CVKA 4WEYA 1MEKA 3I43A 1YQ1A 2WZSA 3C7MA 5D73A 3CTFA 4NXIA 1PX7A 4G19A 3CWGA 3F6DA 2DIZA 3SWLA 2VM1A 1F3BA 1PSQA 2QSIA 3H93A 2C8UA 2MYGA 1QMVA 5HFIA 1OVNA 3GURA 4XIHA 2VAFA 4HU9A 2YWNA 2HSHA 2LNSA 5IM9A 2OE1A 1T7PB 2B5EA 4EVMA 4QQ7A 4NHZA 4G10A 1PL2A 3I9V2 2WFCA 3M9JA 1TU7A 4O5QA 2FY6A 5C04A 3ERWA 4WF4A 1M9AA 2A2SA 1K0MA 1XPVA 1QGVA 4K2XA 1XWBA 5KN2A 2DJJA 2YNXA 2IMIA 1R26A 2WS2A 5DDLA 4TR1B 5A34A 5IMFA 4GXZA 3GNJA 3TJGA 4BVXB 2WZ9A 1QFNA 1YKCA 1R7HA 2H0HA 2WGRA 2XPEA 2HE3A 1YF1A 1ERWA 2OE3A 3L9SA 1GL8A 1GTUA 2FA8A 2L6DA 5H5SA 2H30A 1PN0A 4PTSA 4WKWA 4FIWA 3APSA 1OE8A 3DXBA 6GSVA 3P7XA 3UBKA 5GSTA 1S3CA 3HJPA 3FMWA 1XVQA 4L5LA 3UARA 3GIXA 4Z2UA 5IO0A 2CV4A 4JR4A 1WJKA 5FT3A 4HZ2A 4KCEA 3ZFBA 1M99A 3M1GA 1XXUA 1S3AA 3KP9A 3GKMA 2IL3A 1TTZA 4HZ4A 3TKRA 3F3QA 2LTKA 4G9HA 3EMPA 4O7HA 2B3SA 1THOA 3WD6A 4V1Ag 3UAPA 4MCUA 3HVXA 3UL3A 1JZOA 5JWOB 5F05A 2GLRA 2KHPA 1NM3A 5JCUA 2FUG2 2WVXA 1SJIA 1ZOFA 4MJBA 4IJ3A 4K5SA 2CAIA 3LQ7A 4ZB7A 1XWCA 2CVDA 1OC9B 1K0CA 2C0FA 4YQUA 3ERFA 5DJLA 1MDJA 3TJBA 2YCDA 5ECHB 3L9VA 3M8NA 3TKSC 4HJ2A 5D9TA 4I2UA 4L5OA 3VWXA 5HR0A 5G1LA 4X0XA 1O85A 4GSTA 3I69A 1ZMAA 4JZQA 4MABA 1M2BA 5CRWA 3HVVA 2MZCA 2AAWA 4NPBA 2I3YA 2HSNA 2VLUA 3C73A 2RM5A 4KW6A 5B8BA 3GX0A 3HZ4A 5A5HB 2H76A 4TKYA 3Q6OA 5KN3A 3IDVA 3K8NA 3Q18A 2AV4A 4XRAA 1GTAA 4P3YB 5B6NA 2TRCP 1K0DA 2WCIA 2FLSA 4K0NA 3IE3A 2H71A 1XWGA 3HY2A 5CAXA 2WW2A 1NHOA 4KE3A 3LYPA 2PU9C 5LD0A 4BVXA 3GKXA 3IPZA 4PURA 1SU9A 3DIEA 3GL5A 4AJ7A 3L9UA 3QAWA 3QAVA 1TXXA 5ELGA 4ML6A 4HDEA 1XWAA 1WIKA 1Z3EA 3ZVJD 4X4JA 3IBHA 2OT3A 4PQIA 2PERA 2YV9A 3E9JB 4IQ1A 2L59A 4Z2RA 2PVOC 4WBJA 4GWRA 1ZYPA 4DSSA 2MMNA 2CX4A 5DBQA 4IELA 3IRAA 5D96A 5AIXA 5F06A 1SKWB 5HQPA 2FGXA 1A2LA 1V2AA 3OR5A 2IN3A 1BEDA 2IMFA 3TRPA 2LJRA 4HSCX 3H1NA 1ZL9A 2V41A 1K0OA 1DSBA 1EOGA 1Z7RA 3CRUA 2L57A 3UVTA 1YEXA 3WT1A 1FB0A 1AIUA 1S3DA 2GGTA 22GSA 1YEWC 3WYWA 1MD4A 1XVWA 2CZ2A 2ZNMA 2EFHA 1VF1A 5EL8A 1X9WB 1TRUA 1KBNA 4GLTA 4FYCA 2PUKC 1XZOA 2YOIA 4CDOA 2FA4A 5IIZA 2DKIA
chains in the Genus database with same CATH topology
3MDKA 1OC3A 5G2ZA 4MZBA 4AJ8A 2TRXA 4K0GA 1AAZA 1E2YA 3TDGA 1T4YA 1VF4A 5KOWA 2B7JA 2O87A 3US3A 1F2EA 1GLPA 4MJEA 1TP9A 1Q4JA 4NWYA 5G5EA 4XS1A 5G30A 3TKQA 5COHA 3DVXA 4I6XA 2RLIA 4MF6A 4K7NA 4TXOA 3GRXA 4JU5A 3RHCA 2BMXA 4TRXA 1G6WA 4DVCA 4DSQA 2V2GA 4OCFA 4F0CA 2X8CA 5F07A 1M9BA 2AUVA 2H8LA 5DQYA 2HSMB 4HUAA 3APQA 1HNAA 5A5HA 5ECIB 1M2AA 1T4ZA 3PGTA 2H73A 2YJ7A 3IA1A 4MPGA 3PH9A 1B9XC 1A0RP 4PX1A 2GSRA 4KX4A 5IOXA 3M9KA 3AY8A 5HFKA 1PMTA 2L6CA 2OBIA 1F3AA 1SK2A 3VK9A 4QL7A 1N25A 2NBSA 5CRGA 4OFNA 3LFLA 3CMIA 3DD3A 3VPTA 4K7IA 5DVBA 2X8HA 2VCXA 4O32A 5ABRA 1OKDA 2GT6A 1GSFA 1SKRB 2GSSA 4MZCA 2L4QA 4K9ZA 3GYKA 5J41A 3FZ4A 1AXDA 3F3RA 1SYXA 4WBRD 4K6XA 1T1VA 1SKSB 2RUEA 4KF9A 2HZEA 17GSA 1FB6A 3L4NA 2YJHA 3D0ZA 2VIMA 1E6BA 2GSTA 1GP1A 2GVPA 2IMEA 4MH3A 4WR5A 1B8XA 1T3BA 5ECSA 1JLVA 1FHEA 2FHEA 1O8WA 3Q74A 2E0QA 4OMVA 1PKWA 3LGCA 2I1UA 1TDIA 1ZYEA 2MMAA 3O6TA 1DUGA 1K0AA 2N5FA 2O5VA 2LUSA 4KDXA 4XS6A 4D73A 2UZ8A 3HA9A 2OACA 4FYUA 4IGJA 5J47A 5IMZA 1UVZA 3DMLA 3VI5A 1A2JA 2R3XA 1ZCPA 4A5PA 4F82A 1R5PA 3QFBC 2JACA 2X64A 13GSA 2TIRA 2GQMA 5IQYA 2GSQA 4L0WA 1ZYNA 4KSOA 4TR1A 4EF0A 4EDYA 4AI6A 3IC8A 1BYEA 5F8BA 1NW2A 5ID2B 2QC7A 2DMLA 2QGVA 4EDZA 3EE2A 3FR3A 1B4PA 3BCKA 5AGYA 1EGRA 4O5UA 1WWJA 4IBPA 3FY7A 5KEJA 1ON4A 2XC2A 3HJOA 4MDCA 1PD21 2AJQB 1GUKA 3EPTA 3L78A 3D4TA 3CSHA 4PNGA 1XW5A 2K8SA 3R2QA 2M72A 1FW1A 4JRRA 5IMVA 3ZYWA 2VLTA 1ERUA 5IPGA 3MYDA 1DBYA 3KJYA 1AQWA 1X0RA 2V1MA 2V32A 2VCZA 4EXJA 5DCGA 4QMKA 4NV5A 2DJ3A 3GHAA 1GSEA 1RK4A 1YF0A 1SK1A 1GUMA 4NAXA 3KP8A 2H0IA 3HYPA 4N0ZA 4OWYA 2VD1A 4YKGA 1H4OA 4ZL9A 4JR6A 4N30A 3BCIA 1YVLA 1JZWA 3LW9A 1IYIA 1G7OA 4IHUA 2VM2A 3L0HA 3EC3A 3HKRA 2HXKA 2B1LA 2NPBA 2G0FA 1N2AA 3J7Yk 4OO5A 3TRXA 5KN0A 1GSDA 3RPPA 3GH6A 4AKIA 3GL3A 3RAZA 3O76A 2K8VA 3RDWA 2Z9SA 2MMOA 2B1KA 4ZBDA 4IKHA 2C0GA 4E8EA 2MMZA 5ENUA 2A4VA 2EFDA 5DALB 2H72A 4I97A 4F9ZA 2HRFA 4XHMA 7GSSA 5IPHA 4G2EA 3IAS2 1JZRA 2OBKA 2CZ3A 6GSUA 1QK8A 2C80A 5CREA 3QOUA 1GRXA 19GSA 1XW6A 1FO5A 2H1AA 2YWOA 2DIYA 3W8SA 1SK0A 1SJZA 2E2GA 4KNDA 1SVMA 1UC7A 2FD3A 2QKEA 3VPQA 3GTUA 1TK8B 5ID2A 3TJFA 4XTSA 2O8VB 3F4RA 3GTUB 4POLA 1I5GA 2KP1A 3EINA 3GKNA 2R2JA 2EIQA 3O3TA 1LJRA 2IIYA 3F8UA 1O81A 1U88A 3N9JA 1WP0A 1HNCA 5CYYA 2XBIA 4K1FA 5HR3A 3G9BA 4XRDA 1WMJA 3GSTA 5A1NA 1MDIA 2VD0A 3EMXA 4H86A 1F37A 2NDOA 4F03A 2N5BA 3PPUA 1VF2A 4ECBA 2ON7A 1URMA 5HR1A 2CT6A 3MAKA 5A4UA 3FZ9A 1T8EB 4V1Ap 5ELAA 3U6VA 4EUYA 4G0LA 4WETA 1TI3A 5J4UA 2IWTA 5JWRB 4OO4A 4K7OA 1CQHA 1HQOA 2ZUPA 3DVWA 5ECPB 2H1LA 2LJKA 4HEA2 3TGZA 3LJRA 1O6JA 2YWMA 4TOPA 1W89A 4GRFA 3LXTA 3UBLA 4ECJA 2VUPA 2HSMA 5DAKA 3LG6A 5JWQB 3LXZA 1PA3A 2R0CA 3GX8A 3KTBA 4MJCA 2WJUA 2KUCA 4G0KA 4GTUA 3D4MA 3ZL5A 3EVIA 1FAAA 4BA7A 1BQ7A 3KCMA 2C1YA 3ZLPA 1F6MC 1AW9A 3MIXA 1XCCA 3G7YA 1A8YA 1VGLA 3HZ8A 2DJ0A 3ZITA 2PMTA 4YQMA 1SD8A 2REMA 2DSAA 2CVBA 4LMWA 4MP4A 2PPTA 3C1RA 1TRWA 4YAVA 2X8GA 2VCQA 2GZYA 4MJAA 5D8IA 3D5JA 2WDUA 1TRSA 3HXSA 4J56E 1V9WA 4ZL7A 2QA1A 4RI6A 1TJDA 1LU4A 2DJKA 1X9MB 4TN8A 2HLSA 3TKPA 5CP1A 2DKHA 2J9HA 2C0DA 1IYHA 2YPMA 5JCWA 1XOBA 4BVYB 12GSA 5F0GA 2K18A 1TK5B 5A4WA 5ECOB 2N5AA 3FW2A 4I8BA 2LRCA 3D6IA 2IFQA 3TJJA 1JLWA 2F8FA 4RQRA 3LSZA 2P5QA 1K3LA 2H0GA 2R0GA 1OYJA 5DCHA 5J4YA 3IC4A 1AQXA 1ABAA 4Q5QA 4GCIA 2H75A 1YKAA 4HOJA 1W4VA 3C1SA 3LWAA 3DKSA 4CHSA 1X5EA 4N11A 4DEJA 3WGXA 1B9YC 2KLXA 3ZIVA 4DSSB 3CSJA 3G7JA 1ILOA 1PX6A 2F3MA 2X4AA 1ZZYA 3KZQA 4LL1B 3ZMKA 4MK3A 2R37A 1ACVA 4TR0A 4N3ZA 4XCSA 4MF5A 4ZB9A 4TR3A 3P2AA 1SJ6A 4KDYA 3SBCA 2HQTA 3ZIJA 1FOVA 4MH2A 3F0IA 2OA7A 4ZILA 2XHFA 3FHKA 2HFDA 3QCPA 4EIPA 5J9BA 2GTUA 2LV3A 1XW9A 2HSYA 4EL1A 3ZRDA 3W8JA 11GSA 4E8HA 3UOMA 5HR2A 4RQXA 1Y25A 1GTIA 5IMCA 4PUFC 5EVOA 2I9HA 2LQOA 2VL9A 4KDUA 3M0FA 1GULA 1UN2A 3IR4A 1A23A 2VCTA 3RPNA 1TXUA 1FVKA 1A8LA 2YZHA 2O7KA 2IMKA 1NHYA 3KGKA 4RI7A 1EP8A 3UMAA 3TB2A 2PVQA 3I6AA 5AIVA 4BWQA 4IS0A 2HRNA 2A4HA 4ACSA 4KH7A 4MLYA 1XFLA 3LYKA 2H19A 4TW5A 4HU7A 1Z9HA 1HYUA 2JADA 1K3YA 2GS3A 3KD0A 3KMNA 2VL2C 3WT2A 3GKKA 2AHEA 2XPDA 3KTLA 4PQ1A 4HQSA 2IMDA 1EP7A 2C3TA 1NSWA 3PR8A 1XIYA 1LBKA 5FWGA 2FWFA 1N8JA 1PRXA 2EFEA 3IV4A 4JBBA 1XOAA 3QDNA 3HDCA 5AISA 6GSTA 5G1KA 2R4VA 3H4KA 5GAPD 1YY7A 2WB9A 1EEJA 5B8AA 2OE0A 2H1BA 3E3EA 3EU4A 2VCVA 3FEUA 4HI7A 2JZSA 5H5QA 1YEPA 5CRHA 2C3NA 3HJMA 2HZFA 4LMVA 3F9UA 4W66A 4BVYA 2BTOT 2EIRA 1BAYA 2RM6A 5J9CA 1FG4A 1GNEA 3APOA 1BG5A 3D21A 2AYTA 1OC8A 5G5FA 2F8AA 3CXGA 2H1DA 3DYRA 3KH7A 3IHGA 3D22A 1X5DA 4ISDA 2H6ZA 1MDKA 4AF2A 1EZKA 5IMDA 4LLRA 2F9SA 4NHWA 1KNGA 2CQ9A 1TRVA 1YJ6A 4AKHA 2B7KA 4LA1A 1Q98A 1R5AA 3FZAA 4ZXGA 4ICYA 3BD2A 2PGTA 3GFKA 1ZYQB 2OJLA 3Q19A 1Y6EA 1TKDB 3ERGA 1J9BA 3MWHA 4KA0A 2CAQA 4K8MA 2OKAA 1O7UA 2MBTA 6GSXA 1PN9A 1GH2A 1U3AA 1SL0B 3ZZXA 2HYXA 5ECKB 2P5RA 4OCEA 2A2RA 3E0UA 3LORA 5D9VA 4V2NA 4YH2A 2JSYA 1QQ2A 1EWXA 3MSZA 5BRTA 4JE1A 2ALBA 4EC0A 3HVSA 4WXTA 3J7Yb 1Z7PA 5INYA 2H74A 3TKSA 3A2VA 3TKSE 4J57E 4MPFA 2V6OA 3F4TA 1J08A 5J3RA 2P31A 1V98A 1A24A 3QMXA 2K6VA 1EV9A 1RQMA 2DJ2A 1ZGNA 2J23A 3GN3A 3ZVJA 2JZTA 3VWUA 4FO5A 4HJMA 2GQKA 2H1GA 5KN1A 1G7EA 3GSSA 3EU3A 4IP1A 5H5RA 4DSRA 1AQVA 2VL3A 2R0PA 1VF3A 1O8XA 2BJXA 