4O7LA

Saicar synthetase (type-2) in complex with adp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
232
structure length
232
Chain Sequence
b'VYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 75
structure length 232
sequence length 232
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7lA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7lA02
5FEDA 1E4EA 3NWWA 4NK9A 4RVLA 2BILB 3F6XA 1GZ8A 4CRSA 3ZUUA 3Q6UA 1VYZA 5KUPA 2Q0NA 3UZRA 2YWPA 3OC1A 4OTDA 1EZ1A 3GU4A 5CA0F 2A27A 2BPMA 5ETIA 3VBYA 2X8IA 5GONF 2GPHA 2W6QA 5M51A 1C30A 3LLTA 4OTHA 4XRLA 2VO3A 5JH7F 1VKZA 4YO4A 2XNBA 3V8SA 3WZDA 2PE2A 3BZ3A 5CU2A 3ANRA 3PY3A 2GTMA 1AGWA 4U5JA 4MD8E 4FZ7A 2BVAA 2QI8A 2WQBA 3RUPA 2QOKA 3DTCA 4K18A 4L52A 3TDVA 2I87A 4XZ3B 3AOXA 4H58A 1M0TA 1IRKA 4B6LA 3JRXA 2WMVA 3R71A 1GGOA 4IC8A 2GNIA 2C0IA 2A4LA 4I6FA 4RZVA 2XYNA 5DNRA 5EDRA 4G3CA 3CIKA 3MH2A 3TINA 3NZ0A 2XIZA 5C26A 3UC4A 2Y4PA 2ZMDA 4C0TA 1Y57A 4FTTA 4RGJA 3L8XA 4MK0A 5EI8A 5AMNA 3PUPA 3K3IA 4D58A 5CEMA 4O7NA 3K5HA 2C0OA 3BU6A 3FPMA 4XMOA 2R86A 4RC4A 4DTKA 4E4MA 3FBVA 4YPDA 4HNTA 3PE2A 2HGSA 2J50A 5DIAA 1URCA 3QQJA 5C8MA 5FTOA 4O6LA 4P90A 4A9TA 2WMXA 3NW7A 4DEAA 5AA9A 4FYOA 3RHXA 3Q2MA 2CNQA 4RSSA 3WO0A 1NA7A 4X2JA 5HLNA 4XYFA 4GYGA 3KA0A 4LMNA 2F49A 5M07A 3SD0A 4CZTA 3C51A 3NNWA 3BPRA 3QKLA 5AP1A 2R3IA 2XCLA 3LE6A 3FZPA 3CJFA 3GGFA 5E1SA 3JRWA 4EHZA 2WD1A 3TV4A 3W2PA 2JGZA 4GUBA 5EM8A 1FMOE 3FY2A 4BKJA 4UN0C 4TYHB 3OTUA 2GHMA 1ZYSA 1VR2A 4IJ9A 2XBJA 4CCUA 4O84A 3G0FA 3R6XA 3R5XA 4NKSA 4I93A 2HK5A 4DH3A 2BALA 2XRWA 3BYOA 4L44A 4DFBA 4EWHA 5B7VA 3D94A 2P0CA 1UWHA 5CXHA 4BDCA 4UYNA 2CLQA 4L68A 4GU9A 4WNMA 2CZGA 3UPXA 5HG7A 5M08A 2XJ0A 3MIAA 3F66A 2BRHA 2BFYA 3F82A 3ZTXA 5BMVF 4IAIA 2CPKE 4K77A 3WOWA 1RJBA 3OBGA 3O17A 4V04A 3RK7A 3W18A 2NRUA 4CG9A 4PY1A 5BVFA 2C68A 3SOCA 4IFCA 2YJSA 1WBPA 2CGXA 4ZZOA 5CVGA 4F64A 3NRMA 4DBNA 4I6BA 4CFVA 3A62A 4FBXA 3E8DA 3BE2A 1BL7A 4KD1A 3EQIA 2YIRA 5M44A 2BHHA 3ODYX 4LL0A 5FBNC 4AAAA 4EH3A 3LMHA 4O4HF 3FPQA 3CXWA 5CYIA 2JDTA 2WQOA 2I8CA 3R02A 3WF8A 4EOIA 2JBOA 3TUBA 4IX6A 4BDDA 4H39A 4A06A 4IHJF 3KRRA 1IASA 4DIMA 1MRYA 1I7NA 3RM6A 5AUWA 4LL5A 4TYGA 4GVAA 4RVTA 2OBJA 2XRUA 4P4CA 1P5EA 2YHVA 3POOA 4ZLYA 3CEKA 5HU9A 4D1ZA 3CQWA 2IZSA 3EN5A 2X8EA 3R73A 4FV6A 4GVJA 4JS8A 4TUYF 5CSHA 2PMLX 4FT9A 3O8TA 4N57A 4GH2A 3LQ8A 4X3JA 3UO6A 4MXZA 3BHHA 4ZS4A 2XS0A 3C7QA 1WBTA 1Q24A 3SW4A 2W96B 4L7FA 3NYOA 4KABA 2J0JA 2WQMA 4I4FA 1PXJA 2PMOX 3MJFA 1LEWA 3HA8A 4FTUA 4BICA 3HRCA 2R7KA 4J99A 3R9DA 5HVJA 3DZQA 4JBQA 5KE0A 4GJ2A 3V5LA 2R82A 3LQ3A 3KXMA 4K33A 1VZOA 1XH9A 3PRIA 4HCVA 3GLKA 4I50F 4Z9LA 3BGPA 3HL7A 1SYKA 2PU8A 4OGRA 1OL2A 3BQCA 2F57A 4XP0A 4I24A 3I0OA 1Q3WA 4EBVA 2QO9A 2WIPA 4CXAA 4EKLA 5DRDA 2VU3A 3ZEPA 4WRGA 1JKLA 1XQZA 3JY0A 4QMQA 2F2UA 5KNJA 4MV3A 5FLFA 2GS7A 5JEBA 3EQCA 5BPHA 2HZ0A 4KRCA 4WKQA 5IQHA 3AD4A 3WZKA 3G6GA 4WUNA 2ITQA 3PXZA 5AJQA 3MESA 1XH6A 1QPJA 5IZFA 4FIEA 4L7SA 3E7OA 2GQSA 4XOZA 3VUHA 3WYYA 4YC3A 3F3UA 1PXNA 5BX0A 3V01A 2XA4A 3VUGA 5FDPA 2YZAA 5JRQA 3OCSA 3FAAA 5FD2A 2V59A 2R4BA 5J2UF 2ITYA 3NCZA 5BVEA 3ROCA 5D7VA 5H8BA 4CT2A 4F09A 5L8LA 4C4HA 4FE2A 3Q2OA 4M9UA 4XYLB 4RVKA 3TKIA 2VWUA 3UMWA 1P4FA 4L3PA 5JFVA 2UZVA 5J9LA 3ZU7A 1WZYA 4C3RA 3JR1A 4JG8A 1O9UA 1SVEA 3KCFA 3ZLWA 3P7CA 1PXKA 2OZOA 3MDYA 4ZXTA 5DHJA 1GIIA 1H26A 2XKFA 2XEYA 4AA4A 3BYSA 4ZEGA 4O0XA 4EZ7A 5JGDA 4KSPA 3ZSHA 4GT5A 5IUIA 3UP7A 5TKDA 3D9VA 2OXYA 1X8BA 4RLKA 3ULZA 3WARA 4ZOLF 4F4PA 1KOAA 5JZJA 5HG5A 3Q32A 4V0GA 5JGAA 3AW8A 3CKWA 3F3TA 5HTBA 3E8CA 4I5HA 2W5AA 3HDNA 3KRWA 4RZWA 4YZMA 5H3QA 3PIXA 4FL2A 4RBLA 1GJOA 1UVRA 3DBQA 1NVRA 3E88A 4CSVA 3LWBA 5CY3A 4MF1A 2R87A 1YHVA 2HWOA 4N4SA 5KBRA 1WVXA 3DAJA 3PJ8A 4ZJIA 2ZJWA 3H10A 1F0QA 3QXPA 3W55A 2J9MA 3WILA 1Q8YA 4MAOA 3MB7A 3E3PA 5CQUA 2P2HA 4LUDA 3ORTA 4CCBA 2R85A 3QFFA 5I9XA 1NVSA 3DKFA 3CGFA 4FKGA 4LV8A 2ITZA 5AUYA 2BMCA 4JQ7A 2W4KA 1ZLTA 5CT0A 3DT1A 3CP9A 5ACBC 5J95A 2J0MB 3P9JA 3LXLA 4C35A 4D4RA 3QRJA 5EOBA 3EKNA 4B99A 4IB3A 5HGIA 2W5HA 3B2TA 3KAJA 3OF0A 2O2UA 4RJ4A 4Y73A 2P55A 2WOUA 4FTRA 4PDSA 3R7EA 4C02A 3HLLA 3MYGA 2OF4A 5L6OA 1I7LA 1ND4A 4FYNA 4MXOA 3Q6WA 5EDPA 4R7BA 3ORLA 4PDPA 3UVQA 3KULA 4D1XA 4YUQA 5M56A 1IOWA 5BMSA 1VBGA 4S33A 3TG1A 3ORKA 4F0IA 3H0ZA 5IDPA 2YERA 2JIIA 3EFKA 1YI4A 4L8MA 3QX4A 2OG8A 2I7QA 4II5A 1DAWA 3MWDA 3G90X 2PBZA 2CGVA 5TOZA 5CEQA 3I5NA 5IEYA 4IX3A 2QR8A 3FLWA 3HV6A 1XBBA 2C5OA 5IQGA 4FTLA 3SVVA 4AP7A 4G6NA 3QHRA 4ZAUA 5KX8A 2C6DA 2FPPB 2PE1A 1UWJA 2UVZA 5E8YA 4EOPA 2YWVA 4CVAA 2JDSA 4CFNA 4EGQA 3JZIA 4CKJA 1BLXA 3QZHA 3FZRA 4RJ3A 1KBLA 4PMSA 5ANKA 5KHWA 4GMYA 3MIYA 4P2KA 4PDYA 4XG6A 4ACGA 2HYYA 1AD5A 1AQ1A 1GAGA 1V0OA 2ITXA 2R3KA 2XKCA 3QKKA 4J98A 4FSUA 3FMDA 2JDRA 2YA9A 4ZIMA 3UOLA 3RINA 5LVPA 3FMJA 4AN9A 5DE2A 3W32A 5CA1F 1GZNA 4JX7A 4MAMA 3PG3A 3ZLXA 2E9PA 5IMEA 1B6RA 2OICA 3OWKA 3MVHA 2UW5A 4L67A 3UVRA 3R7UA 4AW0A 3ZO1A 5HV6A 1WAKA 4ERKA 2DWBA 3PVBA 3OZ6A 3VJOA 5LQFA 4ANLA 5IF1A 5AV1A 2WTDA 5ETAA 3OUNB 1T46A 2GNFA 4YZ9A 1Q8ZA 2R64A 2WEVA 3CLYA 2Z04A 3ODZX 