4O7HA

Crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
222
structure length
222
Chain Sequence
MRRLYHHGLSPAARKVRVALAEKRLDYEAVIEETWIRNESFLAMNPEGEVPVLVEADGLTITDGWAICEYLEEVYPEPSLLGGPAAMRAEVRRLVAWFDRKFNREVTEPLVREKLLKRVISGGAPDSRQIRAGRANVHTHLRYISWLIDRRRWLAGDMLTYADITAACHLSLIDYAGDVPWEDHPQAKEWYALVKSRPSFRPLLTETISPIRPPRHYADLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione S-transferase from Rhodospirillum rubrum F11, Target EFI-507460
rcsb
source organism Rhodospirillum rubrum f11
molecule tags Transferase
total genus 92
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4o7hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4o7hA01
1U3AA 16GSA 1CQGA 3CSIA 4V2LA 1O7UA 3ZTLA 4BVYA 2CZ3A 1QQ2A 1YF1A 3W8JA 2VCXA 1HD2A 5HFIA 4IQAA 5CP1A 2K8SA 2F8AA 5E4WA 3DD3A 1YQ1A 1YJ6A 4I97A 3EU4A 3GKMA 4PQHA 2PVQA 5IO2A 1VGLA 2CX4A 2VAFA 1TI3A 3TB2A 4FYCA 5D93A 2HSNB 4QL7A 4MLYA 2C4JA 2VL2A 1SD9A 3LEFA 2B7JA 2FWHA 3UOMA 3HZ8A 2WFCA 4TW5A 3VLNA 4O5RA 2J23A 2X99A 5G1LA 1EOHA 2JZRA 4WETA 2XHFA 3S9FA 2H01A 1O81A 3DXBA 2GLRA 2YZHA 5G30A 3DGQA 1HNCA 3VI7A 1GH2A 2YOIA 2GSTA 3HVSA 4JU5A 5F05A 4RI6A 1UN2A 2CX3A 2M72A 1AC1A 3GTUA 4MPFA 5ECQB 2PPTA 4IJIA 3RAZA 1O8XA 2CVKA 4YQUA 4XS6A 2H76A 1EV9A 1PL1A 2F51A 5JCGA 5HR3A 1Z6MA 3FR3A 2FD3A 1E2YA 4TVEA 5GAPD 3LJRA 2DMLA 1U87A 1K0CA 1EWXA 3HJPA 3Q18A 5KN2A 5AIVA 4Q5NA 5D9VA 4ECIA 2DIYA 3SWLA 2PERA 3GUSA 4ULXA 3F3QA 5FHIA 4V2MA 1QFNA 1SK1A 2YN1A 3LGCA 1QMVA 4MF5A 3GN3A 2VCTA 4MA9A 3FRCA 3EINA 4G10A 4AGSA 3QR6A 1EEMA 3HDCA 3HVXA 1ZL9A 1XCCA 1B9XC 4LL4B 4O7HA 3QAWA 3RHCA 4BL7B 4RQXA 3TOUA 2IN3A 1ERTA 11GSA 2H1DA 5DQSA 3KP8A 3GL5A 4OFNA 4N0VA 1F9MA 2G0FA 3F6FA 3KMOA 1GL8A 1TKDB 1YKCA 5DQYA 4EKZA 3APSA 1B8XA 2H73A 5AIXA 2P0GA 2EIQA 2PMTA 5GZZB 2IWTA 5CNWA 2MZCA 3KH7A 3NZNA 4HJ2A 4K2DA 3UJ1A 2GZYA 1Y6EA 3Q74A 4PXOA 4FYUA 6GSWA 1THOA 3VWUA 4F0CA 3G7YA 2ES7A 4MDCA 4XS4B 4LMVA 2XPDA 5ID2A 2IL3A 1WMJA 4DSRA 1M2BA 3EVIA 3R2QA 3IRAA 3WGXA 2MMAA 4MH2A 3GSSA 2WRTA 3HVVA 1SL1B 3L4NA 1NM3A 3VPTA 3JCML 4Q5RA 3CSJA 5A5KA 4OWYA 2RUFA 4XCSA 4PTSA 1TU7A 5GAND 2X8GA 1O8WA 2XC2A 1S3CA 4PUFC 3QCPA 2OBKA 2OE0A 3GH9A 4NXIA 4I5QA 4WXTA 1V40A 2K6VA 4F03A 1V98A 5JWOB 4L5OA 3L9SA 4X1UA 1M0UA 5J41A 4ZB9A 2V1MA 1KBNA 5IMVA 4I6XA 3L9VA 1HYUA 1TRUA 1S3AA 5CAXA 2C3TA 4PGTA 3C1RA 3PH9A 1YF0A 2FWEA 1JHBA 3KP9A 4TR0A 4KF9A 4KSOA 2B6MA 3FW2A 2IMIA 2MBSA 2H74A 1J08A 3IHQA 2H6XA 4IBPA 3W8SA 1R4WA 1WE0A 3ZREA 4IW9A 1QK8A 5DCHA 3V1WA 2P31A 3LXTA 2AAWA 1VRSD 4ZB6A 2NPBA 5B6NA 2VCZA 1V58A 5ECHB 1FVKA 4PNFA 3F9UA 1GTBA 4MCUA 4GRFA 3KZQA 4I2TA 3NIVA 3PGTA 4WKWA 4PURA 3IPZA 2OE1A 2LRNA 3N5OA 3GKXA 1RQMA 1EOGA 5DALA 3ZVJD 1XFLA 3KM6A 1GSEA 4ZB8A 1TK5B 3IBHA 4FYBA 2NDOA 4IQ1A 1K0DA 3IXRA 1XW5A 3M8NA 3P90A 3UL3A 1GP1A 3EE2A 1JFUA 2VUPA 5IPHA 4NMUA 1TXXA 1ILOA 4AJ7A 1EGOA 1MEKA 3IV4A 3F63A 1XXUA 4GSTA 5ELAA 3ERGA 2FWGA 1QUWA 3TRXA 2B5YA 1YKAA 2H72A 4XTSA 3E9JB 1PGTA 2XBQA 2K9FA 2HZEA 12GSA 2V6OA 1G7OA 2HSMA 3QPMA 5JWRB 1SYRA 3APOA 4J56E 1YEXA 4NHZA 4G9HA 4BVXB 2DJ2A 5CO3A 1PX6A 3I6AA 3KMNA 6GSVA 1TRWA 4RUVA 3RPPA 2M80A 2V2GA 2JACA 2DMMA 5ECIB 1FOVA 1GSDA 5D96A 2NTOA 5INYA 4XS1A 2PVOC 3C7MA 1GUHA 1I9DA 3DVWA 4BWQA 1SJIA 4BWSA 3P7XA 4TR1A 4JE1A 5COHA 2YPMA 3ZZXA 3IOSA 3D5JA 2C3QA 1B48A 1UC7A 2HFDA 4IELA 3DYRA 3LWAA 4ML6A 5B8BA 4G2EA 4KW6A 4JR6A 2GDRA 2GGTA 2LSTA 4WF4A 3TUEA 2MMZA 6GSTA 2IJYA 2O8VB 3QFAC 2GSRA 4NHWA 4L5LA 2LV3A 2C3NA 2K18A 1JLVA 3CYNA 1BG5A 1Z7PA 5ELGA 5HFKA 3IK7A 1F37A 4K7NA 4LL1B 2FHEA 1A8LA 1OKDA 3FR9A 3GHAA 4BA7A 1DE2A 1SK0A 1TTZA 2E0QA 4CHSA 4LMWA 2HXKA 3L78A 3MWHA 5DDLA 4ZILA 10GSA 4DVCA 4HQZA 4ID0A 3F4TA 2OE3A 2JADA 4WR5A 2OA7A 2EC4A 1OYJA 3O6TA 2UZ8A 4EF0A 3CMIA 4H86A 2OACA 3IDVA 1OVNA 1LBKA 5DBQA 2YWMA 5KN0A 2HRAA 3A5WA 4Z7XA 3GA4A 1G6WA 5HR2A 3DWVA 2E7PA 4ZL9A 3EURA 3ZMKA 1TOFA 5J9CA 3UBKA 2H8LA 1XVWA 4EE0A 3C8EA 1GUMA 2CA8A 1WIKA 1FVJA 2IMDA 3CTGA 4PX1A 4J2FA 3G9BA 2AV4A 5F8BA 3ME8A 3TJKA 4TOPA 3LG6A 2HQTA 2H66A 6GSXA 4AJ6A 4KX4A 4K0GA 2M46A 1K0BA 2H1GA 5FT3A 4POMA 3F6DA 1TU8A 4KA0A 4RI7A 2H71A 2O7KA 4EDYA 2N5AA 4NPBA 3KH9A 1ERVA 1NSWA 1OC9A 3FZ4A 1GLQA 2LJAA 1JZOA 1V9WA 1Z7RA 1AUCA 4NWYA 4HOJA 2PGTA 3GURA 1TRSA 2LRTA 2L57A 3VWWA 1M99A 3W6GA 3DMLA 2AB6A 3UVHA 4WBRD 1GNEA 2JL4A 3ERWA 3VFIA 4MF7A 1WRYA 2C1YA 1A0RP 3FYGA 3KGKA 3E0UA 3HD5A 2FWFA 1SYXA 2BJXA 5KN3A 5DJMA 4QL9A 1ERWA 4V2NA 2HZFA 5A4WA 1G6YA 4EO3A 4XIHA 5F0GA 4WEYA 3U5RE 3ERFA 4ACSA 3A2WA 5ECPB 1Z5YE 2LJKA 2VO4A 1A23A 4TN8A 1EP8A 3I69A 1XW6A 3PINA 5ECRB 4OMVA 4DSQA 2PWJA 3FK8A 4TXOB 4V1Ag 2TRXA 4FIWA 4CW9A 1B9YC 1SU9A 4Q5QA 5IQYA 1N2AA 1XBSA 2LNSA 4K7OA 1AQWA 2MMOA 4FQUA 4GTUA 1WJKA 1AIUA 1O6JA 2GVPA 1TP9A 4DSSA 4MABA 1SL2B 2DJKA 1SD8A 1URMA 2HNLA 2LJRA 4MZCA 3QMXA 3GIXA 4OFMA 2BMXA 4CDOA 1TJDA 2Z9SA 2GS3A 1I5GA 4PUAA 2HSHA 2LUSA 1K0OA 3D4MA 1R7HA 3TJGA 2CZ2A 4KNDA 2JU5A 1UVZA 5ECNB 1V2AA 1MTCA 3EMPA 1FB6A 1GRXA 1PA3A 2X64A 1U88A 4MMMA 4IP1A 1GTUA 4KDUA 1RK4A 1XVQA 4OCEA 3WGDA 3UBLA 1B4QA 1DBYA 3FEUA 1IYIA 1T1VA 4TR4A 2HRKB 2KLXA 1J9BA 1A0FA 2L6DA 1ON4A 3ZMLA 3M3MA 1O73A 2C0FA 2YV7A 2DC5A 2WDUA 2GZPA 5DJLA 3UAPA 2IMEA 3LYKA 3RPNA 2GT6A 4BVYB 3EYTA 2XBIA 3KD0A 1K0NA 2A4VA 1A2LA 2AYTA 4I8BA 4E8HA 4K8MA 4IJ3A 4X43A 5H5RA 1J0FA 4BPYA 2HE3A 5A4UA 1W4VA 1K3OA 4USSA 5A4VA 2F3MA 4GLTA 2H6YA 3UEMA 1YEPA 1G0TA 4O92A 3CRUA 5D73A 3BCIA 1FO5A 5F07A 2LTKA 4KDXA 1SKWB 5KN1A 1XWKA 2C80A 4KB3A 1M2DA 2R5GA 2OBIA 1XOAA 3ZLPA 1K0MA 2I3YA 5DAKA 1K3YA 2N5FA 4TXVA 3ZFLA 2L6CA 2RIIA 4MZBA 4D73A 4KDYA 3VI5A 1QXHA 3M1GA 2JZSA 1ZYEA 1ABAA 3LSZA 4POLA 5J9BA 3RDWA 2WCIA 2L5OA 2H6ZA 2E2GA 3GMFA 5IMCA 4WBJA 3O3TA 1VF1A 2VLTA 3BD2A 4HEA2 5DCGA 3TDGA 4GF0A 2YCDA 2LEGA 1H75A 4HS1A 1BQ7A 3ME7A 22GSA 2GZZA 5EPFA 3GTUB 3MAKA 2B7KA 2HYXA 2VCQA 2CQ9A 1XIYA 5EL8A 2IFQA 3QAGA 2YJHA 2B5EA 1FB0A 2FLSA 2PUKC 1OAZA 2X8HA 2JSYA 4GQFA 1VF2A 1SKSB 5CRDA 5G2ZA 2GQLA 3TJFA 2QGVA 3ZL5A 1TK0B 4N11A 5ECSA 3I9V2 3OR5A 1A24A 3WGEA 2R6KA 1OC8A 5IOWA 4L8EA 1AXDA 1GNWA 3TKSE 3GYKA 1R26A 3ISOA 4HDEA 4YQMA 4YQVA 4EL1A 3QAVA 5JWQB 6GSUA 2C0GA 14GSA 1EEJA 2PU9C 1PD21 5ECMB 4HQSA 2JZTA 2R3XA 1WPIA 3A3TA 3A2VA 1X9WB 4XHMA 3I43A 4MJEA 3DKSA 1BJXA 3M9JA 4KAEA 5GSSA 4K0NA 1GTAA 3L0HA 20GSA 1TRVA 4GSNA 2QKEA 1SK2A 2VL9A 4HI7A 3EMXA 1E6BA 1XWBA 2JSZA 2L5LA 2HT9A 2LRCA 3LYPA 5D9XA 2C0EA 1GWCA 5AGYA 4N30A 2CVBA 4K7IA 1F3AA 2YV9A 3G7IA 2TRCP 4YH2A 1ZCPA 1PMTA 1ZGNA 2RUEA 3HJMA 4IP6A 3F4SA 4TRXA 1W89A 4O32A 4MJBA 3IK9A 4POKA 1AAZA 4JBBA 5ID2B 1BYEA 1X0RA 4OD7A 1GSYA 2VLUA 2RM6A 3GX8A 5J3RA 3MDKA 3HA9A 2CV4A 4OCFA 3DVXA 2GSSA 2B1KA 3P8WA 2GTUA 4F0BA 2DJ0A 2O87A 3BOAA 4F9ZA 3D21A 1JZDA 5H5SA 2F9SA 2R2JA 3GKNA 4ILFA 5C04A 3GV1A 1Q98A 4GXZA 4K9ZA 3ZYWA 2R37A 3NOFA 1EZKA 1A2MA 3ZIVA 1X5EA 5LD0A 3J7Yb 3IC4A 3TGZA 1SKRB 1A2JA 5HQPA 4IKHA 4JR4A 3IA1A 1JZWA 1THXA 1MDJA 2V6KA 3H1NA 3F0IA 3R3EA 1GLPA 4YAPA 2VD1A 4ZIJA 3BBYA 5B7CA 5IMZA 3HZ4A 2G2QA 5DVBA 2I1UA 1CQHA 2DJ1A 1RW1A 1GTIA 1BX9A 4OO5A 3UVTA 2LS5A 1AQVA 2AJQB 4JZQA 4IVFA 4FH8A 2GQKA 2IIYA 1XPVA 3H79A 6GSYA 4ECJA 3EU3A 3MNGA 1X5DA 5D9WA 1NW2A 1T7PB 5CYYA 4PQIA 2I9HA 3TJJA 1AW9A 5E59A 3A2XA 4IGJA 4N10A 2H0GA 3Q6OA 1T8EB 5DALB 4L0UA 3WT1A 4PNGA 3FZ9A 1N8JA 3K8NA 4GWRA 5FWGA 4HJMA 5L71A 2IMKA 2WB9A 1H4OA 3TJBA 1XWAA 3TRPA 1TI1A 1HNBA 4TR3A 2FA8A 4MZWA 1PQNA 2YP6A 1R5AA 4XS4A 4NAXA 1AQXA 3PR8A 1YY7A 5HR0A 1MDKA 4LLRA 4Q5FA 2KP2A 3ZITA 3WYWA 1DE1A 3U6VA 2CVDA 1PL2A 4WF5A 2HZEB 2GSQA 4FO5A 4RQRA 1LU4A 2HSMB 2YJ7A 2L4CA 2IMFA 3TKPA 2H75A 2I81A 2KOKA 1G7EA 1PSQA 3LORA 4F2IA 5ECLB 2ALBA 4P3YB 1KNGA 2IPAA 5LCZA 3ZVJA 4EUYA 4V1Ap 1GSQA 2F8FA 2ZCTA 3C73A 2DIZA 1DSBA 1EV4A 2ZNMA 1OE7A 3P2AA 3ED3A 1FHEA 4TR1B 5AN1A 3GL3A 5IM9A 2HRFA 4MK3A 3BCKA 2RLIA 4G0LA 1ML6A 1X5CA 3G7JA 2AHEA 2LQQA 3WD6A 3VWVA 1U6TA 1ACVA 8GSSA 3LQ7A 2H0HA 2P5RA 2DLXA 2B3SA 1WP0A 1Z9HA 4IHUA 5G31A 1BAYA 2OADA 3O76A 1PKWA 3KJYA 3DRNA 5JCWA 1SJ6A 1Q4JA 4HU7A 1TDIA 4POBA 4KCEA 2QSIA 2C0DA 1C72A 3D6IA 2A2SA 2WULA 1OE8A 1VF3A 4EC0A 2YANA 3LXZA 1HQOA 5H5QA 3TKQA 3D4TA 4GSSA 2J9HA 1XWCA 2LQOA 5IMAA 1X9MB 3TKSA 3FKFA 3FHKA 4KCAA 1TK8B 2GT5A 1TW9A 1HNAA 1PN9A 3UARA 3QFBC 1T4YA 3QD9A 1GSFA 1SJZA 6GSSA 2DJJA 2FA4A 4XRAA 2CAIA 1O85A 2H30A 2I4AA 2H0IA 3US3A 4ZXGA 1XOBA 5BMUA 1YZXA 2KHPA 3HHVA 3M0FA 1V57A 17GSA 2VL2C 2YNXA 1KTEA 3GFKA 3FZ5A 1WWJA 3GKKA 5CRGA 4IN0A 4BVXA 2FY6A 3PPUA 4L0WA 2CT6A 2MBTA 1IYHA 2ON5A 3TCOA 5B6MA 3LFLA 2X8CA 1F6MC 4TKYA 2AUVA 2FGXA 4ZBDA 3HJOA 3M9KA 4X0XA 3VWXA 1XW9A 3E3EA 4GQCA 5CRHA 1M9AA 2K8VA 5HR1A 4XRDA 2FCHA 1A8YA 1ZZYA 2N5BA 7GSSA 1ERUA 1OC9B 2KP1A 5G5EA 2V41A 2VM2A 5AISA 1M2AA 3HKRA 1GULA 2FNOA 5ABRA 4NV2A 3QOUA 2WS2A 2LKUA 5JCUA 4AF2A 2E2MA 4WR4A 3AY8A 1ST9A 4QQ7A 3KEBA 1GSSA 3VPQA 3H93A 2YWNA 1R5PA 3L9UA 4HZ4A 4ZBAA 4MH3A 2RM5A 1NHOA 2WGRA 5IO0A 5D9TA 3BJ5A 4E8EA 2OJLA 1FG4A 4LA1A 3KCMA 3GH6A 3HY2A 2VCVA 2DSAA 3CSHA 3TKSC 1MD3A 2O85A 4KSMA 4DEJA 5HFGA 5GSTA 13GSA 3H4KA 1VF4A 1PKZA 2DBCA 2FUG2 1BEDA 2A2RA 3F4RA 1WOUA 4MJAA 3ZIJA 5IMDA 4MF6A 1KEBA 2XPEA 18GSA 1PX7A 2ZUPA 4JRRA 4J57E 2VIMA 3VK9A 4ML1A 3FR6A 4ECBA 3MSZA 3GSTA 1T3BA 2GQMA 1LJRA 1B4PA 2R4VA 1T00A 1EGRA 2VOCA 3HXSA 3SBCA 3EC3A 9GSSA 1M9BA 2TIRA 3APQA 4KH7A 4DSSB 4K6XA 4OFTA 2L59A 2NBSA 3RHBA 4OO4A 5IIZA 5CREA 1OKTA 1EP7A 1MD4A 2H1AA 2C8UA 1QGVA 3IE3A 5J4UA 4G0KA 2VM1A 4ZL7A 3D0ZA 3F3RA 5IPGA 4EDZA 4N0ZA 2HI7A 1GSUA 3TKRA 3D22A 1JLWA 2HSYA 4NV5A 1FW1A 5J5NA 4ZBBA 3DIEA 2EIRA 1ZYQB 5IOXA 2VLVA 3C71A 3VURA 3UIWA 3QDNA 5ECKB 5D8IA 2B5XA 4HZ2A 1SL0B 2WZ9A 2O89A 3CBUA 3TRQA 1S3DA 1JZRA 4K1FA 3N9JA 2YZUA 2ON7A 2H1BA 4IS0A 1USBA 4KGIA 5IMFA 3KIJA 2QC7A 4ECCA 1K3LA 2KUCA 3HYPA 4I2UA 2H19A 1F2EA 3DEXA 1FAAA 2HLSA 4KUNA 2YWIA 3FY7A 5F06A 5ENUA 1Z6NA 1T4ZA 2WJUA 2PBJA 4ZL8A 3ZRDA 4GCIA 1NHYA 1F3BA 3IAS2 3J7Yk 2L4QA 2MMNA 1X9SB 1XWGA 1XZOA 2PN8A 5G5FA 2REMA 4TXOA 19GSA 2MYGA 2VCWA 3GX0A 5LNKe 5DAKB 4G0IA 3GRXA 3GNJA 4EXJA 5KEJA 2NVLA 3FZAA 1OC3A 1PRXA 3Q19A 3F8UA 1U3IA 4D73B 3CXGA 2VD0A 3KXOA 2HRNA 4MP4A 3WT2A 2CAQA 2DJ3A 2LNTA 4MPGA 3CTFA 3RBTA 4F82A 2V32A 3H8QA 4AJ8A 2YWOA 4JEDA 2B1LA 3TOTA 2P5QA 4HUAA 1Z3EA 1ZOFA 4YAVA 4ISDA 1ZMAA 5C00A 1DUGA 1SENA 1GUKA 5EVOA 3IC8A 3ZFBA 2IFQB 4BL7A 4EVMA 2EIOA 4PQ1A 3C1SA 1YDKA 4KE3A 5B8AA 3IAM2 5G1KA 2BTOT 1K0AA 5CRWA 3UMAA 2D2ZA 2VL3A 4HU9A 2OKAA 5ECOB 3KTBA 1MDIA 4MJCA 4G19A 3IR4A 1UA5A 2HRKA 5EY6A 1Y25A 1M7TA 3KTLA 2H70A 3HCZA 3EWLA 3CRTA