2YANA 5IO2A 2WRTA 2VL2A 1AUCA 2C0EA 2B5XA 4NMUA 4N10A 3KH9A 3A2WA 4TXOB 4YKFA 1JFUA 2B5YA 4OFMA 3C71A 2DJ1A 1DE2A 5GSSA 5E4WA 1GSSA 3HMJG 4WF5A 14GSA 2JU5A 10GSA 4PQHA 2G2QA 5ECLB 2GDRA 4GSNA 3VWWA 2FWEA 2HRAA 3UEMA 4ZIJA 5JCGA 3S9FA 3VFIA 2YWIA 3F63A 1Y1UA 1TK0B 2DC5A 2DBCA 5A4VA 3VI7A 2YN1A 3QAGA 1PL1A 2MBSA 4WR4A 3GUSA 2C3QA 4BWSA 2X99A 1G0TA 2KOKA 3IK7A 4ZBBA 3KEBA 2L5LA 4CW9A 5BMUB 4PGTA 1H75A 2DMMA 5AN1A 3CTGA 5CNWA 2R6KA 1HD2A 2X49A 4X1UA 2DLXA 2XBQA 3UVHA 1OC9A 4ID0A 2JSZA 5IMAA 3TOUA 1GSQA 1PKZA 3ME8A 18GSA 3PINA 3TOTA 4D73B 4GQFA 3UJ1A 3NZNA 3H8QA 1TOFA 1K0NA 1F9MA 2ZCTA 4I5QA 5B7CA 2HNLA 5BMUA 16GSA 3HCZA 1GTBA 3H79A 2YV7A 3U5RE 3A5WA 3TU3B 1MD3A 1PGTA 2ES7A 4Q5RA 1M2DA 4OFTA 5G31A 4BL7A 1PQNA 3FKFA 9GSSA 4GDFA 1O73A 1VRSD 4EO3A 1K0BA 1SVLA 3FK8A 5E59A 2A2PA 3CBUA 3W6GA 4POBA 3QR6A 3QPMA 4ZBAA 3ME7A 1JHBA 4ILFA 2H6XA 20GSA 4BL7B 3QD9A 1SVOA 1ST9A 4RUVA 2LQQA 4ZB8A 4ECCA 1A0FA 2AB6A 4E68A 3BOAA 4GF0A 2CX3A 4XS4B 1EOHA 5IOWA 5GAND 2LJAA 3N5OA 2C4JA 4N0VA 4F0BA 4K5RA 3ZMLA 3WGEA 3KM6A 4EIQA 1Z5YE 4FH8A 5ECQB 1JZDA 2EIOA 3ZREA 2HRKA 2UV8G 3CSIA 5A34B 2GZPA 4XS4A 6GSYA 5B6MA 1BJXA 5ECNB 4K2DA 5DAKB 3JCML 1QUWA 3LEFA 2GZZA 5A1NB 4IJIA 1WOUA 2VOCA 2H70A 1V57A 5D93A 1R4WA 3EURA 4KB3A 2QA2A 4MMMA 1RW1A 3KMOA 1EV4A 5ECRB 4ML1A 2NVLA 1UA5A 3GV1A 1BG1A 3RHBA 3TCOA 2JZRA 4EE0A 2H66A 1ERVA 5DJMA 3IAM2 2RIIA 5J4VA 2HI7A 5EY6A 2I81A 4POMA 1GNWA 4Z2TA 3FRCA 2GT5A 3ED3A 3F4SA 1WRYA 4AGSA 5D9WA 3V1WA 3CYNA 4FQUA 3WGDA 3GMFA 3GA4A 2CA8A 5C00A 2E2MA 4PUAA 2LRNA 2PN8A 5J40A 1OKTA 4L8EA 6GSWA 3NIVA 4POKA 2RUFA 1SD9A 1K3OA 2LRTA 1SL2B 1M0UA 1WPIA 3EWLA 3QFAC 4MNNA 3TJKA 4KAEA 2I4AA 3IOSA 4PXOA 1V58A 4FYBA 4IN0A 4KUNA 4CY8A 2F51A 3IHQA 1ERTA 1J0FA 3F6FA 2VLVA 1GWCA 3FR6A 6GSSA 1M7TA 4I2TA 3TRQA 3M3MA 4KGIA 1MTCA 2O89A 1TI1A 1DE1A 3GH9A 2H6YA 1YDKA 2O85A 2LNTA 5D9XA 4TXVA 1ML6A 3VURA 3HHVA 1HNBA 2B6MA 3DRNA 4YAPA 3TUEA 1QXHA 1FVJA 1OAZA 3FR9A 4ZB6A 2HRKB 1SL1B 1WE0A 4JEDA 4USSA 3KXOA 4Q5FA 4IP6A 4Z7XA 1Z6NA 4BPYA 5DALA 2YP6A 1AC1A 2IPAA 2FNOA 4MF7A 1THXA 2EC4A 5CO3A 4LL4B 3BBYA 2YZUA 4GQCA 1T00A 5LNKe 1CQGA 1C72A 1GSUA 3ISOA 4IVFA 1B4QA 3IK9A 1EEMA 4PNFA 2M80A 5LCZA 1XWKA 3HD5A 1KTEA 2GQLA 4G01A 2R5GA 5L71A 2HSNB 2K9FA 3KIJA 4AKXB 3DGQA 3G7IA 2H01A 2E7PA 2VCWA 3A2XA 4NV2A 2ON5A 2PWJA 2HT9A 1TW9A 2LSTA 1SYRA 4ECIA 1B48A 1USBA 4AKGA 5FHIA 3RBTA 1V40A 4O92A 5HFGA 3FYGA 1FOHA 2D2ZA 1OE7A 4MA9A 5CRDA 1TU8A 5J5NA 1BX9A 1U6TA 4KSMA 3MNGA 2KP2A 2IJYA 1I9DA 2OADA 3IXRA 3A5IA 1EGOA 4TVEA 4V2LA 2IFQB 1XBSA 1SENA 4AJ6A 2LEGA 8GSSA 5A5KA 1Z6MA 5ECMB 1X9SB 4YQVA 2V6KA 2L4CA 3ZFLA 4GSSA 4O5RA 3P90A 4EKZA 2JL4A 1GSYA 4QL9A 2VO4A 2FWGA 3CRTA 1BF5A 4IQAA 3BJ5A 1GLQA 5EPFA 3NOFA 2LKUA 2FWHA 1GUHA 3UIWA 5KOXA 3DWVA 1A2MA 4OD7A 3ZTLA 1G6YA 2HZEB 2LS5A 4G0IA 1U3IA 4IW9A 2L5OA 1U87A 4V2MA 3P8WA 4HS1A 3A3TA 4L0UA 4TR4A 3R3EA 2EFCA 3C8EA 1X5CA 4Q5NA 2M46A 2WULA 3VLNA 2P0GA 3VWVA 3DEXA 2VKZG 4ULXA 5DQSA 2PBJA 4J2FA 4F2IA 4MZWA 4X43A 4CY6A 4HQZA 4KCAA 5GZZB 3FZ5A 2NTOA 1YZXA 1KEBA 3EYTA 4ZL8A 2FCHA 2CVKA 4WEYA 1MEKA 3I43A 1YQ1A 3C7MA 5D73A 3CTFA 4NXIA 1PX7A 4G19A 3CWGA 3F6DA 2DIZA 3SWLA 2VM1A 1F3BA 1PSQA 2QSIA 3H93A 2C8UA 2MYGA 1QMVA 5HFIA 1OVNA 3GURA 4XIHA 2VAFA 4HU9A 2YWNA 2HSHA 2LNSA 5IM9A 2OE1A 1T7PB 2B5EA 4EVMA 4QQ7A 4NHZA 4G10A 1PL2A 3I9V2 2WFCA 3M9JA 1TU7A 4O5QA 2FY6A 5C04A 3ERWA 4WF4A 1M9AA 2A2SA 1K0MA 1XPVA 1QGVA 4K2XA 1XWBA 5KN2A 2DJJA 2YNXA 2IMIA 1R26A 2WS2A 5DDLA 4TR1B 5A34A 5IMFA 4GXZA 3GNJA 3TJGA 4BVXB 2WZ9A 1QFNA 1YKCA 1R7HA 2H0HA 2WGRA 2XPEA 2HE3A 1YF1A 1ERWA 2OE3A 3L9SA 1GL8A 1GTUA 2FA8A 2L6DA 5H5SA 2H30A 1PN0A 4PTSA 4WKWA 4FIWA 3APSA 1OE8A 3DXBA 6GSVA 3P7XA 3UBKA 5GSTA 1S3CA 3HJPA 3FMWA 1XVQA 4L5LA 3UARA 3GIXA 4Z2UA 5IO0A 2CV4A 4JR4A 1WJKA 5FT3A 4HZ2A 4KCEA 3ZFBA 1M99A 3M1GA 1XXUA 1S3AA 3KP9A 3GKMA 2IL3A 1TTZA 4HZ4A 3TKRA 3F3QA 2LTKA 4G9HA 3EMPA 4O7HA 2B3SA 1THOA 3WD6A 4V1Ag 3UAPA 4MCUA 3HVXA 3UL3A 1JZOA 5JWOB 5F05A 2GLRA 2KHPA 1NM3A 5JCUA 2FUG2 1SJIA 1ZOFA 4MJBA 4IJ3A 4K5SA 2CAIA 3LQ7A 4ZB7A 1XWCA 2CVDA 1OC9B 1K0CA 2C0FA 4YQUA 3ERFA 5DJLA 1MDJA 3TJBA 2YCDA 5ECHB 3L9VA 3M8NA 3TKSC 4HJ2A 5D9TA 4I2UA 4L5OA 3VWXA 5HR0A 5G1LA 4X0XA 1O85A 4GSTA 3I69A 1ZMAA 4JZQA 4MABA 1M2BA 5CRWA 3HVVA 2MZCA 2AAWA 4NPBA 2I3YA 2HSNA 2VLUA 3C73A 2RM5A 4KW6A 5B8BA 3GX0A 3HZ4A 5A5HB 2H76A 4TKYA 3Q6OA 5KN3A 3IDVA 3K8NA 3Q18A 2AV4A 4XRAA 1GTAA 4P3YB 5B6NA 2TRCP 1K0DA 2WCIA 2FLSA 4K0NA 3IE3A 2H71A 1XWGA 3HY2A 5CAXA 1NHOA 4KE3A 3LYPA 2PU9C 5LD0A 4BVXA 3GKXA 3IPZA 4PURA 1SU9A 3DIEA 3GL5A 4AJ7A 3L9UA 3QAWA 3QAVA 1TXXA 5ELGA 4ML6A 4HDEA 1XWAA 1WIKA 1Z3EA 3ZVJD 4X4JA 3IBHA 2OT3A 4PQIA 2PERA 2YV9A 3E9JB 4IQ1A 2L59A 4Z2RA 2PVOC 4WBJA 4GWRA 1ZYPA 4DSSA 2MMNA 2CX4A 5DBQA 4IELA 3IRAA 5D96A 5AIXA 5F06A 1SKWB 5HQPA 2FGXA 1A2LA 1V2AA 3OR5A 2IN3A 1BEDA 2IMFA 3TRPA 2LJRA 3H1NA 1ZL9A 2V41A 1K0OA 1DSBA 1EOGA 1Z7RA 3CRUA 2L57A 3UVTA 1YEXA 3WT1A 1FB0A 1AIUA 1S3DA 2GGTA 22GSA 3WYWA 1MD4A 1XVWA 2CZ2A 2ZNMA 2EFHA 1VF1A 5EL8A 1X9WB 1TRUA 1KBNA 4GLTA 4FYCA 2PUKC 1XZOA 2YOIA 4CDOA 2FA4A 5IIZA 2DKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDK A;  1OC3 A;  5G2Z A;  4MZB A;  4AJ8 A;  2TRX A;  4K0G A;  1AAZ A;  1E2Y A;  3TDG A;  1T4Y A;  1VF4 A;  2B7J A;  2O87 A;  3US3 A;  1F2E A;  1GLP A;  4MJE A;  1TP9 A;  1Q4J A;  4NWY A;  5G5E A;  4XS1 A;  5G30 A;  3TKQ A;  5COH A;  3DVX A;  4I6X A;  2RLI A;  4MF6 A;  4K7N A;  4TXO A;  3GRX A;  4JU5 A;  3RHC A;  2BMX A;  4TRX A;  1G6W A;  4DVC A;  4DSQ A;  2V2G A;  4OCF A;  4F0C A;  2X8C A;  5F07 A;  1M9B A;  2AUV A;  2H8L A;  5DQY A;  2HSM B;  4HUA A;  3APQ A;  1HNA A;  5ECI B;  1M2A A;  1T4Z A;  3PGT A;  2H73 A;  2YJ7 A;  3IA1 A;  4MPG A;  3PH9 A;  1B9X C;  1A0R P;  4PX1 A;  2GSR A;  4KX4 A;  5IOX A;  3M9K A;  3AY8 A;  5HFK A;  1PMT A;  2L6C A;  2OBI A;  1F3A A;  1SK2 A;  3VK9 A;  4QL7 A;  2NBS A;  5CRG A;  4OFN A;  3LFL A;  3CMI A;  3DD3 A;  3VPT A;  4K7I A;  5DVB A;  2X8H A;  2VCX A;  4O32 A;  5ABR A;  1OKD A;  2GT6 A;  1GSF A;  1SKR B;  2GSS A;  4MZC A;  2L4Q A;  4K9Z A;  3GYK A;  5J41 A;  3FZ4 A;  1AXD A;  3F3R A;  1SYX A;  4WBR D;  4K6X A;  1T1V A;  1SKS B;  2RUE A;  4KF9 A;  2HZE A;  17GS A;  1FB6 A;  3L4N A;  2YJH A;  3D0Z A;  2VIM A;  1E6B A;  2GST A;  1GP1 A;  2GVP A;  2IME A;  4MH3 A;  4WR5 A;  1B8X A;  1T3B A;  5ECS A;  1JLV A;  1FHE A;  2FHE A;  1O8W A;  3Q74 A;  2E0Q A;  4OMV A;  1PKW A;  3LGC A;  2I1U A;  1TDI A;  1ZYE A;  2MMA A;  3O6T A;  1DUG A;  1K0A A;  2N5F A;  2LUS A;  4KDX A;  4XS6 A;  4D73 A;  2UZ8 A;  3HA9 A;  2OAC A;  4FYU A;  4IGJ A;  5IMZ A;  1UVZ A;  3VI5 A;  1A2J A;  3DML A;  2R3X A;  1ZCP A;  4F82 A;  1R5P A;  3QFB C;  2JAC A;  2X64 A;  13GS A;  2TIR A;  2GQM A;  5IQY A;  2GSQ A;  4L0W A;  4KSO A;  4TR1 A;  4EF0 A;  4EDY A;  3IC8 A;  1BYE A;  5F8B A;  1NW2 A;  5ID2 B;  2QC7 A;  2DML A;  2QGV A;  4EDZ A;  3EE2 A;  3FR3 A;  1B4P A;  3BCK A;  5AGY A;  1EGR A;  1WWJ A;  4IBP A;  3FY7 A;  5KEJ A;  1ON4 A;  2XC2 A;  3HJO A;  4MDC A;  1PD2 1;  2AJQ B;  1GUK A;  3L78 A;  3D4T A;  3CSH A;  4PNG A;  1XW5 A;  2K8S A;  3R2Q A;  2M72 A;  1FW1 A;  4JRR A;  5IMV A;  3ZYW A;  2VLT A;  1ERU A;  5IPG A;  1DBY A;  3KJY A;  1AQW A;  1X0R A;  2V1M A;  2V32 A;  2VCZ A;  4EXJ A;  