4O7QA

Crystal structure of the f27g aim2 pyrin domain mutant and similarities of its self-association to ded/ded interactions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
94
structure length
94
Chain Sequence
AMESKYKEILLLTGLDNITDEELDRFKGFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the F27G AIM2 PYD Mutant and Similarities of Its Self-Association to DED/DED Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, apoptosis
molecule keywords Interferon-inducible protein AIM2
total genus 41
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4o7qA00
2OF5A 1CY5A 2O71A 3EZQB 4O9FA 2A9IA 2DBGA 3MOPK 1PN5A 2DO9A 4I16A 2D96A 3YGSP 3YGSC 1E3YA 2MPCA 4F44A 1WH4A 3CL3A 4RHWE 2VGQA 4UZ0A 4IZ7B 4N1LA 1UCPA 4A2WA 2A5YB 2KN6A 2LWDA 2DBDA 2HM2Q 4M9SA 4F42A 1WMGA 1N3KA 4ZBWA 4M9XA 4EWIA 2N00A 2NSNA 2N7ZA 3T6PA 3CRDA 4JUPA 2GF5A 3KATA 1YGOA 4LWDA 2LS7A 4DWNA 2MB9A 2NZ7A 2N1FA 3LQRA 4QOBA 2L9MA 1C15A 2NAQA 4O7QA 1ICHA 4O6XA 1D2ZA 1FADA 2MS8A 2BBZA 1A1ZA 2BBRA 2L6AA 4O9LA 4RHWA 4P4HI 3MOPG 4N1JA 3EZQA 2F1SA 4FH0A 2N83A 4A2QA 2DBHA 2M5VA 1NGRA 4D8OA 2YVIA 1DDFA 2G7RA 4JQWA 2IB1A 2MN4A 1E41A 4IZ5E 1Z6TA 2DBFA 1A1WA 4P4HA 4E9MA 1WXPA 2YGSA 2N80A 2N97A 3MOPA 2YQFA 2YU0A 2B1WA 3LQQA 1DGNA 2LWEA 3QF2A 4NQKA 3J63A 4IZAB 1D2ZB 2KM6A 2OF5H 4N1KA 2MS7A 2P1HA 4M9ZA 1CWWA 3J6JA
chains in the Genus database with same CATH superfamily
2OF5A 1CY5A 2O71A 3EZQB 4O9FA 2A9IA 2DBGA 3MOPK 1PN5A 2DO9A 4I16A 2D96A 3YGSP 3YGSC 1E3YA 2MPCA 4F44A 1WH4A 3CL3A 4RHWE 2VGQA 4UZ0A 4IZ7B 4N1LA 1UCPA 4A2WA 2A5YB 2KN6A 2LWDA 2DBDA 2HM2Q 4M9SA 4F42A 1WMGA 1N3KA 4ZBWA 4M9XA 4EWIA 2N00A 2NSNA 2N7ZA 3T6PA 3CRDA 4JUPA 2GF5A 3KATA 1YGOA 4LWDA 2LS7A 4DWNA 2MB9A 2NZ7A 2N1FA 3LQRA 4QOBA 2L9MA 1C15A 2NAQA 4O7QA 1ICHA 4O6XA 1D2ZA 1FADA 2MS8A 2BBZA 1A1ZA 2BBRA 2L6AA 4O9LA 4RHWA 4P4HI 3MOPG 4N1JA 3EZQA 2F1SA 4FH0A 2N83A 4A2QA 2DBHA 2M5VA 1NGRA 4D8OA 2MJMA 2YVIA 1DDFA 2G7RA 4JQWA 2IB1A 2MN4A 1E41A 4IZ5E 1Z6TA 2DBFA 1A1WA 4P4HA 4E9MA 1WXPA 2YGSA 2N80A 2N97A 3MOPA 2YQFA 2YU0A 2B1WA 3LQQA 1DGNA 2XV9A 2LWEA 3QF2A 4NQKA 3J63A 4IZAB 1D2ZB 2KM6A 2OF5H 4N1KA 2MS7A 2P1HA 4M9ZA 1CWWA 3J6JA
chains in the Genus database with same CATH topology