chains in the Genus database with same CATH superfamily
1U3AA 16GSA 1CQGA 3CSIA 4V2LA 1O7UA 3ZTLA 4BVYA 2CZ3A 1QQ2A 1YF1A 3W8JA 2VCXA 1HD2A 5HFIA 4IQAA 5CP1A 2K8SA 2F8AA 5E4WA 3DD3A 1YQ1A 1SVOA 1YJ6A 4I97A 3EU4A 3GKMA 4PQHA 2PVQA 5IO2A 1VGLA 2CX4A 2VAFA 1TI3A 3TB2A 4FYCA 5D93A 2HSNB 4QL7A 4MLYA 2C4JA 2VL2A 1SD9A 3LEFA 2B7JA 2FWHA 3UOMA 3HZ8A 2WFCA 4TW5A 3VLNA 4O5RA 2J23A 1S3RA 2X99A 5G1LA 1EOHA 2JZRA 4WETA 2XHFA 3S9FA 2H01A 1O81A 3DXBA 2GLRA 2YZHA 5G30A 3DGQA 2VKZG 1HNCA 3VI7A 2DKHA 1GH2A 2YOIA 2GSTA 3HVSA 4JU5A 5F05A 4RI6A 1UN2A 2CX3A 2M72A 1AC1A 3FMWA 3GTUA 4MPFA 5ECQB 2PPTA 4IJIA 3RAZA 1O8XA 2CVKA 4YQUA 4XS6A 2H76A 1EV9A 1PL1A 2F51A 5JCGA 5HR3A 1Z6MA 3FR3A 4HSCX 2WW1A 2FD3A 1E2YA 4TVEA 5GAPD 3LJRA 2DMLA 1U87A 1K0CA 1EWXA 3HJPA 3Q18A 5KN2A 5AIVA 4Q5NA 5D9VA 4ECIA 2DIYA 3SWLA 2PERA 3GUSA 4ULXA 3F3QA 5FHIA 4V2MA 1QFNA 1SK1A 2YN1A 3LGCA 1QMVA 4MF5A 3GN3A 2VCTA 4MA9A 3FRCA 3EINA 4G10A 4AGSA 3QR6A 1EEMA 3HDCA 3HVXA 1ZL9A 1XCCA 1B9XC 4LL4B 4O7HA 3QAWA 3RHCA 4BL7B 4RQXA 3TOUA 2IN3A 1ERTA 11GSA 2H1DA 5DQSA 3KP8A 1M3JA 3GL5A 4OFNA 4N0VA 1BF5A 1F9MA 2G0FA 3F6FA 3KMOA 1GL8A 1TKDB 1YKCA 5DQYA 4EKZA 3APSA 1B8XA 2H73A 5AIXA 2P0GA 2EIQA 2PMTA 5GZZB 2IWTA 5CNWA 2MZCA 3KH7A 3NZNA 4HJ2A 4K2DA 3UJ1A 2GZYA 2DKIA 1Y6EA 3Q74A 4PXOA 4FYUA 6GSWA 1THOA 4K5RA 3VWUA 4F0CA 3G7YA 2ES7A 4MDCA 4XS4B 4LMVA 2XPDA 5ID2A 2IL3A 1WMJA 4DSRA 1M2BA 3EVIA 3R2QA 3IRAA 3WGXA 2MMAA 4MH2A 3GSSA 2WRTA 3HVVA 1SL1B 3L4NA 1NM3A 4CY6A 3VPTA 3JCML 4Q5RA 3CSJA 5A5KA 4OWYA 2RUFA 4XCSA 4PTSA 1TU7A 2A2PA 5GAND 2X8GA 1O8WA 2XC2A 1S3CA 4PUFC 3QCPA 2OBKA 2OE0A 1TXUA 3GH9A 4NXIA 4I5QA 4WXTA 1V40A 2K6VA 4F03A 1XG8A 1V98A 5JWOB 4L5OA 3L9SA 4X1UA 1M0UA 5J41A 4ZB9A 2V1MA 1KBNA 5IMVA 4I6XA 3L9VA 1HYUA 1TRUA 1S3AA 5CAXA 5A34B 2C3TA 4PGTA 3C1RA 3PH9A 1YF0A 2FWEA 1JHBA 3KP9A 4TR0A 2WVXA 4KF9A 4KSOA 2B6MA 3FW2A 2IMIA 2MBSA 2H74A 1J08A 3IHQA 2H6XA 4IBPA 3W8SA 1R4WA 1WE0A 4AKXB 4IW9A 3ZREA 1QK8A 5DCHA 3V1WA 2P31A 3LXTA 2AAWA 1VRSD 4ZB6A 2NPBA 5B6NA 2VCZA 1V58A 5ECHB 1FVKA 4PNFA 3F9UA 1GTBA 4MCUA 4GRFA 3KZQA 4I2TA 3NIVA 3PGTA 4WKWA 4PURA 3IPZA 2OE1A 2LRNA 3N5OA 3GKXA 1RQMA 1EOGA 5DALA 1Y1UA 3ZVJD 1XFLA 3KM6A 1GSEA 4ZB8A 1TK5B 3IBHA 4FYBA 2NDOA 4IQ1A 1K0DA 3IXRA 5J4VA 1XW5A 3CHXC 3M8NA 3P90A 3UL3A 1GP1A 3EE2A 1JFUA 2VUPA 5IPHA 4NMUA 4K2XA 1TXXA 1ILOA 4AJ7A 3CQFA 1EGOA 1MEKA 3IV4A 3F63A 1XXUA 4GSTA 5ELAA 5A5HB 3ERGA 2FWGA 1QUWA 3TRXA 2B5YA 1YKAA 2H72A 5BMUB 4XTSA 3E9JB 1PGTA 2XBQA 2K9FA 2HZEA 12GSA 2V6OA 1BG1A 1G7OA 2HSMA 3QPMA 5JWRB 4AKHA 1SYRA 3APOA 4J56E 1YEXA 4NHZA 4G9HA 4BVXB 2DJ2A 5CO3A 1PX6A 3I6AA 3KMNA 6GSVA 1TRWA 4RUVA 4YKFA 3RPPA 2M80A 2V2GA 2JACA 2DMMA 5ECIB 1FOVA 1GSDA 5D96A 2NTOA 5INYA 4XS1A 2PVOC 3C7MA 1GUHA 1I9DA 3DVWA 4BWQA 1S4BP 1SJIA 4BWSA 3P7XA 4TR1A 4JE1A 5COHA 2YPMA 3ZZXA 3IOSA 3D5JA 2C3QA 1B48A 1UC7A 2HFDA 4IELA 3DYRA 4K5SA 3LWAA 4ML6A 5B8BA 4G2EA 4KW6A 4JR6A 2GDRA 3RGBC 2GGTA 2LSTA 4WF4A 3TUEA 2MMZA 6GSTA 2IJYA 2O8VB 3QFAC 2GSRA 4NHWA 4L5LA 2LV3A 2C3NA 2K18A 1JLVA 3CYNA 2EFHA 1BG5A 1Z7PA 5ELGA 5HFKA 3IK7A 1F37A 4K7NA 4LL1B 2FHEA 1A8LA 1OKDA 3FR9A 3GHAA 4Z2TA 4BA7A 1DE2A 4ZB7A 1SK0A 1TTZA 2E0QA 4CHSA 4LMWA 3LW9A 2HXKA 3L78A 3MWHA 5DDLA 4ZILA 10GSA 4DVCA 4HQZA 4ID0A 3F4TA 2OE3A 2JADA 4WR5A 2OA7A 4O5UA 2EC4A 1OYJA 3O6TA 2UZ8A 4EF0A 3CMIA 4H86A 2OACA 3IDVA 1OVNA 1LBKA 5DBQA 2YWMA 5KN0A 5A1NB 2HRAA 3A5WA 4Z7XA 3GA4A 1G6WA 5HR2A 3DWVA 2E7PA 4ZL9A 3EURA 3ZMKA 1TOFA 5J9CA 3UBKA 2H8LA 1XVWA 4EE0A 3C8EA 1GUMA 2CA8A 1WIKA 1FVJA 2IMDA 3CTGA 4PX1A 4J2FA 3G9BA 2AV4A 5F8BA 3ME8A 3TJKA 4TOPA 3LG6A 2HQTA 2H66A 6GSXA 4AJ6A 4KX4A 3EPTA 4K0GA 2M46A 1K0BA 2H1GA 5FT3A 4POMA 5J4YA 3F6DA 1TU8A 4KA0A 4RI7A 2H71A 2O7KA 4EDYA 2N5AA 4NPBA 3KH9A 1ERVA 1NSWA 1OC9A 3FZ4A 1GLQA 2LJAA 1JZOA 1V9WA 4ICYA 1Z7RA 1AUCA 4NWYA 4HOJA 2PGTA 3GURA 4O5QA 1TRSA 2LRTA 2L57A 3VWWA 1M99A 3W6GA 3DMLA 2AB6A 3UVHA 4WBRD 1GNEA 2JL4A 3ERWA 3VFIA 4MF7A 1WRYA 2C1YA 1A0RP 3FYGA 3KGKA 3E0UA 3HD5A 2QA2A 2FWFA 1SYXA 2BJXA 5KN3A 4AI6A 5DJMA 4QL9A 1ERWA 4V2NA 2HZFA 5A4WA 1G6YA 4EO3A 4XIHA 5F0GA 4WEYA 3U5RE 3ERFA 4ACSA 3A2WA 5ECPB 1Z5YE 2LJKA 2VO4A 1A23A 4TN8A 1EP8A 3I69A 1XW6A 4AKGA 5ECRB 4OMVA 3PINA 4DSQA 2PWJA 3FK8A 4TXOB 4V1Ag 2TRXA 4FIWA 4CW9A 1B9YC 1SU9A 4Q5QA 4W66A 5IQYA 1N2AA 1XBSA 2LNSA 4K7OA 1AQWA 2MMOA 4FQUA 4GTUA 1WJKA 4BIKA 1AIUA 1O6JA 2GVPA 1TP9A 4N3ZA 3HVNA 4DSSA 4MABA 1SL2B 2UV8G 2DJKA 1SD8A 1URMA 2HNLA 2LJRA 4MZCA 3QMXA 3GIXA 4OFMA 2BMXA 4CDOA 1TJDA 2Z9SA 2GS3A 1I5GA 4PUAA 2HSHA 2LUSA 1K0OA 3D4MA 1R7HA 3TJGA 2CZ2A 4KNDA 2JU5A 1UVZA 5ECNB 1V2AA 1MTCA 3EMPA 1FB6A 1GRXA 1PA3A 2X64A 1U88A 4MMMA 4IP1A 1GTUA 4KDUA 1RK4A 1XVQA 4PI2C 4OCEA 3WGDA 3UBLA 1B4QA 1DBYA 3FEUA 1IYIA 1T1VA 4TR4A 2HRKB 2KLXA 1J9BA 1A0FA 2L6DA 1ON4A 3ZMLA 3M3MA 1O73A 2C0FA 2YV7A 2DC5A 2WDUA 2GZPA 5DJLA 3UAPA 2IMEA 3LYKA 3RPNA 2GT6A 4BVYB 3EYTA 2XBIA 3KD0A 1K0NA 2A4VA 1A2LA 2AYTA 4I8BA 4E8HA 4K8MA 4IJ3A 4X43A 5H5RA 1J0FA 4BPYA 2HE3A 5A4UA 1PFOA 1W4VA 1K3OA 4USSA 5A4VA 2F3MA 4GLTA 2H6YA 3UEMA 1YEPA 1G0TA 4O92A 3CRUA 5D73A 3BCIA 1FO5A 5F07A 2LTKA 4KDXA 1SKWB 5KN1A 1XWKA 2C80A 1M2DA 2OBIA 2R5GA 4KB3A 1XOAA 3ZLPA 1K0MA 2I3YA 5DAKA 1K3YA 2N5FA 4TXVA 3ZFLA 2L6CA 2RIIA 4MZBA 4D73A 4KDYA 3VI5A 1QXHA 3M1GA 2JZSA 1ZYEA 1ABAA 3LSZA 4POLA 5J9BA 3RDWA 2WCIA 2L5OA 2H6ZA 2E2GA 2WW2A 3GMFA 5IMCA 4WBJA 4QMKA 3O3TA 1VF1A 2VLTA 3BD2A 4HEA2 5DCGA 3TDGA 4GF0A 2YCDA 2LEGA 1H75A 4HS1A 1BQ7A 3ME7A 22GSA 2GZZA 5EPFA 3GTUB 3MAKA 2B7KA 2HYXA 2VCQA 2CQ9A 1XIYA 5EL8A 2IFQA 1ZYNA 3QAGA 2YJHA 2B5EA 1FB0A 2FLSA 2PUKC 1OAZA 2X8HA 2JSYA 4GQFA 1VF2A 1SKSB 5CRDA 5KOWA 5G2ZA 1FOHA 2GQLA 3TJFA 2QGVA 3ZL5A 1TK0B 4N11A 5ECSA 3I9V2 3OR5A 1A24A 3WGEA 2R6KA 1OC8A 5IOWA 4L8EA 1AXDA 1GNWA 2WVYA 3TKSE 3GYKA 1R26A 3ISOA 4HDEA 4YQMA 4YQVA 2X4AA 4EL1A 3QAVA 5JWQB 6GSUA 2C0GA 14GSA 1EEJA 2PU9C 1PD21 5ECMB 4HQSA 2JZTA 2R3XA 1WPIA 3A3TA 3A2VA 5J47A 1X9WB 4XHMA 3I43A 4MJEA 3DKSA 1BJXA 3M9JA 2EFEA 4KAEA 5GSSA 4K0NA 3HMJG 1GTAA 3L0HA 20GSA 1TRVA 4GSNA 2QKEA 1SK2A 2VL9A 4HI7A 3EMXA 1E6BA 1XWBA 2JSZA 2L5LA 2HSNA 2HT9A 2LRCA 3LYPA 5D9XA 2C0EA 1GWCA 5AGYA 4N30A 2CVBA 4K7IA 1F3AA 2YV9A 3G7IA 2TRCP 4YH2A 1ZCPA 1PMTA 1ZGNA 4Z2UA 2RUEA 3HJMA 4IP6A 3F4SA 4TRXA 1W89A 4O32A 4MJBA 3IK9A 4POKA 1AAZA 5BRTA 4JBBA 5ID2B 1BYEA 1X0RA 4OD7A 1GSYA 2VLUA 2RM6A 3GX8A 5J3RA 2OT3A 3MDKA 3HA9A 2CV4A 4OCFA 3DVXA 2GSSA 3MYDA 2B1KA 3P8WA 2GTUA 4F0BA 4EIPA 2DJ0A 2O87A 3BOAA 4F9ZA 3D21A 1JZDA 5H5SA 2F9SA 2QA1A 2R2JA 3GKNA 4ILFA 5C04A 3GV1A 1Q98A 4GXZA 4K9ZA 3ZYWA 4PI0C 2R37A 3NOFA 1EZKA 1A2MA 3ZIVA 1X5EA 5LD0A 3J7Yb 3IC4A 3TGZA 1SKRB 1A2JA 5HQPA 4IKHA 4JR4A 3IA1A 1JZWA 1THXA 1MDJA 2V6KA 3H1NA 3F0IA 3R3EA 1GLPA 4YAPA 2VD1A 4ZIJA 3BBYA 5B7CA 5IMZA 3HZ4A 2G2QA 5DVBA 2WVXB 2I1UA 1CQHA 2DJ1A 1RW1A 1GTIA 1BX9A 4OO5A 3UVTA 2LS5A 1AQVA 2AJQB 4JZQA 4IVFA 4FH8A 2GQKA 2IIYA 1XPVA 3H79A 6GSYA 4ECJA 3EU3A 3MNGA 1X5DA 5D9WA 1NW2A 1T7PB 5CYYA 4PQIA 2I9HA 3TJJA 1AW9A 5E59A 3A2XA 4IGJA 4N10A 2H0GA 3Q6OA 1T8EB 1N25A 5DALB 4L0UA 3WT1A 4PNGA 3FZ9A 1N8JA 3K8NA 4GWRA 5FWGA 4HJMA 5L71A 2IMKA 2WB9A 1H4OA 3MIXA 3TJBA 1XWAA 3TRPA 1TI1A 1HNBA 4TR3A 4A5PA 2FA8A 4MZWA 1PQNA 2YP6A 1R5AA 4XS4A 4NAXA 1AQXA 3PR8A 2O5VA 1YY7A 3TU3B 5HR0A 1MDKA 3IHGA 4LLRA 4Q5FA 2KP2A 3ZITA 3WYWA 1DE1A 3U6VA 2CVDA 1PL2A 4MNNA 4WF5A 2HZEB 2GSQA 1PN0A 4FO5A 4RQRA 1LU4A 2HSMB 2YJ7A 2L4CA 2IMFA 3TKPA 2H75A 2I81A 2KOKA 1G7EA 2WW3A 1PSQA 3LORA 4F2IA 5ECLB 2ALBA 4P3YB 1KNGA 2IPAA 5LCZA 3ZVJA 4EUYA 4V1Ap 4GDFA 1GSQA 2F8FA 2ZCTA 1M3IA 3C73A 2DIZA 1DSBA 1EV4A 2ZNMA 1OE7A 3P2AA 3ED3A 1FHEA 4TR1B 5A34A 5AN1A 3GL3A 5IM9A 2HRFA 4MK3A 3BCKA 2RLIA 4G0LA 1ML6A 1X5CA 3G7JA 2AHEA 2LQQA 3WD6A 3VWVA 1U6TA 1ACVA 8GSSA 3LQ7A 2H0HA 2EFDA 2P5RA 2DLXA 2B3SA 1WP0A 1Z9HA 4IHUA 5G31A 1BAYA 2OADA 3O76A 1PKWA 3KJYA 3DRNA 5JCWA 1SJ6A 1Q4JA 4HU7A 1TDIA 4POBA 4KCEA 2QSIA 2R0GA 2C0DA 1C72A 3D6IA 2A2SA 2WULA 1OE8A 1VF3A 4EC0A 2YANA 3LXZA 2H1LA 1HQOA 5H5QA 3TKQA 3D4TA 4GSSA 2J9HA 1XWCA 2LQOA 5IMAA 1X9MB 3TKSA 3FKFA 3FHKA 4KCAA 1TK8B 2GT5A 1ZYPA 1TW9A 1HNAA 1PN9A 3UARA 3QFBC 1T4YA 3QD9A 1GSFA 1SJZA 6GSSA 2DJJA 2FA4A 4XRAA 2R0CA 2CAIA 1O85A 5A5HA 2H30A 2I4AA 2H0IA 3US3A 4ZXGA 1XOBA 5BMUA 1YZXA 2O36A 2KHPA 3HHVA 3M0FA 1V57A 17GSA 2VL2C 2YNXA 1KTEA 3GFKA 3FZ5A 1WWJA 3GKKA 5CRGA 4IN0A 4BVXA 2FY6A 3PPUA 4YKGA 4L0WA 2O3EA 2CT6A 2MBTA 1IYHA 2ON5A 3TCOA 4FXYP 5B6MA 3LFLA 2X8CA 1F6MC 4TKYA 2AUVA 2FGXA 4ZBDA 3HJOA 3M9KA 4X0XA 3VWXA 1XW9A 3E3EA 4GQCA 5CRHA 1M9AA 2K8VA 5HR1A 4XRDA 2FCHA 1A8YA 1ZZYA 2N5BA 7GSSA 1ERUA 1OC9B 2KP1A 5G5EA 2V41A 2VM2A 5AISA 1M2AA 3HKRA 1GULA 2FNOA 5ABRA 4NV2A 3QOUA 2WS2A 2LKUA 5JCUA 4AF2A 2E2MA 4WR4A 3AY8A 1ST9A 1SVMA 4QQ7A 3KEBA 1GSSA 3VPQA 3H93A 2YWNA 1R5PA 3L9UA 2R0PA 4HZ4A 4ZBAA 4MH3A 2RM5A 1NHOA 2WGRA 5IO0A 5D9TA 3BJ5A 4E8EA 5J40A 2OJLA 1FG4A 4LA1A 3KCMA 3GH6A 3HY2A 2VCVA 2DSAA 3CSHA 3TKSC 1MD3A 2O85A 4KSMA 4DEJA 