5DCG A;  4NV5 A;  2DJ3 A;  3GHA A;  1GSE A;  1RK4 A;  1YF0 A;  1SK1 A;  1GUM A;  4NAX A;  3KP8 A;  2H0I A;  3HYP A;  4N0Z A;  4OWY A;  2VD1 A;  1H4O A;  4ZL9 A;  4JR6 A;  4N30 A;  3BCI A;  1JZW A;  1IYI A;  1G7O A;  4IHU A;  2VM2 A;  3L0H A;  3EC3 A;  3HKR A;  2HXK A;  2B1L A;  2NPB A;  2G0F A;  1N2A A;  3J7Y k;  4OO5 A;  3TRX A;  5KN0 A;  1GSD A;  3RPP A;  3GH6 A;  3GL3 A;  3RAZ A;  3O76 A;  2K8V A;  3RDW A;  2Z9S A;  2MMO A;  2B1K A;  4ZBD A;  4IKH A;  2C0G A;  4E8E A;  2MMZ A;  5ENU A;  2A4V A;  5DAL B;  2H72 A;  4I97 A;  4F9Z A;  2HRF A;  4XHM A;  7GSS A;  5IPH A;  4G2E A;  3IAS 2;  1JZR A;  2OBK A;  2CZ3 A;  6GSU A;  1QK8 A;  2C80 A;  5CRE A;  3QOU A;  1GRX A;  19GS A;  1XW6 A;  1FO5 A;  2H1A A;  2YWO A;  2DIY A;  3W8S A;  1SK0 A;  1SJZ A;  2E2G A;  4KND A;  1UC7 A;  2FD3 A;  2QKE A;  3VPQ A;  3GTU A;  1TK8 B;  5ID2 A;  3TJF A;  4XTS A;  2O8V B;  3F4R A;  3GTU B;  4POL A;  1I5G A;  2KP1 A;  3EIN A;  3GKN A;  2R2J A;  2EIQ A;  3O3T A;  1LJR A;  2IIY A;  3F8U A;  1O81 A;  1U88 A;  3N9J A;  1WP0 A;  1HNC A;  5CYY A;  2XBI A;  4K1F A;  5HR3 A;  3G9B A;  4XRD A;  1WMJ A;  3GST A;  1MDI A;  2VD0 A;  3EMX A;  4H86 A;  1F37 A;  2NDO A;  4F03 A;  2N5B A;  3PPU A;  1VF2 A;  4ECB A;  2ON7 A;  1URM A;  5HR1 A;  2CT6 A;  3MAK A;  5A4U A;  3FZ9 A;  1T8E B;  4V1A p;  5ELA A;  3U6V A;  4EUY A;  4G0L A;  4WET A;  1TI3 A;  5J4U A;  2IWT A;  5JWR B;  4OO4 A;  4K7O A;  1CQH A;  1HQO A;  2ZUP A;  3DVW A;  5ECP B;  2LJK A;  4HEA 2;  3TGZ A;  3LJR A;  1O6J A;  2YWM A;  4TOP A;  1W89 A;  4GRF A;  3LXT A;  3UBL A;  4ECJ A;  2VUP A;  2HSM A;  5DAK A;  3LG6 A;  5JWQ B;  3LXZ A;  1PA3 A;  3GX8 A;  3KTB A;  4MJC A;  2WJU A;  2KUC A;  4G0K A;  4GTU A;  3D4M A;  3ZL5 A;  3EVI A;  1FAA A;  4BA7 A;  1BQ7 A;  3KCM A;  2C1Y A;  3ZLP A;  1F6M C;  1AW9 A;  1XCC A;  3G7Y A;  1A8Y A;  1VGL A;  3HZ8 A;  2DJ0 A;  3ZIT A;  2PMT A;  4YQM A;  1SD8 A;  2REM A;  2DSA A;  2CVB A;  4LMW A;  4MP4 A;  2PPT A;  3C1R A;  1TRW A;  4YAV A;  2X8G A;  2VCQ A;  2GZY A;  4MJA A;  5D8I A;  3D5J A;  2WDU A;  1TRS A;  3HXS A;  4J56 E;  1V9W A;  4ZL7 A;  4RI6 A;  1TJD A;  1LU4 A;  2DJK A;  1X9M B;  4TN8 A;  2HLS A;  3TKP A;  5CP1 A;  2J9H A;  2C0D A;  1IYH A;  2YPM A;  5JCW A;  1XOB A;  4BVY B;  12GS A;  5F0G A;  2K18 A;  1TK5 B;  5A4W A;  5ECO B;  2N5A A;  3FW2 A;  4I8B A;  2LRC A;  3D6I A;  2IFQ A;  3TJJ A;  1JLW A;  2F8F A;  4RQR A;  3LSZ A;  2P5Q A;  1K3L A;  2H0G A;  1OYJ A;  5DCH A;  3IC4 A;  1AQX A;  1ABA A;  4Q5Q A;  4GCI A;  2H75 A;  1YKA A;  4HOJ A;  1W4V A;  3C1S A;  3LWA A;  3DKS A;  4CHS A;  1X5E A;  4N11 A;  4DEJ A;  3WGX A;  1B9Y C;  2KLX A;  3ZIV A;  4DSS B;  3CSJ A;  3G7J A;  1ILO A;  1PX6 A;  2F3M A;  1ZZY A;  3KZQ A;  4LL1 B;  3ZMK A;  4MK3 A;  2R37 A;  1ACV A;  4TR0 A;  4XCS A;  4MF5 A;  4ZB9 A;  4TR3 A;  3P2A A;  1SJ6 A;  4KDY A;  3SBC A;  2HQT A;  3ZIJ A;  1FOV A;  4MH2 A;  3F0I A;  2OA7 A;  4ZIL A;  2XHF A;  3FHK A;  2HFD A;  3QCP A;  5J9B A;  2GTU A;  2LV3 A;  1XW9 A;  2HSY A;  4EL1 A;  3ZRD A;  3W8J A;  11GS A;  4E8H A;  3UOM A;  5HR2 A;  4RQX A;  1Y25 A;  1GTI A;  5IMC A;  4PUF C;  5EVO A;  2I9H A;  2LQO A;  2VL9 A;  4KDU A;  3M0F A;  1GUL A;  1UN2 A;  3IR4 A;  1A23 A;  2VCT A;  3RPN A;  1FVK A;  1A8L A;  2YZH A;  2O7K A;  2IMK A;  1NHY A;  3KGK A;  4RI7 A;  1EP8 A;  3UMA A;  3TB2 A;  2PVQ A;  3I6A A;  5AIV A;  4BWQ A;  4IS0 A;  2HRN A;  4ACS A;  4KH7 A;  4MLY A;  1XFL A;  3LYK A;  2H19 A;  4TW5 A;  4HU7 A;  1Z9H A;  1HYU A;  2JAD A;  1K3Y A;  2GS3 A;  3KD0 A;  3KMN A;  2VL2 C;  3WT2 A;  3GKK A;  2AHE A;  2XPD A;  3KTL A;  4PQ1 A;  4HQS A;  2IMD A;  1EP7 A;  2C3T A;  1NSW A;  3PR8 A;  1XIY A;  1LBK A;  5FWG A;  2FWF A;  1N8J A;  1PRX A;  3IV4 A;  4JBB A;  1XOA A;  3QDN A;  3HDC A;  5AIS A;  6GST A;  5G1K A;  2R4V A;  3H4K A;  5GAP D;  1YY7 A;  2WB9 A;  1EEJ A;  5B8A A;  2OE0 A;  2H1B A;  3E3E A;  3EU4 A;  2VCV A;  3FEU A;  4HI7 A;  2JZS A;  5H5Q A;  1YEP A;  5CRH A;  2C3N A;  3HJM A;  2HZF A;  4LMV A;  3F9U A;  4BVY A;  2BTO T;  2EIR A;  1BAY A;  2RM6 A;  5J9C A;  1FG4 A;  1GNE A;  3APO A;  1BG5 A;  3D21 A;  2AYT A;  1OC8 A;  5G5F A;  2F8A A;  3CXG A;  2H1D A;  3DYR A;  3KH7 A;  3D22 A;  1X5D A;  4ISD A;  2H6Z A;  1MDK A;  4AF2 A;  1EZK A;  5IMD A;  4LLR A;  2F9S A;  4NHW A;  1KNG A;  2CQ9 A;  1TRV A;  1YJ6 A;  2B7K A;  4LA1 A;  1Q98 A;  1R5A A;  3FZA A;  4ZXG A;  3BD2 A;  2PGT A;  3GFK A;  1ZYQ B;  2OJL A;  3Q19 A;  1Y6E A;  1TKD B;  3ERG A;  1J9B A;  3MWH A;  4KA0 A;  2CAQ A;  4K8M A;  2OKA A;  1O7U A;  2MBT A;  6GSX A;  1PN9 A;  1GH2 A;  1U3A A;  1SL0 B;  3ZZX A;  2HYX A;  5ECK B;  2P5R A;  4OCE A;  2A2R A;  3E0U A;  3LOR A;  5D9V A;  4V2N A;  4YH2 A;  2JSY A;  1QQ2 A;  1EWX A;  3MSZ A;  4JE1 A;  2ALB A;  4EC0 A;  3HVS A;  4WXT A;  3J7Y b;  1Z7P A;  5INY A;  2H74 A;  3TKS A;  3A2V A;  3TKS E;  4J57 E;  4MPF A;  2V6O A;  3F4T A;  1J08 A;  5J3R A;  2P31 A;  1V98 A;  1A24 A;  3QMX A;  2K6V A;  1EV9 A;  1RQM A;  2DJ2 A;  1ZGN A;  2J23 A;  3GN3 A;  3ZVJ A;  2JZT A;  3VWU A;  4FO5 A;  4HJM A;  2GQK A;  2H1G A;  5KN1 A;  1G7E A;  3GSS A;  3EU3 A;  4IP1 A;  5H5R A;  4DSR A;  1AQV A;  2VL3 A;  1VF3 A;  1O8X A;  2BJX A;  2YAN A;  5IO2 A;  2WRT A;  2VL2 A;  1AUC A;  2C0E A;  2B5X A;  4NMU A;  4N10 A;  3KH9 A;  3A2W A;  4TXO B;  1JFU A;  2B5Y A;  4OFM A;  3C71 A;  2DJ1 A;  1DE2 A;  5GSS A;  5E4W A;  1GSS A;  4WF5 A;  14GS A;  2JU5 A;  10GS A;  4PQH A;  2G2Q A;  5ECL B;  2GDR A;  4GSN A;  3VWW A;  2FWE A;  2HRA A;  3UEM A;  4ZIJ A;  5JCG A;  3S9F A;  3VFI A;  2YWI A;  3F63 A;  1TK0 B;  2DC5 A;  2DBC A;  5A4V A;  3VI7 A;  2YN1 A;  3QAG A;  1PL1 A;  2MBS A;  4WR4 A;  3GUS A;  2C3Q A;  4BWS A;  2X99 A;  1G0T A;  2KOK A;  3IK7 A;  4ZBB A;  3KEB A;  2L5L A;  4CW9 A;  4PGT A;  1H75 A;  2DMM A;  5AN1 A;  3CTG A;  5CNW A;  2R6K A;  1HD2 A;  4X1U A;  2DLX A;  2XBQ A;  3UVH A;  1OC9 A;  4ID0 A;  2JSZ A;  5IMA A;  3TOU A;  1GSQ A;  1PKZ A;  3ME8 A;  18GS A;  3PIN A;  3TOT A;  4D73 B;  4GQF A;  3UJ1 A;  3NZN A;  3H8Q A;  1TOF A;  1K0N A;  1F9M A;  2ZCT A;  4I5Q A;  5B7C A;  2HNL A;  5BMU A;  16GS A;  3HCZ A;  1GTB A;  3H79 A;  2YV7 A;  3U5R E;  3A5W A;  1MD3 A;  1PGT A;  2ES7 A;  4Q5R A;  1M2D A;  4OFT A;  5G31 A;  4BL7 A;  1PQN A;  3FKF A;  9GSS A;  1O73 A;  1VRS D;  4EO3 A;  1K0B A;  3FK8 A;  5E59 A;  3CBU A;  3W6G A;  4POB A;  3QR6 A;  3QPM A;  4ZBA A;  3ME7 A;  1JHB A;  4ILF A;  2H6X A;  20GS A;  4BL7 B;  3QD9 A;  1ST9 A;  4RUV A;  2LQQ A;  4ZB8 A;  4ECC A;  1A0F A;  2AB6 A;  3BOA A;  4GF0 A;  2CX3 A;  4XS4 B;  1EOH A;  5IOW A;  5GAN D;  2LJA A;  3N5O A;  2C4J A;  4N0V A;  4F0B A;  3ZML A;  3WGE A;  3KM6 A;  1Z5Y E;  4FH8 A;  5ECQ B;  1JZD A;  2EIO A;  3ZRE A;  2HRK A;  3CSI A;  2GZP A;  4XS4 A;  6GSY A;  5B6M A;  1BJX A;  5ECN B;  4K2D A;  5DAK B;  3JCM L;  1QUW A;  3LEF A;  2GZZ A;  4IJI A;  1WOU A;  2VOC A;  2H70 A;  1V57 A;  5D93 A;  1R4W A;  3EUR A;  4KB3 A;  4MMM A;  1RW1 A;  3KMO A;  1EV4 A;  5ECR B;  4ML1 A;  2NVL A;  1UA5 A;  3GV1 A;  3RHB A;  3TCO A;  2JZR A;  4EE0 A;  2H66 A;  1ERV A;  5DJM A;  3IAM 2;  2RII A;  2HI7 A;  5EY6 A;  2I81 A;  4POM A;  1GNW A;  3FRC A;  2GT5 A;  3ED3 A;  3F4S A;  