4FSMA 5JN2A 2QU5A 3FMHA 5FTQA 5G6VA 1YRPA 3WF5A 3WZEA 4D9UA 4PMPA 1YWVA 4H05A 2IP4A 3GOKA 3OUUA 4QNYA 4ALUA 5KKNB 3DNDA 1OL1A 3Q4CA 4C5CA 4FKIA 2R7MA 1H1RA 2R3GA 1XH5A 2JKOA 3D5XA 2LAVA 4G31A 4AT3A 3KF7A 4EOSA 3R9NA 3QHWA 5EYDA 4CG8A 2HENA 4RMZA 2BROA 3WE8A 4FIGA 2YABA 3FHIA 2C1AA 4O7LA 2ETRA 2F7XE 2ITVA 2RKUA 5HCXA 4OTFA 3QQGA 1RE8A 4MQ1A 3LFSA 2PN1A 2Z7RA 2IW6A 4FKUA 4FFRA 3CTJA 2XIRA 4JG6A 4PWNA 1SNXA 3VBXA 5A4EA 3UYTA 3ZO3A 4EQCA 1Q8UA 3GFEA 2B9HA 5FQDC 4DGNA 2VQDA 3RK5A 3FV8A 3TNIA 4BDKA 2UW4A 4MHAA 5BUJA 4TW9A 1A06A 3FEGA 3O7LB 3HAVA 4G2FA 2GDOA 4QYGA 2W1DA 4AT5A 3CS9A 4EQMA 3IW5A 3CSVA 2PY3A 1CM8A 2VN9A 2RFDA 3DXPA 4L42A 3IOKA 3POZA 4Z7GA 4ZTQA 3OT8A 1OBGA 4FZFB 2CNUA 4GL9A 2VTOA 4O7VA 2Y0AA 4NFMA 4X2KA 4RJ5A 2DIKA 4E6DA 4FICA 4ZOGA 4KBAA 4S31A 4PTEA 4XV1A 2J90A 5DPVA 4NTTA 4PMTA 4OTGA 5HBEA 2GQGA 2J2IB 2YCQA 2XM9A 4RWLA 4DEDA 3KK8A 1NY3A 1VJYA 3FLNC 4AN3A 4OBOA 1W84A 2CGWA 4X2NA 1T45A 5CSVA 3ZZEA 2KULA 2UW3A 2WTKC 3U8WA 2O64A 5JSMA 1PMEA 1J91A 3AGLA 3QTWA 3HV4A 4K9YA 4TYIA 4ZSEA 4R5YA 4MV6A 4EGJA 2ZOQA 2E9UA 3H9FA 1PF8A 4FTIA 4GCJA 3MPTA 3AG9A 4E8AA 4RIWA 4J96A 4O0SA 3R28A 4QMVA 3DK3A 3OXTA 3U6JA 5JQ8A 4DGMA 5KBQA 4KAOA 4IC7A 4PF4A 3NIZA 3E7VA 4FMQA 2R0UA 2UZBA 2QOQA 4IACA 1P14A 3EQFA 1J7UA 3KU2A 3ZC6A 3KXNA 3FYKX 4YO6A 3QALE 5CEKA 3WBLA 1GY3A 3A8XA 4IE9A 3UYSA 2YDIA 4O81A 4NJDA 4QOXA 5CLPA 4HOKA 4BF2A 4FGRA 1CQJB 5CSPA 3K5VA 4EH4A 4R77A 3UODA 1P2AA 3OVVA 3VS7A 3NEWA 3AGMA 4JG7A 3AC2A 1E9HA 3NUYA 3PXYA 1KOBA 4GUEA 3W16A 4I4TF 4YZNA 4XLVA 3R8VA 2V22A 3MFUA 3PFQA 4EWQA 4U9AA 1Z2PX 4DFNA 2UW7A 5HBHA 3R7YA 4DTAA 4USEA 4IMYA 1TKIA 5IISA 2VTMA 2W1IA 4F1MA 3DK7A 4MV9A 4TNBA 4XEYA 4FVRA 3TDWA 5ANEA 2B52A 5HD4A 2G2HA 2XK9A 3LOKA 1OECA 5GHVA 1CKIA 4DEBA 4ENXA 3DY7A 3UDBA 1KUTA 4FKPA 4M67A 4O96A 4PX6A 5LVMA 4HVHA 3G8DA 4O7TA 2VTSA 4FV1A 2AC5A 5HG9A 3DFAA 4QP4A 2XK8A 3CJGA 5IA5A 4I6QA 3MTLA 3UQGA 3ORRA 3QLGA 5CAPA 1YHSA 4IWOA 1OPLA 3SXSA 1KJ9A 4YAJB 5HEZA 3PDTA 5D41A 4ZTMA 3U9NA 2C6LA 5CF8A 4K11A 1ZYJA 2C4GA 3I7BA 5CEOA 3BG5A 2J7TA 3VF8A 2RFEA 4NKAA 5J2TF 2PE0A 3CQEA 2GNJA 2WFYA 4FVQA 4G9CA 3PY0A 3JUHA 3M1SA 4B8LA 1PHKA 4NZWB 2J0LA 4ANQA 3N4UA 4FODA 4YR8A 3LXNA 2R2PA 5C8NA 4IEBA 3C0GA 4LMUA 3MWUA 1JKJB 3LFQA 3MPAA 4FZ6A 3V04A 2OH4A 4TTHB 2VWXA 1TQPA 2QOCA 2YFXA 4QYHA 2Y8OA 4DITA 2VD5A 4HVSA 4ZMEA 4BCIA 4I3ZA 5JFSA 4MNEA 3TI1A 4D5HA 2X6DA 2J4ZA 3KF4A 3NUNA 5DOSA 4LGGA 4IZAA 4FT7A 1YDTE 3UOHA 1WBOA 1OPJA 1XJDA 3I0QA 1QPDA 4IJPA 4B8MA 5ETCA 4F7JA 5IYZF 4K0YA 2B0QA 4QRCA 2VWIA 2BUJA 3V8WA 1CSNA 5KMLA 1H4LA 4R1YA 3RI1A 3TNWA 1KJIA 2VWYA 3B8RA 5CS6A 4IX4A 4XOYA 4Y5QA 1M52A 2PVYA 2BZHB 2OJJA 4Y46A 2B9IA 5AA8A 3LM0A 3ATTA 3HO8A 1W8CA 3PA3A 4BCKA 5CNNA 1JAMA 4LV5A 3Q5IA 2OO8X 3L8SA 4EORA 5L2SA 2HXQA 4FR4A 3FI4A 2QO7A 2X6EA 3OCBA 5AUVA 5FRIA 3VBTA 3RV4A 3A7HA 3U54A 1K9AA 5LOVF 5A3XA 4U79A 2NP8A 1BNCA 3OP5A 2PL0A 1ZWSA 3EQDA 3JVRA 4YNEA 1Z5MA 1SNUA 2DQ7X 4NM7A 4AXAA 3PXKA 1RDQE 2EB2A 4MWHA 5K3YA 5F9EA 4UX9A 1PXPA 2OJGA 3KC3A 4NJ3A 5IPJA 3NUXA 2XZSA 4IWDA 2OJFE 1IA8A 1Q8TA 4YMJA 2I40A 4FIJA 2BRGA 1QCFA 4W4WA 4DINA 4QSHA 3UIUA 3BCEA 4QP3A 3NAYA 3PJ1A 4QPAA 4YJUA 5LA6F 1ZOGA 1PW2A 3DDQA 5HE0A 3C9WA 3H30A 3MA3A 3REPA 4MVFA 2WU6A 2P0AA 4EOJA 5C03A 3VS6A 4BIDA 4C2WA 3Q53A 4DG0E 4JAIA 5HVKA 5LWMA 5M55A 4DT9A 2BAKA 4QP6A 4UYAA 5HX6A 5I5ZA 3Q04A 1PRYA 1LEZA 3NAXA 5A4CA 3QX2A 1JDEA 2W1FA 1ZZLA 3EYGA 2PZIA 4IH8A 5DN3A 5J9YA 2CN5A 1OZ1A 4J8NA 4YZDA 5ACKA 4FKJA 1XH7A 2QOFA 3PTGA 3PWDA 1OMWA 4EL9A 2X1NA 1XBAA 4ZTNA 2WO6A 2RFNA 5B0XA 2DLNA 3CD3A 3QTXA 3PPKA 4Y5HA 2XJ1A 3A7GA 3PA5A 3G33A 3TV7A 4U0IA 2IVUA 2O65A 5AADA 3R9HA 2CLXA 3LVPA 2CKOA 1UA2A 3P78A 3AC4A 4YAKB 3QFVA 1Z57A 3E64A 3G9NA 4FSTA 3QU0A 4LG4A 4XH6A 3RPVA 2FSTX 3Q5ZA 3TL8A 3HBLA 3ZMMA 5ANJA 5F95A 5E8ZA 2CCIA 5E8XA 1OL5A 1YDSE 4QQJA 3VRZA 4YURA 5I0BA 1URWA 2JIUA 3ENMA 3F9NA 4UBAA 4BDBA 5ETFA 2DWCA 2UZLA 3H9OA 4JR3A 5F20A 3UOKA 5CXZA 4RJ7A 3TNHA 4RFZA 1XKKA 3IG7A 5TT7A 4ZY5A 4XRJA 4YB8B 3GC7A 3PJ2A 4GT4A 4X0MA 1NVQA 4J71A 3ZRLA 5FXRA 3HUCA 4GK2A 2WTJA 5EKNA 1W98A 3PSBA 3KAKA 2R3HA 1QL6A 1LPUA 4U97A 1YOMA 4QYEA 5DFPA 3C4FA 1GZOA 1OKVA 2Y7JA 5HE3A 4FV0A 4EK5A 1CTPE 5A9UA 3LHJA 3HZTA 3K3PA 4FEXA 3AC8A 3AT4A 4IM3A 4K6ZA 2XM8A 2Y9QA 3AC3A 4F6SA 2PVHA 2W1ZA 3CPBA 2NRYA 4FV3A 3ZO4A 3LAUA 3EFJA 4ANSA 1BKXA 2W71A 4QMYA 4YC6A 2EXMA 3DAEA 2W70A 3UQFA 3HX4A 5BYLA 1F3MC 1FGIA 1Q61A 2VAGA 5FP5A 1IA9A 2XYUA 5FEEA 3D14A 3PXRA 2JKQA 3FUPA 3QKMA 3PVWA 3VRYA 1Q62A 2IVVA 3NDMA 1UU9A 3GVUA 3PVUA 2XB7A 2BTSA 1SVGA 2YACA 3O51A 4ONAA 5KMKA 3L1SA 3R22A 3JVSA 2UVXA 1ATPE 2C5NA 4IVCA 4J8MA 3TKHA 2WZJA 4MXYA 3F61A 4GEOA 4JQ8A 1H25A 5BVNA 4L9IA 4YTCA 3MI9A 1PK8A 4XCUA 5CEPA 4KB8A 3DKGA 3Q52A 4TKSA 1APME 2QOHA 2XIKA 4BIEA 3UZTA 3N51A 3A8WA 4AT4A 2UVYA 2VTQA 3EB0A 4FT5A 5BNJA 3CPCA 4RFMA 3BU3A 3DS6A 4BDJA 1ERKA 4C5BA 3HP5A 2BRNA 2Y4IB 3DLZA 3AQVA 1WBSA 5M53A 3ACJA 4FFOA 2C0TA 1I09A 4NH1A 3C4EA 2QF7A 2I0EA 2VGPA 1BXRA 3SRVA 4B4LA 1ZZ2A 5CAVA 3UNJA 4E6CA 1Z9XA 2O3PA 3E3BX 4FKLA 4QQTA 4KKEA 4U41A 4F7LA 1E1VA 