2OF5A 1CY5A 2O71A 3EZQB 4O9FA 2A9IA 2DBGA 3MOPK 1PN5A 2DO9A 4I16A 2D96A 3YGSP 3YGSC 1E3YA 2MPCA 4F44A 1WH4A 3CL3A 4RHWE 2VGQA 4UZ0A 4IZ7B 4N1LA 1UCPA 4A2WA 2A5YB 2KN6A 2LWDA 2DBDA 2HM2Q 4M9SA 4F42A 1WMGA 1N3KA 4ZBWA 4M9XA 4EWIA 2N00A 2NSNA 2N7ZA 3T6PA 3CRDA 4JUPA 2GF5A 3KATA 1YGOA 4LWDA 2LS7A 4DWNA 2MB9A 2NZ7A 2N1FA 3LQRA 4QOBA 2L9MA 1C15A 2NAQA 4O7QA 1ICHA 4O6XA 1D2ZA 1FADA 2MS8A 2BBZA 1A1ZA 2BBRA 2L6AA 4O9LA 4RHWA 4P4HI 3MOPG 4N1JA 3EZQA 2F1SA 4FH0A 2N83A 4A2QA 2DBHA 2M5VA 1NGRA 4D8OA 2MJMA 2YVIA 1DDFA 2G7RA 4JQWA 2IB1A 2MN4A 1E41A 4IZ5E 1Z6TA 2DBFA 1A1WA 4P4HA 4E9MA 1WXPA 2YGSA 2N80A 2N97A 3MOPA 2YQFA 2YU0A 2B1WA 3LQQA 1DGNA 2XV9A 2LWEA 3QF2A 4NQKA 3J63A 4IZAB 1D2ZB 2KM6A 2OF5H 4N1KA 2MS7A 2P1HA 4M9ZA 1CWWA 3J6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF5 A;  1CY5 A;  2O71 A;  3EZQ B;  4O9F A;  2A9I A;  2DBG A;  3MOP K;  1PN5 A;  2DO9 A;  4I16 A;  2D96 A;  3YGS P;  3YGS C;  1E3Y A;  2MPC A;  4F44 A;  1WH4 A;  3CL3 A;  4RHW E;  2VGQ A;  4UZ0 A;  4IZ7 B;  4N1L A;  1UCP A;  4A2W A;  2A5Y B;  2KN6 A;  2LWD A;  2DBD A;  2HM2 Q;  4M9S A;  4F42 A;  1WMG A;  1N3K A;  4ZBW A;  4M9X A;  4EWI A;  2N00 A;  2NSN A;  2N7Z A;  3T6P A;  3CRD A;  4JUP A;  2GF5 A;  3KAT A;  1YGO A;  4LWD A;  2LS7 A;  4DWN A;  2MB9 A;  2NZ7 A;  2N1F A;  3LQR A;  4QOB A;  2L9M A;  1C15 A;  2NAQ A;  4O7Q A;  1ICH A;  4O6X A;  1D2Z A;  1FAD A;  2MS8 A;  2BBZ A;  1A1Z A;  2BBR A;  2L6A A;  4O9L A;  4RHW A;  4P4H I;  3MOP G;  4N1J A;  3EZQ A;  2F1S A;  4FH0 A;  2N83 A;  4A2Q A;  2DBH A;  2M5V A;  1NGR A;  4D8O A;  2YVI A;  1DDF A;  2G7R A;  4JQW A;  2IB1 A;  2MN4 A;  1E41 A;  4IZ5 E;  1Z6T A;  2DBF A;  1A1W A;  4P4H A;  4E9M A;  1WXP A;  2YGS A;  2N80 A;  2N97 A;  3MOP A;  2YQF A;  2YU0 A;  2B1W A;  3LQQ A;  1DGN A;  2LWE A;  3QF2 A;  4NQK A;  3J63 A;  4IZA B;  1D2Z B;  2KM6 A;  2OF5 H;  4N1K A;  2MS7 A;  2P1H A;  4M9Z A;  1CWW A;  3J6J A; 
#chains in the Genus database with same CATH topology
 2OF5 A;  1CY5 A;  2O71 A;  3EZQ B;  4O9F A;  2A9I A;  2DBG A;  3MOP K;  1PN5 A;  2DO9 A;  4I16 A;  2D96 A;  3YGS P;  3YGS C;  1E3Y A;  2MPC A;  4F44 A;  1WH4 A;  3CL3 A;  4RHW E;  2VGQ A;  4UZ0 A;  4IZ7 B;  4N1L A;  1UCP A;  4A2W A;  2A5Y B;  2KN6 A;  2LWD A;  2DBD A;  2HM2 Q;  4M9S A;  4F42 A;  1WMG A;  1N3K A;  4ZBW A;  4M9X A;  4EWI A;  2N00 A;  2NSN A;  2N7Z A;  3T6P A;  3CRD A;  4JUP A;  2GF5 A;  3KAT A;  1YGO A;  4LWD A;  2LS7 A;  4DWN A;  2MB9 A;  2NZ7 A;  2N1F A;  3LQR A;  4QOB A;  2L9M A;  1C15 A;  2NAQ A;  4O7Q A;  1ICH A;  4O6X A;  1D2Z A;  1FAD A;  2MS8 A;  2BBZ A;  1A1Z A;  2BBR A;  2L6A A;  4O9L A;  4RHW A;  4P4H I;  3MOP G;  4N1J A;  3EZQ A;  2F1S A;  4FH0 A;  2N83 A;  4A2Q A;  2DBH A;  2M5V A;  1NGR A;  4D8O A;  2MJM A;  2YVI A;  1DDF A;  2G7R A;  4JQW A;  2IB1 A;  2MN4 A;  1E41 A;  4IZ5 E;  1Z6T A;  2DBF A;  1A1W A;  4P4H A;  4E9M A;  1WXP A;  2YGS A;  2N80 A;  2N97 A;  3MOP A;  2YQF A;  2YU0 A;  2B1W A;  3LQQ A;  1DGN A;  2XV9 A;  2LWE A;  3QF2 A;  4NQK A;  3J63 A;  4IZA B;  1D2Z B;  2KM6 A;  2OF5 H;  4N1K A;  2MS7 A;  2P1H A;  4M9Z A;  1CWW A;  3J6J A; 
#chains in the Genus database with same CATH homology
 2OF5 A;  1CY5 A;  2O71 A;  3EZQ B;  4O9F A;  2A9I A;  2DBG A;  3MOP K;  1PN5 A;  2DO9 A;  4I16 A;  2D96 A;  3YGS P;  3YGS C;  1E3Y A;  2MPC A;  4F44 A;  1WH4 A;  3CL3 A;  4RHW E;  2VGQ A;  4UZ0 A;  4IZ7 B;  4N1L A;  1UCP A;  4A2W A;  2A5Y B;  2KN6 A;  2LWD A;  2DBD A;  2HM2 Q;  4M9S A;  4F42 A;  1WMG A;  1N3K A;  4ZBW A;  4M9X A;  4EWI A;  2N00 A;  2NSN A;  2N7Z A;  3T6P A;  3CRD A;  4JUP A;  2GF5 A;  3KAT A;  1YGO A;  4LWD A;  2LS7 A;  4DWN A;  2MB9 A;  2NZ7 A;  2N1F A;  3LQR A;  4QOB A;  2L9M A;  1C15 A;  2NAQ A;  4O7Q A;  1ICH A;  4O6X A;  1D2Z A;  1FAD A;  2MS8 A;  2BBZ A;  1A1Z A;  2BBR A;  2L6A A;  4O9L A;  4RHW A;  4P4H I;  3MOP G;  4N1J A;  3EZQ A;  2F1S A;  4FH0 A;  2N83 A;  4A2Q A;  2DBH A;  2M5V A;  1NGR A;  4D8O A;  2MJM A;  2YVI A;  1DDF A;  2G7R A;  4JQW A;  2IB1 A;  2MN4 A;  1E41 A;  4IZ5 E;  1Z6T A;  2DBF A;  1A1W A;  4P4H A;  4E9M A;  1WXP A;  2YGS A;  2N80 A;  2N97 A;  3MOP A;  2YQF A;  2YU0 A;  2B1W A;  3LQQ A;  1DGN A;  2XV9 A;  2LWE A;  3QF2 A;  4NQK A;  3J63 A;  4IZA B;  1D2Z B;  2KM6 A;  2OF5 H;  4N1K A;  2MS7 A;  2P1H A;  4M9Z A;  1CWW A;  3J6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...