5HFGA 5GSTA 13GSA 3H4KA 1VF4A 1PKZA 2DBCA 2FUG2 1BEDA 2A2RA 3F4RA 1WOUA 2WVZA 4MJAA 3ZIJA 5IMDA 4MF6A 1KEBA 2XPEA 18GSA 1PX7A 2ZUPA 5A1NA 4JRRA 4J57E 5KOXA 2VIMA 3VK9A 4ML1A 3FR6A 4ECBA 3MSZA 3GSTA 1T3BA 2GQMA 1LJRA 1B4PA 2R4VA 1T00A 1EGRA 2VOCA 1I1IP 3HXSA 3SBCA 3EC3A 9GSSA 1M9BA 2TIRA 3APQA 4KH7A 4DSSB 2A4HA 4OFTA 4K6XA 2L59A 2NBSA 3RHBA 4OO4A 5IIZA 5CREA 1OKTA 1EP7A 1MD4A 2H1AA 2C8UA 1QGVA 3IE3A 5J4UA 4G0KA 2VM1A 4ZL7A 3D0ZA 3F3RA 5IPGA 4EDZA 4N0ZA 2HI7A 1GSUA 3TKRA 3D22A 1JLWA 2HSYA 4NV5A 1FW1A 5J5NA 4ZBBA 3DIEA 2EIRA 1ZYQB 5IOXA 2VLVA 1SVLA 3C71A 3RFRC 3VURA 3UIWA 3QDNA 4E68A 5ECKB 5D8IA 2B5XA 4HZ2A 1SL0B 2WZ9A 2O89A 3CBUA 3TRQA 1S3DA 1JZRA 4K1FA 3N9JA 2YZUA 2ON7A 4Z2RA 2H1BA 4IS0A 1USBA 4KGIA 5IMFA 3KIJA 2QC7A 4ECCA 1K3LA 2KUCA 3HYPA 4I2UA 2H19A 1F2EA 4EIQA 3DEXA 1FAAA 2HLSA 4KUNA 2YWIA 3CWGA 3FY7A 5F06A 5ENUA 1Z6NA 1T4ZA 2WJUA 2PBJA 4ZL8A 3ZRDA 4GCIA 1NHYA 1F3BA 3IAS2 3J7Yk 2L4QA 2WW0A 2MMNA 1X9SB 1XWGA 1XZOA 4PHZC 2PN8A 5G5FA 2REMA 4TXOA 3A5IA 19GSA 2MYGA 2VCWA 3GX0A 4X4JA 5LNKe 5DAKB 2WZSA 4G0IA 3GRXA 3GNJA 4EXJA 5KEJA 2NVLA 3FZAA 1OC3A 1PRXA 3Q19A 3F8UA 1U3IA 4D73B 2EFCA 3CXGA 2VD0A 3KXOA 2HRNA 4MP4A 3WT2A 2CAQA 2DJ3A 2LNTA 4MPGA 3CTFA 3RBTA 4F82A 2V32A 3H8QA 4AJ8A 4AKIA 2YWOA 4JEDA 2B1LA 3TOTA 2P5QA 4HUAA 1Z3EA 4G01A 1ZOFA 4YAVA 4ISDA 1ZMAA 5C00A 1DUGA 1SENA 1GUKA 5EVOA 3IC8A 3ZFBA 2IFQB 4BL7A 4EVMA 2EIOA 4PQ1A 3C1SA 1YDKA 4KE3A 5B8AA 3IAM2 5G1KA 2BTOT 1K0AA 5CRWA 3UMAA 2D2ZA 1YVLA 2X49A 2VL3A 4HU9A 4CY8A 2OKAA 5ECOB 3KTBA 1MDIA 4MJCA 4G19A 3IR4A 1UA5A 2HRKA 5EY6A 1Y25A 1M7TA 3KTLA 1YEWC 2H70A 3HCZA 3EWLA 3CRTA
chains in the Genus database with same CATH topology
1U3AA 16GSA 1CQGA 3CSIA 4V2LA 1O7UA 3ZTLA 4BVYA 2CZ3A 1QQ2A 1YF1A 3W8JA 2VCXA 1HD2A 5HFIA 4IQAA 5CP1A 2K8SA 2F8AA 5E4WA 3DD3A 1YQ1A 1SVOA 1YJ6A 4I97A 3EU4A 3GKMA 4PQHA 2PVQA 5IO2A 1VGLA 2CX4A 2VAFA 1TI3A 3TB2A 4FYCA 5D93A 2HSNB 4QL7A 4MLYA 2C4JA 2VL2A 1SD9A 3LEFA 2B7JA 2FWHA 3UOMA 3HZ8A 2WFCA 4TW5A 3VLNA 4O5RA 2J23A 2X99A 5G1LA 1EOHA 2JZRA 4WETA 2XHFA 3S9FA 2H01A 1O81A 3DXBA 2GLRA 2YZHA 5G30A 3DGQA 2VKZG 1HNCA 3VI7A 2DKHA 1GH2A 2YOIA 2GSTA 3HVSA 4JU5A 5F05A 4RI6A 1UN2A 2CX3A 2M72A 1AC1A 3FMWA 3GTUA 4MPFA 5ECQB 2PPTA 4IJIA 3RAZA 1O8XA 2CVKA 4YQUA 4XS6A 2H76A 1EV9A 1PL1A 2F51A 5JCGA 5HR3A 1Z6MA 3FR3A 2FD3A 1E2YA 4TVEA 5GAPD 3LJRA 2DMLA 1U87A 1K0CA 1EWXA 3HJPA 3Q18A 5KN2A 5AIVA 4Q5NA 5D9VA 4ECIA 2DIYA 3SWLA 2PERA 3GUSA 4ULXA 3F3QA 5FHIA 4V2MA 1QFNA 1SK1A 2YN1A 3LGCA 1QMVA 4MF5A 3GN3A 2VCTA 4MA9A 3FRCA 3EINA 4G10A 4AGSA 3QR6A 1EEMA 3HDCA 3HVXA 1ZL9A 1XCCA 1B9XC 4LL4B 4O7HA 3QAWA 3RHCA 4BL7B 4RQXA 3TOUA 2IN3A 1ERTA 11GSA 2H1DA 5DQSA 3KP8A 3GL5A 4OFNA 4N0VA 1BF5A 1F9MA 2G0FA 3F6FA 3KMOA 1GL8A 1TKDB 1YKCA 5DQYA 4EKZA 3APSA 1B8XA 2H73A 5AIXA 2P0GA 2EIQA 2PMTA 5GZZB 2IWTA 5CNWA 2MZCA 3KH7A 3NZNA 4HJ2A 4K2DA 3UJ1A 2GZYA 2DKIA 1Y6EA 3Q74A 4PXOA 4FYUA 6GSWA 1THOA 4K5RA 3VWUA 4F0CA 3G7YA 2ES7A 4MDCA 4XS4B 4LMVA 2XPDA 5ID2A 2IL3A 1WMJA 4DSRA 1M2BA 3EVIA 3R2QA 3IRAA 3WGXA 2MMAA 4MH2A 3GSSA 2WRTA 3HVVA 1SL1B 3L4NA 1NM3A 4CY6A 3VPTA 3JCML 4Q5RA 3CSJA 5A5KA 4OWYA 2RUFA 4XCSA 4PTSA 1TU7A 2A2PA 5GAND 2X8GA 1O8WA 2XC2A 1S3CA 4PUFC 3QCPA 2OBKA 2OE0A 1TXUA 3GH9A 4NXIA 4I5QA 4WXTA 1V40A 2K6VA 4F03A 1V98A 5JWOB 4L5OA 3L9SA 4X1UA 1M0UA 5J41A 4ZB9A 2V1MA 1KBNA 5IMVA 4I6XA 3L9VA 1HYUA 1TRUA 1S3AA 5CAXA 5A34B 2C3TA 4PGTA 3C1RA 3PH9A 1YF0A 2FWEA 1JHBA 3KP9A 4TR0A 4KF9A 4KSOA 2B6MA 3FW2A 2IMIA 2MBSA 2H74A 1J08A 3IHQA 2H6XA 4IBPA 3W8SA 1R4WA 1WE0A 4AKXB 4IW9A 3ZREA 1QK8A 5DCHA 3V1WA 2P31A 3LXTA 2AAWA 1VRSD 4ZB6A 2NPBA 5B6NA 2VCZA 1V58A 5ECHB 1FVKA 4PNFA 3F9UA 1GTBA 4MCUA 4GRFA 3KZQA 4I2TA 3NIVA 3PGTA 4WKWA 4PURA 3IPZA 2OE1A 2LRNA 3N5OA 3GKXA 1RQMA 1EOGA 5DALA 1Y1UA 3ZVJD 1XFLA 3KM6A 1GSEA 4ZB8A 1TK5B 3IBHA 4FYBA 2NDOA 4IQ1A 1K0DA 3IXRA 5J4VA 1XW5A 3M8NA 3P90A 3UL3A 1GP1A 3EE2A 1JFUA 2VUPA 5IPHA 4NMUA 4K2XA 1TXXA 1ILOA 4AJ7A 1EGOA 1MEKA 3IV4A 3F63A 1XXUA 4GSTA 5ELAA 5A5HB 3ERGA 2FWGA 1QUWA 3TRXA 2B5YA 1YKAA 2H72A 5BMUB 4XTSA 3E9JB 1PGTA 2XBQA 2K9FA 2HZEA 12GSA 2V6OA 1BG1A 1G7OA 2HSMA 3QPMA 5JWRB 4AKHA 1SYRA 3APOA 4J56E 1YEXA 4NHZA 4G9HA 4BVXB 2DJ2A 5CO3A 1PX6A 3I6AA 3KMNA 6GSVA 1TRWA 4RUVA 4YKFA 3RPPA 2M80A 2V2GA 2JACA 2DMMA 5ECIB 1FOVA 1GSDA 5D96A 2NTOA 5INYA 4XS1A 2PVOC 3C7MA 1GUHA 1I9DA 3DVWA 4BWQA 1SJIA 4BWSA 3P7XA 4TR1A 4JE1A 5COHA 2YPMA 3ZZXA 3IOSA 3D5JA 2C3QA 1B48A 1UC7A 2HFDA 4IELA 3DYRA 4K5SA 3LWAA 4ML6A 5B8BA 4G2EA 4KW6A 4JR6A 2GDRA 2GGTA 2LSTA 4WF4A 3TUEA 2MMZA 6GSTA 2IJYA 2O8VB 3QFAC 2GSRA 4NHWA 4L5LA 2LV3A 2C3NA 2K18A 1JLVA 3CYNA 2EFHA 1BG5A 1Z7PA 5ELGA 5HFKA 3IK7A 1F37A 4K7NA 4LL1B 2FHEA 1A8LA 1OKDA 3FR9A 3GHAA 4Z2TA 4BA7A 1DE2A 4ZB7A 1SK0A 1TTZA 2E0QA 4CHSA 4LMWA 3LW9A 2HXKA 3L78A 3MWHA 5DDLA 4ZILA 10GSA 4DVCA 4HQZA 4ID0A 3F4TA 2OE3A 2JADA 4WR5A 2OA7A 4O5UA 2EC4A 1OYJA 3O6TA 2UZ8A 4EF0A 3CMIA 4H86A 2OACA 3IDVA 1OVNA 1LBKA 5DBQA 2YWMA 5KN0A 5A1NB 2HRAA 3A5WA 4Z7XA 3GA4A 1G6WA 5HR2A 3DWVA 2E7PA 4ZL9A 3EURA 3ZMKA 1TOFA 5J9CA 3UBKA 2H8LA 1XVWA 4EE0A 3C8EA 1GUMA 2CA8A 1WIKA 1FVJA 2IMDA 3CTGA 4PX1A 4J2FA 3G9BA 2AV4A 5F8BA 3ME8A 3TJKA 4TOPA 3LG6A 2HQTA 2H66A 6GSXA 4AJ6A 4KX4A 3EPTA 4K0GA 2M46A 1K0BA 2H1GA 5FT3A 4POMA 5J4YA 3F6DA 1TU8A 4KA0A 4RI7A 2H71A 2O7KA 4EDYA 2N5AA 4NPBA 3KH9A 1ERVA 1NSWA 1OC9A 3FZ4A 1GLQA 2LJAA 1JZOA 1V9WA 4ICYA 1Z7RA 1AUCA 4NWYA 4HOJA 2PGTA 3GURA 4O5QA 1TRSA 2LRTA 2L57A 3VWWA 1M99A 3W6GA 3DMLA 2AB6A 3UVHA 4WBRD 1GNEA 2JL4A 3ERWA 3VFIA 4MF7A 1WRYA 2C1YA 1A0RP 3FYGA 3KGKA 3E0UA 3HD5A 2QA2A 2FWFA 1SYXA 2BJXA 5KN3A 4AI6A 5DJMA 4QL9A 1ERWA 4V2NA 2HZFA 5A4WA 1G6YA 4EO3A 4XIHA 5F0GA 4WEYA 3U5RE 3ERFA 4ACSA 3A2WA 5ECPB 1Z5YE 2LJKA 2VO4A 1A23A 4TN8A 1EP8A 3I69A 1XW6A 4AKGA 5ECRB 4OMVA 3PINA 4DSQA 2PWJA 3FK8A 4TXOB 4V1Ag 2TRXA 4FIWA 4CW9A 1B9YC 1SU9A 4Q5QA 4W66A 5IQYA 1N2AA 1XBSA 2LNSA 4K7OA 1AQWA 2MMOA 4FQUA 4GTUA 1WJKA 1AIUA 1O6JA 2GVPA 1TP9A 4N3ZA 4DSSA 4MABA 1SL2B 2UV8G 2DJKA 1SD8A 1URMA 2HNLA 2LJRA 4MZCA 3QMXA 3GIXA 4OFMA 2BMXA 4CDOA 1TJDA 2Z9SA 2GS3A 1I5GA 4PUAA 2HSHA 2LUSA 1K0OA 3D4MA 1R7HA 3TJGA 2CZ2A 4KNDA 2JU5A 1UVZA 5ECNB 1V2AA 1MTCA 3EMPA 1FB6A 1GRXA 1PA3A 2X64A 1U88A 4MMMA 4IP1A 1GTUA 4KDUA 1RK4A 1XVQA 4OCEA 3WGDA 3UBLA 1B4QA 1DBYA 3FEUA 1IYIA 1T1VA 4TR4A 2HRKB 2KLXA 1J9BA 1A0FA 2L6DA 1ON4A 3ZMLA 3M3MA 1O73A 2C0FA 2YV7A 2DC5A 2WDUA 2GZPA 5DJLA 3UAPA 2IMEA 3LYKA 3RPNA 2GT6A 4BVYB 3EYTA 2XBIA 3KD0A 1K0NA 2A4VA 1A2LA 2AYTA 4I8BA 4E8HA 4K8MA 4IJ3A 4X43A 5H5RA 1J0FA 4BPYA 2HE3A 5A4UA 1W4VA 1K3OA 4USSA 5A4VA 2F3MA 4GLTA 2H6YA 3UEMA 1YEPA 1G0TA 4O92A 3CRUA 5D73A 3BCIA 1FO5A 5F07A 2LTKA 4KDXA 1SKWB 5KN1A 1XWKA 2C80A 1M2DA 2OBIA 2R5GA 4KB3A 1XOAA 3ZLPA 1K0MA 2I3YA 5DAKA 1K3YA 2N5FA 4TXVA 3ZFLA 2L6CA 2RIIA 4MZBA 4D73A 4KDYA 3VI5A 1QXHA 3M1GA 2JZSA 1ZYEA 1ABAA 3LSZA 4POLA 5J9BA 3RDWA 2WCIA 2L5OA 2H6ZA 2E2GA 3GMFA 5IMCA 4WBJA 4QMKA 3O3TA 1VF1A 2VLTA 3BD2A 4HEA2 5DCGA 3TDGA 4GF0A 2YCDA 2LEGA 1H75A 4HS1A 1BQ7A 3ME7A 22GSA 2GZZA 5EPFA 3GTUB 3MAKA 2B7KA 2HYXA 2VCQA 2CQ9A 1XIYA 5EL8A 2IFQA 1ZYNA 3QAGA 2YJHA 2B5EA 1FB0A 2FLSA 2PUKC 1OAZA 2X8HA 2JSYA 4GQFA 1VF2A 1SKSB 5CRDA 5KOWA 5G2ZA 1FOHA 2GQLA 3TJFA 2QGVA 3ZL5A 1TK0B 4N11A 5ECSA 3I9V2 3OR5A 1A24A 3WGEA 2R6KA 1OC8A 5IOWA 4L8EA 1AXDA 1GNWA 3TKSE 3GYKA 1R26A 3ISOA 4HDEA 4YQMA 4YQVA 2X4AA 4EL1A 3QAVA 5JWQB 6GSUA 2C0GA 14GSA 1EEJA 2PU9C 1PD21 5ECMB 4HQSA 2JZTA 2R3XA 1WPIA 3A3TA 3A2VA 5J47A 1X9WB 4XHMA 3I43A 4MJEA 3DKSA 1BJXA 3M9JA 2EFEA 4KAEA 5GSSA 4K0NA 3HMJG 1GTAA 3L0HA 20GSA 1TRVA 4GSNA 2QKEA 1SK2A 2VL9A 4HI7A 3EMXA 1E6BA 1XWBA 2JSZA 2L5LA 2HSNA 2HT9A 2LRCA 3LYPA 5D9XA 2C0EA 1GWCA 5AGYA 4N30A 2CVBA 4K7IA 1F3AA 2YV9A 3G7IA 2TRCP 4YH2A 1ZCPA 1PMTA 1ZGNA 4Z2UA 2RUEA 3HJMA 4IP6A 3F4SA 4TRXA 1W89A 4O32A 4MJBA 3IK9A 4POKA 1AAZA 5BRTA 4JBBA 5ID2B 1BYEA 1X0RA 4OD7A 1GSYA 2VLUA 2RM6A 3GX8A 5J3RA 2OT3A 3MDKA 3HA9A 2CV4A 4OCFA 3DVXA 2GSSA 3MYDA 2B1KA 3P8WA 2GTUA 4F0BA 4EIPA 2DJ0A 2O87A 3BOAA 4F9ZA 3D21A 1JZDA 5H5SA 2F9SA 2QA1A 2R2JA 3GKNA 4ILFA 5C04A 3GV1A 1Q98A 4GXZA 4K9ZA 3ZYWA 2R37A 3NOFA 1EZKA 1A2MA 3ZIVA 1X5EA 5LD0A 3J7Yb 3IC4A 3TGZA 1SKRB 1A2JA 5HQPA 4IKHA 4JR4A 3IA1A 1JZWA 1THXA 1MDJA 2V6KA 3H1NA 3F0IA 3R3EA 1GLPA 4YAPA 2VD1A 4ZIJA 3BBYA 5B7CA 5IMZA 3HZ4A 2G2QA 5DVBA 2I1UA 1CQHA 2DJ1A 1RW1A 1GTIA 1BX9A 4OO5A 3UVTA 2LS5A 1AQVA 2AJQB 4JZQA 4IVFA 4FH8A 2GQKA 2IIYA 1XPVA 3H79A 6GSYA 4ECJA 3EU3A 3MNGA 1X5DA 5D9WA 1NW2A 1T7PB 5CYYA 4PQIA 2I9HA 3TJJA 1AW9A 5E59A 3A2XA 4IGJA 4N10A 2H0GA 3Q6OA 1T8EB 1N25A 5DALB 4L0UA 3WT1A 4PNGA 3FZ9A 1N8JA 3K8NA 4GWRA 5FWGA 4HJMA 5L71A 2IMKA 2WB9A 1H4OA 3MIXA 3TJBA 1XWAA 3TRPA 1TI1A 1HNBA 4TR3A 4A5PA 2FA8A 4MZWA 1PQNA 2YP6A 1R5AA 4XS4A 4NAXA 1AQXA 3PR8A 2O5VA 1YY7A 3TU3B 5HR0A 1MDKA 3IHGA 4LLRA 4Q5FA 2KP2A 3ZITA 3WYWA 1DE1A 3U6VA 2CVDA 1PL2A 4MNNA 4WF5A 2HZEB 2GSQA 1PN0A 4FO5A 4RQRA 1LU4A 2HSMB 2YJ7A 2L4CA 2IMFA 3TKPA 2H75A 2I81A 2KOKA 1G7EA 1PSQA 3LORA 4F2IA 5ECLB 2ALBA 4P3YB 1KNGA 2IPAA 5LCZA 3ZVJA 4EUYA 4V1Ap 4GDFA 1GSQA 2F8FA 2ZCTA 3C73A 2DIZA 1DSBA 1EV4A 2ZNMA 1OE7A 3P2AA 3ED3A 1FHEA 4TR1B 5A34A 5AN1A 3GL3A 5IM9A 2HRFA 4MK3A 3BCKA 2RLIA 4G0LA 1ML6A 1X5CA 3G7JA 2AHEA 2LQQA 3WD6A 3VWVA 1U6TA 1ACVA 8GSSA 3LQ7A 2H0HA 2EFDA 2P5RA 2DLXA 2B3SA 1WP0A 1Z9HA 4IHUA 5G31A 1BAYA 2OADA 3O76A 1PKWA 3KJYA 3DRNA 5JCWA 1SJ6A 1Q4JA 4HU7A 1TDIA 4POBA 4KCEA 2QSIA 2R0GA 2C0DA 1C72A 3D6IA 2A2SA 2WULA 1OE8A 1VF3A 4EC0A 2YANA 3LXZA 2H1LA 1HQOA 5H5QA 3TKQA 3D4TA 4GSSA 2J9HA 1XWCA 2LQOA 5IMAA 1X9MB 3TKSA 3FKFA 3FHKA 4KCAA 1TK8B 2GT5A 1ZYPA 1TW9A 1HNAA 1PN9A 3UARA 3QFBC 1T4YA 3QD9A 1GSFA 1SJZA 6GSSA 2DJJA 2FA4A 4XRAA 2R0CA 2CAIA 1O85A 