2DYLA 4IWQA 4AE9A 5CF6A 2RGPA 3Q96A 4NYEA 3R1QA 4XLIA 2IVSA 2ZDUA 1CS0A 4TYEA 4XP2A 4BZDA 5K4IA 3QGYA 3BEGA 2W0JA 4XNEA 2C00A 3SAYA 3HECA 2UZWE 3D7TB 4UXQA 5GJGA 3LFNA 3FXXA 3BGZA 3P0MA 3NGAA 3IW8A 2XMYA 3KVXA 4RIYB 3FQHA 1SCUB 2HCKA 5EM6A 2YM3A 4CMOA 2OJIA 3JYAA 4Z7HA 1Q3DA 1JBPE 3RWQA 5CEIA 4AUAA 5E92A 4FKTA 3H4JA 2JFLA 3LCTA 3NUPA 4FKSA 4MNFA 2W05A 3LP8A 4JDIA 2OGVA 2VTRA 4L00A 4X2GA 2PVLA 4CKRA 3VBWA 4IIRA 4ZSAA 3R1NA 4JX3A 4Q5HA 3AD6A 3P23A 4GK4A 1Y8GA 1LR4A 1B38A 2VO6A 2ZYBA 3R63A 2B9JA 1G8AA 3C5IA 4O0RA 5DGZA 3VAPA 3W2QA 4A9YA 4D2RA 3TNPC 3IECA 2H6DA 3U6HA 3GCQA 3ZYAA 1BUHA 3MVLA 4U6RA 3SGCA 4YZCA 4BGQA 2JLDA 3GQIA 4IAYA 1F5QA 4EJ7A 4U3YA 1M6VA 2VPQA 3W2RA 4EYMA 4IIJF 4G17A 3AC1A 5AV2A 1KV2A 4RG0A 2WXVA 3KQ7A 3QCQA 4FFLA 2C6TA 3QTIA 2PTKA 2A19B 4FZAB 4YPSA 2RG5A 2RG6A 2ONLA 3OTVA 3ZXZA 3QD3A 4MBJA 3LMIA 3I12A 3B2WA 3LJ2A 4U43A 4EHVA 2OXDA 4LOQA 3IO7A 4O6EA 3KVWA 2ZM1A 1RQQA 3ZSIA 3CE3A 4DF3A 1V1KA 3LJ1A 3UG1A 5L2WA 5IA4A 4GIIA 1CQIB 5AV4A 1OBDA 3OWLA 4K2RA 4I0SA 2JD5A 3MPMA 4WT6A 4DEGA 5C27A 2IZUA 1MUOA 4O0WA 4FTQA 4EJNA 4UEUA 2FH9A 5CANA 4FTMA 4FX3A 3R9OA 5IDNA 5AP7A 2OIQA 4YJQA 3ZDIA 5LXMA 2JAMA 4DFZE 3VPBA 3FMNA 1I44A 5IG1A 3RAWA 2A2AA 3FSFA 3DU8A 3P7BA 5FDXA 4CFWA 2R3FA 1M17A 2X39A 3T3UA 5E91A 3P1AA 2WYOA 3VOTA 3MGYA 4KKGA 1O6YA 3AMYA 3NUSA 4WD5A 4RIXB 1U54B 2W4JA 3ZO2A 4EC8A 5J5SA 4L1KA 4AG8A 2QODA 2ZV9A 2W1EA 4TWPA 4EOQA 2OXXA 3PY1A 1KE6A 1MP8A 2AUHA 3NR9A 3I1AA 3CC6A 2QONA 5ICPA 4MA0A 3BHYA 4TT7A 3ORNA 3HMOA 4XBRA 4KIOA 5AUUA 3V5TA 2YAKA 3QQKA 4AGDA 4FU0A 2JFMA 3OROA 4XP3A 4C58A 5HIDA 2PMNX 5JKGA 5C8KA 3LCOA 4EUTA 3QQHA 4K1BA 5C1OA 4YHJA 2XJ2A 2REIA 3K2LA 4DE4A 4ZLOA 5J87A 2XNGA 4L46A 3G8CA 2BTRA 3OW4A 5DVRA 4MCVA 5CASA 3PP0A 2PVFA 3NNXA 4DYMA 4M12A 3VBVA 3PSDA 4QYFA 3PZEA 4A9RA 2IWIA 3SA0A 4QMUA 2O0UA 2GFSA 3UVPA 1Z2OX 4RWIA 3L9PA 4FNZA 3E93A 4I22A 4IB5A 4QMTA 3FMEA 3DKOA 3MFSA 5FUTA 5HBRB 2BR1A 1H8FA 1JKTA 3DPKA 2GHGA 5AP0A 3NIEA 3WF7A 2VTNA 5HZNA 1U46A 4FIFA 1PMNA 2XNOA 3EN9A 2XEZA 4H3BA 2GPWA 3R8PA 3FQSA 1OVEA 4BYJA 4AX8A 2ZDGA 2YS6A 3SOAA 4FEWA 3O23A 3R1SA 3GBZA 3GOPA 3C50A 2V55A 4BR3A 1SM2A 4F9CA 4DFLA 3W8QA 4ZHQF 3ZS5A 2C69A 4W4XA 2OIBA 4AWIA 3BU5A 1WCCA 3PSCA 4C62A 1H0VA 4TYJA 1NW1A 1W93A 3QZFA 4Y95A 3RAHA 4KS7A 2YIXA 3IQ7A 4IB1A 4QP2A 4WRSA 4XG8A 3ROYA 3COIA 2HY0A 5D11A 4G5JA 4RQKA 2I0VA 2YM4A 4U44A 4N70A 4WSYA 3ALOA 1PMUA 2UZNA 2ZB0A 2OW3A 3PP1A 3HV3A 3T3VA 4NIFB 3N8DA 4BDHA 2X8DA 4JT3A 3KXZA 2R9SA 5EYKA 3GIDA 4OT6A 1JKKA 5CF4A 4YSMA 1KE7A 2F7ZE 2QO2A 3F5GA 4LRMA 2QK4A 3DTWA 3ZSGA 2BIKB 3VS3A 3COKA 3PPJA 2RF9A 4DLJA 2W17A 1PXLA 5IA2A 5IQAA 2X81A 4JJRA 4D1SA 4F6WA 4IAKA 4JLCA 3TW6A 2GS2A 4JIAA 5L3AA 1L8TA 4FKQA 1R0PA 5M09A 2UZEA 2ACXA 4EOMA 4WO5A 4FI1A 5HVYA 4E7WA 4BDIA 4O7SA 1M2QA 5CT7A 4LRKA 4KNBA 4PV0A 2JBPA 2XK3A 2YM5A 3C4CA 4M13A 4DCEA 3NX8A 1YHWA 2W1CA 4J7BA 2P2IA 1REJA 3HVCA 4HCTA 2A1AB 1R3CA 3FJQE 3QRIA 3FMLA 4XS2A 4DFYA 3HUBA 3PLSA 4V01A 3V8TA 5BPFA 5DYJA 4FG9A 4ACCA 3Q4UA 5CALA 2NU8B 2W6OA 5B2LA 3QL8A 3WF6A 1O6KA 4RC3A 4P7EA 3BELA 2JC6A 4TNDA 1OIUA 3W10A 3IDPA 2C5VA 2WTVA 3D4QA 1OB3A 4R5SA 1OIRA 4X21A 4ZY4A 3A7IA 4FOBA 4IAZA 5EG3A 4OTIA 1EHIA 1Y6AA 2GS6A 3A7JA 2GNHA 4N0SA 3WZUA 1Y8YA 1YWRA 4HYHA 3R8MA 4E5AX 4XYMB 5JK3A 3BWFA 3D5VA 3DF7A 3HA6A 2PZRA 4RIOA 3F5XA 3UO5A 3R83A 4AOIA 4DT8A 4CQEA 3DJ5A 3O8UA 4I4EA 5EW9A 1ZYDA 2HZ4A 2QC6A 1OM1A 3BGQA 3OW3A 4WNOA 5C9CA 3EHAA 1YXXA 1T36A 3UIBA 3VW6A 4QNAA 3RAIA 4ARKA 4HGTA 5KMMA 4O0YA 4A9SA 4UZDA 4X3FB 3SW7A 2GNLA 2OU7A 2OZAB 3IDCA 3RPSA 1M0WA 3ATSA 3FXZA 2GU8A 4MD7E 5H8EA 2OLSA 2XD4A 1WBNA 4IDVA 5AFVA 2VTHA 3UQCA 2NNWB 3MH1A 2FVDA 1U5QA 4C5AA 3KXGA 5J1WA 3KMMA 2QOOA 3OT3A 4HNFA 2UUEA 2VTTA 3C1XA 4UWCA 2O8YA 2WELA 3RNIA 5K9IA 5JFWA 2HXLA 5L2IA 4YGAA 2RIOA 2VRXA 3ACKA 3QXOA 4MYGA 4NWMA 4O83A 5EW8A 4AZVA 5EHLA 1YWNA 4FIHA 4BI2A 3VA7A 3FMMA 3O0GA 1OKZA 4I94A 4O82A 3KEXA 3UIMA 3NYXA 4YJNA 5HE1A 2C6MA 2YDKA 3KRXA 1PKGA 2WMRA 4YLJA 5EK7A 2IPXA 3EH9A 4NSTA 4RX9A 3ZFXA 5A6OA 4JIKA 4ZSJA 4W4VA 2XF0A 3BYUA 4APPA 4DAWA 4C4GA 5JZNA 4PMMA 5FBOA 5J8IA 3VN9A 4E5BA 1K3AA 2FSLX 4TYHA 5EHOA 4FC0A 2G9XA 2Z7LA 5BVDA 4PTCA 4DC2A 5IQBA 2UW9A 4UZHA 3QD4A 4FT3A 1UNGA 5HO8A 2BCJA 2XK7A 5CQWA 1KE8A 3P86A 3DAKA 4O38A 3WE4A 1GNGA 2ZB1A 4GSBA 2CCHA 5CZHA 4ACDA 3FWQA 4MBLA 5HCYA 4E6QA 4BCFA 4JBVA 2IO6A 4HYUA 5JRSA 4H3QA 4FUXA 3RCDA 3AMBA 3NVMB 3IK3A 5TO8A 3V3VA 3LQ5A 3UMXA 5JQGF 2Z7SA 3QCSA 4RFYA 2ZV8A 3ORMA 4ITHA 4C4JA 1AUXA 3DB6A 3LLAA 2CDZA 3QYZA 1KJ8A 2HZIA 3H9RA 1JSVA 2V7AA 1O6LA 3EN6A 2PPQA 1PYEA 4JRNA 4M3QA 3JPVA 3CY3A 4WNPA 5DWRA 3ZHPC 1H01A 2HW6A 3TACA 2OFVA 2R3NA 2VTJA 1ZYCA 2GLTA 2QVSE 3VPCA 1IR3A 4GG5A 4GG7A 3MY0A 4HYIA 1TQMA 4QMXA 4HNIA 3WI6A 4IB0A 3O96A 3OFMA 4QT1A 3KMWA 2RL5A 3VULA 3HMPA 4IHPA 2QOIA 4WG3A 2F7EE 3KFAA 4FKVA 3TZ9A 5D12A 3BYMA 3R8UA 2WNTA 1HCKA 2YZLA 2ITUA 3OY1A 3Q9ZA 4KSQA 2V7OA 3I4BA 2W1GA 3ZLYA 3RALA 3FHRA 2XKDA 4FFNA 4B9DA 3QCXA 2YRWA 4M84A 3M11A 2J6MA 2X7GA 3I81A 3RHKA 3ZEWA 5LVNA 4WG4A 3NSZA 3PZHA 4QPSA 4UV0A 1J3HA 2QQ7A 3QQUA 