1WRY A;  4AGS A;  5D9W A;  3V1W A;  3CYN A;  4FQU A;  3WGD A;  3GMF A;  3GA4 A;  2CA8 A;  5C00 A;  2E2M A;  4PUA A;  2LRN A;  2PN8 A;  1OKT A;  4L8E A;  6GSW A;  3NIV A;  4POK A;  2RUF A;  1SD9 A;  1K3O A;  2LRT A;  1SL2 B;  1M0U A;  1WPI A;  3EWL A;  3QFA C;  3TJK A;  4KAE A;  2I4A A;  3IOS A;  4PXO A;  1V58 A;  4FYB A;  4IN0 A;  4KUN A;  2F51 A;  3IHQ A;  1ERT A;  1J0F A;  3F6F A;  2VLV A;  1GWC A;  3FR6 A;  6GSS A;  1M7T A;  4I2T A;  3TRQ A;  3M3M A;  4KGI A;  1MTC A;  2O89 A;  1TI1 A;  1DE1 A;  3GH9 A;  2H6Y A;  1YDK A;  2O85 A;  2LNT A;  5D9X A;  4TXV A;  1ML6 A;  3VUR A;  3HHV A;  1HNB A;  2B6M A;  3DRN A;  4YAP A;  3TUE A;  1QXH A;  1FVJ A;  1OAZ A;  3FR9 A;  4ZB6 A;  2HRK B;  1SL1 B;  1WE0 A;  4JED A;  4USS A;  3KXO A;  4Q5F A;  4IP6 A;  4Z7X A;  1Z6N A;  4BPY A;  5DAL A;  2YP6 A;  1AC1 A;  2IPA A;  2FNO A;  4MF7 A;  1THX A;  2EC4 A;  5CO3 A;  4LL4 B;  3BBY A;  2YZU A;  4GQC A;  1T00 A;  5LNK e;  1CQG A;  1C72 A;  1GSU A;  3ISO A;  4IVF A;  1B4Q A;  3IK9 A;  1EEM A;  4PNF A;  2M80 A;  5LCZ A;  1XWK A;  3HD5 A;  1KTE A;  2GQL A;  5L71 A;  2R5G A;  2HSN B;  2K9F A;  3KIJ A;  3DGQ A;  3G7I A;  2H01 A;  2E7P A;  2VCW A;  3A2X A;  4NV2 A;  2ON5 A;  2PWJ A;  2HT9 A;  1TW9 A;  2LST A;  1SYR A;  4ECI A;  1B48 A;  1USB A;  5FHI A;  3RBT A;  1V40 A;  4O92 A;  5HFG A;  3FYG A;  2D2Z A;  1OE7 A;  4MA9 A;  5CRD A;  1TU8 A;  5J5N A;  1BX9 A;  1U6T A;  4KSM A;  3MNG A;  2KP2 A;  2IJY A;  1I9D A;  2OAD A;  3IXR A;  1EGO A;  4TVE A;  4V2L A;  2IFQ B;  1XBS A;  1SEN A;  4AJ6 A;  2LEG A;  8GSS A;  5A5K A;  1Z6M A;  5ECM B;  1X9S B;  4YQV A;  2V6K A;  2L4C A;  3ZFL A;  4GSS A;  4O5R A;  3P90 A;  4EKZ A;  2JL4 A;  1GSY A;  4QL9 A;  2VO4 A;  2FWG A;  3CRT A;  4IQA A;  3BJ5 A;  1GLQ A;  5EPF A;  3NOF A;  2LKU A;  2FWH A;  1GUH A;  3UIW A;  3DWV A;  1A2M A;  4OD7 A;  3ZTL A;  1G6Y A;  2HZE B;  2LS5 A;  4G0I A;  1U3I A;  4IW9 A;  2L5O A;  1U87 A;  4V2M A;  3P8W A;  4HS1 A;  3A3T A;  4L0U A;  4TR4 A;  3R3E A;  3C8E A;  1X5C A;  4Q5N A;  2M46 A;  2WUL A;  3VLN A;  2P0G A;  3VWV A;  3DEX A;  4ULX A;  5DQS A;  2PBJ A;  4J2F A;  4F2I A;  4MZW A;  4X43 A;  4HQZ A;  4KCA A;  5GZZ B;  3FZ5 A;  2NTO A;  1YZX A;  1KEB A;  3EYT A;  4ZL8 A;  2FCH A;  2CVK A;  4WEY A;  1MEK A;  3I43 A;  1YQ1 A;  3C7M A;  5D73 A;  3CTF A;  4NXI A;  1PX7 A;  4G19 A;  3F6D A;  2DIZ A;  3SWL A;  2VM1 A;  1F3B A;  1PSQ A;  2QSI A;  3H93 A;  2C8U A;  2MYG A;  1QMV A;  5HFI A;  1OVN A;  3GUR A;  4XIH A;  2VAF A;  4HU9 A;  2YWN A;  2HSH A;  2LNS A;  5IM9 A;  2OE1 A;  1T7P B;  2B5E A;  4EVM A;  4QQ7 A;  4NHZ A;  4G10 A;  1PL2 A;  3I9V 2;  2WFC A;  3M9J A;  1TU7 A;  2FY6 A;  5C04 A;  3ERW A;  4WF4 A;  1M9A A;  2A2S A;  1K0M A;  1XPV A;  1QGV A;  1XWB A;  5KN2 A;  2DJJ A;  2YNX A;  2IMI A;  1R26 A;  2WS2 A;  5DDL A;  4TR1 B;  5IMF A;  4GXZ A;  3GNJ A;  3TJG A;  4BVX B;  2WZ9 A;  1QFN A;  1YKC A;  1R7H A;  2H0H A;  2WGR A;  2XPE A;  2HE3 A;  1YF1 A;  1ERW A;  2OE3 A;  3L9S A;  1GL8 A;  1GTU A;  2FA8 A;  2L6D A;  5H5S A;  2H30 A;  4PTS A;  4WKW A;  4FIW A;  3APS A;  1OE8 A;  3DXB A;  6GSV A;  3P7X A;  3UBK A;  5GST A;  1S3C A;  3HJP A;  1XVQ A;  4L5L A;  3UAR A;  3GIX A;  5IO0 A;  2CV4 A;  4JR4 A;  1WJK A;  5FT3 A;  4HZ2 A;  4KCE A;  3ZFB A;  1M99 A;  3M1G A;  1XXU A;  1S3A A;  3KP9 A;  3GKM A;  2IL3 A;  1TTZ A;  4HZ4 A;  3TKR A;  3F3Q A;  2LTK A;  4G9H A;  3EMP A;  4O7H A;  2B3S A;  1THO A;  3WD6 A;  4V1A g;  3UAP A;  4MCU A;  3HVX A;  3UL3 A;  1JZO A;  5JWO B;  5F05 A;  2GLR A;  2KHP A;  1NM3 A;  5JCU A;  2FUG 2;  1SJI A;  1ZOF A;  4MJB A;  4IJ3 A;  2CAI A;  3LQ7 A;  1XWC A;  2CVD A;  1OC9 B;  1K0C A;  2C0F A;  4YQU A;  3ERF A;  5DJL A;  1MDJ A;  3TJB A;  2YCD A;  5ECH B;  3L9V A;  3M8N A;  3TKS C;  4HJ2 A;  5D9T A;  4I2U A;  4L5O A;  3VWX A;  5HR0 A;  5G1L A;  4X0X A;  1O85 A;  4GST A;  3I69 A;  1ZMA A;  4JZQ A;  4MAB A;  1M2B A;  5CRW A;  3HVV A;  2MZC A;  2AAW A;  4NPB A;  2I3Y A;  2VLU A;  3C73 A;  2RM5 A;  4KW6 A;  5B8B A;  3GX0 A;  3HZ4 A;  2H76 A;  4TKY A;  3Q6O A;  5KN3 A;  3IDV A;  3K8N A;  3Q18 A;  2AV4 A;  4XRA A;  1GTA A;  4P3Y B;  5B6N A;  2TRC P;  1K0D A;  2WCI A;  2FLS A;  4K0N A;  3IE3 A;  2H71 A;  1XWG A;  3HY2 A;  5CAX A;  1NHO A;  4KE3 A;  3LYP A;  2PU9 C;  5LD0 A;  4BVX A;  3GKX A;  3IPZ A;  4PUR A;  1SU9 A;  3DIE A;  3GL5 A;  4AJ7 A;  3L9U A;  3QAW A;  3QAV A;  1TXX A;  5ELG A;  4ML6 A;  4HDE A;  1XWA A;  1WIK A;  1Z3E A;  3ZVJ D;  3IBH A;  4PQI A;  2PER A;  2YV9 A;  3E9J B;  4IQ1 A;  2L59 A;  2PVO C;  4WBJ A;  4GWR A;  4DSS A;  2MMN A;  2CX4 A;  5DBQ A;  4IEL A;  3IRA A;  5D96 A;  5AIX A;  5F06 A;  1SKW B;  5HQP A;  2FGX A;  1A2L A;  1V2A A;  3OR5 A;  2IN3 A;  1BED A;  2IMF A;  3TRP A;  2LJR A;  3H1N A;  1ZL9 A;  2V41 A;  1K0O A;  1DSB A;  1EOG A;  1Z7R A;  3CRU A;  2L57 A;  3UVT A;  1YEX A;  3WT1 A;  1FB0 A;  1AIU A;  1S3D A;  2GGT A;  22GS A;  3WYW A;  1MD4 A;  1XVW A;  2CZ2 A;  2ZNM A;  5EL8 A;  1VF1 A;  1X9W B;  1TRU A;  1KBN A;  4GLT A;  4FYC A;  2PUK C;  1XZO A;  2YOI A;  4CDO A;  2FA4 A;  5IIZ A; 
#chains in the Genus database with same CATH topology
 3MDK A;  1OC3 A;  5G2Z A;  4MZB A;  4AJ8 A;  2TRX A;  4K0G A;  1AAZ A;  1E2Y A;  3TDG A;  1T4Y A;  1VF4 A;  5KOW A;  2B7J A;  2O87 A;  3US3 A;  1F2E A;  1GLP A;  4MJE A;  1TP9 A;  1Q4J A;  4NWY A;  5G5E A;  4XS1 A;  5G30 A;  3TKQ A;  5COH A;  3DVX A;  4I6X A;  2RLI A;  4MF6 A;  4K7N A;  4TXO A;  3GRX A;  4JU5 A;  3RHC A;  2BMX A;  4TRX A;  1S3R A;  1G6W A;  4DVC A;  4DSQ A;  2V2G A;  4OCF A;  4F0C A;  1M3I A;  2X8C A;  5F07 A;  1M9B A;  2AUV A;  2H8L A;  5DQY A;  2HSM B;  4HUA A;  3APQ A;  1HNA A;  5A5H A;  5ECI B;  1M2A A;  1T4Z A;  3PGT A;  2H73 A;  2YJ7 A;  3IA1 A;  4MPG A;  3PH9 A;  1B9X C;  1A0R P;  4PX1 A;  2GSR A;  4KX4 A;  5IOX A;  3M9K A;  3AY8 A;  5HFK A;  1PMT A;  2L6C A;  2OBI A;  1F3A A;  1SK2 A;  3VK9 A;  4QL7 A;  1N25 A;  2NBS A;  5CRG A;  4OFN A;  3LFL A;  3CMI A;  3DD3 A;  3VPT A;  4K7I A;  5DVB A;  2X8H A;  2VCX A;  4O32 A;  5ABR A;  1M3J A;  4FXY P;  1OKD A;  2GT6 A;  1GSF A;  1SKR B;  2GSS A;  4MZC A;  2L4Q A;  4K9Z A;  3GYK A;  5J41 A;  3FZ4 A;  1AXD A;  3F3R A;  1SYX A;  4WBR D;  4K6X A;  1T1V A;  1SKS B;  2RUE A;  4KF9 A;  2HZE A;  17GS A;  1FB6 A;  3L4N A;  2YJH A;  3D0Z A;  2VIM A;  1E6B A;  2GST A;  1GP1 A;  2GVP A;  2IME A;  4MH3 A;  4WR5 A;  1B8X A;  1T3B A;  5ECS A;  1JLV A;  1FHE A;  2FHE A;  1O8W A;  3Q74 A;  2E0Q A;  4OMV A;  1PKW A;  3LGC A;  2I1U A;  1TDI A;  1ZYE A;  2MMA A;  3O6T A;  1DUG A;  1K0A A;  2N5F A;  2O5V A;  2LUS A;  4KDX A;  4XS6 A;  4D73 A;  2UZ8 A;  3HA9 A;  2OAC A;  4FYU A;  4IGJ A;  5J47 A;  5IMZ A;  1UVZ A;  3DML A;  3VI5 A;  1A2J A;  2R3X A;  1ZCP A;  4A5P A;  4F82 A;  1R5P A;  3QFB C;  2JAC A;  2X64 A;  13GS A;  2TIR A;  2GQM A;  5IQY A;  2GSQ A;  4L0W A;  1ZYN A;  4KSO A;  4TR1 A;  4EF0 A;  4EDY A;  4AI6 A;  3IC8 A;  1BYE A;  5F8B A;  1NW2 A;  5ID2 B;  2QC7 A;  2DML A;  2QGV A;  4EDZ A;  3EE2 A;  3FR3 A;  1B4P A;  3BCK A;  5AGY A;  1EGR A;  4O5U A;  1WWJ A;  4IBP A;  3FY7 A;  5KEJ A;  1ON4 A;  2XC2 A;  2WW1 A;  3HJO A;  4MDC A;  1PD2 1;  2AJQ B;  1GUK A;  3EPT A;  3L78 A;  3D4T