5A5HA 2H30A 2I4AA 2H0IA 3US3A 4ZXGA 1XOBA 5BMUA 1YZXA 2KHPA 3HHVA 3M0FA 1V57A 17GSA 2VL2C 2YNXA 1KTEA 3GFKA 3FZ5A 1WWJA 3GKKA 5CRGA 4IN0A 4BVXA 2FY6A 3PPUA 4YKGA 4L0WA 2CT6A 2MBTA 1IYHA 2ON5A 3TCOA 5B6MA 3LFLA 2X8CA 1F6MC 4TKYA 2AUVA 2FGXA 4ZBDA 3HJOA 3M9KA 4X0XA 3VWXA 1XW9A 3E3EA 4GQCA 5CRHA 1M9AA 2K8VA 5HR1A 4XRDA 2FCHA 1A8YA 1ZZYA 2N5BA 7GSSA 1ERUA 1OC9B 2KP1A 5G5EA 2V41A 2VM2A 5AISA 1M2AA 3HKRA 1GULA 2FNOA 5ABRA 4NV2A 3QOUA 2WS2A 2LKUA 5JCUA 4AF2A 2E2MA 4WR4A 3AY8A 1ST9A 1SVMA 4QQ7A 3KEBA 1GSSA 3VPQA 3H93A 2YWNA 1R5PA 3L9UA 2R0PA 4HZ4A 4ZBAA 4MH3A 2RM5A 1NHOA 2WGRA 5IO0A 5D9TA 3BJ5A 4E8EA 5J40A 2OJLA 1FG4A 4LA1A 3KCMA 3GH6A 3HY2A 2VCVA 2DSAA 3CSHA 3TKSC 1MD3A 2O85A 4KSMA 4DEJA 5HFGA 5GSTA 13GSA 3H4KA 1VF4A 1PKZA 2DBCA 2FUG2 1BEDA 2A2RA 3F4RA 1WOUA 4MJAA 3ZIJA 5IMDA 4MF6A 1KEBA 2XPEA 18GSA 1PX7A 2ZUPA 5A1NA 4JRRA 4J57E 5KOXA 2VIMA 3VK9A 4ML1A 3FR6A 4ECBA 3MSZA 3GSTA 1T3BA 2GQMA 1LJRA 1B4PA 2R4VA 1T00A 1EGRA 2VOCA 3HXSA 3SBCA 3EC3A 9GSSA 1M9BA 2TIRA 3APQA 4KH7A 4DSSB 2A4HA 4OFTA 4K6XA 2L59A 2NBSA 3RHBA 4OO4A 5IIZA 5CREA 1OKTA 1EP7A 1MD4A 2H1AA 2C8UA 1QGVA 3IE3A 5J4UA 4G0KA 2VM1A 4ZL7A 3D0ZA 3F3RA 5IPGA 4EDZA 4N0ZA 2HI7A 1GSUA 3TKRA 3D22A 1JLWA 2HSYA 4NV5A 1FW1A 5J5NA 4ZBBA 3DIEA 2EIRA 1ZYQB 5IOXA 2VLVA 1SVLA 3C71A 3VURA 3UIWA 3QDNA 4E68A 5ECKB 5D8IA 2B5XA 4HZ2A 1SL0B 2WZ9A 2O89A 3CBUA 3TRQA 1S3DA 1JZRA 4K1FA 3N9JA 2YZUA 2ON7A 4Z2RA 2H1BA 4IS0A 1USBA 4KGIA 5IMFA 3KIJA 2QC7A 4ECCA 1K3LA 2KUCA 3HYPA 4I2UA 2H19A 1F2EA 4EIQA 3DEXA 1FAAA 2HLSA 4KUNA 2YWIA 3CWGA 3FY7A 5F06A 5ENUA 1Z6NA 1T4ZA 2WJUA 2PBJA 4ZL8A 3ZRDA 4GCIA 1NHYA 1F3BA 3IAS2 3J7Yk 2L4QA 2MMNA 1X9SB 1XWGA 1XZOA 2PN8A 5G5FA 2REMA 4TXOA 3A5IA 19GSA 2MYGA 2VCWA 3GX0A 4X4JA 5LNKe 5DAKB 4G0IA 3GRXA 3GNJA 4EXJA 5KEJA 2NVLA 3FZAA 1OC3A 1PRXA 3Q19A 3F8UA 1U3IA 4D73B 2EFCA 3CXGA 2VD0A 3KXOA 2HRNA 4MP4A 3WT2A 2CAQA 2DJ3A 2LNTA 4MPGA 3CTFA 3RBTA 4F82A 2V32A 3H8QA 4AJ8A 4AKIA 2YWOA 4JEDA 2B1LA 3TOTA 2P5QA 4HUAA 1Z3EA 4G01A 1ZOFA 4YAVA 4ISDA 1ZMAA 5C00A 1DUGA 1SENA 1GUKA 5EVOA 3IC8A 3ZFBA 2IFQB 4BL7A 4EVMA 2EIOA 4PQ1A 3C1SA 1YDKA 4KE3A 5B8AA 3IAM2 5G1KA 2BTOT 1K0AA 5CRWA 3UMAA 2D2ZA 1YVLA 2X49A 2VL3A 4HU9A 4CY8A 2OKAA 5ECOB 3KTBA 1MDIA 4MJCA 4G19A 3IR4A 1UA5A 2HRKA 5EY6A 1Y25A 1M7TA 3KTLA 2H70A 3HCZA 3EWLA 3CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3A A;  16GS A;  1CQG A;  3CSI A;  4V2L A;  1O7U A;  3ZTL A;  4BVY A;  2CZ3 A;  1QQ2 A;  1YF1 A;  3W8J A;  2VCX A;  1HD2 A;  5HFI A;  4IQA A;  5CP1 A;  2K8S A;  2F8A A;  5E4W A;  3DD3 A;  1YQ1 A;  1YJ6 A;  4I97 A;  3EU4 A;  3GKM A;  4PQH A;  2PVQ A;  5IO2 A;  1VGL A;  2CX4 A;  2VAF A;  1TI3 A;  3TB2 A;  4FYC A;  5D93 A;  2HSN B;  4QL7 A;  4MLY A;  2C4J A;  2VL2 A;  1SD9 A;  3LEF A;  2B7J A;  2FWH A;  3UOM A;  3HZ8 A;  2WFC A;  4TW5 A;  3VLN A;  4O5R A;  2J23 A;  2X99 A;  5G1L A;  1EOH A;  2JZR A;  4WET A;  2XHF A;  3S9F A;  2H01 A;  1O81 A;  3DXB A;  2GLR A;  2YZH A;  5G30 A;  3DGQ A;  1HNC A;  3VI7 A;  1GH2 A;  2YOI A;  2GST A;  3HVS A;  4JU5 A;  5F05 A;  4RI6 A;  1UN2 A;  2CX3 A;  2M72 A;  1AC1 A;  3GTU A;  4MPF A;  5ECQ B;  2PPT A;  4IJI A;  3RAZ A;  1O8X A;  2CVK A;  4YQU A;  4XS6 A;  2H76 A;  1EV9 A;  1PL1 A;  2F51 A;  5JCG A;  5HR3 A;  1Z6M A;  3FR3 A;  2FD3 A;  1E2Y A;  4TVE A;  5GAP D;  3LJR A;  2DML A;  1U87 A;  1K0C A;  1EWX A;  3HJP A;  3Q18 A;  5KN2 A;  5AIV A;  4Q5N A;  5D9V A;  4ECI A;  2DIY A;  3SWL A;  2PER A;  3GUS A;  4ULX A;  3F3Q A;  5FHI A;  4V2M A;  1QFN A;  1SK1 A;  2YN1 A;  3LGC A;  1QMV A;  4MF5 A;  3GN3 A;  2VCT A;  4MA9 A;  3FRC A;  3EIN A;  4G10 A;  4AGS A;  3QR6 A;  1EEM A;  3HDC A;  3HVX A;  1ZL9 A;  1XCC A;  1B9X C;  4LL4 B;  4O7H A;  3QAW A;  3RHC A;  4BL7 B;  4RQX A;  3TOU A;  2IN3 A;  1ERT A;  11GS A;  2H1D A;  5DQS A;  3KP8 A;  3GL5 A;  4OFN A;  4N0V A;  1F9M A;  2G0F A;  3F6F A;  3KMO A;  1GL8 A;  1TKD B;  1YKC A;  5DQY A;  4EKZ A;  3APS A;  1B8X A;  2H73 A;  5AIX A;  2P0G A;  2EIQ A;  2PMT A;  5GZZ B;  2IWT A;  5CNW A;  2MZC A;  3KH7 A;  3NZN A;  4HJ2 A;  4K2D A;  3UJ1 A;  2GZY A;  1Y6E A;  3Q74 A;  4PXO A;  4FYU A;  6GSW A;  1THO A;  3VWU A;  4F0C A;  3G7Y A;  2ES7 A;  4MDC A;  4XS4 B;  4LMV A;  2XPD A;  5ID2 A;  2IL3 A;  1WMJ A;  4DSR A;  1M2B A;  3EVI A;  3R2Q A;  3IRA A;  3WGX A;  2MMA A;  4MH2 A;  3GSS A;  2WRT A;  3HVV A;  1SL1 B;  3L4N A;  1NM3 A;  3VPT A;  3JCM L;  4Q5R A;  3CSJ A;  5A5K A;  4OWY A;  2RUF A;  4XCS A;  4PTS A;  1TU7 A;  5GAN D;  2X8G A;  1O8W A;  2XC2 A;  1S3C A;  4PUF C;  3QCP A;  2OBK A;  2OE0 A;  3GH9 A;  4NXI A;  4I5Q A;  4WXT A;  1V40 A;  2K6V A;  4F03 A;  1V98 A;  5JWO B;  4L5O A;  3L9S A;  4X1U A;  1M0U A;  5J41 A;  4ZB9 A;  2V1M A;  1KBN A;  5IMV A;  4I6X A;  3L9V A;  1HYU A;  1TRU A;  1S3A A;  5CAX A;  2C3T A;  4PGT A;  3C1R A;  3PH9 A;  1YF0 A;  2FWE A;  1JHB A;  3KP9 A;  4TR0 A;  4KF9 A;  4KSO A;  2B6M A;  3FW2 A;  2IMI A;  2MBS A;  2H74 A;  1J08 A;  3IHQ A;  2H6X A;  4IBP A;  3W8S A;  1R4W A;  1WE0 A;  3ZRE A;  4IW9 A;  1QK8 A;  5DCH A;  3V1W A;  2P31 A;  3LXT A;  2AAW A;  1VRS D;  4ZB6 A;  2NPB A;  5B6N A;  2VCZ A;  1V58 A;  5ECH B;  1FVK A;  4PNF A;  3F9U A;  1GTB A;  4MCU A;  4GRF A;  3KZQ A;  4I2T A;  3NIV A;  3PGT A;  4WKW A;  4PUR A;  3IPZ A;  2OE1 A;  2LRN A;  3N5O A;  3GKX A;  1RQM A;  1EOG A;  5DAL A;  3ZVJ D;  1XFL A;  3KM6 A;  1GSE A;  4ZB8 A;  1TK5 B;  3IBH A;  4FYB A;  2NDO A;  4IQ1 A;  1K0D A;  3IXR A;  1XW5 A;  3M8N A;  3P90 A;  3UL3 A;  1GP1 A;  3EE2 A;  1JFU A;  2VUP A;  5IPH A;  4NMU A;  1TXX A;  1ILO A;  4AJ7 A;  1EGO A;  1MEK A;  3IV4 A;  3F63 A;  1XXU A;  4GST A;  5ELA A;  3ERG A;  2FWG A;  1QUW A;  3TRX A;  2B5Y A;  1YKA A;  2H72 A;  4XTS A;  3E9J B;  1PGT A;  2XBQ A;  2K9F A;  2HZE A;  12GS A;  2V6O A;  1G7O A;  2HSM A;  3QPM A;  5JWR B;  1SYR A;  3APO A;  4J56 E;  1YEX A;  4NHZ A;  4G9H A;  4BVX B;  2DJ2 A;  5CO3 A;  1PX6 A;  3I6A A;  3KMN A;  6GSV A;  1TRW A;  4RUV A;  3RPP A;  2M80 A;  2V2G A;  2JAC A;  2DMM A;  5ECI B;  1FOV A;  1GSD A;  5D96 A;  2NTO A;  5INY A;  4XS1 A;  2PVO C;  3C7M A;  1GUH A;  1I9D A;  3DVW A;  4BWQ A;  1SJI A;  4BWS A;  3P7X A;  4TR1 A;  4JE1 A;  5COH A;  2YPM A;  3ZZX A;  3IOS A;  3D5J A;  2C3Q A;  1B48 A;  1UC7 A;  2HFD A;  4IEL A;  3DYR A;  3LWA A;  4ML6 A;  5B8B A;  4G2E A;  4KW6 A;  4JR6 A;  2GDR A;  2GGT A;  2LST A;  4WF4 A;  3TUE A;  2MMZ A;  6GST A;  2IJY A;  2O8V B;  3QFA C;  2GSR A;  4NHW A;  4L5L A;  2LV3 A;  2C3N A;  2K18 A;  1JLV A;  3CYN A;  1BG5 A;  1Z7P A;  5ELG A;  5HFK A;  3IK7 A;  1F37 A;  4K7N A;  4LL1 B;  2FHE A;  1A8L A;  1OKD A;  3FR9 A;  3GHA A;  4BA7 A;  1DE2 A;  1SK0 A;  1TTZ A;  2E0Q A;  4CHS A;  4LMW A;  2HXK A;  3L78 A;  3MWH A;  5DDL A;  4ZIL A;  10GS A;  4DVC A;  4HQZ A;  4ID0 A;  3F4T A;  2OE3 A;  2JAD A;  4WR5 A;  2OA7 A;  2EC4 A;  1OYJ A;  3O6T A;  2UZ8 A;  4EF0 A;  3CMI A;  4H86 A;  2OAC A;  3IDV A;  1OVN A;  1LBK A;  5DBQ A;  2YWM A;  5KN0 A;  2HRA A;  3A5W A;  4Z7X A;  3GA4 A;  1G6W A;  5HR2 A;  3DWV A;  2E7P A;  4ZL9 A;  3EUR A;  3ZMK A;  1TOF A;  5J9C A;  3UBK A;  2H8L A;  1XVW A;  4EE0 A;  3C8E A;  1GUM A;  2CA8 A;  1WIK A;  1FVJ A;  2IMD A;  3CTG A;  4PX1 A;  4J2F A;  3G9B A;  2AV4 A;  5F8B A;  3ME8 A;  3TJK A;  4TOP A;  3LG6 A;  2HQT A;  2H66 A;  6GSX A;  4AJ6 A;  4KX4 A;  4K0G A;  2M46 A;  1K0B A;  2H1G A;  5FT3 A;  4POM A;  3F6D A;  1TU8 A;  4KA0 A;  4RI7 A;  2H71 A;  2O7K A;  4EDY A;  2N5A A;  4NPB A;  3KH9 A;  1ERV A;  1NSW A;  1OC9 A;  3FZ4 A;  1GLQ A;  2LJA A;  1JZO A;  1V9W A;  1Z7R A;  1AUC A;  4NWY A;  4HOJ A;  2PGT A;  3GUR A;  1TRS A;  2LRT A;  2L57 A;  3VWW A;  1M99 A;  3W6G A;  3DML A;  2AB6 A;  3UVH A;  4WBR D;  1GNE A;  2JL4 A;  3ERW A;  3VFI A;  4MF7 A;  1WRY A;  2C1Y A;  1A0R P;  3FYG A;  3KGK A;  3E0U A;  3HD5 A;  2FWF A;  1SYX A;  2BJX A;  5KN3 A;  5DJM A;  4QL9 A;  1ERW A;  4V2N A;  2HZF A;  5A4W A;  1G6Y A;  4EO3 A;  4XIH A;  5F0G A;  4WEY A;  3U5R E;  3ERF A;  4ACS A;  3A2W A;  5ECP B;  1Z5Y E;  2LJK A;  2VO4 A;  1A23 A;  4TN8 A;  1EP8 A;  3I69 A;  1XW6 A;  3PIN A;  5ECR B;  4OMV A;  4DSQ A;  2PWJ A;  3FK8 A;  4TXO B;  4V1A g;  2TRX A;  4FIW A;  4CW9 A;  1B9Y C;  1SU9 A;  4Q5Q A;  5IQY A;  1N2A A;  1XBS A;  2LNS A;  4K7O A;  1AQW A;  2MMO A;  4FQU A;  4GTU A;  1WJK A;  1AIU A;  1O6J A;  2GVP A;  1TP9 A;  4DSS A;  4MAB A;  1SL2 B;  2DJK A;  1SD8 A;  1URM A;  2HNL A;  2LJR A;  4MZC A;  3QMX A;  3GIX A;  4OFM A;  2BMX A;  4CDO A;  1TJD A;  2Z9S A;  2GS3 A;  1I5G A;  4PUA A;  2HSH A;  2LUS A;  1K0O A;  3D4M A;  1R7H A;  3TJG A;  2CZ2 A;  4KND A;  2JU5 A;  1UVZ A;  5ECN B;  1V2A A;  1MTC A;  3EMP A;  1FB6 A;  1GRX A;  1PA3 A;  2X64 A;  1U88 A;  4MMM A;  4IP1 A;  1GTU A;  4KDU A;  1RK4 A;  1XVQ A;  4OCE A;  3WGD A;  3UBL A;  1B4Q A;  1DBY A;  3FEU A;  1IYI A;  1T1V A;  4TR4 A;  2HRK B;  2KLX A;  1J9B A;  1A0F A;  2L6D A;  1ON4 A;  3ZML A;  3M3M A;  1O73 A;  2C0F A;  2YV7 A;  2DC5 A;  2WDU A;  2GZP A;  5DJL A;  3UAP A;  2IME A;  3LYK A;  3RPN A;  2GT6 A;  4BVY B;  3EYT A;  2XBI A;  3KD0 A;  1K0N A;  2A4V A;  1A2L A;  2AYT A;  4I8B A;  4E8H A;  4K8M A;  4IJ3 A;  4X43 A;  5H5R A;  1J0F A;  4BPY A;  2HE3 A;  5A4U A;  1W4V A;  1K3O A;  4USS A;  5A4V A;  2F3M A;  4GLT A;  2H6Y A;  3UEM A;  1YEP A;  1G0T A;  4O92 A;  3CRU A;  5D73 A;  3BCI A;  1FO5 A;  5F07 A;  2LTK A;  4KDX A;  1SKW B;  5KN1 A;  1XWK A;  2C80 A;  4KB3 A;  1M2D A;  2R5G A;  2OBI A;  1XOA A;  3ZLP A;  1K0M A;  2I3Y A;  5DAK A;  1K3Y A;  2N5F A;  4TXV A;  3ZFL A;  2L6C A;  2RII A;  4MZB A;  4D73 A;  4KDY