4FV8A 4GJ3A 4HPTE 3C4XA 3M2WA 4FV5A 5EZYF 1EUDB 4G3GA 4LUEA 3BV2A 4RPVA 4MTAA 1E4EB 4ZLZA 2R7NA 2HAKA 2VTIA 3VHKA 4FV4A 3VMMA 4YTIA 4ANBA 2ZDHA 3RAKA 3MH3A 2YN8A 4BDFA 4FSWA 4AE6A 4G3EA 4HNUA 4EG0A 2XK6A 4JQEA 4ANMA 4DTBA 5EH0A 4EBWA 5EQYA 5EI2A 4KS8A 4PL4A 3Q4ZA 3LFEA 4L3LA 3W8LA 5C4LA 3DXNA 2E9VA 2ITTA 2JKKA 3HRFA 4YHFA 2R3QA 3UP2A 1WFCA 4FKOA 5FTGA 3KCKA 1JOWB 3ORZA 5AP6A 4Z16A 4ZJVA 2H8HA 3BHTA 3DJ7A 4R3RA 3SX9A 4CV9A 1KSWA 1JPAA 1OITA 3EFLA 2CNVA 4F9AA 4IVDA 2ITPA 1OIQA 5IEVA 4H1MA 4FEUA 2Z02A 4ID7A 2XNMA 3A60A 3BYVA 3E62A 4XBUA 1H28A 3LFFA 1XO2B 4KA3A 4ZTSA 3F7WA 4IM0A 3MS9A 1XR1A 4D2SA 2YISA 3QA8A 1YXSA 2R7IA 4ZZNA 5CAUA 3PYYA 4YJSA 1PXOA 3U4WA 1UNHA 4EK4A 3HRBA 4ACMA 4ENYA 4F1TA 3JY9A 3LCDA 5M06A 4FT0A 5GNKA 1K2PA 1JVPP 5HBJA 2G15A 5I9WA 3BV3A 1R39A 3EL8A 3VQHA 4BTKA 4ZSGA 1B6CB 5T6KA 1OGUA 1J1CA 2UW8A 4CKIA 1WBVA 4JOAA 4EOOA 2YCFA 2W4OA 4S2ZA 5EYCA 3LFCA 4AZTA 3RVGA 3QRTA 2OFUA 4YJVA 3V4ZA 2PULA 1FBNA 5LMKC 2EXCX 3CTHA 4I5PA 1Y91A 3QTUA 3ZUVA 3GI3A 5B2MA 4KUJA 3LJ0A 5CU6A 4WA9A 4E4TA 1CKPA 4BCJA 4MBIA 2CN8A 3GT8A 4G34A 4TY1A 4FIIA 2FPGB 4BBFA 2YDJA 2KTYA 5LMBA 2WMTA 4CMTA 5BYZA 3C4WA 3O71A 4UWBA 4HR7A 4BCGA 3MTFA 1ZY4A 4U7ZA 3DBCA 3RK9A 3QLFA 3DK6A 2ZV7A 5E8VA 1B39A 3MY5A 1R1WA 3D5WA 3QQFA 5JT2A 4BCNA 1MRUA 2BKZA 2I0HA 3VS5A 4FV2A 1A48A 3DZOA 3N4TA 3MN3A 3QAME 5FG8A 4KKHA 5H8GA 4C3PA 3LFAA 4JI9A 4F6UA 3PIYA 4QP9A 2W6PA 3BQRA 3E63A 5AWMA 5M4FA 4C59A 4WBNF 5DT3A 5AV0A 4LRJA 3WIKA 5AM6A 5EW3A 5BUEA 2BDJA 4Q2AA 1DIKA 4O0UA 3WYXA 2IG7A 4UALA 1UU7A 2ZAZA 2V58A 2QLUA 5A6NA 4G5PA 3GP0A 2G01A 1OUKA 3GC9A 2BZKB 1GOLA 4RRVA 1BL6A 4TL0A 5IA1A 2AC3A 1JLLB 4FL1A 3GEQA 2YS7A 2EB3A 4D4VA 4O7ZA 5DLSA 2VZ6A 4R3CA 1U4DA 2C1BA 3GU5A 2R5TA 3OEZA 5JQWA 4BTFA 5JVLA 4Z55A 1QPCA 2OH0E 1XHAA 2PZYA 2UZDA 4NM3A 2C3JA 1ZAOA 2JKMA 4O4LF 3VUIA 3ZDUA 4CMUA 2V5AA 2E9NA 2XP2A 3E8NA 4G6OA 4HZSA 4LOPA 5LARA 1Q5KA 4PP9A 5IQFA 4QMZA 2PVNA 2W06A 3ETJA 4ASDA 4BCMA 4TV8F 4KIQA 1W0XC 4BB4A 3KN5A 3LKMA 4HVDA 4RZQA 2OI4X 3HKOA 4G16A 3TNQB 1R78A 3QC9A 3DGKA 3S95A 4EZ3A 1QPEA 5E1EA 1YVJA 3PPZA 4S32A 2QHMA 3TJDA 4F65A 2OZAA 2GMXA 4EH9A 2BZJA 1CKJA 1J1BA 4GFMA 3A2CA 5CENA 3GU7A 4WOVA 2G2IA 3SC1A 5IH6A 4IZOA 1YXVA 2J5FA 3ENHA 4MQ2A 2Y6MA 4C61A 2XCKA 4L3JA 4NCTC 5BQ0A 4E73A 3PJCA 2WMSA 4XV9A 4ASXA 4I41A 1OI9A 2UZTA 1CE8A 3QRKA 3CY2A 3EQRA 5CVFA 4BRXA 3F7ZA 4LM5A 3C0HA 3TZ8A 3E5AA 2VV9A 4L43A 2YAAA 4KBKA 3FKLA 3DDPA 3SG8A 3UJGA 4GKHA 5FNVF 5D9HA 1FOTA 4WHZA 1S9IA 4FV9A 5FXSA 3DB8A 4C37A 4C7TA 4I55F 1YKRA 3QZIA 2FA2A 2A0CX 1FQ1B 1EUCB 1NT2A 3D83A 4IZ7A 3VUMA 4YLLA 4HVGA 2X2KA 4D9TA 5J9ZA 1ULZA 2UW6A 3UTOA 3U9TA 1JSUA 4QYYA 4C4IA 3DNEA 4RX5A 2C3KA 4IQ6A 3SXFA 2XNEA 2I6LA 2YIQA 4J95A 3D0EA 3EMGA 4QTBA 4O0VA 4N6ZA 5CI6A 4ITJA 4YLKA 1R0EA 4ZY6A 4AOJA 3FC1X 3II5A 3V5PA 2FYSA 3TIGA 1DV2A 4IAAA 3EZVA 2FO0A 3HV5A 4WBBB 3D15A 2PSQA 2IN6A 2BZIB 3N4VA 2PVPA 3ZOSA 4APCA 3OD6X 3CR0A 3R21A 3MY1A 3U4UA 4JNWA 3T9TA 3O7LD 4FVPA 5HQ0A 5CAEB 3OEFX 2H9VA 4NU1A 5IEXA 1L3RE 3F5PA 2GHLA 4C36A 4NW6A 4ZJJA 1Q99A 5J1VA 3MB6A 5A4LA 4KRDA 1GIJA 2B54A 3BKBA 3KK9A 5I9YA 4HZRA 2PVKA 4DH7A 1U59A 2R84A 3RPYA 4BCOA 1KC7A 4QMLA 4D4SA 4BCHA 5C8YF 4LQMA 1H27A 4C34A 2IJMA 3NMUF 3GQLA 3EIDA 3F2NA 2NUAB 2YCRA 4F7NA 1OKWA 4JBPA 5TF9A 1CDKA 2PHKA 1UKHA 4FA2A 5EQEA 3UC3A 4F7SA 3R04A 3NUAA 4NL0A 4YJTA 5BMMA 2IW9A 3G5DA 3LZBA 4EH6A 4FSQA 2CMWA 4AZSA 5L6WL 4A7CA 5HX8A 5LVLA 4DEEA 4BGGA 5HLWA 3KL8A 2C5XA 3DBDA 4E5WA 4EK3A 2X4FA 2QOLA 3I5ZA 3NVKI 4GFGA 1H1PA 4MX9A 3K54A 3L8PA 5E8TA 1UKIA 2CKQA 3DBEA 4XX9A 5KMIA 3VO3A 4GV1A 3H0YA 4RA5A 4FKWA 5DBXA 1Q4LA 1WBWA 3UZPA 5F94A 5DEYA 3GNIB 3V5WA 3V5QA 5I4NA 4V0GB 2BHEA 4DH8A 3IDBA 3QBNA 2YZMA 3KKVA 3LXKA 3QYWA 2XBAA 5IH5A 5AP2A 5F1ZA 5D1JA 4O91A 3V4SA 4RX7A 4I0TA 4DEHA 3PG1A 4ZS0A 5GJFA 3NLBA 5A46A 4QMWA 1UU3A 4FOCA 1UV5A 3MFTA 2FUMA 4OLIA 3BLQA 3PXFA 4IADA 5I9UA 4C38A 4F9YA 4EH2A 2O5KA 4OBQA 3FKOA 3QWKA 2X0SA 2XCHA 3IPHA 2PVRA 1P4OA 5FM3A 3G6HA 2FPIB 2YM7A 3LCKA 2PK9A 3FI8A 2QCSA 5AP3A 1DI9A 4UB7A 4DGLC 4E26A 4HPUE 1STCE 4QMPA 2GNGA 2ZDTA 3EQBA 3NNVA 2UZUE 3RM7A 5LMKA 2O63A 2YITA 4U45A 1EH4A 2ESMA 4QQCA 4YTHA 5AM7A 5E8UA 3RGFA 4ERWA 2JEDA 2BAJA 1OUYA 3P08A 1AUVA 2VR1A 3ELJA 4E4LA 5CF5A 2PZPA 3LM5A 1YOLA 2JAVA 2Y6OA 5A54A 1S9JA 4EC9A 4FG7A 2HWPA 5EHYA 1BX6A 2W6MA 1BI7A 2VX1A 5CU4A 3UO4A 3EWHA 3QD2B 1FVVA 3KULB 2QHNA 3AD5A 4M0ZA 1YXTA 4FFMA 4MXAA 3BWJA 1DI8A 2BRMA 3LIJA 4QO9A 5DH3A 4BTJA 5LCKA 3NNUA 5EQPA 3ANQA 4HGSA 3FLZA 4AF3A 5EYMA 4EUUA 3AT2A 3E92A 4KINA 4CGAA 3UPZA 3TZMA 4FNYA 4NT4A 2ERZE 4BIBA 1V0PA 4IZ5A 2C3LA 2PVMA 4CEGA 3P5KA 1JDBB 1YW2A 1ZMWA 3I60A 3TEIA 2WQNA 3R9RA 4FL3A 3VS1A 3ORIA 5BPYA 4IANA 4AACA 3R2YA 4X2FA 3O50A 4OUCA 3DA6A 4E20A 3UFXB 2AYPA 2X2MA 2Y4IC 4E6AA 3BBTB 1KJJA 5AP4A 3HB9A 3R00A 4Y83A 1HOWA 2R3JA 3EL7A 3MSSA 2YYAA 4ALWA 4U81A 3F3ZA 4A4OA 3OHTA 4JXFA 4GKIA 1GIHA 1JSTA 2JITA 4I5MA 3ETHA 1OKYA 2GTNA 3GUBA 4LYNA 2V0DA 2VWVA 4OTQA 3P79A 4Y85A 4FSYA 2HW7A 4BBMA 5DA3A 1ZOHA 3LMGA 4GT3A 3WF9A 4DGGA 5CNOA 5AX9A 4OTRA 4UY9A 4RVMA 2PYWA 