A;  3CSH A;  4PNG A;  1XW5 A;  2K8S A;  3R2Q A;  2M72 A;  1FW1 A;  4JRR A;  5IMV A;  3ZYW A;  2VLT A;  1ERU A;  5IPG A;  3MYD A;  1DBY A;  3KJY A;  1AQW A;  1X0R A;  2V1M A;  2V32 A;  2VCZ A;  4EXJ A;  5DCG A;  4QMK A;  4NV5 A;  2DJ3 A;  3GHA A;  1GSE A;  1RK4 A;  1YF0 A;  1SK1 A;  1GUM A;  4NAX A;  3KP8 A;  1PFO A;  2H0I A;  3HYP A;  4N0Z A;  4OWY A;  2VD1 A;  4YKG A;  1H4O A;  4ZL9 A;  4JR6 A;  4N30 A;  3BCI A;  1YVL A;  1JZW A;  3LW9 A;  1IYI A;  1G7O A;  4IHU A;  2VM2 A;  3L0H A;  3EC3 A;  3HKR A;  2HXK A;  2B1L A;  2NPB A;  2G0F A;  1N2A A;  3J7Y k;  4OO5 A;  3TRX A;  5KN0 A;  1GSD A;  3RPP A;  3GH6 A;  2WVZ A;  4AKI A;  3GL3 A;  3RAZ A;  3O76 A;  2K8V A;  3RDW A;  2Z9S A;  2MMO A;  2B1K A;  4ZBD A;  4IKH A;  2C0G A;  4E8E A;  2MMZ A;  5ENU A;  2A4V A;  2EFD A;  5DAL B;  2H72 A;  4I97 A;  4F9Z A;  2HRF A;  4XHM A;  7GSS A;  5IPH A;  4G2E A;  3IAS 2;  1JZR A;  2OBK A;  2CZ3 A;  6GSU A;  1QK8 A;  2C80 A;  5CRE A;  3QOU A;  1GRX A;  19GS A;  1XW6 A;  1FO5 A;  2H1A A;  2YWO A;  2DIY A;  3W8S A;  1SK0 A;  1SJZ A;  2E2G A;  4KND A;  1SVM A;  1UC7 A;  2FD3 A;  2QKE A;  3VPQ A;  1S4B P;  3GTU A;  1TK8 B;  5ID2 A;  3TJF A;  4XTS A;  2O8V B;  3F4R A;  3GTU B;  4POL A;  1I5G A;  2KP1 A;  3EIN A;  3GKN A;  2R2J A;  2EIQ A;  3O3T A;  1LJR A;  2IIY A;  3F8U A;  1O81 A;  1U88 A;  3N9J A;  1WP0 A;  1HNC A;  5CYY A;  2XBI A;  4K1F A;  5HR3 A;  3G9B A;  4XRD A;  1WMJ A;  3GST A;  5A1N A;  1MDI A;  2VD0 A;  3EMX A;  4H86 A;  1F37 A;  2NDO A;  4F03 A;  2N5B A;  3PPU A;  1VF2 A;  4ECB A;  2ON7 A;  1URM A;  5HR1 A;  2CT6 A;  2WW0 A;  3MAK A;  5A4U A;  3FZ9 A;  1T8E B;  4V1A p;  5ELA A;  3U6V A;  4EUY A;  4G0L A;  4WET A;  1TI3 A;  5J4U A;  2IWT A;  5JWR B;  4OO4 A;  4K7O A;  1CQH A;  1HQO A;  2ZUP A;  3DVW A;  5ECP B;  2H1L A;  2LJK A;  4HEA 2;  3TGZ A;  3LJR A;  1O6J A;  2YWM A;  4TOP A;  1W89 A;  4GRF A;  3LXT A;  3UBL A;  2O36 A;  4ECJ A;  2VUP A;  2HSM A;  5DAK A;  3LG6 A;  5JWQ B;  3LXZ A;  1PA3 A;  2R0C A;  3GX8 A;  3KTB A;  4MJC A;  2WJU A;  2KUC A;  4G0K A;  4GTU A;  3D4M A;  3ZL5 A;  3EVI A;  1FAA A;  4BA7 A;  1BQ7 A;  3KCM A;  2C1Y A;  3ZLP A;  1F6M C;  1AW9 A;  3MIX A;  1XG8 A;  1XCC A;  3G7Y A;  1A8Y A;  1VGL A;  3HZ8 A;  2DJ0 A;  3ZIT A;  2PMT A;  4YQM A;  1SD8 A;  2REM A;  2DSA A;  2CVB A;  4LMW A;  4MP4 A;  2PPT A;  3C1R A;  1TRW A;  4YAV A;  2X8G A;  2VCQ A;  2GZY A;  4PI2 C;  4MJA A;  5D8I A;  3D5J A;  2WDU A;  1TRS A;  3HXS A;  4BIK A;  4J56 E;  1V9W A;  4ZL7 A;  2QA1 A;  4RI6 A;  1TJD A;  1LU4 A;  2DJK A;  1X9M B;  4TN8 A;  2HLS A;  3TKP A;  5CP1 A;  2DKH A;  2J9H A;  2C0D A;  1IYH A;  2YPM A;  5JCW A;  3RFR C;  1XOB A;  4BVY B;  12GS A;  5F0G A;  2K18 A;  1TK5 B;  5A4W A;  5ECO B;  2N5A A;  3FW2 A;  4I8B A;  2LRC A;  3D6I A;  2IFQ A;  3TJJ A;  1JLW A;  2F8F A;  4RQR A;  3LSZ A;  2P5Q A;  1K3L A;  2H0G A;  2R0G A;  1OYJ A;  5DCH A;  5J4Y A;  3IC4 A;  1AQX A;  1ABA A;  4Q5Q A;  4GCI A;  2H75 A;  1YKA A;  4HOJ A;  1W4V A;  3C1S A;  3LWA A;  3DKS A;  4CHS A;  1X5E A;  4N11 A;  4DEJ A;  3WGX A;  1B9Y C;  2KLX A;  3ZIV A;  4DSS B;  3CSJ A;  3G7J A;  1ILO A;  1PX6 A;  2F3M A;  2X4A A;  1ZZY A;  3KZQ A;  4LL1 B;  3ZMK A;  4MK3 A;  2R37 A;  1ACV A;  4TR0 A;  4N3Z A;  4XCS A;  4MF5 A;  4ZB9 A;  4TR3 A;  3P2A A;  1SJ6 A;  4KDY A;  3SBC A;  2HQT A;  3ZIJ A;  1FOV A;  4MH2 A;  3F0I A;  2OA7 A;  4ZIL A;  2XHF A;  3FHK A;  2HFD A;  3QCP A;  4EIP A;  5J9B A;  2GTU A;  2LV3 A;  1XW9 A;  2HSY A;  4EL1 A;  3ZRD A;  3W8J A;  11GS A;  4E8H A;  3UOM A;  5HR2 A;  4RQX A;  1Y25 A;  1GTI A;  5IMC A;  4PUF C;  5EVO A;  2I9H A;  2LQO A;  2VL9 A;  4KDU A;  3M0F A;  1GUL A;  1UN2 A;  3IR4 A;  1A23 A;  2VCT A;  3RPN A;  1TXU A;  1FVK A;  1A8L A;  2YZH A;  2O7K A;  2IMK A;  1NHY A;  3KGK A;  4RI7 A;  1EP8 A;  3UMA A;  3TB2 A;  2PVQ A;  3I6A A;  5AIV A;  4BWQ A;  4IS0 A;  1I1I P;  2A4H A;  2HRN A;  4ACS A;  4KH7 A;  4MLY A;  1XFL A;  3LYK A;  2H19 A;  4TW5 A;  4HU7 A;  1Z9H A;  1HYU A;  3HVN A;  2JAD A;  1K3Y A;  2GS3 A;  3KD0 A;  3KMN A;  2VL2 C;  3WT2 A;  3GKK A;  2AHE A;  2XPD A;  3KTL A;  4PQ1 A;  4HQS A;  2IMD A;  1EP7 A;  2C3T A;  1NSW A;  3PR8 A;  1XIY A;  1LBK A;  5FWG A;  2FWF A;  1N8J A;  1PRX A;  2EFE A;  3IV4 A;  4JBB A;  1XOA A;  3QDN A;  3HDC A;  5AIS A;  6GST A;  5G1K A;  2R4V A;  3H4K A;  5GAP D;  1YY7 A;  2WB9 A;  1EEJ A;  5B8A A;  2OE0 A;  2H1B A;  3E3E A;  3EU4 A;  2VCV A;  3FEU A;  4HI7 A;  2JZS A;  2WW3 A;  5H5Q A;  1YEP A;  5CRH A;  2C3N A;  3HJM A;  2HZF A;  4LMV A;  3F9U A;  4W66 A;  4BVY A;  4PHZ C;  2BTO T;  2EIR A;  1BAY A;  2RM6 A;  5J9C A;  1FG4 A;  1GNE A;  3APO A;  1BG5 A;  3D21 A;  2AYT A;  1OC8 A;  5G5F A;  2F8A A;  3CXG A;  2H1D A;  3DYR A;  3KH7 A;  3IHG A;  3D22 A;  1X5D A;  4ISD A;  2H6Z A;  1MDK A;  4AF2 A;  1EZK A;  5IMD A;  4LLR A;  2F9S A;  4NHW A;  1KNG A;  2CQ9 A;  1TRV A;  1YJ6 A;  4AKH A;  2B7K A;  4LA1 A;  1Q98 A;  1R5A A;  3FZA A;  4ZXG A;  4ICY A;  3BD2 A;  2PGT A;  3GFK A;  1ZYQ B;  2OJL A;  3Q19 A;  1Y6E A;  1TKD B;  3ERG A;  1J9B A;  3MWH A;  4KA0 A;  2CAQ A;  4K8M A;  2OKA A;  1O7U A;  2MBT A;  6GSX A;  1PN9 A;  1GH2 A;  1U3A A;  1SL0 B;  3ZZX A;  2HYX A;  5ECK B;  2P5R A;  4OCE A;  2A2R A;  3E0U A;  3LOR A;  5D9V A;  4V2N A;  4YH2 A;  2JSY A;  1QQ2 A;  1EWX A;  3MSZ A;  5BRT A;  4JE1 A;  2ALB A;  4EC0 A;  3HVS A;  4WXT A;  3J7Y b;  1Z7P A;  5INY A;  2H74 A;  3TKS A;  3A2V A;  3TKS E;  4J57 E;  4MPF A;  2V6O A;  3F4T A;  1J08 A;  5J3R A;  2P31 A;  1V98 A;  1A24 A;  3QMX A;  2K6V A;  1EV9 A;  1RQM A;  2DJ2 A;  4PI0 C;  1ZGN A;  2J23 A;  3GN3 A;  3ZVJ A;  2JZT A;  3VWU A;  4FO5 A;  4HJM A;  2GQK A;  2H1G A;  5KN1 A;  1G7E A;  3GSS A;  3EU3 A;  4IP1 A;  5H5R A;  4DSR A;  1AQV A;  2VL3 A;  2R0P A;  1VF3 A;  1O8X A;  2BJX A;  2YAN A;  5IO2 A;  2WRT A;  2VL2 A;  1AUC A;  2C0E A;  2B5X A;  4NMU A;  4N10 A;  3KH9 A;  3A2W A;  4TXO B;  4YKF A;  1JFU A;  2B5Y A;  4OFM A;  3C71 A;  2DJ1 A;  1DE2 A;  5GSS A;  5E4W A;  1GSS A;  3HMJ G;  4WF5 A;  14GS A;  2JU5 A;  10GS A;  4PQH A;  2G2Q A;  5ECL B;  2GDR A;  4GSN A;  3VWW A;  2FWE A;  2HRA A;  3UEM A;  4ZIJ A;  5JCG A;  3S9F A;  3VFI A;  2YWI A;  3F63 A;  1Y1U A;  1TK0 B;  2DC5 A;  2DBC A;  5A4V A;  3VI7 A;  2YN1 A;  3QAG A;  1PL1 A;  2MBS A;  4WR4 A;  3GUS A;  2C3Q A;  4BWS A;  2X99 A;  1G0T A;  2KOK A;  3IK7 A;  4ZBB A;  3KEB A;  2L5L A;  4CW9 A;  5BMU B;  4PGT A;  1H75 A;  2DMM A;  5AN1 A;  3CTG A;  5CNW A;  2R6K A;  1HD2 A;  2X49 A;  4X1U A;  2DLX A;  2XBQ A;  3UVH A;  1OC9 A;  4ID0 A;  2JSZ A;  5IMA A;  3TOU A;  1GSQ A;  1PKZ A;  3ME8 A;  18GS A;  3PIN A;  3TOT A;  4D73 B;  4GQF A;  3UJ1 A;  3NZN A;  3H8Q A;  1TOF A;  1K0N A;  1F9M A;  2ZCT A;  4I5Q A;  3RGB C;  5B7C A;  2HNL A;  5BMU A;  16GS A;  3HCZ A;  1GTB A;  3H79 A;  2YV7 A;  3U5R E;  3A5W A;  3TU3 B;  1MD3 A;  1PGT A;  2ES7 A;  4Q5R A;  1M2D A;  4OFT A;  5G31 A;  4BL7 A;  1PQN A;  3FKF A;  9GSS A;  3CHX C;  4GDF A;  1O73 A;  1VRS D;  4EO3 A;  1K0B A;  1SVL A;  3FK8 A;  5E59 A;  2A2P A;  3CBU A;  3W6G A;  4POB A;  3QR6 A;  3QPM A;  4ZBA A;  3ME7 A;  1JHB A;  4ILF A;  2H6X A;  20GS A;  4BL7 B;  3QD9 A;  1SVO A;  1ST9 A;  4RUV A;  2LQQ A;  4ZB8 A;  4ECC A;  1A0F A;  2AB6 A;  4E68 A;  3BOA A;  4GF0 A;  2CX3 A;  4XS4 B;  1EOH A;  5IOW A;  5GAN D;  2LJA A;  3N5O A;  2C4J A;  4N0V A;  4F0B A;  4K5R A;  3ZML A;  3WGE A;  3KM6 A;  4EIQ A;  1Z5Y E;  4FH8 A;  5ECQ B;  1JZD A;  2EIO A;  3ZRE A;  2HRK A;  2UV8 G;  3CSI A;  5A34 B;  2GZP A;  4XS4 A;  6GSY A;  5B6M A;  1BJX A;  5ECN B;  4K2D A;  5DAK B;  3JCM L;  1QUW A;  3LEF A;  2GZZ A;  5A1N B;  4IJI A;  1WOU A;  2VOC A;  2H70 A;  1V57 A;  5D93 A;  1R4W A;  3EUR A;  4KB3 A;  2QA2 A;  4MMM A;  1RW1 A;  3KMO A;  1EV4 A;  5ECR B;  4ML1 A;  2NVL A;  1UA5 A;  3GV1 A;  1BG1 A;  3RHB A;  3TCO A;  2JZR A;  4EE0 A;  2H66 A;  1ERV A;  5DJM A;  3IAM 2;  2RII A;  5J4V A;  2HI7 A;  5EY6 A;  2I81 A;  4POM A;  1GNW A;  4Z2T A;  3FRC A;  2GT5 A;  3ED3 A;  3F4S A;  1WRY A;  4AGS A;  5D9W A;  3V1W A;  3CYN A;  4FQU A;  3WGD A;  3GMF A;  3GA4 A;  2CA8 A;  5C00 A;  2E2M A;  4PUA A;  2LRN A;  2PN8 A;  5J40 A;  1OKT A;  4L8E A;  6GSW A;  3NIV A;  4POK A;  2RUF A;  1SD9 A;  1K3O A;  2LRT A;  1SL2 B;  1M0U A;  1WPI A;  3EWL A;  3QFA C;  4MNN A;  3TJK A;  4KAE A;  2I4A A;  2O3E A;  4PXO A;  1V58 A;  3IOS A;  4FYB A;  4IN0 A;  4KUN A;  4CY8 A;  2F51 A;  3IHQ A;  1ERT A;  1J0F A;  3F6F A;  2VLV A;  1GWC A;  3FR6 A;  6GSS A;  1M7T A;  4I2T A;  3TRQ A;  3M3M A;  4KGI A;  1MTC A;  2O89 A;  1TI1 A;  1DE1 A;  3GH9 A;  2H6Y A;  1YDK A;  2O85 A;  2LNT A;  5D9X A;  4TXV A;  1ML6 A;  3VUR A;  3HHV A;  1HNB A;  2B6M A;  3DRN A;  4YAP A;  3TUE A;  1QXH A;  1FVJ A;  1OAZ A;  3FR9 A;  4ZB6 A;  2HRK B;  1SL1 B;  1WE0 A;  4JED A;  4USS A;  3KXO A;  4Q5F A;  4IP6 A;  4Z7X A;  2WVY A;  1Z6N A;  4BPY A;  5DAL A;  2YP6 A;  1AC1 A;  2IPA A;  2FNO A;  4MF7 A;  1THX A;  2EC4 A;  5CO3 A;  4LL4 B;  3BBY A;  2YZU A;  4GQC A;  1T00 A;  5LNK e;  1CQG A;  1C72 A;  1GSU A;  3ISO A;  4IVF A;  1B4Q A;  3IK9 A;  1EEM A;  4PNF A;  2M80 A;  5LCZ A;  1XWK A;  3HD5 A;  1KTE A;  2GQL A;  4G01 A;  2R5G A;  5L71 A;  2HSN B;  2K9F A;  3KIJ A;  4AKX B;  3DGQ A;  3G7I A;  2H01 A;  2E7P A;  2VCW A;  3A2X A;  4NV2 A;  2ON5 A;  2PWJ A;  2HT9 A;  1TW9 A;  2LST A;  1SYR A;  4ECI A;  1B48 A;  1USB A;  4AKG A;  5FHI A;  3RBT A;  1V40 A;  4O92 A;  5HFG A;  3FYG A;  1FOH A;  2D2Z A;  1OE7 A;  4MA9 A;  5CRD A;  1TU8 A;  5J5N A;  1BX9 A;  1U6T A;  4KSM A;  3MNG A;  2KP2 A;  2IJY A;  1I9D A;  2OAD A;  3IXR A;  3A5I A;  1EGO A;  4TVE A;  4V2L A;  2IFQ B;  1XBS A;  1SEN A;  4AJ6 A;  2LEG A;  8GSS A;  5A5K A;  1Z6M A;  5ECM B;  1X9S B;  4YQV A;  2V6K A;  2L4C A;  2WVX B;  3ZFL A;  4GSS A;  4O5R A;  3P90 A;  4EKZ A;  2JL4 A;  1GSY A;  4QL9 A;  2VO4 A;  2FWG A;  3CRT A;  1BF5 A;  4IQA A;  3BJ5 A;  1GLQ A;  5EPF A;  3NOF A;  2LKU A;  2FWH A;  1GUH A;  3UIW A;  5KOX A;  3DWV A;  1A2M A;  4OD7 A;  3ZTL A;  1G6Y A;  2HZE B;  2LS5 A;  4G0I A;  1U3I A;  4IW9 A;  2L5O A;  1U87 A;  3CQF A;  4V2M A;  3P8W A;  4HS1 A;  3A3T A;  4L0U A;  4TR4 A;  3R3E A;  2EFC A;  3C8E A;  1X5C A;  4Q5N A;  2M46 A;  2WUL A;  3VLN A;  2P0G A;  3VWV A;  3DEX A;  2VKZ G;  4ULX A;  5DQS A;  2PBJ A;  4J2F A;  4F2I A;  4MZW A;  4X43 A;  4CY6 A;  4HQZ A;  4KCA A;  5GZZ B;  3FZ5 A;  2NTO A;  1YZX A;  1KEB A;  3EYT A;  4ZL8 A;  2FCH A;  2CVK A;  4WEY A;  1MEK A;  3I43 A;  1YQ1 A;  2WZS A;  3C7M A;  5D73 A;  3CTF A;  4NXI A;  1PX7 A;  4G19 A;  3CWG A;  3F6D A;  2DIZ A;  3SWL A;  2VM1 A;  1F3B A;  1PSQ A;  2QSI A;  3H93 A;  2C8U A;  2MYG A;  1QMV A;  5HFI A;  1OVN A;  3GUR A;  4XIH A;  2VAF A;  4HU9 A;  2YWN A;  2HSH A;  2LNS A;  5IM9 A;  2OE1 A;  1T7P B;  2B5E A;  4EVM A;  4QQ7 A;  4NHZ A;  4G10 A;  1PL2 A;  3I9V 2;  2WFC A;  3M9J A;  1TU7 A;  4O5Q A;  2FY6 A;  5C04 A;  3ERW A;  4WF4 A;  1M9A A;  2A2S A;  1K0M A;  1XPV A;  1QGV A;  4K2X A;  1XWB A;  5KN2 A;  2DJJ A;  2YNX A;  2IMI A;  1R26 A;  2WS2 A;  5DDL A;  4TR1 B;  5A34 A;  5IMF A;  4GXZ A;  3GNJ A;  3TJG A;  4BVX B;  2WZ9 A;  1QFN A;  1YKC A;  1R7H A;  2H0H A;  2WGR A;  2XPE A;  2HE3 A;  1YF1 A;  1ERW A;  2OE3 A;  3L9S A;  1GL8 A;  1GTU A;  2FA8 A;  2L6D A;  5H5S A;  2H30 A;  1PN0 A;  4PTS A;  4WKW A;  4FIW A;  3APS A;  1OE8 A;  3DXB A;  6GSV A;  3P7X A;  3UBK A;  5GST A;  1S3C A;  3HJP A;  3FMW A;  1XVQ A;  4L5L A;  3UAR A;  3GIX A;  4Z2U A;  5IO0 A;  2CV4 A;  4JR4 A;  1WJK A;  5FT3 A;  4HZ2 A;  4KCE A;  3ZFB A;  1M99 A;  3M1G A;  1XXU A;  1S3A A;  3KP9 A;  3GKM A;  2IL3 A;  1TTZ A;  4HZ4 A;  3TKR A;  3F3Q A;  2LTK A;  4G9H A;  3EMP A;  4O7H A;  2B3S A;  1THO A;  3WD6 A;  4V1A g;  3UAP A;  4MCU A;  3HVX A;  3UL3 A;  1JZO A;  5JWO B;  5F05 A;  2GLR A;  2KHP A;  1NM3 A;  5JCU A;  2FUG 2;  2WVX A;  1SJI A;  1ZOF A;  4MJB A;  4IJ3 A;  4K5S A;  2CAI A;  3LQ7 A;  4ZB7 A;  1XWC A;  2CVD A;  1OC9 B;  1K0C A;  2C0F A;  4YQU A;  3ERF A;  5DJL A;  1MDJ A;  3TJB A;  2YCD A;  5ECH B;  3L9V A;  3M8N A;  3TKS C;  4HJ2 A;  5D9T A;  4I2U A;  4L5O A;  3VWX A;  5HR0 A;  5G1L A;  4X0X A;  1O85 A;  4GST A;  3I69 A;  1ZMA A;  4JZQ A;  4MAB A;  1M2B A;  5CRW A;  3HVV A;  2MZC A;  2AAW A;  4NPB A;  2I3Y A;  2HSN A;  2VLU A;  3C73 A;  2RM5 A;  4KW6 A;  5B8B A;  3GX0 A;  3HZ4 A;  5A5H B;  2H76 A;  4TKY A;  3Q6O A;  5KN3 A;  3IDV A;  3K8N A;  3Q18 A;  2AV4 A;  4XRA A;  1GTA A;  4P3Y B;  5B6N A;  2TRC P;  1K0D A;  2WCI A;  2FLS A;  4K0N A;  3IE3 A;  2H71 A;  1XWG A;  3HY2 A;  5CAX A;  2WW2 A;  1NHO A;  4KE3 A;  3LYP A;  2PU9 C;  5LD0 A;  4BVX A;  3GKX A;  3IPZ A;  4PUR A;  1SU9 A;  3DIE A;  3GL5 A;  4AJ7 A;  3L9U A;  3QAW A;  3QAV A;  1TXX A;  5ELG A;  4ML6 A;  4HDE A;  1XWA A;  1WIK A;  1Z3E A;  3ZVJ D;  4X4J A;  3IBH A;  2OT3 A;  4PQI A;  2PER A;  2YV9 A;  3E9J B;  4IQ1 A;  2L59 A;  4Z2R A;  2PVO C;  4WBJ A;  4GWR A;  1ZYP A;  4DSS A;  2MMN A;  2CX4 A;  5DBQ A;  4IEL A;  3IRA A;  5D96 A;  5AIX A;  5F06 A;  1SKW B;  5HQP A;  2FGX A;  1A2L A;  1V2A A;  3OR5 A;  2IN3 A;  1BED A;  2IMF A;  3TRP A;  2LJR A;  4HSC X;  3H1N A;  1ZL9 A;  2V41 A;  1K0O A;  1DSB A;  1EOG A;  1Z7R A;  3CRU A;  2L57 A;  3UVT A;  1YEX A;  3WT1 A;  1FB0 A;  1AIU A;  1S3D A;  2GGT A;  22GS A;  1YEW C;  3WYW A;  1MD4 A;  1XVW A;  2CZ2 A;  2ZNM A;  2EFH A;  1VF1 A;  5EL8 A;  1X9W B;  1TRU A;  1KBN A;  4GLT A;  4FYC A;  2PUK C;  1XZO A;  2YOI A;  4CDO A;  2FA4 A;  5IIZ A;  2DKI A; 
#chains in the Genus database with same CATH homology