A;  3VI5 A;  1QXH A;  3M1G A;  2JZS A;  1ZYE A;  1ABA A;  3LSZ A;  4POL A;  5J9B A;  3RDW A;  2WCI A;  2L5O A;  2H6Z A;  2E2G A;  3GMF A;  5IMC A;  4WBJ A;  3O3T A;  1VF1 A;  2VLT A;  3BD2 A;  4HEA 2;  5DCG A;  3TDG A;  4GF0 A;  2YCD A;  2LEG A;  1H75 A;  4HS1 A;  1BQ7 A;  3ME7 A;  22GS A;  2GZZ A;  5EPF A;  3GTU B;  3MAK A;  2B7K A;  2HYX A;  2VCQ A;  2CQ9 A;  1XIY A;  5EL8 A;  2IFQ A;  3QAG A;  2YJH A;  2B5E A;  1FB0 A;  2FLS A;  2PUK C;  1OAZ A;  2X8H A;  2JSY A;  4GQF A;  1VF2 A;  1SKS B;  5CRD A;  5G2Z A;  2GQL A;  3TJF A;  2QGV A;  3ZL5 A;  1TK0 B;  4N11 A;  5ECS A;  3I9V 2;  3OR5 A;  1A24 A;  3WGE A;  2R6K A;  1OC8 A;  5IOW A;  4L8E A;  1AXD A;  1GNW A;  3TKS E;  3GYK A;  1R26 A;  3ISO A;  4HDE A;  4YQM A;  4YQV A;  4EL1 A;  3QAV A;  5JWQ B;  6GSU A;  2C0G A;  14GS A;  1EEJ A;  2PU9 C;  1PD2 1;  5ECM B;  4HQS A;  2JZT A;  2R3X A;  1WPI A;  3A3T A;  3A2V A;  1X9W B;  4XHM A;  3I43 A;  4MJE A;  3DKS A;  1BJX A;  3M9J A;  4KAE A;  5GSS A;  4K0N A;  1GTA A;  3L0H A;  20GS A;  1TRV A;  4GSN A;  2QKE A;  1SK2 A;  2VL9 A;  4HI7 A;  3EMX A;  1E6B A;  1XWB A;  2JSZ A;  2L5L A;  2HT9 A;  2LRC A;  3LYP A;  5D9X A;  2C0E A;  1GWC A;  5AGY A;  4N30 A;  2CVB A;  4K7I A;  1F3A A;  2YV9 A;  3G7I A;  2TRC P;  4YH2 A;  1ZCP A;  1PMT A;  1ZGN A;  2RUE A;  3HJM A;  4IP6 A;  3F4S A;  4TRX A;  1W89 A;  4O32 A;  4MJB A;  3IK9 A;  4POK A;  1AAZ A;  4JBB A;  5ID2 B;  1BYE A;  1X0R A;  4OD7 A;  1GSY A;  2VLU A;  2RM6 A;  3GX8 A;  5J3R A;  3MDK A;  3HA9 A;  2CV4 A;  4OCF A;  3DVX A;  2GSS A;  2B1K A;  3P8W A;  2GTU A;  4F0B A;  2DJ0 A;  2O87 A;  3BOA A;  4F9Z A;  3D21 A;  1JZD A;  5H5S A;  2F9S A;  2R2J A;  3GKN A;  4ILF A;  5C04 A;  3GV1 A;  1Q98 A;  4GXZ A;  4K9Z A;  3ZYW A;  2R37 A;  3NOF A;  1EZK A;  1A2M A;  3ZIV A;  1X5E A;  5LD0 A;  3J7Y b;  3IC4 A;  3TGZ A;  1SKR B;  1A2J A;  5HQP A;  4IKH A;  4JR4 A;  3IA1 A;  1JZW A;  1THX A;  1MDJ A;  2V6K A;  3H1N A;  3F0I A;  3R3E A;  1GLP A;  4YAP A;  2VD1 A;  4ZIJ A;  3BBY A;  5B7C A;  5IMZ A;  3HZ4 A;  2G2Q A;  5DVB A;  2I1U A;  1CQH A;  2DJ1 A;  1RW1 A;  1GTI A;  1BX9 A;  4OO5 A;  3UVT A;  2LS5 A;  1AQV A;  2AJQ B;  4JZQ A;  4IVF A;  4FH8 A;  2GQK A;  2IIY A;  1XPV A;  3H79 A;  6GSY A;  4ECJ A;  3EU3 A;  3MNG A;  1X5D A;  5D9W A;  1NW2 A;  1T7P B;  5CYY A;  4PQI A;  2I9H A;  3TJJ A;  1AW9 A;  5E59 A;  3A2X A;  4IGJ A;  4N10 A;  2H0G A;  3Q6O A;  1T8E B;  5DAL B;  4L0U A;  3WT1 A;  4PNG A;  3FZ9 A;  1N8J A;  3K8N A;  4GWR A;  5FWG A;  4HJM A;  5L71 A;  2IMK A;  2WB9 A;  1H4O A;  3TJB A;  1XWA A;  3TRP A;  1TI1 A;  1HNB A;  4TR3 A;  2FA8 A;  4MZW A;  1PQN A;  2YP6 A;  1R5A A;  4XS4 A;  4NAX A;  1AQX A;  3PR8 A;  1YY7 A;  5HR0 A;  1MDK A;  4LLR A;  4Q5F A;  2KP2 A;  3ZIT A;  3WYW A;  1DE1 A;  3U6V A;  2CVD A;  1PL2 A;  4WF5 A;  2HZE B;  2GSQ A;  4FO5 A;  4RQR A;  1LU4 A;  2HSM B;  2YJ7 A;  2L4C A;  2IMF A;  3TKP A;  2H75 A;  2I81 A;  2KOK A;  1G7E A;  1PSQ A;  3LOR A;  4F2I A;  5ECL B;  2ALB A;  4P3Y B;  1KNG A;  2IPA A;  5LCZ A;  3ZVJ A;  4EUY A;  4V1A p;  1GSQ A;  2F8F A;  2ZCT A;  3C73 A;  2DIZ A;  1DSB A;  1EV4 A;  2ZNM A;  1OE7 A;  3P2A A;  3ED3 A;  1FHE A;  4TR1 B;  5AN1 A;  3GL3 A;  5IM9 A;  2HRF A;  4MK3 A;  3BCK A;  2RLI A;  4G0L A;  1ML6 A;  1X5C A;  3G7J A;  2AHE A;  2LQQ A;  3WD6 A;  3VWV A;  1U6T A;  1ACV A;  8GSS A;  3LQ7 A;  2H0H A;  2P5R A;  2DLX A;  2B3S A;  1WP0 A;  1Z9H A;  4IHU A;  5G31 A;  1BAY A;  2OAD A;  3O76 A;  1PKW A;  3KJY A;  3DRN A;  5JCW A;  1SJ6 A;  1Q4J A;  4HU7 A;  1TDI A;  4POB A;  4KCE A;  2QSI A;  2C0D A;  1C72 A;  3D6I A;  2A2S A;  2WUL A;  1OE8 A;  1VF3 A;  4EC0 A;  2YAN A;  3LXZ A;  1HQO A;  5H5Q A;  3TKQ A;  3D4T A;  4GSS A;  2J9H A;  1XWC A;  2LQO A;  5IMA A;  1X9M B;  3TKS A;  3FKF A;  3FHK A;  4KCA A;  1TK8 B;  2GT5 A;  1TW9 A;  1HNA A;  1PN9 A;  3UAR A;  3QFB C;  1T4Y A;  3QD9 A;  1GSF A;  1SJZ A;  6GSS A;  2DJJ A;  2FA4 A;  4XRA A;  2CAI A;  1O85 A;  2H30 A;  2I4A A;  2H0I A;  3US3 A;  4ZXG A;  1XOB A;  5BMU A;  1YZX A;  2KHP A;  3HHV A;  3M0F A;  1V57 A;  17GS A;  2VL2 C;  2YNX A;  1KTE A;  3GFK A;  3FZ5 A;  1WWJ A;  3GKK A;  5CRG A;  4IN0 A;  4BVX A;  2FY6 A;  3PPU A;  4L0W A;  2CT6 A;  2MBT A;  1IYH A;  2ON5 A;  3TCO A;  5B6M A;  3LFL A;  2X8C A;  1F6M C;  4TKY A;  2AUV A;  2FGX A;  4ZBD A;  3HJO A;  3M9K A;  4X0X A;  3VWX A;  1XW9 A;  3E3E A;  4GQC A;  5CRH A;  1M9A A;  2K8V A;  5HR1 A;  4XRD A;  2FCH A;  1A8Y A;  1ZZY A;  2N5B A;  7GSS A;  1ERU A;  1OC9 B;  2KP1 A;  5G5E A;  2V41 A;  2VM2 A;  5AIS A;  1M2A A;  3HKR A;  1GUL A;  2FNO A;  5ABR A;  4NV2 A;  3QOU A;  2WS2 A;  2LKU A;  5JCU A;  4AF2 A;  2E2M A;  4WR4 A;  3AY8 A;  1ST9 A;  4QQ7 A;  3KEB A;  1GSS A;  3VPQ A;  3H93 A;  2YWN A;  1R5P A;  3L9U A;  4HZ4 A;  4ZBA A;  4MH3 A;  2RM5 A;  1NHO A;  2WGR A;  5IO0 A;  5D9T A;  3BJ5 A;  4E8E A;  2OJL A;  1FG4 A;  4LA1 A;  3KCM A;  3GH6 A;  3HY2 A;  2VCV A;  2DSA A;  3CSH A;  3TKS C;  1MD3 A;  2O85 A;  4KSM A;  4DEJ A;  5HFG A;  5GST A;  13GS A;  3H4K A;  1VF4 A;  1PKZ A;  2DBC A;  2FUG 2;  1BED A;  2A2R A;  3F4R A;  1WOU A;  4MJA A;  3ZIJ A;  5IMD A;  4MF6 A;  1KEB A;  2XPE A;  18GS A;  1PX7 A;  2ZUP A;  4JRR A;  4J57 E;  2VIM A;  3VK9 A;  4ML1 A;  3FR6 A;  4ECB A;  3MSZ A;  3GST A;  1T3B A;  2GQM A;  1LJR A;  1B4P A;  2R4V A;  1T00 A;  1EGR A;  2VOC A;  3HXS A;  3SBC A;  3EC3 A;  9GSS A;  1M9B A;  2TIR A;  3APQ A;  4KH7 A;  4DSS B;  4K6X A;  4OFT A;  2L59 A;  2NBS A;  3RHB A;  4OO4 A;  5IIZ A;  5CRE A;  1OKT A;  1EP7 A;  1MD4 A;  2H1A A;  2C8U A;  1QGV A;  3IE3 A;  5J4U A;  4G0K A;  2VM1 A;  4ZL7 A;  3D0Z A;  3F3R A;  5IPG A;  4EDZ A;  4N0Z A;  2HI7 A;  1GSU A;  3TKR A;  3D22 A;  1JLW A;  2HSY A;  4NV5 A;  1FW1 A;  5J5N A;  4ZBB A;  3DIE A;  2EIR A;  1ZYQ B;  5IOX A;  2VLV A;  3C71 A;  3VUR A;  3UIW A;  3QDN A;  5ECK B;  5D8I A;  2B5X A;  4HZ2 A;  1SL0 B;  2WZ9 A;  2O89 A;  3CBU A;  3TRQ A;  1S3D A;  1JZR A;  4K1F A;  3N9J A;  2YZU A;  2ON7 A;  2H1B A;  4IS0 A;  1USB A;  4KGI A;  5IMF A;  3KIJ A;  2QC7 A;  4ECC A;  1K3L A;  2KUC A;  3HYP A;  4I2U A;  2H19 A;  1F2E A;  3DEX A;  1FAA A;  2HLS A;  4KUN A;  2YWI A;  3FY7 A;  5F06 A;  5ENU A;  1Z6N A;  1T4Z A;  2WJU A;  2PBJ A;  4ZL8 A;  3ZRD A;  4GCI A;  1NHY A;  1F3B A;  3IAS 2;  3J7Y k;  2L4Q A;  2MMN A;  1X9S B;  1XWG A;  1XZO A;  2PN8 A;  5G5F A;  2REM A;  4TXO A;  19GS A;  2MYG A;  2VCW A;  3GX0 A;  5LNK e;  5DAK B;  4G0I A;  3GRX A;  3GNJ A;  4EXJ A;  5KEJ A;  2NVL A;  3FZA A;  1OC3 A;  1PRX A;  3Q19 A;  3F8U A;  1U3I A;  4D73 B;  3CXG A;  2VD0 A;  3KXO A;  2HRN A;  4MP4 A;  3WT2 A;  2CAQ A;  2DJ3 A;  2LNT A;  4MPG A;  3CTF A;  3RBT A;  4F82 A;  2V32 A;  3H8Q A;  4AJ8 A;  2YWO A;  4JED A;  2B1L A;  3TOT A;  2P5Q A;  4HUA A;  1Z3E A;  1ZOF A;  4YAV A;  4ISD A;  1ZMA A;  5C00 A;  1DUG A;  1SEN A;  1GUK A;  5EVO A;  3IC8 A;  3ZFB A;  2IFQ B;  4BL7 A;  4EVM A;  2EIO A;  4PQ1 A;  3C1S A;  1YDK A;  4KE3 A;  5B8A A;  3IAM 2;  5G1K A;  2BTO T;  1K0A A;  5CRW A;  3UMA A;  2D2Z A;  2VL3 A;  4HU9 A;  2OKA A;  5ECO B;  3KTB A;  1MDI A;  4MJC A;  4G19 A;  3IR4 A;  1UA5 A;  2HRK A;  5EY6 A;  1Y25 A;  1M7T A;  3KTL A;  2H70 A;  3HCZ A;  3EWL A;  3CRT A; 
#chains in the Genus database with same CATH topology
 1U3A A;  16GS A;  1CQG A;  3CSI A;  4V2L A;  1O7U A;  3ZTL A;  4BVY A;  2CZ3 A;  1QQ2 A;  1YF1 A;  3W8J A;  2VCX A;  1HD2 A;  5HFI A;  4IQA A;  5CP1 A;  2K8S A;  2F8A A;  5E4W A;  3DD3 A;  1YQ1 A;  1SVO A;  1YJ6 A;  4I97 A;  3EU4 A;  3GKM A;  4PQH A;  2PVQ A;  5IO2 A;  1VGL A;  2CX4 A;  2VAF A;  1TI3 A;  3TB2 A;  4FYC A;  5D93 A;  2HSN B;  4QL7 A;  4MLY A;  2C4J A;  2VL2 A;  1SD9 A;  3LEF A;  2B7J A;  2FWH A;  3UOM A;  3HZ8 A;  2WFC A;  4TW5 A;  3VLN A;  4O5R A;  2J23 A;  1S3R A;  2X99 A;  5G1L A;  1EOH A;  2JZR A;  4WET A;  2XHF A;  3S9F A;  2H01 A;  1O81 A;  3DXB A;  2GLR A;  2YZH A;  5G30 A;  3DGQ A;  2VKZ G;  1HNC A;  3VI7 A;  2DKH A;  1GH2 A;  2YOI A;  2GST A;  3HVS A;  4JU5 A;  5F05 A;  4RI6 A;  1UN2 A;  2CX3 A;  2M72 A;  1AC1 A;  3FMW A;  3GTU A;  4MPF A;  5ECQ B;  2PPT A;  4IJI A;  3RAZ A;  1O8X A;  2CVK A;  4YQU A;  4XS6 A;  2H76 A;  1EV9 A;  1PL1 A;  2F51 A;  5JCG A;  5HR3 A;  1Z6M A;  3FR3 A;  4HSC X;  2WW1 A;  2FD3 A;  1E2Y A;  4TVE A;  5GAP D;  3LJR A;  2DML A;  1U87 A;  1K0C A;  1EWX A;  3HJP A;  3Q18 A;  5KN2 A;  5AIV A;  4Q5N A;  5D9V A;  4ECI A;  2DIY A;  3SWL A;  2PER A;  3GUS A;  4ULX A;  3F3Q A;  5FHI A;  4V2M A;  1QFN A;  1SK1 A;  2YN1 A;  3LGC A;  1QMV A;  4MF5 A;  3GN3 A;  2VCT A;  4MA9 A;  3FRC A;  3EIN A;  4G10 A;  4AGS A;  3QR6 A;  1EEM A;  3HDC A;  3HVX A;  1ZL9 A;  1XCC A;  1B9X C;  4LL4 B;  4O7H A;  3QAW A;  3RHC A;  4BL7 B;  4RQX A;  3TOU A;  2IN3 A;  1ERT A;  11GS A;  2H1D A;  5DQS A;  3KP8 A;  1M3J A;  3GL5 A;  4OFN A;  4N0V A;  1BF5 A;  1F9M A;  2G0F A;  3F6F A;  3KMO A;  1GL8 A;  1TKD B;  1YKC A;  5DQY A;  4EKZ A;  3APS A;  1B8X A;  2H73 A;  5AIX A;  2P0G A;  2EIQ A;  2PMT A;  5GZZ B;  2IWT A;  5CNW A;  2MZC A;  3KH7 A;  3NZN A;  4HJ2 A;  4K2D A;  3UJ1 A;  2GZY A;  2DKI A;  1Y6E A;  3Q74 A;  4PXO A;  4FYU A;  6GSW A;  1THO A;  4K5R A;  3VWU A;  4F0C A;  3G7Y A;  2ES7 A;  4MDC A;  4XS4 B;  4LMV A;  2XPD A;  5ID2 A;  2IL3 A;  1WMJ A;  4DSR A;  1M2B A;  3EVI A;  3R2Q A;  3IRA A;  3WGX A;  2MMA A;  4MH2 A;  3GSS A;  2WRT A;  3HVV A;  1SL1 B;  3L4N A;  1NM3 A;  4CY6 A;  3VPT A;  3JCM L;  4Q5R A;  3CSJ A;  5A5K A;  4OWY A;  2RUF A;  4XCS A;  4PTS A;  1TU7 A;  2A2P A;  5GAN D;  2X8G A;  1O8W A;  