3UNZA 5CVHA 3HDMA 4CRLA 5K4JA 5HICA 4FFPA 1PYXA 1JWHA 1ZOEA 3GFWA 1PXMA 3BHVA 3SLSA 3R7IA 2YZNA 3ORXA 3IOPA 3Q60A 3SKCA 3MH0A 2W5BA 2PUNA 3RPRA 4G3FA 4XG4A 5BUIA 3FZSA 2VGOA 3ZM9A 3R2BA 3SQQA 5AAGA 4Y8VB 1FINA 4U3ZA 4D4YA 4YSJA 2X2LA 4HW7A 5CWZA 5DI1A 4EYJA 4NCTA 3DCVA 4TPTA 3WIGA 4G9RA 5AIRA 3FMKA 3GCSA 1TVOA 3FC2A 4JR7A 5HNGA 4MV1A 3EQGA 5KMNA 1YOJA 2B7AA 3L9NA 4RWJA 1W7HA 2VNWA 4MXXA 5HG8A 4OTWA 4XUFA 3M42A 3ULIA 2C6KA 2W9ZB 3QF9A 3UIXA 2EUFB 2BAQA 1M2PA 4O27B 4YU2A 2CHLA 2VNYA 3LXPA 5LVOA 1YI3A 3CTQA 4DH1A 2ITNA 2YZGA 3EN7A 1XWSA 4WUAA 4AGUA 4M69B 4DN5A 5KHXA 5HTCA 3D7ZA 3MBLA 4YTFA 2XNNA 3OCGA 4BZNA 3MJ1A 4FTCA 5D10A 4MKCA 5IH4A 4FEQA 4GK3A 4F70A 3RZBA 5M4UA 3JXWA 2C6IA 4AW1A 3MWEA 4CTBA 2VTLA 4AW2A 2JDOA 4H36A 2BFXA 4MWIA 4O4IF 4EOKA 3KRLA 5IU2A 3C5UA 3OMVA 2NU9B 1VYWA 2GSFA 4BGHA 3FI2A 3IS5A 1Q41A 3BRBA 4FSNA 2F2CB 4G3DA 4XG2A 3BI6A 3U87A 2HELA 1FPUA 1PJKA 2YM6A 2C47A 3UNKA 5LMAA 4M14A 3SG9A 5D7AA 5C1QB 5EOLA 5HKMA 5LCJA 4JRVA 3ZRKA 4AZEA 4DG3E 3R5FA 3S00A 1H1WA 4KBCA 4L6QA 1GLVA 3AT3A 4XJ0A 3S0OA 4CLJA 5E90A 3HEGA 4DH5A 4J53A 4C4FA 4BDEA 5LP6F 5LXTF 3TJCA 1RW8A 4FSZA 5HO7A 4CT1A 3F3WA 3RCJA 5H2UA 3C0IA 3NYVA 4R6VA 4TV9F 2W7XA 3O2MA 1E1XA 3G15A 2QR7A 4HCUA 4XV2A 5FEQA 3FL4A 3IW4A 3TTJA 3UG2A 5IUGA 4IVAA 2R3PA 4TXCA 5JFXA 4X7QA 2OWBA 5CSWA 1Z2NX 1J7IA 2C6EA 3OS3A 4FUYA 3SDJA 4P5ZA 4JAJA 4R3PA 4D0WA 2ZDQA 3DQWA 3ZFMA 4RJ6A 2YJRA 3FZOA 3MV5A 4YP8A 3C4ZA 3WO1A 5H9BA 3F5UA 4RIWB 4AU8A 4EH7A 4QTAA 2QKWB 4YJOA 4W8EA 4F1OA 5DT0A 1H1SA 3VS2A 4F0GA 5KKRB 3G51A 1ZARA 4EZ5A 4RA4A 4O7RA 2QNJA 3OWPA 4B7TA 4LFIA 5KO1A 3COMA 1KWPA 4FTNA 4ZSLA 1V0BA 4FTAA 2YEXA 5K5NA 1JQHA 5HNBA 2YIYA 4IW0A 4WBOA 3VIDA 1KEEA 2QG7A 4TZRA 4MV4A 3FZ1A 4FTOA 3A4OX 3Q9XA 3QCYA 3TWJA 4ALVA 3NW5A 3SV0A 1YI6A 3E8EA 5J7HA 1BYGA 4AOTA 2WTCA 4DLKA 4YZBA 2C6OA 2OF2A 4FV7A 1M14A 2I0YA 4AFEA 3ALNA 4ZTHA 2R3LA 1DV1A 2ETKA 1M7NA 4BI0A 3BBWA 3VC4A 4A07A 4AZWA 4M8TA 5EM5A 3VS4A 3DOGA 3NW6A 4F9BA 4Z3VA 2JDVA 4XG9A 3I6UA 4PUZA 3T8OA 4F63A 3HP2A 4FK3A 3R7VA 4FEVA 4FGBA 3FZTA 3BLRA 5ANDA 5KKRC 4QTEA 1W96A 3GXLA 2PUUA 3SXRA 2ITOA 2VTPA 4G1WA 5AX3A 3IGGA 1KJQA 2UW0A 5CSXA 3LFBA 2X9FA 3G9LX 3PIZA 1M2RA 5AV3A 1XH8A 4BDGA 2VO7A 3EKKA 3VNTA 2CSNA 4YNOA 3OUZA 4HYSA 4A9UA 3EQPA 4CFXA 4AS0A 5AP5A 3Q3BA 5JVDF 1HCLA 3EOCA 3G2FA 4MNEB 3MJ2A 4PRJA 1H08A 4IDTA 4TWOA 5K5XA 2UV2A 2HY81 2R3RA 3P7AA 4D28A 4BC6A 1FVTA 3N6RA 2VO0A 3F2RA 4YJ2F 2XK4A 4J52A 4O7YA 2W6NA 1ZRZA 4JDHA 2YRXA 1TQIA 2YM8A 3R0TA 1LUFA 4ZTLA 5C01A 3LCSA 1C3OA 2WMBA 4FZDB 1BI8A 1YXUA 3NUUA 3ZBFA 4ZI7F 4I6HA 1OPKA 4F08A 4FNXA 3GU8A 1Q8WA 2WGJA 3U6IA 3PRFA 4OR5A 2OSCA 4FTJA 4YC8A 2XIXA 3VBQA 4AGWA 4NM5A 2ZMCA 3LW0A 3OXIA 3PA4A 3W2OA 5C1PA 4I92A 3VUDA 5ANGA 1KV1A 4BVUA 4C33A 5M4IA 3F88A 1KE9A 1H24A 4CFMA 4R7HA 2GFCA 4O2AF 2NO3A 2NU6B 2QG5A 3G0EA 3H3CA 3D7TA 3HYHA 4K8AA 2FB8A 4MV7A 3PE1A 1OL6A 2R3OA 3MFRA 3QUDA 3QGWA 4HGLA 4WG5A 5AUTA 2CJMA 2CGUA 4RIYA 1REKA 4QQ5A 4XHKB 3ZONA 3I6WA 1FVRA 3NYNA 4QP7A 4E4XA 5L6PA 4YBKA 3S4QA 4I0RA 4TWNA 2EVAA 2VX3A 4J97A 5LOHA 3TIIA 3GCPA 1IOVA 5HESA 3OWJA 4AZFA 4U80A 5H80A 3ID6C 3EQHA 4O2BF 3MVJA 4GRBA 1YQJA 4RQVA 4O4JF 3MVMA 4QTDA 3T9IA 2WEIA 3IW7A 2WMWA 3VJNA 3KN6A 3F69A 2VWWA 3QTRA 1XBCA 3R8LA 4IVBA 2C3IB 3HV7A 4X3FC 5E9EA 2WB8A 1XH4A 3W1FA 5HD7A 5DRBA 2VTAA 3A99A 5BVKA 1UNLA 4BTMA 3JZFA 5JQ5A 3CKXA 4NM0A 3I79A 3KXXA 4CFFA 2PMIA 4ITIA 3W2CA 2XH5A 4GW8A 5EDQA 2J5EA 2FP4B 4L45A 3LPBA 4RC2A 2HZNA 2OLCA 4S34A 2ZM3A 2WTIA 3L8VA 3VS0A 1JLUE 1SVHA 3GU6A 5AAFA 3V51A 3VHEA 4DEIA 2GQRA 4I23A 5E8SA 1PKDA 3OOMA 5HIBA 3HNGA 2V5QA 4QTCA 4I5CA 2IZTA 4F9WA 3TKUA 4EONA 4XG7A 2BIYA 3TV6A 4L01A 5F4NA 5HCZA 4JDKA 1EYZA 4ASEA 4GS6A 4AFJA 3Q4TA 2ITWA 3NS9A 3TXOA 3R30A 1OL7A 1W82A 3BEAA 3CGOA 3BLHA 1GSOA 3GCUA 3VUKA 1J7LA 3TIYA 1GSHA 5T68A 1G5SA 3QRUA 4ACHA 3TQTA 4TWCA 2WTWA 4I20A 4MD9E 2V62A 2BDWA 4B0GA 4J1RA 4EHEA 5CX9A 2YL2A 3AC5A 2QU6A 3W33A 4E4NA 3UBDA 2QURA 5KMOA 3QUPA 2PUPA 4USDA 4E93A 4IZYA 1B6SA 5DR9A 2FSOX 2LGCA 4D5KA 5IQEA 2EWAA 5M4CA 4RIXA 1U54A 4M15A 4MV8A 3D2IA 3TT0A 1IG1A 3ERKA 3OXZA 3QC4A 1IEPA 3KXHA 4O2ZA 4WIHA 2WTKB 3C13A 5DT4A 2ZM4A 2PVJA 3TTIA 2E9OA 2FSMX 4BCPA 5HHWA 4PTGA 2WMUA 3ZBXA 4OBPA 3OUKA 1PMVA 2B1PA 4RWKA 4CLIA 3E87A 4NW5A 5E7RA 4DCAA 4DFUA 5ITAA 2B9FA 4EHGA 2VWBA 3EYHA 2WPAA 4EK8A 2WOTA 4HGEA 2ETMA 4BCQA 1CMKE 2X4ZA 3HMNA 4HJOA 1H0WA 5DR6A 3RTPA 4E1ZA 4PP7A 3O8PA 4PL3A 5IQCA 4FK6A 5ANOA 3E5NA 4EK6A 2W6ZA 4JDJA 4ZQIA 5CB4F 3KY2A 5KMJA 3P4KA 1WR2A 1OIYA 1PX2A 1NXKA 4NTSA 4WNKA 1ZMUA 3AMAA 1H00A 1MQBA 4LI5A 4PNKA 1H1QA 3FI3A 4M68A 4JL9A 4QP8A 2GPSA 4ASZA 5DMXA 2XUUA 4I1ZA 1SMHA 5CI7A 1SZMA 3FDNA 4AA5A 2DS1A 3F3VA 4D0XA 4EH8A 3K5UA 4AGCA 3V5JA 1VEBA 3KMUA 2VUWA 3KRJA 5I9ZA 2P4IA 4FNWA 3U9CA 1U5RA 3N9XA 2E2BA 4P5QA 3SRVB 4A4LA 4U8ZA 5AAEA 4YBZB 2Q83A 3QQLA 2UZOA 3VWAA 3Q2JA 5I9VA 4F99A 5EKOA 2X9EA 2WMQA 3CD8A 3FLQA 2CKEA 3SHEA 4BYIA 3PJ3A 4M0YA 3FLSA 3MA6A 2J0IA 3FLYA 3CQUA 3R7OA 3R01A 2H96A 4FTKA 5IQDA 4HNVA 5HE2A 3PLAE 5HNIX 4YBJA 4H3PA 1DM2A 3QTSA 3QTQA 2X7OA 4BHNA 