 3MDK A;  1OC3 A;  5G2Z A;  4MZB A;  4AJ8 A;  2TRX A;  4K0G A;  1AAZ A;  1E2Y A;  3TDG A;  1T4Y A;  1VF4 A;  5KOW A;  2B7J A;  2O87 A;  3US3 A;  1F2E A;  1GLP A;  4MJE A;  1TP9 A;  1Q4J A;  4NWY A;  5G5E A;  4XS1 A;  5G30 A;  3TKQ A;  5COH A;  3DVX A;  4I6X A;  2RLI A;  4MF6 A;  4K7N A;  4TXO A;  3GRX A;  4JU5 A;  3RHC A;  2BMX A;  4TRX A;  1G6W A;  4DVC A;  4DSQ A;  2V2G A;  4OCF A;  4F0C A;  2X8C A;  5F07 A;  1M9B A;  2AUV A;  2H8L A;  5DQY A;  2HSM B;  4HUA A;  3APQ A;  1HNA A;  5A5H A;  5ECI B;  1M2A A;  1T4Z A;  3PGT A;  2H73 A;  2YJ7 A;  3IA1 A;  4MPG A;  3PH9 A;  1B9X C;  1A0R P;  4PX1 A;  2GSR A;  4KX4 A;  5IOX A;  3M9K A;  3AY8 A;  5HFK A;  1PMT A;  2L6C A;  2OBI A;  1F3A A;  1SK2 A;  3VK9 A;  4QL7 A;  1N25 A;  2NBS A;  5CRG A;  4OFN A;  3LFL A;  3CMI A;  3DD3 A;  3VPT A;  4K7I A;  5DVB A;  2X8H A;  2VCX A;  4O32 A;  5ABR A;  1OKD A;  2GT6 A;  1GSF A;  1SKR B;  2GSS A;  4MZC A;  2L4Q A;  4K9Z A;  3GYK A;  5J41 A;  3FZ4 A;  1AXD A;  3F3R A;  1SYX A;  4WBR D;  4K6X A;  1T1V A;  1SKS B;  2RUE A;  4KF9 A;  2HZE A;  17GS A;  1FB6 A;  3L4N A;  2YJH A;  3D0Z A;  2VIM A;  1E6B A;  2GST A;  1GP1 A;  2GVP A;  2IME A;  4MH3 A;  4WR5 A;  1B8X A;  1T3B A;  5ECS A;  1JLV A;  1FHE A;  2FHE A;  1O8W A;  3Q74 A;  2E0Q A;  4OMV A;  1PKW A;  3LGC A;  2I1U A;  1TDI A;  1ZYE A;  2MMA A;  3O6T A;  1DUG A;  1K0A A;  2N5F A;  2O5V A;  2LUS A;  4KDX A;  4XS6 A;  4D73 A;  2UZ8 A;  3HA9 A;  2OAC A;  4FYU A;  4IGJ A;  5J47 A;  5IMZ A;  1UVZ A;  3DML A;  3VI5 A;  1A2J A;  2R3X A;  1ZCP A;  4A5P A;  4F82 A;  1R5P A;  3QFB C;  2JAC A;  2X64 A;  13GS A;  2TIR A;  2GQM A;  5IQY A;  2GSQ A;  4L0W A;  1ZYN A;  4KSO A;  4TR1 A;  4EF0 A;  4EDY A;  4AI6 A;  3IC8 A;  1BYE A;  5F8B A;  1NW2 A;  5ID2 B;  2QC7 A;  2DML A;  2QGV A;  4EDZ A;  3EE2 A;  3FR3 A;  1B4P A;  3BCK A;  5AGY A;  1EGR A;  4O5U A;  1WWJ A;  4IBP A;  3FY7 A;  5KEJ A;  1ON4 A;  2XC2 A;  3HJO A;  4MDC A;  1PD2 1;  2AJQ B;  1GUK A;  3EPT A;  3L78 A;  3D4T A;  3CSH A;  4PNG A;  1XW5 A;  2K8S A;  3R2Q A;  2M72 A;  1FW1 A;  4JRR A;  5IMV A;  3ZYW A;  2VLT A;  1ERU A;  5IPG A;  3MYD A;  1DBY A;  3KJY A;  1AQW A;  1X0R A;  2V1M A;  2V32 A;  2VCZ A;  4EXJ A;  5DCG A;  4QMK A;  4NV5 A;  2DJ3 A;  3GHA A;  1GSE A;  1RK4 A;  1YF0 A;  1SK1 A;  1GUM A;  4NAX A;  3KP8 A;  2H0I A;  3HYP A;  4N0Z A;  4OWY A;  2VD1 A;  4YKG A;  1H4O A;  4ZL9 A;  4JR6 A;  4N30 A;  3BCI A;  1YVL A;  1JZW A;  3LW9 A;  1IYI A;  1G7O A;  4IHU A;  2VM2 A;  3L0H A;  3EC3 A;  3HKR A;  2HXK A;  2B1L A;  2NPB A;  2G0F A;  1N2A A;  3J7Y k;  4OO5 A;  3TRX A;  5KN0 A;  1GSD A;  3RPP A;  3GH6 A;  4AKI A;  3GL3 A;  3RAZ A;  3O76 A;  2K8V A;  3RDW A;  2Z9S A;  2MMO A;  2B1K A;  4ZBD A;  4IKH A;  2C0G A;  4E8E A;  2MMZ A;  5ENU A;  2A4V A;  2EFD A;  5DAL B;  2H72 A;  4I97 A;  4F9Z A;  2HRF A;  4XHM A;  7GSS A;  5IPH A;  4G2E A;  3IAS 2;  1JZR A;  2OBK A;  2CZ3 A;  6GSU A;  1QK8 A;  2C80 A;  5CRE A;  3QOU A;  1GRX A;  19GS A;  1XW6 A;  1FO5 A;  2H1A A;  2YWO A;  2DIY A;  3W8S A;  1SK0 A;  1SJZ A;  2E2G A;  4KND A;  1SVM A;  1UC7 A;  2FD3 A;  2QKE A;  3VPQ A;  3GTU A;  1TK8 B;  5ID2 A;  3TJF A;  4XTS A;  2O8V B;  3F4R A;  3GTU B;  4POL A;  1I5G A;  2KP1 A;  3EIN A;  3GKN A;  2R2J A;  2EIQ A;  3O3T A;  1LJR A;  2IIY A;  3F8U A;  1O81 A;  1U88 A;  3N9J A;  1WP0 A;  1HNC A;  5CYY A;  2XBI A;  4K1F A;  5HR3 A;  3G9B A;  4XRD A;  1WMJ A;  3GST A;  5A1N A;  1MDI A;  2VD0 A;  3EMX A;  4H86 A;  1F37 A;  2NDO A;  4F03 A;  2N5B A;  3PPU A;  1VF2 A;  4ECB A;  2ON7 A;  1URM A;  5HR1 A;  2CT6 A;  3MAK A;  5A4U A;  3FZ9 A;  1T8E B;  4V1A p;  5ELA A;  3U6V A;  4EUY A;  4G0L A;  4WET A;  1TI3 A;  5J4U A;  2IWT A;  5JWR B;  4OO4 A;  4K7O A;  1CQH A;  1HQO A;  2ZUP A;  3DVW A;  5ECP B;  2H1L A;  2LJK A;  4HEA 2;  3TGZ A;  3LJR A;  1O6J A;  2YWM A;  4TOP A;  1W89 A;  4GRF A;  3LXT A;  3UBL A;  4ECJ A;  2VUP A;  2HSM A;  5DAK A;  3LG6 A;  5JWQ B;  3LXZ A;  1PA3 A;  2R0C A;  3GX8 A;  3KTB A;  4MJC A;  2WJU A;  2KUC A;  4G0K A;  4GTU A;  3D4M A;  3ZL5 A;  3EVI A;  1FAA A;  4BA7 A;  1BQ7 A;  3KCM A;  2C1Y A;  3ZLP A;  1F6M C;  1AW9 A;  3MIX A;  1XCC A;  3G7Y A;  1A8Y A;  1VGL A;  3HZ8 A;  2DJ0 A;  3ZIT A;  2PMT A;  4YQM A;  1SD8 A;  2REM A;  2DSA A;  2CVB A;  4LMW A;  4MP4 A;  2PPT A;  3C1R A;  1TRW A;  4YAV A;  2X8G A;  2VCQ A;  2GZY A;  4MJA A;  5D8I A;  3D5J A;  2WDU A;  1TRS A;  3HXS A;  4J56 E;  1V9W A;  4ZL7 A;  2QA1 A;  4RI6 A;  1TJD A;  1LU4 A;  2DJK A;  1X9M B;  4TN8 A;  2HLS A;  3TKP A;  5CP1 A;  2DKH A;  2J9H A;  2C0D A;  1IYH A;  2YPM A;  5JCW A;  1XOB A;  4BVY B;  12GS A;  5F0G A;  2K18 A;  1TK5 B;  5A4W A;  5ECO B;  2N5A A;  3FW2 A;  4I8B A;  2LRC A;  3D6I A;  2IFQ A;  3TJJ A;  1JLW A;  2F8F A;  4RQR A;  3LSZ A;  2P5Q A;  1K3L A;  2H0G A;  2R0G A;  1OYJ A;  5DCH A;  5J4Y A;  3IC4 A;  1AQX A;  1ABA A;  4Q5Q A;  4GCI A;  2H75 A;  1YKA A;  4HOJ A;  1W4V A;  3C1S A;  3LWA A;  3DKS A;  4CHS A;  1X5E A;  4N11 A;  4DEJ A;  3WGX A;  1B9Y C;  2KLX A;  3ZIV A;  4DSS B;  3CSJ A;  3G7J A;  1ILO A;  1PX6 A;  2F3M A;  2X4A A;  1ZZY A;  3KZQ A;  4LL1 B;  3ZMK A;  4MK3 A;  2R37 A;  1ACV A;  4TR0 A;  4N3Z A;  4XCS A;  4MF5 A;  4ZB9 A;  4TR3 A;  3P2A A;  1SJ6 A;  4KDY A;  3SBC A;  2HQT A;  3ZIJ A;  1FOV A;  4MH2 A;  3F0I A;  2OA7 A;  4ZIL A;  2XHF A;  3FHK A;  2HFD A;  3QCP A;  4EIP A;  5J9B A;  2GTU A;  2LV3 A;  1XW9 A;  2HSY A;  4EL1 A;  3ZRD A;  3W8J A;  11GS A;  4E8H A;  3UOM A;  5HR2 A;  4RQX A;  1Y25 A;  1GTI A;  5IMC A;  4PUF C;  5EVO A;  2I9H A;  2LQO A;  2VL9 A;  4KDU A;  3M0F A;  1GUL A;  1UN2 A;  3IR4 A;  1A23 A;  2VCT A;  3RPN A;  1TXU A;  1FVK A;  1A8L A;  2YZH A;  2O7K A;  2IMK A;  1NHY A;  3KGK A;  4RI7 A;  1EP8 A;  3UMA A;  3TB2 A;  2PVQ A;  3I6A A;  5AIV A;  4BWQ A;  4IS0 A;  2HRN A;  2A4H A;  4ACS A;  4KH7 A;  4MLY A;  1XFL A;  3LYK A;  2H19 A;  4TW5 A;  4HU7 A;  1Z9H A;  1HYU A;  2JAD A;  1K3Y A;  2GS3 A;  3KD0 A;  3KMN A;  2VL2 C;  3WT2 A;  3GKK A;  2AHE A;  2XPD A;  3KTL A;  4PQ1 A;  4HQS A;  2IMD A;  1EP7 A;  2C3T A;  1NSW A;  3PR8 A;  1XIY A;  1LBK A;  5FWG A;  2FWF A;  1N8J A;  1PRX A;  2EFE A;  3IV4 A;  4JBB A;  1XOA A;  3QDN A;  3HDC A;  5AIS A;  6GST A;  5G1K A;  2R4V A;  3H4K A;  5GAP D;  1YY7 A;  2WB9 A;  1EEJ A;  5B8A A;  2OE0 A;  2H1B A;  3E3E A;  3EU4 A;  2VCV A;  3FEU A;  4HI7 A;  2JZS A;  5H5Q A;  1YEP A;  5CRH A;  2C3N A;  3HJM A;  2HZF A;  4LMV A;  3F9U A;  4W66 A;  4BVY A;  2BTO T;  2EIR A;  1BAY A;  2RM6 A;  5J9C A;  1FG4 A;  1GNE A;  3APO A;  1BG5 A;  3D21 A;  2AYT A;  1OC8 A;  5G5F A;  2F8A A;  3CXG A;  2H1D A;  3DYR A;  3KH7 A;  3IHG A;  3D22 A;  1X5D A;  4ISD A;  2H6Z A;  1MDK A;  4AF2 A;  1EZK A;  5IMD A;  4LLR A;  2F9S A;  4NHW A;  1KNG A;  2CQ9 A;  1TRV A;  1YJ6 A;  4AKH A;  2B7K A;  4LA1 A;  1Q98 A;  1R5A A;  3FZA A;  4ZXG A;  4ICY A;  3BD2 A;  2PGT A;  3GFK A;  1ZYQ B;  2OJL A;  3Q19 A;  1Y6E A;  1TKD B;  3ERG A;  1J9B A;  3MWH A;  4KA0 A;  2CAQ A;  4K8M A;  2OKA A;  1O7U A;  2MBT A;  6GSX A;  1PN9 A;  1GH2 A;  1U3A A;  1SL0 B;  3ZZX A;  2HYX A;  5ECK B;  2P5R A;  4OCE A;  2A2R A;  3E0U A;  3LOR A;  5D9V A;  4V2N A;  4YH2 A;  2JSY A;  1QQ2 A;  1EWX A;  3MSZ A;  5BRT A;  4JE1 A;  2ALB A;  4EC0 A;  3HVS A;  4WXT A;  3J7Y b;  1Z7P A;  5INY A;  2H74 A;  3TKS A;  3A2V A;  3TKS E;  4J57 E;  4MPF A;  2V6O A;  3F4T A;  1J08 A;  5J3R A;  2P31 A;  1V98 A;  1A24 A;  3QMX A;  2K6V A;  1EV9 A;  1RQM A;  2DJ2 A;  1ZGN A;  2J23 A;  3GN3 A;  3ZVJ A;  2JZT A;  3VWU A;  4FO5 A;  4HJM A;  2GQK A;  2H1G A;  5KN1 A;  1G7E A;  3GSS A;  3EU3 A;  4IP1 A;  5H5R A;  4DSR A;  1AQV A;  2VL3 A;  2R0P A;  1VF3 A;  1O8X A;  2BJX A;  2YAN A;  5IO2 A;  2WRT A;  2VL2 A;  1AUC A;  2C0E A;  2B5X A;  4NMU A;  4N10 A;  3KH9 A;  3A2W A;  4TXO B;  4YKF A;  1JFU A;  2B5Y A;  4OFM A;  3C71 A;  2DJ1 A;  1DE2 A;  5GSS A;  5E4W A;  1GSS A;  3HMJ G;  4WF5 A;  14GS A;  2JU5 A;  10GS A;  4PQH A;  2G2Q A;  5ECL B;  2GDR A;  4GSN A;  3VWW A;  2FWE A;  2HRA A;  3UEM A;  4ZIJ A;  5JCG A;  3S9F A;  3VFI A;  2YWI A;  3F63 A;  1Y1U