2XC2 A;  1S3C A;  4PUF C;  3QCP A;  2OBK A;  2OE0 A;  1TXU A;  3GH9 A;  4NXI A;  4I5Q A;  4WXT A;  1V40 A;  2K6V A;  4F03 A;  1XG8 A;  1V98 A;  5JWO B;  4L5O A;  3L9S A;  4X1U A;  1M0U A;  5J41 A;  4ZB9 A;  2V1M A;  1KBN A;  5IMV A;  4I6X A;  3L9V A;  1HYU A;  1TRU A;  1S3A A;  5CAX A;  5A34 B;  2C3T A;  4PGT A;  3C1R A;  3PH9 A;  1YF0 A;  2FWE A;  1JHB A;  3KP9 A;  4TR0 A;  2WVX A;  4KF9 A;  4KSO A;  2B6M A;  3FW2 A;  2IMI A;  2MBS A;  2H74 A;  1J08 A;  3IHQ A;  2H6X A;  4IBP A;  3W8S A;  1R4W A;  1WE0 A;  4AKX B;  4IW9 A;  3ZRE A;  1QK8 A;  5DCH A;  3V1W A;  2P31 A;  3LXT A;  2AAW A;  1VRS D;  4ZB6 A;  2NPB A;  5B6N A;  2VCZ A;  1V58 A;  5ECH B;  1FVK A;  4PNF A;  3F9U A;  1GTB A;  4MCU A;  4GRF A;  3KZQ A;  4I2T A;  3NIV A;  3PGT A;  4WKW A;  4PUR A;  3IPZ A;  2OE1 A;  2LRN A;  3N5O A;  3GKX A;  1RQM A;  1EOG A;  5DAL A;  1Y1U A;  3ZVJ D;  1XFL A;  3KM6 A;  1GSE A;  4ZB8 A;  1TK5 B;  3IBH A;  4FYB A;  2NDO A;  4IQ1 A;  1K0D A;  3IXR A;  5J4V A;  1XW5 A;  3CHX C;  3M8N A;  3P90 A;  3UL3 A;  1GP1 A;  3EE2 A;  1JFU A;  2VUP A;  5IPH A;  4NMU A;  4K2X A;  1TXX A;  1ILO A;  4AJ7 A;  3CQF A;  1EGO A;  1MEK A;  3IV4 A;  3F63 A;  1XXU A;  4GST A;  5ELA A;  5A5H B;  3ERG A;  2FWG A;  1QUW A;  3TRX A;  2B5Y A;  1YKA A;  2H72 A;  5BMU B;  4XTS A;  3E9J B;  1PGT A;  2XBQ A;  2K9F A;  2HZE A;  12GS A;  2V6O A;  1BG1 A;  1G7O A;  2HSM A;  3QPM A;  5JWR B;  4AKH A;  1SYR A;  3APO A;  4J56 E;  1YEX A;  4NHZ A;  4G9H A;  4BVX B;  2DJ2 A;  5CO3 A;  1PX6 A;  3I6A A;  3KMN A;  6GSV A;  1TRW A;  4RUV A;  4YKF A;  3RPP A;  2M80 A;  2V2G A;  2JAC A;  2DMM A;  5ECI B;  1FOV A;  1GSD A;  5D96 A;  2NTO A;  5INY A;  4XS1 A;  2PVO C;  3C7M A;  1GUH A;  1I9D A;  3DVW A;  4BWQ A;  1S4B P;  1SJI A;  4BWS A;  3P7X A;  4TR1 A;  4JE1 A;  5COH A;  2YPM A;  3ZZX A;  3IOS A;  3D5J A;  2C3Q A;  1B48 A;  1UC7 A;  2HFD A;  4IEL A;  3DYR A;  4K5S A;  3LWA A;  4ML6 A;  5B8B A;  4G2E A;  4KW6 A;  4JR6 A;  2GDR A;  3RGB C;  2GGT A;  2LST A;  4WF4 A;  3TUE A;  2MMZ A;  6GST A;  2IJY A;  2O8V B;  3QFA C;  2GSR A;  4NHW A;  4L5L A;  2LV3 A;  2C3N A;  2K18 A;  1JLV A;  3CYN A;  2EFH A;  1BG5 A;  1Z7P A;  5ELG A;  5HFK A;  3IK7 A;  1F37 A;  4K7N A;  4LL1 B;  2FHE A;  1A8L A;  1OKD A;  3FR9 A;  3GHA A;  4Z2T A;  4BA7 A;  1DE2 A;  4ZB7 A;  1SK0 A;  1TTZ A;  2E0Q A;  4CHS A;  4LMW A;  3LW9 A;  2HXK A;  3L78 A;  3MWH A;  5DDL A;  4ZIL A;  10GS A;  4DVC A;  4HQZ A;  4ID0 A;  3F4T A;  2OE3 A;  2JAD A;  4WR5 A;  2OA7 A;  4O5U A;  2EC4 A;  1OYJ A;  3O6T A;  2UZ8 A;  4EF0 A;  3CMI A;  4H86 A;  2OAC A;  3IDV A;  1OVN A;  1LBK A;  5DBQ A;  2YWM A;  5KN0 A;  5A1N B;  2HRA A;  3A5W A;  4Z7X A;  3GA4 A;  1G6W A;  5HR2 A;  3DWV A;  2E7P A;  4ZL9 A;  3EUR A;  3ZMK A;  1TOF A;  5J9C A;  3UBK A;  2H8L A;  1XVW A;  4EE0 A;  3C8E A;  1GUM A;  2CA8 A;  1WIK A;  1FVJ A;  2IMD A;  3CTG A;  4PX1 A;  4J2F A;  3G9B A;  2AV4 A;  5F8B A;  3ME8 A;  3TJK A;  4TOP A;  3LG6 A;  2HQT A;  2H66 A;  6GSX A;  4AJ6 A;  4KX4 A;  3EPT A;  4K0G A;  2M46 A;  1K0B A;  2H1G A;  5FT3 A;  4POM A;  5J4Y A;  3F6D A;  1TU8 A;  4KA0 A;  4RI7 A;  2H71 A;  2O7K A;  4EDY A;  2N5A A;  4NPB A;  3KH9 A;  1ERV A;  1NSW A;  1OC9 A;  3FZ4 A;  1GLQ A;  2LJA A;  1JZO A;  1V9W A;  4ICY A;  1Z7R A;  1AUC A;  4NWY A;  4HOJ A;  2PGT A;  3GUR A;  4O5Q A;  1TRS A;  2LRT A;  2L57 A;  3VWW A;  1M99 A;  3W6G A;  3DML A;  2AB6 A;  3UVH A;  4WBR D;  1GNE A;  2JL4 A;  3ERW A;  3VFI A;  4MF7 A;  1WRY A;  2C1Y A;  1A0R P;  3FYG A;  3KGK A;  3E0U A;  3HD5 A;  2QA2 A;  2FWF A;  1SYX A;  2BJX A;  5KN3 A;  4AI6 A;  5DJM A;  4QL9 A;  1ERW A;  4V2N A;  2HZF A;  5A4W A;  1G6Y A;  4EO3 A;  4XIH A;  5F0G A;  4WEY A;  3U5R E;  3ERF A;  4ACS A;  3A2W A;  5ECP B;  1Z5Y E;  2LJK A;  2VO4 A;  1A23 A;  4TN8 A;  1EP8 A;  3I69 A;  1XW6 A;  4AKG A;  5ECR B;  4OMV A;  3PIN A;  4DSQ A;  2PWJ A;  3FK8 A;  4TXO B;  4V1A g;  2TRX A;  4FIW A;  4CW9 A;  1B9Y C;  1SU9 A;  4Q5Q A;  4W66 A;  5IQY A;  1N2A A;  1XBS A;  2LNS A;  4K7O A;  1AQW A;  2MMO A;  4FQU A;  4GTU A;  1WJK A;  4BIK A;  1AIU A;  1O6J A;  2GVP A;  1TP9 A;  4N3Z A;  3HVN A;  4DSS A;  4MAB A;  1SL2 B;  2UV8 G;  2DJK A;  1SD8 A;  1URM A;  2HNL A;  2LJR A;  4MZC A;  3QMX A;  3GIX A;  4OFM A;  2BMX A;  4CDO A;  1TJD A;  2Z9S A;  2GS3 A;  1I5G A;  4PUA A;  2HSH A;  2LUS A;  1K0O A;  3D4M A;  1R7H A;  3TJG A;  2CZ2 A;  4KND A;  2JU5 A;  1UVZ A;  5ECN B;  1V2A A;  1MTC A;  3EMP A;  1FB6 A;  1GRX A;  1PA3 A;  2X64 A;  1U88 A;  4MMM A;  4IP1 A;  1GTU A;  4KDU A;  1RK4 A;  1XVQ A;  4PI2 C;  4OCE A;  3WGD A;  3UBL A;  1B4Q A;  1DBY A;  3FEU A;  1IYI A;  1T1V A;  4TR4 A;  2HRK B;  2KLX A;  1J9B A;  1A0F A;  2L6D A;  1ON4 A;  3ZML A;  3M3M A;  1O73 A;  2C0F A;  2YV7 A;  2DC5 A;  2WDU A;  2GZP A;  5DJL A;  3UAP A;  2IME A;  3LYK A;  3RPN A;  2GT6 A;  4BVY B;  3EYT A;  2XBI A;  3KD0 A;  1K0N A;  2A4V A;  1A2L A;  2AYT A;  4I8B A;  4E8H A;  4K8M A;  4IJ3 A;  4X43 A;  5H5R A;  1J0F A;  4BPY A;  2HE3 A;  5A4U A;  1PFO A;  1W4V A;  1K3O A;  4USS A;  5A4V A;  2F3M A;  4GLT A;  2H6Y A;  3UEM A;  1YEP A;  1G0T A;  4O92 A;  3CRU A;  5D73 A;  3BCI A;  1FO5 A;  5F07 A;  2LTK A;  4KDX A;  1SKW B;  5KN1 A;  1XWK A;  2C80 A;  1M2D A;  2OBI A;  2R5G A;  4KB3 A;  1XOA A;  3ZLP A;  1K0M A;  2I3Y A;  5DAK A;  1K3Y A;  2N5F A;  4TXV A;  3ZFL A;  2L6C A;  2RII A;  4MZB A;  4D73 A;  4KDY A;  3VI5 A;  1QXH A;  3M1G A;  2JZS A;  1ZYE A;  1ABA A;  3LSZ A;  4POL A;  5J9B A;  3RDW A;  2WCI A;  2L5O A;  2H6Z A;  2E2G A;  2WW2 A;  3GMF A;  5IMC A;  4WBJ A;  4QMK A;  3O3T A;  1VF1 A;  2VLT A;  3BD2 A;  4HEA 2;  5DCG A;  3TDG A;  4GF0 A;  2YCD A;  2LEG A;  1H75 A;  4HS1 A;  1BQ7 A;  3ME7 A;  22GS A;  2GZZ A;  5EPF A;  3GTU B;  3MAK A;  2B7K A;  2HYX A;  2VCQ A;  2CQ9 A;  1XIY A;  5EL8 A;  2IFQ A;  1ZYN A;  3QAG A;  2YJH A;  2B5E A;  1FB0 A;  2FLS A;  2PUK C;  1OAZ A;  2X8H A;  2JSY A;  4GQF A;  1VF2 A;  1SKS B;  5CRD A;  5KOW A;  5G2Z A;  1FOH A;  2GQL A;  3TJF A;  2QGV A;  3ZL5 A;  1TK0 B;  4N11 A;  5ECS A;  3I9V 2;  3OR5 A;  1A24 A;  3WGE A;  2R6K A;  1OC8 A;  5IOW A;  4L8E A;  1AXD A;  1GNW A;  2WVY A;  3TKS E;  3GYK A;  1R26 A;  3ISO A;  4HDE A;  4YQM A;  4YQV A;  2X4A A;  4EL1 A;  3QAV A;  5JWQ B;  6GSU A;  2C0G A;  14GS A;  1EEJ A;  2PU9 C;  1PD2 1;  5ECM B;  4HQS A;  2JZT A;  2R3X A;  1WPI A;  3A3T A;  3A2V A;  5J47 A;  1X9W B;  4XHM A;  3I43 A;  4MJE A;  3DKS A;  1BJX A;  3M9J A;  2EFE A;  4KAE A;  5GSS A;  4K0N A;  3HMJ G;  1GTA A;  3L0H A;  20GS A;  1TRV A;  4GSN A;  2QKE A;  1SK2 A;  2VL9 A;  4HI7 A;  3EMX A;  1E6B A;  1XWB A;  2JSZ A;  2L5L A;  2HSN A;  2HT9 A;  2LRC A;  3LYP A;  5D9X A;  2C0E A;  1GWC A;  5AGY A;  4N30 A;  2CVB A;  4K7I A;  1F3A A;  2YV9 A;  3G7I A;  2TRC P;  4YH2 A;  1ZCP A;  1PMT A;  1ZGN A;  4Z2U A;  2RUE A;  3HJM A;  4IP6 A;  3F4S A;  4TRX A;  1W89 A;  4O32 A;  4MJB A;  3IK9 A;  4POK A;  1AAZ A;  5BRT A;  4JBB A;  5ID2 B;  1BYE A;  1X0R A;  4OD7 A;  1GSY A;  2VLU A;  2RM6 A;  3GX8 A;  5J3R A;  2OT3 A;  3MDK A;  3HA9 A;  2CV4 A;  4OCF A;  3DVX A;  2GSS A;  3MYD A;  2B1K A;  3P8W A;  2GTU A;  4F0B A;  4EIP A;  2DJ0 A;  2O87 A;  3BOA A;  4F9Z A;  3D21 A;  1JZD A;  5H5S A;  2F9S A;  2QA1 A;  2R2J A;  3GKN A;  4ILF A;  5C04 A;  3GV1 A;  1Q98 A;  4GXZ A;  4K9Z A;  3ZYW A;  4PI0 C;  2R37 A;  3NOF A;  1EZK A;  1A2M A;  3ZIV A;  1X5E A;  5LD0 A;  3J7Y b;  3IC4 A;  3TGZ A;  1SKR B;  1A2J A;  5HQP A;  4IKH A;  4JR4 A;  3IA1 A;  1JZW A;  1THX A;  1MDJ A;  2V6K A;  3H1N A;  3F0I A;  3R3E A;  1GLP A;  4YAP A;  2VD1 A;  4ZIJ A;  3BBY A;  5B7C A;  5IMZ A;  3HZ4 A;  2G2Q A;  5DVB A;  2WVX B;  2I1U A;  1CQH A;  2DJ1 A;  1RW1 A;  1GTI A;  1BX9 A;  4OO5 A;  3UVT A;  2LS5 A;  1AQV A;  2AJQ B;  4JZQ A;  4IVF A;  4FH8 A;  2GQK A;  2IIY A;  1XPV A;  3H79 A;  6GSY A;  4ECJ A;  3EU3 A;  3MNG A;  1X5D A;  5D9W A;  1NW2 A;  1T7P B;  5CYY A;  4PQI A;  2I9H A;  3TJJ A;  1AW9 A;  5E59 A;  3A2X A;  4IGJ A;  4N10 A;  2H0G A;  3Q6O A;  1T8E B;  1N25 A;  5DAL B;  4L0U A;  3WT1 A;  4PNG A;  3FZ9 A;  1N8J A;  3K8N A;  4GWR A;  5FWG A;  4HJM A;  5L71 A;  2IMK A;  2WB9 A;  1H4O A;  3MIX A;  3TJB A;  1XWA A;  3TRP A;  1TI1 A;  1HNB A;  4TR3 A;  4A5P A;  2FA8 A;  4MZW A;  1PQN A;  2YP6 A;  1R5A A;  4XS4 A;  4NAX A;  1AQX A;  3PR8 A;  2O5V A;  1YY7 A;  3TU3 B;  5HR0 A;  1MDK A;  3IHG A;  4LLR A;  4Q5F A;  2KP2 A;  3ZIT A;  3WYW A;  1DE1 A;  3U6V A;  2CVD A;  1PL2 A;  4MNN A;  4WF5 A;  2HZE B;  2GSQ A;  1PN0 A;  4FO5 A;  4RQR A;  1LU4 A;  2HSM B;  2YJ7 A;  2L4C A;  2IMF A;  3TKP A;  2H75 A;  2I81 A;  2KOK A;  1G7E A;  2WW3 A;  1PSQ A;  3LOR A;  4F2I A;  5ECL B;  2ALB A;  4P3Y B;  1KNG A;  2IPA A;  5LCZ A;  3ZVJ A;  4EUY A;  4V1A p;  4GDF A;  1GSQ A;  2F8F A;  2ZCT A;  1M3I A;  3C73 A;  2DIZ A;  1DSB A;  1EV4 A;  2ZNM A;  1OE7 A;  3P2A A;  3ED3 A;  1FHE A;  4TR1 B;  5A34 A;  5AN1 A;  3GL3 A;  5IM9 A;  2HRF A;  4MK3 A;  3BCK A;  2RLI A;  4G0L A;  1ML6 A;  1X5C A;  3G7J A;  2AHE A;  2LQQ A;  3WD6 A;  3VWV A;  1U6T A;  1ACV A;  8GSS A;  3LQ7 A;  2H0H A;  2EFD A;  2P5R A;  2DLX A;  2B3S A;  1WP0 A;  1Z9H A;  4IHU A;  5G31 A;  1BAY A;  2OAD A;  3O76 A;  1PKW A;  3KJY A;  3DRN A;  5JCW A;  1SJ6 A;  1Q4J A;  4HU7 A;  1TDI A;  4POB A;  4KCE A;  2QSI A;  2R0G A;  2C0D A;  1C72 A;  3D6I A;  2A2S A;  2WUL A;  1OE8 A;  1VF3 A;  4EC0 A;  2YAN A;  3LXZ A;  2H1L A;  1HQO A;  5H5Q A;  3TKQ A;  3D4T A;  4GSS A;  2J9H A;  1XWC A;  2LQO A;  5IMA A;  1X9M B;  3TKS A;  3FKF A;  3FHK A;  4KCA