5CAOA 3FQEA 2R7LA 2PZ5A 4GU6A 5DR2A 5GJDA 5CU0A 2GCDA 3JS2A 3TM0A 5CAQA 3A61A 3EJ1A 3DFCB 3OG7A 3OCTA 4UWYA 3QA0A 4BHZA 3Q1KA 4DA5A 5D8DA 3ZM4A 3ETAA 3R1YA 4I21A 4CZUA 1IAJA 5L2TA 3U51A 4DBXA 2Z7QA 5GINE 3F2AA 2BRBA 4YJRA 2YCSA 5B2KA 4DLIA 4RJ8A 5TR6A 3TUCA 1H07A 3TN8A 4R78A 4MH7A 1MRVA 2OIDA 3L9MA 4U40A 5IQIA 3GB2A 3RJCA 2DUVA 3ZXTA 1Y6BA 3HAMA 4PDOA 3HGKA 4BI1A 1WMKA 3DQXA 4EI4A 2ZV2A 3RFCA 3IONA 4CTCA 4PQNA 3TCPA 1ZY5A 3THBA 3UGCA 5FGKA 3OBJA 2HJWA 5M57A 1W83A 3KREA 2B55A 4O86A 5JH6A 4EH5A 3Q9WA 2G2FA 4W8DA 3ZH8A 3K5IA 4L53A 5KX5F 5EI6A 3ZCLA 4CFUA 4CV8A 3U55A 5DEWA 5A4TA 3WZJA 3CBLA 4XX0B 3OY3A 4M97A 3L9LA 4RLLA 4S30A 3D5UA 2NPQA 4O0TA 4AA0A 4F0FA 4HVIA 3DV3A 3RWPA 5KCVA 4NUSA 4AW5A 4G6LA 2DZDA 3NPCA 3ZC5A 4H1JA 2Z60A 3TZ7A 2SCUB 1QMZA 4PL5A 1UU8A 4FKRA 3ORQA 5BVOA 1MQ4A 3DKCA 3R23A 2WIHA 3FY0A 4EQUA 2FB9A 1BMKA 4O22A 1G3NA 4M7IA 2OJ9A 2J51A 5LJJA 5L8JA 2W9FB 2YIWA 3OOGA 2SRCA 2I1MA 2XKEA 3BHUA 2B4SB 4IWPA 4OW8A 4W4YA 5EFQA 4IBMA 2IW8A 3RKBA 4FSRA 3QTZA 1A9XA 2IVTA 3ORPA 4GFOA 3W2SA 1ZXEA 5BYYA 1KE5A 5A4QA 2F9GA 2HIWA 3IW6A 2OK1A 3GC8A 4QMOA 5HU3A 2R0IA 3RV3A 5HLPA 4X3FA 4DG2E 1GZKA 4DGOA 2EU9A 5KZIA 3QZGA 2W99B 2R7BA 3MW1A 5HI2A 3S3IA 5IA0A 3K3JA 2H34A 3HMMA 2J0KA 5FM2A 4UXLA 3A7FA 3EN4A 3PVGA 5E8WA 4GIHA 2Q0BA 5CU3A 1DAYA 3ZUTA 5IA3A 3WNZA 4U42A 2ONLC 1A9UA 4YJPA 4ZTRA 4USFA 4Q5EA 2XNPA 4IM2A 3ITZA 5AUXA 5EM7A 3UE4A 3TIZA 2VX0A 4BZOA 4EEVA 3FXWA 4CD0A 4ME6A 4ZZMA 3QUEA 4YHTA 5IUHA 3SE7A 4XV3A 3KGAA 3ZZWA 3KALA 1WVYA 4ORKA 4O21A 2X0GA 3R5HA 2B53A 4OT5A 3VF9A 3VW8A 2WKMA 4MA5A 3Q9YA 4N6YA 4Y8DA 5FP6A 2F4JA 5JGBA 2J9GA 4QMNA 2PUIA 4AQCA 3GCVA 5GIPE 2G1TA 3BE9A 1PXIA 4TRLA 3AX6A 2QLQA 5HIEA 4GYIA 4HQ6A 4C2VA 3EZRA 4ZK5A 4DHFA 2OKRA 3NCGA 5C4KA 3R8ZA 3A4PA 2WU7A 5G1XA 3FL5A 2YW2A 4ZP5A 3ZRMA 3VQUA 3AXWA 1FGKA 3DXQA 4QMMA 4EKKA 2WQEA 2C30A 5CZIA 1YDRE 1LP4A 2WAJA 4O2PA 4JBOA 4RX8A 3RMFA 3DBFA 3IGOA 5IMXA 4KIPA 3GENA 4IX5A 2ZVAA 1JKSA 4BY9E 4MXCA 1FMKA 3D2KA 3KB7A 4EOLA 5GIOE 2Z2WA 2HOGA 3QWJA 4LGHA 4IFGA 3U9SA 5LYJF 3FE3A 4ZMFA 3ET7A 4MEDA 4QP1A 4BBEA 2RFSA 5CTPA 3ZLSA 4DFXE 4R7IA 3EFWA 5T3QA 3DLSA 3FSKA 2Z8CA 4BDAA 4BN1A 5LWNA 2XIYA 4R1VA 3ZFYA 3VVHA 4A4XA 5DG5A 3BIZA 5L8KA 4KWPA 2WHBA 4X6RA 3S1HA 2NU7B 5A14A 4V05A 2WMAA 3DJ6A 5AEPA 1JNKA 4NFNA 2P3GX 3GC0A 4O7WA 1WVWA 3LFDA 4D55A 2C5YA 1GSAA 4QMSA 2QKRA 5FXQA 4JVGA 1VBHA 3CCNA 3I7CA 3QD0A 4XG3A 2ERKA 4LOOA 1IAHA 2XVDA 4PNIA 4Q9SA 5BVWA 3FKNA 2CKPA 3HMIA 2JIVA 3RPOA 4CNHA 4X6QC 3FYJX 5ANIA 2IZRA 5AIKA 4Y72A 2P33A 2QD9A 5KZ0A 2X7FA 3UOJA 1Q97A 3COHA 4AN2A 1DS5A 5JMSA 4TN6A 3BX5A 2BKKA 3S2PA 4C4EA 4Q9ZA 1G8SA 5AUZA 3TUDA 3V6SA 3V6RA 2PWLA 4RT7A 1M7QA 3RP9A 2VWZA 1PY5A 4C3FA 2BDFA 4YJ3F 3B8QA 2I80A 3IKAA 2QOBA 5E4HA 2W1HA 4FG8A 4IAFA 3PXQA 5HORA 2FGIA 2R3MA 1ZMVA 3PWYA
chains in the Genus database with same CATH superfamily
5FEDA 1E4EA 3NWWA 4NK9A 4RVLA 2BILB 3F6XA 3VNNA 1GZ8A 4CRSA 5BWTA 3ZUUA 4IWXA 3Q6UA 1VYZA 5KUPA 2Q0NA 3UZRA 2YWPA 3OC1A 4OTDA 1EZ1A 3GU4A 5CA0F 2A27A 2BPMA 5ETIA 3VBYA 2X8IA 5GONF 2GPHA 2W6QA 5M51A 1C30A 3LLTA 4OTHA 4XRLA 2VO3A 5JH7F 2ZGIA 1VKZA 4YO4A 2XNBA 4FJVA 3V8SA 3WZDA 5FR9A 2PE2A 3BZ3A 5CU2A 3ANRA 3PY3A 2GTMA 1AGWA 4U5JA 4MD8E 4FZ7A 2BVAA 2QI8A 2WQBA 3RUPA 2QOKA 3DTCA 4K18A 4L52A 3TDVA 2I87A 4XZ3B 3AOXA 4H58A 1M0TA 1IRKA 4B6LA 3JRXA 2WMVA 3R71A 1GGOA 4IC8A 2GNIA 2C0IA 2A4LA 4I6FA 4RZVA 2XYNA 5DNRA 5EDRA 4G3CA 3CIKA 3MH2A 3TINA 3NZ0A 2XIZA 5C26A 3UC4A 2Y4PA 2ZMDA 3AKLA 5I5VA 4C0TA 1Y57A 4FTTA 4RGJA 3L8XA 4MK0A 5EI8A 5AMNA 3PUPA 2XALA 3K3IA 4D58A 5CEMA 4O7NA 2HIVA 3K5HA 2C0OA 3BU6A 3FPMA 4XMOA 4EFEA 4CC5A 2QB5A 2R86A 4RC4A 4DTKA 4E4MA 3FBVA 4YPDA 4UCRA 3PE2A 2HGSA 2J50A 5DIAA 1URCA 3QQJA 5C8MA 5FTOA 4O6LA 4P90A 4A9TA 2WMXA 3NW7A 4DEAA 5AA9A 5FPOA 4FYOA 3KYHC 3RHXA 3Q2MA 3T9DA 2CNQA 4RSSA 3WO0A 1NA7A 4X2JA 5HLNA 4XYFA 5I60A 4GYGA 3KA0A 4LMNA 2F49A 5M07A 3SD0A 4CZTA 3C51A 3NNWA 3BPRA 3QKLA 5AP1A 2R3IA 2XCLA 3LE6A 3FZPA 3CJFA 3GGFA 5E1SA 3JRWA 4EHZA 2WD1A 3TV4A 3W2PA 2JGZA 4GUBA 5EM8A 1FMOE 3FY2A 4BKJA 4UN0C 4TYHB 3OTUA 2GHMA 1ZYSA 1VR2A 4IJ9A 2XBJA 4CCUA 4O84A 3G0FA 3R6XA 3R5XA 4NKSA 4I93A 2HK5A 4DH3A 2BALA 2XRWA 3BYOA 4L44A 4DFBA 4EWHA 5B7VA 3D94A 2P0CA 1UWHA 5CXHA 4BDCA 4UYNA 2CLQA 4L68A 4GU9A 4WNMA 2CZGA 3UPXA 5HG7A 5M08A 2XJ0A 3MIAA 3F66A 2BRHA 2BFYA 3F82A 3ZTXA 5BMVF 4IAIA 2CPKE 4K77A 2X5RA 3WOWA 1RJBA 3OBGA 3O17A 4V04A 3RK7A 4K6NA 3W18A 2NRUA 4CG9A 4PY1A 5BVFA 4EEQA 2C68A 3SOCA 4IFCA 2YJSA 3UYYA 1WBPA 2CGXA 4ZZOA 4UFZA 5CVGA 4F64A 3NRMA 4DBNA 4I6BA 4CFVA 3A62A 4FBXA 3E8DA 3BE2A 1BL7A 4KD1A 3EQIA 2YIRA 5M44A 2BHHA 3ODYX 4LL0A 5FBNC 4AAAA 4EH3A 3LMHA 4O4HF 3FPQA 3CXWA 5CYIA 2JDTA 2WQOA 2I8CA 3R02A 3WF8A 4EOIA 2JBOA 3TUBA 4IX6A 4BDDA 4H39A 4A06A 4IHJF 3KRRA 1IASA 4DIMA 1MRYA 1I7NA 3RM6A 5AUWA 4LL5A 4TYGA 4GVAA 4RVTA 2OBJA 2XRUA 4P4CA 1P5EA 2YHVA 3POOA 4ZLYA 3CEKA 5HU9A 4D1ZA 3CQWA 4HNTA 2IZSA 3EN5A 2X8EA 3R73A 4FV6A 4GVJA 4JS8A 4TUYF 5CSHA 2PMLX 4FT9A 3O8TA 4N57A 4GH2A 3LQ8A 4X3JA 3UO6A 4MXZA 3BHHA 3JSNA 4ZS4A 2XS0A 3C7QA 1WBTA 1Q24A 