A;  1TK0 B;  2DC5 A;  2DBC A;  5A4V A;  3VI7 A;  2YN1 A;  3QAG A;  1PL1 A;  2MBS A;  4WR4 A;  3GUS A;  2C3Q A;  4BWS A;  2X99 A;  1G0T A;  2KOK A;  3IK7 A;  4ZBB A;  3KEB A;  2L5L A;  4CW9 A;  5BMU B;  4PGT A;  1H75 A;  2DMM A;  5AN1 A;  3CTG A;  5CNW A;  2R6K A;  1HD2 A;  2X49 A;  4X1U A;  2DLX A;  2XBQ A;  3UVH A;  1OC9 A;  4ID0 A;  2JSZ A;  5IMA A;  3TOU A;  1GSQ A;  1PKZ A;  3ME8 A;  18GS A;  3PIN A;  3TOT A;  4D73 B;  4GQF A;  3UJ1 A;  3NZN A;  3H8Q A;  1TOF A;  1K0N A;  1F9M A;  2ZCT A;  4I5Q A;  5B7C A;  2HNL A;  5BMU A;  16GS A;  3HCZ A;  1GTB A;  3H79 A;  2YV7 A;  3U5R E;  3A5W A;  3TU3 B;  1MD3 A;  1PGT A;  2ES7 A;  4Q5R A;  1M2D A;  4OFT A;  5G31 A;  4BL7 A;  1PQN A;  3FKF A;  9GSS A;  4GDF A;  1O73 A;  1VRS D;  4EO3 A;  1K0B A;  1SVL A;  3FK8 A;  5E59 A;  2A2P A;  3CBU A;  3W6G A;  4POB A;  3QR6 A;  3QPM A;  4ZBA A;  3ME7 A;  1JHB A;  4ILF A;  2H6X A;  20GS A;  4BL7 B;  3QD9 A;  1SVO A;  1ST9 A;  4RUV A;  2LQQ A;  4ZB8 A;  4ECC A;  1A0F A;  2AB6 A;  4E68 A;  3BOA A;  4GF0 A;  2CX3 A;  4XS4 B;  1EOH A;  5IOW A;  5GAN D;  2LJA A;  3N5O A;  2C4J A;  4N0V A;  4F0B A;  4K5R A;  3ZML A;  3WGE A;  3KM6 A;  4EIQ A;  1Z5Y E;  4FH8 A;  5ECQ B;  1JZD A;  2EIO A;  3ZRE A;  2HRK A;  2UV8 G;  3CSI A;  5A34 B;  2GZP A;  4XS4 A;  6GSY A;  5B6M A;  1BJX A;  5ECN B;  4K2D A;  5DAK B;  3JCM L;  1QUW A;  3LEF A;  2GZZ A;  5A1N B;  4IJI A;  1WOU A;  2VOC A;  2H70 A;  1V57 A;  5D93 A;  1R4W A;  3EUR A;  4KB3 A;  2QA2 A;  4MMM A;  1RW1 A;  3KMO A;  1EV4 A;  5ECR B;  4ML1 A;  2NVL A;  1UA5 A;  3GV1 A;  1BG1 A;  3RHB A;  3TCO A;  2JZR A;  4EE0 A;  2H66 A;  1ERV A;  5DJM A;  3IAM 2;  2RII A;  5J4V A;  2HI7 A;  5EY6 A;  2I81 A;  4POM A;  1GNW A;  4Z2T A;  3FRC A;  2GT5 A;  3ED3 A;  3F4S A;  1WRY A;  4AGS A;  5D9W A;  3V1W A;  3CYN A;  4FQU A;  3WGD A;  3GMF A;  3GA4 A;  2CA8 A;  5C00 A;  2E2M A;  4PUA A;  2LRN A;  2PN8 A;  5J40 A;  1OKT A;  4L8E A;  6GSW A;  3NIV A;  4POK A;  2RUF A;  1SD9 A;  1K3O A;  2LRT A;  1SL2 B;  1M0U A;  1WPI A;  3EWL A;  3QFA C;  4MNN A;  3TJK A;  4KAE A;  2I4A A;  3IOS A;  4PXO A;  1V58 A;  4FYB A;  4IN0 A;  4KUN A;  4CY8 A;  2F51 A;  3IHQ A;  1ERT A;  1J0F A;  3F6F A;  2VLV A;  1GWC A;  3FR6 A;  6GSS A;  1M7T A;  4I2T A;  3TRQ A;  3M3M A;  4KGI A;  1MTC A;  2O89 A;  1TI1 A;  1DE1 A;  3GH9 A;  2H6Y A;  1YDK A;  2O85 A;  2LNT A;  5D9X A;  4TXV A;  1ML6 A;  3VUR A;  3HHV A;  1HNB A;  2B6M A;  3DRN A;  4YAP A;  3TUE A;  1QXH A;  1FVJ A;  1OAZ A;  3FR9 A;  4ZB6 A;  2HRK B;  1SL1 B;  1WE0 A;  4JED A;  4USS A;  3KXO A;  4Q5F A;  4IP6 A;  4Z7X A;  1Z6N A;  4BPY A;  5DAL A;  2YP6 A;  1AC1 A;  2IPA A;  2FNO A;  4MF7 A;  1THX A;  2EC4 A;  5CO3 A;  4LL4 B;  3BBY A;  2YZU A;  4GQC A;  1T00 A;  5LNK e;  1CQG A;  1C72 A;  1GSU A;  3ISO A;  4IVF A;  1B4Q A;  3IK9 A;  1EEM A;  4PNF A;  2M80 A;  5LCZ A;  1XWK A;  3HD5 A;  1KTE A;  2GQL A;  4G01 A;  2R5G A;  5L71 A;  2HSN B;  2K9F A;  3KIJ A;  4AKX B;  3DGQ A;  3G7I A;  2H01 A;  2E7P A;  2VCW A;  3A2X A;  4NV2 A;  2ON5 A;  2PWJ A;  2HT9 A;  1TW9 A;  2LST A;  1SYR A;  4ECI A;  1B48 A;  1USB A;  4AKG A;  5FHI A;  3RBT A;  1V40 A;  4O92 A;  5HFG A;  3FYG A;  1FOH A;  2D2Z A;  1OE7 A;  4MA9 A;  5CRD A;  1TU8 A;  5J5N A;  1BX9 A;  1U6T A;  4KSM A;  3MNG A;  2KP2 A;  2IJY A;  1I9D A;  2OAD A;  3IXR A;  3A5I A;  1EGO A;  4TVE A;  4V2L A;  2IFQ B;  1XBS A;  1SEN A;  4AJ6 A;  2LEG A;  8GSS A;  5A5K A;  1Z6M A;  5ECM B;  1X9S B;  4YQV A;  2V6K A;  2L4C A;  3ZFL A;  4GSS A;  4O5R A;  3P90 A;  4EKZ A;  2JL4 A;  1GSY A;  4QL9 A;  2VO4 A;  2FWG A;  3CRT A;  1BF5 A;  4IQA A;  3BJ5 A;  1GLQ A;  5EPF A;  3NOF A;  2LKU A;  2FWH A;  1GUH A;  3UIW A;  5KOX A;  3DWV A;  1A2M A;  4OD7 A;  3ZTL A;  1G6Y A;  2HZE B;  2LS5 A;  4G0I A;  1U3I A;  4IW9 A;  2L5O A;  1U87 A;  4V2M A;  3P8W A;  4HS1 A;  3A3T A;  4L0U A;  4TR4 A;  3R3E A;  2EFC A;  3C8E A;  1X5C A;  4Q5N A;  2M46 A;  2WUL A;  3VLN A;  2P0G A;  3VWV A;  3DEX A;  2VKZ G;  4ULX A;  5DQS A;  2PBJ A;  4J2F A;  4F2I A;  4MZW A;  4X43 A;  4CY6 A;  4HQZ A;  4KCA A;  5GZZ B;  3FZ5 A;  2NTO A;  1YZX A;  1KEB A;  3EYT A;  4ZL8 A;  2FCH A;  2CVK A;  4WEY A;  1MEK A;  3I43 A;  1YQ1 A;  3C7M A;  5D73 A;  3CTF A;  4NXI A;  1PX7 A;  4G19 A;  3CWG A;  3F6D A;  2DIZ A;  3SWL A;  2VM1 A;  1F3B A;  1PSQ A;  2QSI A;  3H93 A;  2C8U A;  2MYG A;  1QMV A;  5HFI A;  1OVN A;  3GUR A;  4XIH A;  2VAF A;  4HU9 A;  2YWN A;  2HSH A;  2LNS A;  5IM9 A;  2OE1 A;  1T7P B;  2B5E A;  4EVM A;  4QQ7 A;  4NHZ A;  4G10 A;  1PL2 A;  3I9V 2;  2WFC A;  3M9J A;  1TU7 A;  4O5Q A;  2FY6 A;  5C04 A;  3ERW A;  4WF4 A;  1M9A A;  2A2S A;  1K0M A;  1XPV A;  1QGV A;  4K2X A;  1XWB A;  5KN2 A;  2DJJ A;  2YNX A;  2IMI A;  1R26 A;  2WS2 A;  5DDL A;  4TR1 B;  5A34 A;  5IMF A;  4GXZ A;  3GNJ A;  3TJG A;  4BVX B;  2WZ9 A;  1QFN A;  1YKC A;  1R7H A;  2H0H A;  2WGR A;  2XPE A;  2HE3 A;  1YF1 A;  1ERW A;  2OE3 A;  3L9S A;  1GL8 A;  1GTU A;  2FA8 A;  2L6D A;  5H5S A;  2H30 A;  1PN0 A;  4PTS A;  4WKW A;  4FIW A;  3APS A;  1OE8 A;  3DXB A;  6GSV A;  3P7X A;  3UBK A;  5GST A;  1S3C A;  3HJP A;  3FMW A;  1XVQ A;  4L5L A;  3UAR A;  3GIX A;  4Z2U A;  5IO0 A;  2CV4 A;  4JR4 A;  1WJK A;  5FT3 A;  4HZ2 A;  4KCE A;  3ZFB A;  1M99 A;  3M1G A;  1XXU A;  1S3A A;  3KP9 A;  3GKM A;  2IL3 A;  1TTZ A;  4HZ4 A;  3TKR A;  3F3Q A;  2LTK A;  4G9H A;  3EMP A;  4O7H A;  2B3S A;  1THO A;  3WD6 A;  4V1A g;  3UAP A;  4MCU A;  3HVX A;  3UL3 A;  1JZO A;  5JWO B;  5F05 A;  2GLR A;  2KHP A;  1NM3 A;  5JCU A;  2FUG 2;  1SJI A;  1ZOF A;  4MJB A;  4IJ3 A;  4K5S A;  2CAI A;  3LQ7 A;  4ZB7 A;  1XWC A;  2CVD A;  1OC9 B;  1K0C A;  2C0F A;  4YQU A;  3ERF A;  5DJL A;  1MDJ A;  3TJB A;  2YCD A;  5ECH B;  3L9V A;  3M8N A;  3TKS C;  4HJ2 A;  5D9T A;  4I2U A;  4L5O A;  3VWX A;  5HR0 A;  5G1L A;  4X0X A;  1O85 A;  4GST A;  3I69 A;  1ZMA A;  4JZQ A;  4MAB A;  1M2B A;  5CRW A;  3HVV A;  2MZC A;  2AAW A;  4NPB A;  2I3Y A;  2HSN A;  2VLU A;  3C73 A;  2RM5 A;  4KW6 A;  5B8B A;  3GX0 A;  3HZ4 A;  5A5H B;  2H76 A;  4TKY A;  3Q6O A;  5KN3 A;  3IDV A;  3K8N A;  3Q18 A;  2AV4 A;  4XRA A;  1GTA A;  4P3Y B;  5B6N A;  2TRC P;  1K0D A;  2WCI A;  2FLS A;  4K0N A;  3IE3 A;  2H71 A;  1XWG A;  3HY2 A;  5CAX A;  1NHO A;  4KE3 A;  3LYP A;  2PU9 C;  5LD0 A;  4BVX A;  3GKX A;  3IPZ A;  4PUR A;  1SU9 A;  3DIE A;  3GL5 A;  4AJ7 A;  3L9U A;  3QAW A;  3QAV A;  1TXX A;  5ELG A;  4ML6 A;  4HDE A;  1XWA A;  1WIK A;  1Z3E A;  3ZVJ D;  4X4J A;  3IBH A;  2OT3 A;  4PQI A;  2PER A;  2YV9 A;  3E9J B;  4IQ1 A;  2L59 A;  4Z2R A;  2PVO C;  4WBJ A;  4GWR A;  1ZYP A;  4DSS A;  2MMN A;  2CX4 A;  5DBQ A;  4IEL A;  3IRA A;  5D96 A;  5AIX A;  5F06 A;  1SKW B;  5HQP A;  2FGX A;  1A2L A;  1V2A A;  3OR5 A;  2IN3 A;  1BED A;  2IMF A;  3TRP A;  2LJR A;  3H1N A;  1ZL9 A;  2V41 A;  1K0O A;  1DSB A;  1EOG A;  1Z7R A;  3CRU A;  2L57 A;  3UVT A;  1YEX A;  3WT1 A;  1FB0 A;  1AIU A;  1S3D A;  2GGT A;  22GS A;  3WYW A;  1MD4 A;  1XVW A;  2CZ2 A;  2ZNM A;  2EFH A;  1VF1 A;  5EL8 A;  1X9W B;  1TRU A;  1KBN A;  4GLT A;  4FYC A;  2PUK C;  1XZO A;  2YOI A;  4CDO A;  2FA4 A;  5IIZ A;  2DKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...