A;  1TK8 B;  2GT5 A;  1ZYP A;  1TW9 A;  1HNA A;  1PN9 A;  3UAR A;  3QFB C;  1T4Y A;  3QD9 A;  1GSF A;  1SJZ A;  6GSS A;  2DJJ A;  2FA4 A;  4XRA A;  2R0C A;  2CAI A;  1O85 A;  5A5H A;  2H30 A;  2I4A A;  2H0I A;  3US3 A;  4ZXG A;  1XOB A;  5BMU A;  1YZX A;  2O36 A;  2KHP A;  3HHV A;  3M0F A;  1V57 A;  17GS A;  2VL2 C;  2YNX A;  1KTE A;  3GFK A;  3FZ5 A;  1WWJ A;  3GKK A;  5CRG A;  4IN0 A;  4BVX A;  2FY6 A;  3PPU A;  4YKG A;  4L0W A;  2O3E A;  2CT6 A;  2MBT A;  1IYH A;  2ON5 A;  3TCO A;  4FXY P;  5B6M A;  3LFL A;  2X8C A;  1F6M C;  4TKY A;  2AUV A;  2FGX A;  4ZBD A;  3HJO A;  3M9K A;  4X0X A;  3VWX A;  1XW9 A;  3E3E A;  4GQC A;  5CRH A;  1M9A A;  2K8V A;  5HR1 A;  4XRD A;  2FCH A;  1A8Y A;  1ZZY A;  2N5B A;  7GSS A;  1ERU A;  1OC9 B;  2KP1 A;  5G5E A;  2V41 A;  2VM2 A;  5AIS A;  1M2A A;  3HKR A;  1GUL A;  2FNO A;  5ABR A;  4NV2 A;  3QOU A;  2WS2 A;  2LKU A;  5JCU A;  4AF2 A;  2E2M A;  4WR4 A;  3AY8 A;  1ST9 A;  1SVM A;  4QQ7 A;  3KEB A;  1GSS A;  3VPQ A;  3H93 A;  2YWN A;  1R5P A;  3L9U A;  2R0P A;  4HZ4 A;  4ZBA A;  4MH3 A;  2RM5 A;  1NHO A;  2WGR A;  5IO0 A;  5D9T A;  3BJ5 A;  4E8E A;  5J40 A;  2OJL A;  1FG4 A;  4LA1 A;  3KCM A;  3GH6 A;  3HY2 A;  2VCV A;  2DSA A;  3CSH A;  3TKS C;  1MD3 A;  2O85 A;  4KSM A;  4DEJ A;  5HFG A;  5GST A;  13GS A;  3H4K A;  1VF4 A;  1PKZ A;  2DBC A;  2FUG 2;  1BED A;  2A2R A;  3F4R A;  1WOU A;  2WVZ A;  4MJA A;  3ZIJ A;  5IMD A;  4MF6 A;  1KEB A;  2XPE A;  18GS A;  1PX7 A;  2ZUP A;  5A1N A;  4JRR A;  4J57 E;  5KOX A;  2VIM A;  3VK9 A;  4ML1 A;  3FR6 A;  4ECB A;  3MSZ A;  3GST A;  1T3B A;  2GQM A;  1LJR A;  1B4P A;  2R4V A;  1T00 A;  1EGR A;  2VOC A;  1I1I P;  3HXS A;  3SBC A;  3EC3 A;  9GSS A;  1M9B A;  2TIR A;  3APQ A;  4KH7 A;  4DSS B;  2A4H A;  4OFT A;  4K6X A;  2L59 A;  2NBS A;  3RHB A;  4OO4 A;  5IIZ A;  5CRE A;  1OKT A;  1EP7 A;  1MD4 A;  2H1A A;  2C8U A;  1QGV A;  3IE3 A;  5J4U A;  4G0K A;  2VM1 A;  4ZL7 A;  3D0Z A;  3F3R A;  5IPG A;  4EDZ A;  4N0Z A;  2HI7 A;  1GSU A;  3TKR A;  3D22 A;  1JLW A;  2HSY A;  4NV5 A;  1FW1 A;  5J5N A;  4ZBB A;  3DIE A;  2EIR A;  1ZYQ B;  5IOX A;  2VLV A;  1SVL A;  3C71 A;  3RFR C;  3VUR A;  3UIW A;  3QDN A;  4E68 A;  5ECK B;  5D8I A;  2B5X A;  4HZ2 A;  1SL0 B;  2WZ9 A;  2O89 A;  3CBU A;  3TRQ A;  1S3D A;  1JZR A;  4K1F A;  3N9J A;  2YZU A;  2ON7 A;  4Z2R A;  2H1B A;  4IS0 A;  1USB A;  4KGI A;  5IMF A;  3KIJ A;  2QC7 A;  4ECC A;  1K3L A;  2KUC A;  3HYP A;  4I2U A;  2H19 A;  1F2E A;  4EIQ A;  3DEX A;  1FAA A;  2HLS A;  4KUN A;  2YWI A;  3CWG A;  3FY7 A;  5F06 A;  5ENU A;  1Z6N A;  1T4Z A;  2WJU A;  2PBJ A;  4ZL8 A;  3ZRD A;  4GCI A;  1NHY A;  1F3B A;  3IAS 2;  3J7Y k;  2L4Q A;  2WW0 A;  2MMN A;  1X9S B;  1XWG A;  1XZO A;  4PHZ C;  2PN8 A;  5G5F A;  2REM A;  4TXO A;  3A5I A;  19GS A;  2MYG A;  2VCW A;  3GX0 A;  4X4J A;  5LNK e;  5DAK B;  2WZS A;  4G0I A;  3GRX A;  3GNJ A;  4EXJ A;  5KEJ A;  2NVL A;  3FZA A;  1OC3 A;  1PRX A;  3Q19 A;  3F8U A;  1U3I A;  4D73 B;  2EFC A;  3CXG A;  2VD0 A;  3KXO A;  2HRN A;  4MP4 A;  3WT2 A;  2CAQ A;  2DJ3 A;  2LNT A;  4MPG A;  3CTF A;  3RBT A;  4F82 A;  2V32 A;  3H8Q A;  4AJ8 A;  4AKI A;  2YWO A;  4JED A;  2B1L A;  3TOT A;  2P5Q A;  4HUA A;  1Z3E A;  4G01 A;  1ZOF A;  4YAV A;  4ISD A;  1ZMA A;  5C00 A;  1DUG A;  1SEN A;  1GUK A;  5EVO A;  3IC8 A;  3ZFB A;  2IFQ B;  4BL7 A;  4EVM A;  2EIO A;  4PQ1 A;  3C1S A;  1YDK A;  4KE3 A;  5B8A A;  3IAM 2;  5G1K A;  2BTO T;  1K0A A;  5CRW A;  3UMA A;  2D2Z A;  1YVL A;  2X49 A;  2VL3 A;  4HU9 A;  4CY8 A;  2OKA A;  5ECO B;  3KTB A;  1MDI A;  4MJC A;  4G19 A;  3IR4 A;  1UA5 A;  2HRK A;  5EY6 A;  1Y25 A;  1M7T A;  3KTL A;  1YEW C;  2H70 A;  3HCZ A;  3EWL A;  3CRT A; 
#chains in the Genus database with same CATH homology
 1U3A A;  16GS A;  1CQG A;  3CSI A;  4V2L A;  1O7U A;  3ZTL A;  4BVY A;  2CZ3 A;  1QQ2 A;  1YF1 A;  3W8J A;  2VCX A;  1HD2 A;  5HFI A;  4IQA A;  5CP1 A;  2K8S A;  2F8A A;  5E4W A;  3DD3 A;  1YQ1 A;  1SVO A;  1YJ6 A;  4I97 A;  3EU4 A;  3GKM A;  4PQH A;  2PVQ A;  5IO2 A;  1VGL A;  2CX4 A;  2VAF A;  1TI3 A;  3TB2 A;  4FYC A;  5D93 A;  2HSN B;  4QL7 A;  4MLY A;  2C4J A;  2VL2 A;  1SD9 A;  3LEF A;  2B7J A;  2FWH A;  3UOM A;  3HZ8 A;  2WFC A;  4TW5 A;  3VLN A;  4O5R A;  2J23 A;  2X99 A;  5G1L A;  1EOH A;  2JZR A;  4WET A;  2XHF A;  3S9F A;  2H01 A;  1O81 A;  3DXB A;  2GLR A;  2YZH A;  5G30 A;  3DGQ A;  2VKZ G;  1HNC A;  3VI7 A;  2DKH A;  1GH2 A;  2YOI A;  2GST A;  3HVS A;  4JU5 A;  5F05 A;  4RI6 A;  1UN2 A;  2CX3 A;  2M72 A;  1AC1 A;  3FMW A;  3GTU A;  4MPF A;  5ECQ B;  2PPT A;  4IJI A;  3RAZ A;  1O8X A;  2CVK A;  4YQU A;  4XS6 A;  2H76 A;  1EV9 A;  1PL1 A;  2F51 A;  5JCG A;  5HR3 A;  1Z6M A;  3FR3 A;  2FD3 A;  1E2Y A;  4TVE A;  5GAP D;  3LJR A;  2DML A;  1U87 A;  1K0C A;  1EWX A;  3HJP A;  3Q18 A;  5KN2 A;  5AIV A;  4Q5N A;  5D9V A;  4ECI A;  2DIY A;  3SWL A;  2PER A;  3GUS A;  4ULX A;  3F3Q A;  5FHI A;  4V2M A;  1QFN A;  1SK1 A;  2YN1 A;  3LGC A;  1QMV A;  4MF5 A;  3GN3 A;  2VCT A;  4MA9 A;  3FRC A;  3EIN A;  4G10 A;  4AGS A;  3QR6 A;  1EEM A;  3HDC A;  3HVX A;  1ZL9 A;  1XCC A;  1B9X C;  4LL4 B;  4O7H A;  3QAW A;  3RHC A;  4BL7 B;  4RQX A;  3TOU A;  2IN3 A;  1ERT A;  11GS A;  2H1D A;  5DQS A;  3KP8 A;  3GL5 A;  4OFN A;  4N0V A;  1BF5 A;  1F9M A;  2G0F A;  3F6F A;  3KMO A;  1GL8 A;  1TKD B;  1YKC A;  5DQY A;  4EKZ A;  3APS A;  1B8X A;  2H73 A;  5AIX A;  2P0G A;  2EIQ A;  2PMT A;  5GZZ B;  2IWT A;  5CNW A;  2MZC A;  3KH7 A;  3NZN A;  4HJ2 A;  4K2D A;  3UJ1 A;  2GZY A;  2DKI A;  1Y6E A;  3Q74 A;  4PXO A;  4FYU A;  6GSW A;  1THO A;  4K5R A;  3VWU A;  4F0C A;  3G7Y A;  2ES7 A;  4MDC A;  4XS4 B;  4LMV A;  2XPD A;  5ID2 A;  2IL3 A;  1WMJ A;  4DSR A;  1M2B A;  3EVI A;  3R2Q A;  3IRA A;  3WGX A;  2MMA A;  4MH2 A;  3GSS A;  2WRT A;  3HVV A;  1SL1 B;  3L4N A;  1NM3 A;  4CY6 A;  3VPT A;  3JCM L;  4Q5R A;  3CSJ A;  5A5K A;  4OWY A;  2RUF A;  4XCS A;  4PTS A;  1TU7 A;  2A2P A;  5GAN D;  2X8G A;  1O8W A;  2XC2 A;  1S3C A;  4PUF C;  3QCP A;  2OBK A;  2OE0 A;  1TXU A;  3GH9 A;  4NXI A;  4I5Q A;  4WXT A;  1V40 A;  2K6V A;  4F03 A;  1V98 A;  5JWO B;  4L5O A;  3L9S A;  4X1U A;  1M0U A;  5J41 A;  4ZB9 A;  2V1M A;  1KBN A;  5IMV A;  4I6X A;  3L9V A;  1HYU A;  1TRU A;  1S3A A;  5CAX A;  5A34 B;  2C3T A;  4PGT A;  3C1R A;  3PH9 A;  1YF0 A;  2FWE A;  1JHB A;  3KP9 A;  4TR0 A;  4KF9 A;  4KSO A;  2B6M A;  3FW2 A;  2IMI A;  2MBS A;  2H74 A;  1J08 A;  3IHQ A;  2H6X A;  4IBP A;  3W8S A;  1R4W A;  1WE0 A;  4AKX B;  4IW9 A;  3ZRE A;  1QK8 A;  5DCH A;  3V1W A;  2P31 A;  3LXT A;  2AAW A;  1VRS D;  4ZB6 A;  2NPB A;  5B6N A;  2VCZ A;  1V58 A;  5ECH B;  1FVK A;  4PNF A;  3F9U A;  1GTB A;  4MCU A;  4GRF A;  3KZQ A;  4I2T A;  3NIV A;  3PGT A;  4WKW A;  4PUR A;  3IPZ A;  2OE1 A;  2LRN A;  3N5O A;  3GKX A;  1RQM A;  1EOG A;  5DAL A;  1Y1U A;  3ZVJ D;  1XFL A;  3KM6 A;  1GSE A;  4ZB8 A;  1TK5 B;  3IBH A;  4FYB A;  2NDO A;  4IQ1 A;  1K0D A;  3IXR A;  5J4V A;  1XW5 A;  3M8N A;  3P90 A;  3UL3 A;  1GP1 A;  3EE2 A;  1JFU A;  2VUP A;  5IPH A;  4NMU A;  4K2X A;  1TXX A;  1ILO A;  4AJ7 A;  1EGO A;  1MEK A;  3IV4 A;  3F63 A;  1XXU A;  4GST A;  5ELA A;  5A5H B;  3ERG A;  2FWG A;  1QUW A;  3TRX A;  2B5Y A;  1YKA A;  2H72 A;  5BMU B;  4XTS A;  3E9J B;  1PGT A;  2XBQ A;  2K9F A;  2HZE A;  12GS A;  2V6O A;  1BG1 A;  1G7O A;  2HSM A;  3QPM A;  5JWR B;  4AKH A;  1SYR A;  3APO A;  4J56 E;  1YEX A;  4NHZ A;  4G9H A;  4BVX B;  2DJ2 A;  5CO3 A;  1PX6 A;  3I6A A;  3KMN A;  6GSV A;  1TRW A;  4RUV A;  4YKF A;  3RPP A;  2M80 A;  2V2G A;  2JAC A;  2DMM A;  5ECI B;  1FOV A;  1GSD A;  5D96 A;  2NTO A;  5INY A;  4XS1 A;  2PVO C;  3C7M A;  1GUH A;  1I9D A;  3DVW A;  4BWQ A;  1SJI A;  4BWS A;  3P7X A;  4TR1 A;  4JE1 A;  5COH A;  2YPM A;  3ZZX A;  3IOS A;  3D5J A;  2C3Q A;  1B48 A;  1UC7 A;  2HFD A;  4IEL A;  3DYR A;  4K5S A;  3LWA A;  4ML6 A;  5B8B A;  4G2E A;  4KW6 A;  4JR6 A;  2GDR A;  2GGT A;  2LST A;  4WF4 A;  3TUE A;  2MMZ A;  6GST A;  2IJY A;  2O8V B;  3QFA C;  2GSR A;  4NHW A;  4L5L A;  2LV3 A;  2C3N A;  2K18 A;  1JLV A;  3CYN A;  2EFH A;  1BG5 A;  1Z7P A;  5ELG A;  5HFK A;  3IK7 A;  1F37 A;  4K7N A;  4LL1 B;  2FHE A;  1A8L A;  1OKD A;  3FR9 A;  3GHA A;  4Z2T A;  4BA7 A;  1DE2 A;  4ZB7 A;  1SK0 A;  1TTZ A;  2E0Q A;  4CHS A;  4LMW A;  3LW9 A;  2HXK A;  3L78 A;  3MWH A;  5DDL A;  4ZIL A;  10GS A;  4DVC A;  4HQZ A;  4ID0 A;  3F4T A;  2OE3 A;  2JAD A;  4WR5 A;  2OA7 A;  4O5U A;  2EC4 A;  1OYJ A;  3O6T A;  2UZ8 A;  4EF0 A;  3CMI A;  4H86 A;  2OAC A;  3IDV A;  1OVN A;  1LBK A;  5DBQ A;  2YWM A;  5KN0 A;  5A1N B;  2HRA A;  3A5W A;  4Z7X A;  3GA4 A;  1G6W A;  5HR2 A;  3DWV A;  2E7P A;  4ZL9 A;  3EUR A;  3ZMK A;  1TOF A;  5J9C A;  3UBK A;  2H8L A;  1XVW A;  4EE0 A;  3C8E A;  1GUM A;  2CA8 A;  1WIK A;  1FVJ A;  2IMD A;  3CTG A;  4PX1 A;  4J2F A;  3G9B A;  2AV4 A;  5F8B A;  3ME8 A;  3TJK A;  4TOP A;  3LG6 A;  2HQT A;  2H66 A;  6GSX A;  4AJ6 A;  4KX4 A;  3EPT A;  4K0G A;  2M46 A;  1K0B A;  2H1G A;  5FT3 A;  4POM A;  5J4Y A;  3F6D A;  1TU8 A;  4KA0 A;  4RI7 A;  2H71 A;  2O7K A;  4EDY A;  2N5A A;  4NPB A;  3KH9 A;  1ERV A;  1NSW A;  1OC9 A;  3FZ4 A;  1GLQ A;  2LJA A;  1JZO A;  1V9W A;  4ICY A;  1Z7R A;  1AUC A;  4NWY A;  4HOJ A;  2PGT A;  3GUR A;  4O5Q A;  1TRS A;  2LRT A;  2L57 A;  3VWW A;  1M99 A;  3W6G A;  3DML A;  2AB6 A;  3UVH A;  4WBR D;  1GNE A;  2JL4 A;  3ERW A;  3VFI A;  4MF7 A;  1WRY A;  2C1Y A;  1A0R P;  3FYG A;  3KGK A;  3E0U A;  3HD5 A;  2QA2 A;  2FWF A;  1SYX A;  