3SW4A 4E6NA 2W96B 4L7FA 3NYOA 4KABA 2J0JA 2WQMA 4I4FA 3UDZA 1PXJA 3UZBA 2PMOX 3MJFA 1LEWA 3HA8A 4FTUA 4BICA 3HRCA 2R7KA 4J99A 3R9DA 5HVJA 3DZQA 4JBQA 5KE0A 4GJ2A 3V5LA 2R82A 3LQ3A 3KXMA 4K33A 1VZOA 1XH9A 3PRIA 4HCVA 3GLKA 4I50F 4Z9LA 3BGPA 3HL7A 1SYKA 2PU8A 4OGRA 2EJ3A 1OL2A 3BQCA 2F57A 4XP0A 4I24A 3I0OA 1Q3WA 4EBVA 4PBCA 2QO9A 2WIPA 4CXAA 4EKLA 5DRDA 2VU3A 3ZEPA 4WRGA 1JKLA 1XQZA 3JY0A 4QMQA 2F2UA 5KNJA 4MV3A 5FLFA 2GS7A 5JEBA 3EQCA 5BPHA 2HZ0A 4KRCA 4WKQA 5IQHA 3AD4A 3WZKA 3G6GA 4WUNA 2ITQA 3PXZA 5AJQA 3MESA 1XH6A 1QPJA 5IZFA 4FIEA 4L7SA 3E7OA 2GQSA 4XOZA 3VUHA 3WYYA 4YC3A 3F3UA 1PXNA 5BX0A 3LULA 3V01A 2XA4A 3VUGA 5FDPA 2YZAA 5JRQA 1G2WA 3OCSA 3FAAA 5FD2A 2V59A 2R4BA 5J2UF 2ITYA 3NCZA 5BVEA 3ROCA 5D7VA 5H8BA 4CT2A 4F09A 5L8LA 4C4HA 4FE2A 3Q2OA 3W0QA 4M9UA 4XYLB 4RVKA 3TKIA 2VWUA 3UMWA 1P4FA 4L3PA 5JFVA 2UZVA 5J9LA 3ZU7A 1WZYA 4C3RA 3JR1A 4JG8A 1O9UA 1SVEA 3KCFA 3ZLWA 3P7CA 1PXKA 2OZOA 3MDYA 3CEBA 4ZXTA 5DHJA 1GIIA 1H26A 5CR5A 2XKFA 2XEYA 4AA4A 3BYSA 4ZEGA 4O0XA 4EZ7A 5JGDA 4KSPA 3ZSHA 4GT5A 5IUIA 3UP7A 5TKDA 5I5XA 3D9VA 2OXYA 1X8BA 4RLKA 3ULZA 3WARA 4GLWA 4ZOLF 4F4PA 1KOAA 5JZJA 3BL9A 5HG5A 3Q32A 4V0GA 5JGAA 3AW8A 3CKWA 3F3TA 5HTBA 3E8CA 4I5HA 2W5AA 3HDNA 3KRWA 4RZWA 4YZMA 5H3QA 3PIXA 4FL2A 4RBLA 1GJOA 1UC8A 1UVRA 3DBQA 1NVRA 3E88A 4CSVA 3LWBA 5CY3A 4MF1A 2R87A 1YHVA 2HWOA 4N4SA 5KBRA 1WVXA 3DAJA 3PJ8A 4ZJIA 2ZJWA 3H10A 1F0QA 3QXPA 3W55A 2J9MA 4DDIA 3WILA 1Q8YA 4MAOA 3MB7A 3E3PA 5CQUA 2P2HA 4LUDA 5I5TA 3ORTA 4CCBA 2R85A 3QFFA 5I9XA 1NVSA 3DKFA 3CGFA 4FKGA 4LV8A 2ITZA 5AUYA 2BMCA 4JQ7A 2W4KA 1ZLTA 3OUUA 5CT0A 3DT1A 4PZ8A 3CP9A 5ACBC 5J95A 2J0MB 3P9JA 3LXLA 4C35A 4D4RA 3QRJA 5EOBA 3EKNA 4B99A 4IB3A 5HGIA 2W5HA 3B2TA 2VUGA 3KAJA 3OF0A 2O2UA 4RJ4A 4Y73A 2P55A 2WOUA 4FTRA 4PDSA 3R7EA 4C02A 3HLLA 5I5YA 3MYGA 2OF4A 5L6OA 1I7LA 1UC9A 1ND4A 4FYNA 4MXOA 3Q6WA 5EDPA 4R7BA 3ORLA 4PDPA 3UVQA 3KULA 4D1XA 4YUQA 5M56A 1IOWA 5BMSA 1VBGA 4S33A 3TG1A 3ORKA 4F0IA 3H0ZA 5IDPA 2YERA 2JIIA 3EFKA 3W0RA 1YI4A 4L8MA 3QX4A 2OG8A 2I7QA 4II5A 1DAWA 3MWDA 3G90X 2PBZA 2CGVA 5TOZA 5CEQA 4AXCA 3I5NA 5IEYA 4IX3A 2QR8A 3FLWA 3HV6A 1XBBA 2C5OA 5IQGA 4FTLA 3SVVA 3TY8A 4AP7A 4G6NA 3QHRA 4ZAUA 5KX8A 2C6DA 2FPPB 2PE1A 1UWJA 2UVZA 5E8YA 4EOPA 2YWVA 4CVAA 2JDSA 4CFNA 4EGQA 3JZIA 4CKJA 1BLXA 3QZHA 3FZRA 4RJ3A 3JSLA 1KBLA 4PMSA 5ANKA 5KHWA 4GMYA 3MIYA 4P2KA 4PDYA 4XG6A 4ACGA 2HYYA 1AD5A 1AQ1A 1GAGA 1V0OA 2ITXA 2R3KA 2XKCA 3QKKA 4J98A 4FSUA 3FMDA 2JDRA 2YA9A 4ZIMA 3UOLA 3RINA 5LVPA 3FMJA 4AN9A 5DE2A 3VPDA 3W32A 5CA1F 1GZNA 4JX7A 4MAMA 3PG3A 3ZLXA 3CSWA 2E9PA 5IMEA 1B6RA 2OICA 3OWKA 3MVHA 2UW5A 4L67A 3UVRA 3R7UA 4AW0A 3ZO1A 5HV6A 1WAKA 4CKCA 4ERKA 2DWBA 3PVBA 3OZ6A 3VJOA 5LQFA 4ANLA 5IF1A 5AV1A 2WTDA 5ETAA 4UX9A 3W5OA 3OUNB 1T46A 2GNFA 4YZ9A 1Q8ZA 2R64A 2WEVA 3CLYA 2Z04A 3ODZX 4FSMA 5JN2A 2QU5A 3FMHA 5FTQA 5G6VA 1YRPA 3WF5A 3WZEA 4D9UA 4PMPA 1YWVA 4H05A 5BV3A 3GOKA 2IP4A 4QNYA 4ALUA 5BWRA 3DNDA 5KKNB 1OL1A 3Q4CA 4C5CA 4FKIA 2R7MA 1H1RA 2R3GA 1XH5A 2JKOA 3D5XA 2LAVA 4G31A 4AT3A 2COGA 3KF7A 4EOSA 3R9NA 3QHWA 2Q7DA 5EYDA 4CG8A 2HENA 4RMZA 2BROA 3WE8A 4FIGA 2YABA 3FHIA 2EIYA 3PUFC 2C1AA 4O7LA 2ETRA 2F7XE 2ITVA 2RKUA 5HCXA 4OTFA 3QQGA 1RE8A 4MQ1A 3LFSA 2PN1A 2Z7RA 2IW6A 4FKUA 4FFRA 3CTJA 2XIRA 4JG6A 4PWNA 1SNXA 3VBXA 5A4EA 3UYTA 3ZO3A 4EQCA 1Q8UA 3GFEA 2B9HA 5FQDC 4DGNA 2VQDA 3RK5A 3FV8A 3TNIA 4BDKA 2UW4A 4MHAA 5BUJA 4TW9A 3T9EA 1CKOA 1A06A 3FEGA 3O7LB 3HAVA 4G2FA 2DAAA 2GDOA 4QYGA 2W1DA 4AT5A 3CS9A 4EQMA 3IW5A 5HNEA 3CSVA 2PY3A 1CM8A 2VN9A 4CMFA 2RFDA 3DXPA 3U0GA 4L42A 3IOKA 3POZA 4Z7GA 4ZTQA 1DGSA 3OT8A 1OBGA 4FZFB 2CNUA 4GL9A 4DDGA 2VTOA 4O7VA 2Y0AA 4NFMA 4X2KA 4RJ5A 2DIKA 4E6DA 4FICA 4ZOGA 4KBAA 4S31A 4PTEA 4XV1A 2J90A 5DPVA 4NTTA 4PMTA 4OTGA 5HBEA 2GQGA 2J2IB 2YCQA 4LH7A 3RTXA 2XM9A 4RWLA 4DEDA 3KK8A 2ODTX 1NY3A 1VJYA 3FLNC 4AN3A 4OBOA 1W84A 2CGWA 4X2NA 1T45A 5CSVA 3ZZEA 2KULA 2UW3A 2WTKC 3U8WA 2O64A 5JSMA 1PMEA 1J91A 3AGLA 3QTWA 3HV4A 4K9YA 4TYIA 4ZSEA 4R5YA 4MV6A 4PZ6A 4EGJA 2ZOQA 2E9UA 3H9FA 1PF8A 4FTIA 4GCJA 3MPTA 3AG9A 4E8AA 4RIWA 4J96A 4O0SA 3R28A 4QMVA 3DK3A 3OXTA 5HD4A 3U6JA 5JQ8A 4DGMA 5KBQA 4KAOA 4IC7A 1DAAA 4PF4A 3NIZA 3E7VA 4FMQA 2R0UA 2UZBA 2QOQA 4IACA 1P14A 3EQFA 1J7UA 3KU2A 3ZC6A 3KXNA 3FYKX 4YO6A 3QALE 5CEKA 3WBLA 1GY3A 3A8XA 4IE9A 3UYSA 2YDIA 4O81A 1A0GA 4NJDA 4QOXA 5CLPA 1VLRA 4HOKA 4BF2A 4FGRA 1CQJB 5CSPA 3K5VA 4EH4A 4R77A 3UODA 1P2AA 3OVVA 3VS7A 3NEWA 3AGMA 4JG7A 3AC2A 1E9HA 3NUYA 3PXYA 1KOBA 4GUEA 3W16A 4I4TF 4YZNA 4XLVA 3R8VA 2V22A 3MFUA 3PFQA 4EWQA 4U9AA 1Z2PX 4DFNA 2UW7A 5HBHA 3R7YA 4DTAA 4USEA 4IMYA 1TKIA 5IISA 2VTMA 2W1IA 4F1MA 3DK7A 4MV9A 4TNBA 4Q4CA 4XEYA 4FVRA 3TDWA 5ANEA 2B52A 3W0OA 2G2HA 2XK9A 3LOKA 1OECA 5GHVA 1CKIA 4DEBA 4ENXA 3DY7A 3UDBA 1KUTA 4FKPA 4M67A 4O96A 4PX6A 5LVMA 4HVHA 3G8DA 4O7TA 2VTSA 4FV1A 2AC5A 5HG9A 3DFAA 1CKNA 4QP4A 2XK8A 3CJGA 5IA5A 4I6QA 3MTLA 3UQGA 3ORRA 3QLGA 5CAPA 1YHSA 4IWOA 1OPLA 3SXSA 1KJ9A 4YAJB 5HEZA 3PDTA 5D41A 4ZTMA 3U9NA 2C6LA 5CF8A 4K11A 1ZYJA 2C4GA 3I7BA 5CEOA 3BG5A 2J7TA 3VF8A 2RFEA 4NKAA 5J2TF 2PE0A 3CQEA 2GNJA 2WFYA 4FVQA 4G9CA 3PY0A 3JUHA 3M1SA 4B8LA 1PHKA 4NZWB 2J0LA 4ANQA 3N4UA 4FODA 4YR8A 3LXNA 2R2PA 5C8NA 4IEBA 3C0GA 4LMUA 3MWUA 1JKJB 3LFQA 2HDKA 3MPAA 4FZ6A 3V04A 2OH4A 4TTHB 2VWXA 1TQPA 2QOCA 2YFXA 4QYHA 2Y8OA 4DITA 2VD5A 4HVSA 4ZMEA 4BCIA 4I3ZA 5JFSA 4MNEA 3TI1A 4D5HA 2X6DA 2J4ZA 3KF4A 3NUNA 5DOSA 4LGGA 4IZAA 4FT7A 1YDTE 3UOHA 1WBOA 1OPJA 1XJDA 3I0QA 1QPDA 4IJPA 4B8MA 5ETCA 4F7JA 5IYZF 4K0YA 2B0QA 4QRCA 2VWIA 2BUJA 3V8WA 1CSNA 5KMLA 1H4LA 4R1YA 3RI1A 3TNWA 1KJIA 2VWYA 3B8RA 5CS6A 4IX4A 3BL7A 4XOYA 1M52A 2PVYA 2BZHB 2OJJA 3P5JC 4Y46A 2B9IA 4Y5QA 3HT5A 5AA8A 3LM0A 3ATTA 3HO8A 1W8CA 3PA3A 4BCKA 5CNNA 1JAMA 4LV5A 3Q5IA 2OO8X 3DTGA 3L8SA 4EORA 5L2SA 2HXQA 4FR4A 3FI4A 2QO7A 2X6EA 3OCBA 5AUVA 5FRIA 3VBTA 3RV4A 3A7HA 3U54A 1K9AA 5LOVF 5A3XA 4U79A 2NP8A 1BNCA 3OP5A 2PL0A 1ZWSA 3EQDA 3JVRA 4YNEA 1Z5MA 1SNUA 2DQ7X 4NM7A 4AXAA 3PXKA 1RDQE 2EB2A 4MWHA 4QEBA 5K3YA 5F9EA 1PXPA 2OJGA 3KC3A 4RCNA 4NJ3A 5IPJA 3NUXA 2XZSA 4IWDA 2OJFE 1IA8A 1Q8TA 4YMJA 2I40A 4FIJA 2BRGA 1QCFA 4W4WA 4DINA 4QSHA 3UIUA 3BCEA 4QP3A 3NAYA 3PJ1A 4QPAA 4YJUA 5LA6F 1ZOGA 4AXEA 1PW2A 3DDQA 5HE0A 3C9WA 3H30A 3MA3A 3REPA 4MVFA 2WU6A 2P0AA 4EOJA 5C03A 3VS6A 4BIDA 4C2WA 3Q53A 4DG0E 4JAIA 1TAEA 5HVKA 5LWMA 5M55A 4DT9A 5KS8A 2BAKA 4QP6A 4UYAA 5HX6A 5I5ZA 3Q04A 1PRYA 1LEZA 3NAXA 5A4CA 3W0PA 3QX2A 1JDEA 2W1FA 1ZZLA 3EYGA 2PZIA 2AEGA 4IH8A 5DN3A 5J9YA 2CN5A 1OZ1A 4J8NA 4YZDA 5ACKA 4FKJA 1XH7A 2QOFA 3PTGA 3PWDA 1OMWA 4EL9A 2X1NA 1XBAA 4ZTNA 2WO6A 2RFNA 5B0XA 2DLNA 3CD3A 3QTXA 3PPKA 4Y5HA 2XJ1A 3A7GA 3PA5A 3G33A 1ET0A 3TV7A 4U0IA 2IVUA 2O65A 5AADA 3R9HA 2CLXA 3LVPA 2CKOA 1UA2A 3P78A 3AC4A 4YAKB 3QFVA 1Z57A 3E64A 3G9NA 4FSTA 3QU0A 4LG4A 4XH6A 3RPVA 2FSTX 3Q5ZA 3TL8A 3HBLA 3ZMMA 5ANJA 5F95A 5E8ZA 2CCIA 5E8XA 1OL5A 1YDSE 4QQJA 3VRZA 4YURA 5I0BA 1URWA 2JIUA 3ENMA 3F9NA 4UBAA 4BDBA 5ETFA 2DWCA 2UZLA 3H9OA 4JR3A 5F20A 5D1PA 3UOKA 5CXZA 4RJ7A 3TNHA 4RFZA 1XKKA 3IG7A 5TT7A 4ZY5A 4XRJA 4YB8B 3GC7A 3PJ2A 4GT4A 4X0MA 1NVQA 4J71A 3ZRLA 5FXRA 3HUCA 4GK2A 2WTJA 5EKNA 1W98A 3PSBA 3KAKA 2R3HA 1QL6A 1LPUA 4U97A 1YOMA 4QYEA 5DFPA 3C4FA 1GZOA 1OKVA 2Y7JA 5HE3A 4FV0A 4EK5A 1CTPE 2EJ0A 5A9UA 3LHJA 3HZTA 3K3PA 4FEXA 3AC8A 3AT4A 4IM3A 4K6ZA 2XM8A 2Y9QA 3AC3A 4F6SA 3BA9A 2PVHA 2W1ZA 3CPBA 2NRYA 4FV3A 3ZO4A 3LAUA 3EFJA 4ANSA 1BKXA 2W71A 4QMYA 4YC6A 2EXMA 3DAEA 2W70A 3UQFA 3HX4A 5BYLA 1F3MC 1FGIA 1Q61A 2VAGA 5FP5A 1IA9A 2XYUA 5FEEA 3D14A 3PXRA 2JKQA 3FUPA 3QKMA 3PVWA 3VRYA 1Q62A 2IVVA 3NDMA 1UU9A 3GVUA 3PVUA 2XB7A 2BTSA 1SVGA 2YACA 3O51A 4ONAA 5KMKA 3L1SA 3R22A 3PN1A 3QWUA 3JVSA 2UVXA 1ATPE 2C5NA 4IVCA 4J8MA 3SNOA 3TKHA 2WZJA 4MXYA 3F61A 4GEOA 4JQ8A 1H25A 5BVNA 4GLXA 4L9IA 4YTCA 3MI9A 1PK8A 4XCUA 5CEPA 4CE5A 4KB8A 3DKGA 3Q52A 4DQNA 4TKSA 1APME 2QOHA 2XIKA 4BIEA 3UZTA 3N51A 3A8WA 4AT4A 2UVYA 2VTQA 3EB0A 4FT5A 5BNJA 3CPCA 4RFMA 3BU3A 3DS6A 4BDJA 1ERKA 4C5BA 3HP5A 2BRNA 2Y4IB 3DLZA 3AQVA 1WBSA 5M53A 3ACJA 4FFOA 2C0TA 1I09A 4NH1A 3C4EA 2QF7A 2I0EA 2VGPA 1BXRA 3SRVA 4B4LA 4TVIA 1ZZ2A 5CAVA 3UNJA 4E6CA 1Z9XA 2O3PA 3E3BX 4FKLA 4QQTA 4KKEA 4U41A 4F7LA 1E1VA 2DYLA 4IWQA 4AE9A 5CF6A 2RGPA 3Q96A 4NYEA 4UCOA 3R1QA 4XLIA 2IVSA 2ZDUA 1CS0A 4TYEA 4XP2A 4BZDA 5K4IA 3QGYA 4EFBA 3BEGA 2W0JA 4XNEA 2C00A 3SAYA 3HECA 2UZWE 3D7TB 4UXQA 5GJGA 3LFNA 3FXXA 3BGZA 3P0MA 3NGAA 3IW8A 2XMYA 3KVXA 1P16A 4RIYB 3FQHA 1SCUB 2HCKA 5EM6A 2YM3A 4CMOA 3WWHA 2OJIA 3JYAA 4Z7HA 1Q3DA 1JBPE 3RWQA 5CEIA 4AUAA 5E92A 4FKTA 3H4JA 2JFLA 3LCTA 3NUPA 4FKSA 4MNFA 2W05A 3LP8A 4JDIA 2OGVA 2VTRA 4L00A 4X2GA 4JMQA 2PVLA 4CKRA 3VBWA 4IIRA 4ZSAA 3R1NA 4JX3A 4Q5HA 3AD6A 3P23A 4GK4A 1Y8GA 2ZYBA 1LR4A 1B38A 2VO6A 3R63A 2B9JA 1G8AA 3C5IA 4O0RA 5DGZA 3VAPA 3W2QA 4A9YA 4D2RA 3TNPC 3IECA 2H6DA 3U6HA 5DISC 3GCQA 3ZYAA 1BUHA 3MVLA 4U6RA 3SGCA 4YZCA 4BGQA 2JLDA 3GQIA 4IAYA 1F5QA 4EJ7A 4U3YA 1M6VA 2VPQA 3W2RA 4EYMA 4IIJF 4G17A 3AC1A 5AV2A 1KV2A 4RG0A 2WXVA 3KQ7A 3QCQA 4FFLA 2C6TA 3QTIA 2PTKA 2A19B 4FZAB 4YPSA 2RG5A 2RG6A 2ONLA 3OTVA 3ZXZA 3QD3A 5E25A 4MBJA 3LMIA 3I12A 3B2WA 3LJ2A 4U43A 4EHVA 2OXDA 4LOQA 3IO7A 4O6EA 3KVWA 2ZM1A 1RQQA 3ZSIA 3CE3A 4DF3A 1KTAA 1V1KA 3LJ1A 3UG1A 5L2WA 5IA4A 4GIIA 1CQIB 5AV4A 1OBDA 3OWLA 4K2RA 4I0SA 2JD5A 3MPMA 4WT6A 4DEGA 5C27A 2IZUA 1MUOA 4O0WA 4FTQA 3BA8A 4EJNA 4UEUA 2FH9A 5CANA 4FTMA 4FX3A 3R9OA 5IDNA 5AP7A 2OIQA 3DAAA 4YJQA 3ZDIA 5LXMA 2JAMA 4DFZE 3VPBA 3FMNA 1I44A 5IG1A 3RAWA 2A2AA 3FSFA 3DU8A 3P7BA 5FDXA 4CFWA 4EQ5A 2R3FA 5BWWA 1M17A 2X39A 3T3UA 5E91A 3P1AA 2WYOA 3VOTA 3MGYA 4KKGA 1O6YA 3AMYA 3NUSA 4WD5A 4RIXB 1U54B 2W4JA 3ZO2A 4EC8A 5J5SA 4L1KA 4AG8A 2QODA 2ZV9A 2W1EA 4TWPA 4EOQA 2OXXA 3PY1A 1KE6A 1MP8A 2ABJA 2AUHA 3NR9A 3I1AA 3CC6A 2QONA 5ICPA 4MA0A 3BHYA 3WWIA 4TT7A 3ORNA 3HMOA 4XBRA 4KIOA 5AUUA 3V5TA 2YAKA 3QQKA 4AGDA 4FU0A 2JFMA 3OROA 4XP3A 4C58A 5HIDA 2PMNX 5JKGA 2HG8A 5C8KA 3LCOA 4EUTA 3QQHA 4K1BA 5C1OA 4YHJA 2XJ2A 2REIA 3K2LA 4DE4A 4ZLOA 5J87A 2XNGA 4L46A 3G8CA 2BTRA 3OW4A 1ST0A 5DVRA 4MCVA 5CASA 3PP0A 2PVFA 3NNXA 4DYMA 4M12A 3VBVA 3PSDA 4QYFA 3PZEA 4A9RA 2IWIA 3SA0A 4QMUA 2O0UA 2GFSA