2BJX A;  5KN3 A;  4AI6 A;  5DJM A;  4QL9 A;  1ERW A;  4V2N A;  2HZF A;  5A4W A;  1G6Y A;  4EO3 A;  4XIH A;  5F0G A;  4WEY A;  3U5R E;  3ERF A;  4ACS A;  3A2W A;  5ECP B;  1Z5Y E;  2LJK A;  2VO4 A;  1A23 A;  4TN8 A;  1EP8 A;  3I69 A;  1XW6 A;  4AKG A;  5ECR B;  4OMV A;  3PIN A;  4DSQ A;  2PWJ A;  3FK8 A;  4TXO B;  4V1A g;  2TRX A;  4FIW A;  4CW9 A;  1B9Y C;  1SU9 A;  4Q5Q A;  4W66 A;  5IQY A;  1N2A A;  1XBS A;  2LNS A;  4K7O A;  1AQW A;  2MMO A;  4FQU A;  4GTU A;  1WJK A;  1AIU A;  1O6J A;  2GVP A;  1TP9 A;  4N3Z A;  4DSS A;  4MAB A;  1SL2 B;  2UV8 G;  2DJK A;  1SD8 A;  1URM A;  2HNL A;  2LJR A;  4MZC A;  3QMX A;  3GIX A;  4OFM A;  2BMX A;  4CDO A;  1TJD A;  2Z9S A;  2GS3 A;  1I5G A;  4PUA A;  2HSH A;  2LUS A;  1K0O A;  3D4M A;  1R7H A;  3TJG A;  2CZ2 A;  4KND A;  2JU5 A;  1UVZ A;  5ECN B;  1V2A A;  1MTC A;  3EMP A;  1FB6 A;  1GRX A;  1PA3 A;  2X64 A;  1U88 A;  4MMM A;  4IP1 A;  1GTU A;  4KDU A;  1RK4 A;  1XVQ A;  4OCE A;  3WGD A;  3UBL A;  1B4Q A;  1DBY A;  3FEU A;  1IYI A;  1T1V A;  4TR4 A;  2HRK B;  2KLX A;  1J9B A;  1A0F A;  2L6D A;  1ON4 A;  3ZML A;  3M3M A;  1O73 A;  2C0F A;  2YV7 A;  2DC5 A;  2WDU A;  2GZP A;  5DJL A;  3UAP A;  2IME A;  3LYK A;  3RPN A;  2GT6 A;  4BVY B;  3EYT A;  2XBI A;  3KD0 A;  1K0N A;  2A4V A;  1A2L A;  2AYT A;  4I8B A;  4E8H A;  4K8M A;  4IJ3 A;  4X43 A;  5H5R A;  1J0F A;  4BPY A;  2HE3 A;  5A4U A;  1W4V A;  1K3O A;  4USS A;  5A4V A;  2F3M A;  4GLT A;  2H6Y A;  3UEM A;  1YEP A;  1G0T A;  4O92 A;  3CRU A;  5D73 A;  3BCI A;  1FO5 A;  5F07 A;  2LTK A;  4KDX A;  1SKW B;  5KN1 A;  1XWK A;  2C80 A;  1M2D A;  2OBI A;  2R5G A;  4KB3 A;  1XOA A;  3ZLP A;  1K0M A;  2I3Y A;  5DAK A;  1K3Y A;  2N5F A;  4TXV A;  3ZFL A;  2L6C A;  2RII A;  4MZB A;  4D73 A;  4KDY A;  3VI5 A;  1QXH A;  3M1G A;  2JZS A;  1ZYE A;  1ABA A;  3LSZ A;  4POL A;  5J9B A;  3RDW A;  2WCI A;  2L5O A;  2H6Z A;  2E2G A;  3GMF A;  5IMC A;  4WBJ A;  4QMK A;  3O3T A;  1VF1 A;  2VLT A;  3BD2 A;  4HEA 2;  5DCG A;  3TDG A;  4GF0 A;  2YCD A;  2LEG A;  1H75 A;  4HS1 A;  1BQ7 A;  3ME7 A;  22GS A;  2GZZ A;  5EPF A;  3GTU B;  3MAK A;  2B7K A;  2HYX A;  2VCQ A;  2CQ9 A;  1XIY A;  5EL8 A;  2IFQ A;  1ZYN A;  3QAG A;  2YJH A;  2B5E A;  1FB0 A;  2FLS A;  2PUK C;  1OAZ A;  2X8H A;  2JSY A;  4GQF A;  1VF2 A;  1SKS B;  5CRD A;  5KOW A;  5G2Z A;  1FOH A;  2GQL A;  3TJF A;  2QGV A;  3ZL5 A;  1TK0 B;  4N11 A;  5ECS A;  3I9V 2;  3OR5 A;  1A24 A;  3WGE A;  2R6K A;  1OC8 A;  5IOW A;  4L8E A;  1AXD A;  1GNW A;  3TKS E;  3GYK A;  1R26 A;  3ISO A;  4HDE A;  4YQM A;  4YQV A;  2X4A A;  4EL1 A;  3QAV A;  5JWQ B;  6GSU A;  2C0G A;  14GS A;  1EEJ A;  2PU9 C;  1PD2 1;  5ECM B;  4HQS A;  2JZT A;  2R3X A;  1WPI A;  3A3T A;  3A2V A;  5J47 A;  1X9W B;  4XHM A;  3I43 A;  4MJE A;  3DKS A;  1BJX A;  3M9J A;  2EFE A;  4KAE A;  5GSS A;  4K0N A;  3HMJ G;  1GTA A;  3L0H A;  20GS A;  1TRV A;  4GSN A;  2QKE A;  1SK2 A;  2VL9 A;  4HI7 A;  3EMX A;  1E6B A;  1XWB A;  2JSZ A;  2L5L A;  2HSN A;  2HT9 A;  2LRC A;  3LYP A;  5D9X A;  2C0E A;  1GWC A;  5AGY A;  4N30 A;  2CVB A;  4K7I A;  1F3A A;  2YV9 A;  3G7I A;  2TRC P;  4YH2 A;  1ZCP A;  1PMT A;  1ZGN A;  4Z2U A;  2RUE A;  3HJM A;  4IP6 A;  3F4S A;  4TRX A;  1W89 A;  4O32 A;  4MJB A;  3IK9 A;  4POK A;  1AAZ A;  5BRT A;  4JBB A;  5ID2 B;  1BYE A;  1X0R A;  4OD7 A;  1GSY A;  2VLU A;  2RM6 A;  3GX8 A;  5J3R A;  2OT3 A;  3MDK A;  3HA9 A;  2CV4 A;  4OCF A;  3DVX A;  2GSS A;  3MYD A;  2B1K A;  3P8W A;  2GTU A;  4F0B A;  4EIP A;  2DJ0 A;  2O87 A;  3BOA A;  4F9Z A;  3D21 A;  1JZD A;  5H5S A;  2F9S A;  2QA1 A;  2R2J A;  3GKN A;  4ILF A;  5C04 A;  3GV1 A;  1Q98 A;  4GXZ A;  4K9Z A;  3ZYW A;  2R37 A;  3NOF A;  1EZK A;  1A2M A;  3ZIV A;  1X5E A;  5LD0 A;  3J7Y b;  3IC4 A;  3TGZ A;  1SKR B;  1A2J A;  5HQP A;  4IKH A;  4JR4 A;  3IA1 A;  1JZW A;  1THX A;  1MDJ A;  2V6K A;  3H1N A;  3F0I A;  3R3E A;  1GLP A;  4YAP A;  2VD1 A;  4ZIJ A;  3BBY A;  5B7C A;  5IMZ A;  3HZ4 A;  2G2Q A;  5DVB A;  2I1U A;  1CQH A;  2DJ1 A;  1RW1 A;  1GTI A;  1BX9 A;  4OO5 A;  3UVT A;  2LS5 A;  1AQV A;  2AJQ B;  4JZQ A;  4IVF A;  4FH8 A;  2GQK A;  2IIY A;  1XPV A;  3H79 A;  6GSY A;  4ECJ A;  3EU3 A;  3MNG A;  1X5D A;  5D9W A;  1NW2 A;  1T7P B;  5CYY A;  4PQI A;  2I9H A;  3TJJ A;  1AW9 A;  5E59 A;  3A2X A;  4IGJ A;  4N10 A;  2H0G A;  3Q6O A;  1T8E B;  1N25 A;  5DAL B;  4L0U A;  3WT1 A;  4PNG A;  3FZ9 A;  1N8J A;  3K8N A;  4GWR A;  5FWG A;  4HJM A;  5L71 A;  2IMK A;  2WB9 A;  1H4O A;  3MIX A;  3TJB A;  1XWA A;  3TRP A;  1TI1 A;  1HNB A;  4TR3 A;  4A5P A;  2FA8 A;  4MZW A;  1PQN A;  2YP6 A;  1R5A A;  4XS4 A;  4NAX A;  1AQX A;  3PR8 A;  2O5V A;  1YY7 A;  3TU3 B;  5HR0 A;  1MDK A;  3IHG A;  4LLR A;  4Q5F A;  2KP2 A;  3ZIT A;  3WYW A;  1DE1 A;  3U6V A;  2CVD A;  1PL2 A;  4MNN A;  4WF5 A;  2HZE B;  2GSQ A;  1PN0 A;  4FO5 A;  4RQR A;  1LU4 A;  2HSM B;  2YJ7 A;  2L4C A;  2IMF A;  3TKP A;  2H75 A;  2I81 A;  2KOK A;  1G7E A;  1PSQ A;  3LOR A;  4F2I A;  5ECL B;  2ALB A;  4P3Y B;  1KNG A;  2IPA A;  5LCZ A;  3ZVJ A;  4EUY A;  4V1A p;  4GDF A;  1GSQ A;  2F8F A;  2ZCT A;  3C73 A;  2DIZ A;  1DSB A;  1EV4 A;  2ZNM A;  1OE7 A;  3P2A A;  3ED3 A;  1FHE A;  4TR1 B;  5A34 A;  5AN1 A;  3GL3 A;  5IM9 A;  2HRF A;  4MK3 A;  3BCK A;  2RLI A;  4G0L A;  1ML6 A;  1X5C A;  3G7J A;  2AHE A;  2LQQ A;  3WD6 A;  3VWV A;  1U6T A;  1ACV A;  8GSS A;  3LQ7 A;  2H0H A;  2EFD A;  2P5R A;  2DLX A;  2B3S A;  1WP0 A;  1Z9H A;  4IHU A;  5G31 A;  1BAY A;  2OAD A;  3O76 A;  1PKW A;  3KJY A;  3DRN A;  5JCW A;  1SJ6 A;  1Q4J A;  4HU7 A;  1TDI A;  4POB A;  4KCE A;  2QSI A;  2R0G A;  2C0D A;  1C72 A;  3D6I A;  2A2S A;  2WUL A;  1OE8 A;  1VF3 A;  4EC0 A;  2YAN A;  3LXZ A;  2H1L A;  1HQO A;  5H5Q A;  3TKQ A;  3D4T A;  4GSS A;  2J9H A;  1XWC A;  2LQO A;  5IMA A;  1X9M B;  3TKS A;  3FKF A;  3FHK A;  4KCA A;  1TK8 B;  2GT5 A;  1ZYP A;  1TW9 A;  1HNA A;  1PN9 A;  3UAR A;  3QFB C;  1T4Y A;  3QD9 A;  1GSF A;  1SJZ A;  6GSS A;  2DJJ A;  2FA4 A;  4XRA A;  2R0C A;  2CAI A;  1O85 A;  5A5H A;  2H30 A;  2I4A A;  2H0I A;  3US3 A;  4ZXG A;  1XOB A;  5BMU A;  1YZX A;  2KHP A;  3HHV A;  3M0F A;  1V57 A;  17GS A;  2VL2 C;  2YNX A;  1KTE A;  3GFK A;  3FZ5 A;  1WWJ A;  3GKK A;  5CRG A;  4IN0 A;  4BVX A;  2FY6 A;  3PPU A;  4YKG A;  4L0W A;  2CT6 A;  2MBT A;  1IYH A;  2ON5 A;  3TCO A;  5B6M A;  3LFL A;  2X8C A;  1F6M C;  4TKY A;  2AUV A;  2FGX A;  4ZBD A;  3HJO A;  3M9K A;  4X0X A;  3VWX A;  1XW9 A;  3E3E A;  4GQC A;  5CRH A;  1M9A A;  2K8V A;  5HR1 A;  4XRD A;  2FCH A;  1A8Y A;  1ZZY A;  2N5B A;  7GSS A;  1ERU A;  1OC9 B;  2KP1 A;  5G5E A;  2V41 A;  2VM2 A;  5AIS A;  1M2A A;  3HKR A;  1GUL A;  2FNO A;  5ABR A;  4NV2 A;  3QOU A;  2WS2 A;  2LKU A;  5JCU A;  4AF2 A;  2E2M A;  4WR4 A;  3AY8 A;  1ST9 A;  1SVM A;  4QQ7 A;  3KEB A;  1GSS A;  3VPQ A;  3H93 A;  2YWN A;  1R5P A;  3L9U A;  2R0P A;  4HZ4 A;  4ZBA A;  4MH3 A;  2RM5 A;  1NHO A;  2WGR A;  5IO0 A;  5D9T A;  3BJ5 A;  4E8E A;  5J40 A;  2OJL A;  1FG4 A;  4LA1 A;  3KCM A;  3GH6 A;  3HY2 A;  2VCV A;  2DSA A;  3CSH A;  3TKS C;  1MD3 A;  2O85 A;  4KSM A;  4DEJ A;  5HFG A;  5GST A;  13GS A;  3H4K A;  1VF4 A;  1PKZ A;  2DBC A;  2FUG 2;  1BED A;  2A2R A;  3F4R A;  1WOU A;  4MJA A;  3ZIJ A;  5IMD A;  4MF6 A;  1KEB A;  2XPE A;  18GS A;  1PX7 A;  2ZUP A;  5A1N A;  4JRR A;  4J57 E;  5KOX A;  2VIM A;  3VK9 A;  4ML1 A;  3FR6 A;  4ECB A;  3MSZ A;  3GST A;  1T3B A;  2GQM A;  1LJR A;  1B4P A;  2R4V A;  1T00 A;  1EGR A;  2VOC A;  3HXS A;  3SBC A;  3EC3 A;  9GSS A;  1M9B A;  2TIR A;  3APQ A;  4KH7 A;  4DSS B;  2A4H A;  4OFT A;  4K6X A;  2L59 A;  2NBS A;  3RHB A;  4OO4 A;  5IIZ A;  5CRE A;  1OKT A;  1EP7 A;  1MD4 A;  2H1A A;  2C8U A;  1QGV A;  3IE3 A;  5J4U A;  4G0K A;  2VM1 A;  4ZL7 A;  3D0Z A;  3F3R A;  5IPG A;  4EDZ A;  4N0Z A;  2HI7 A;  1GSU A;  3TKR A;  3D22 A;  1JLW A;  2HSY A;  4NV5 A;  1FW1 A;  5J5N A;  4ZBB A;  3DIE A;  2EIR A;  1ZYQ B;  5IOX A;  2VLV A;  1SVL A;  3C71 A;  3VUR A;  3UIW A;  3QDN A;  4E68 A;  5ECK B;  5D8I A;  2B5X A;  4HZ2 A;  1SL0 B;  2WZ9 A;  2O89 A;  3CBU A;  3TRQ A;  1S3D A;  1JZR A;  4K1F A;  3N9J A;  2YZU A;  2ON7 A;  4Z2R A;  2H1B A;  4IS0 A;  1USB A;  4KGI A;  5IMF A;  3KIJ A;  2QC7 A;  4ECC A;  1K3L A;  2KUC A;  3HYP A;  4I2U A;  2H19 A;  1F2E A;  4EIQ A;  3DEX A;  1FAA A;  2HLS A;  4KUN A;  2YWI A;  3CWG A;  3FY7 A;  5F06 A;  5ENU A;  1Z6N A;  1T4Z A;  2WJU A;  2PBJ A;  4ZL8 A;  3ZRD A;  4GCI A;  1NHY A;  1F3B A;  3IAS 2;  3J7Y k;  2L4Q A;  2MMN A;  1X9S B;  1XWG A;  1XZO A;  2PN8 A;  5G5F A;  2REM A;  4TXO A;  3A5I A;  19GS A;  2MYG A;  2VCW A;  3GX0 A;  4X4J A;  5LNK e;  5DAK B;  4G0I A;  3GRX A;  3GNJ A;  4EXJ A;  5KEJ A;  2NVL A;  3FZA A;  1OC3 A;  1PRX A;  3Q19 A;  3F8U A;  1U3I A;  4D73 B;  2EFC A;  3CXG A;  2VD0 A;  3KXO A;  2HRN A;  4MP4 A;  3WT2 A;  2CAQ A;  2DJ3 A;  2LNT A;  4MPG A;  3CTF A;  3RBT A;  4F82 A;  2V32 A;  3H8Q A;  4AJ8 A;  4AKI A;  2YWO A;  4JED A;  2B1L A;  3TOT A;  2P5Q A;  4HUA A;  1Z3E A;  4G01 A;  1ZOF A;  4YAV A;  4ISD A;  1ZMA A;  5C00 A;  1DUG A;  1SEN A;  1GUK A;  5EVO A;  3IC8 A;  3ZFB A;  2IFQ B;  4BL7 A;  4EVM A;  2EIO A;  4PQ1 A;  3C1S A;  1YDK A;  4KE3 A;  5B8A A;  3IAM 2;  5G1K A;  2BTO T;  1K0A A;  5CRW A;  3UMA A;  2D2Z A;  1YVL A;  2X49 A;  2VL3 A;  4HU9 A;  4CY8 A;  2OKA A;  5ECO B;  3KTB A;  1MDI A;  4MJC A;  4G19 A;  3IR4 A;  1UA5 A;  2HRK A;  5EY6 A;  1Y25 A;  1M7T A;  3KTL A;  2H70 A;  3HCZ A;  3EWL A;  3CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...