4O7QA

Crystal structure of the f27g aim2 pyrin domain mutant and similarities of its self-association to ded/ded interactions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
94
structure length
94
Chain Sequence
AMESKYKEILLLTGLDNITDEELDRFKGFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the F27G AIM2 PYD Mutant and Similarities of Its Self-Association to DED/DED Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, apoptosis
molecule keywords Interferon-inducible protein AIM2
total genus 41
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4o7qA00
2LWEA 4NQKA 4M9ZA 2BBZA 4O9FA 2N00A 3YGSP 4P4HI 2N97A 4O7QA 1CWWA 4F42A 1C15A 4RHWA 4IZAB 2NSNA 3KATA 1ICHA 2NAQA 2M5VA 2MPCA 3MOPK 3LQQA 2YGSA 4N1JA 3T6PA 2N83A 4N1LA 2G7RA 2N1FA 2N7ZA 1WH4A 2YQFA 2HM2Q 2P1HA 1A1ZA 2GF5A 4A2WA 4JQWA 2KM6A 2YVIA 2IB1A 3J63A 4N1KA 3J6JA 2KN6A 2A9IA 1NGRA 2MS7A 3EZQA 2D96A 1D2ZB 1N3KA 4IZ5E 1YGOA 1PN5A 2F1SA 2DBHA 1DGNA 4I16A 4A2QA 2LS7A 4F44A 2MN4A 1UCPA 3MOPA 2MS8A 4E9MA 3CRDA 2L9MA 1WMGA 2O71A 4QOBA 4IZ7B 1A1WA 4JUPA 4O6XA 2DBDA 4EWIA 3MOPG 2YU0A 2DBGA 2N80A 2BBRA 1WXPA 1DDFA 2LWDA 2DBFA 4UZ0A 1CY5A 1E3YA 2VGQA 2OF5A 2NZ7A 4FH0A 2A5YB 4RHWE 3QF2A 4M9SA 1Z6TA 4DWNA 2L6AA 4P4HA 4D8OA 3EZQB 1D2ZA 2MB9A 4M9XA 3YGSC 2OF5H 3CL3A 4O9LA 1FADA 1E41A 3LQRA 4LWDA 4ZBWA 2B1WA 2DO9A
chains in the Genus database with same CATH superfamily
2LWEA 4NQKA 4M9ZA 2BBZA 4O9FA 2N00A 2XV9A 3YGSP 4P4HI 2N97A 4O7QA 1CWWA 4F42A 1C15A 4RHWA 4IZAB 2NSNA 3KATA 1ICHA 2NAQA 2M5VA 2MPCA 3MOPK 3LQQA 2YGSA 4N1JA 3T6PA 2N83A 4N1LA 2G7RA 2N1FA 2N7ZA 1WH4A 2YQFA 2HM2Q 2P1HA 1A1ZA 2GF5A 4A2WA 4JQWA 2KM6A 2YVIA 2IB1A 3J63A 4N1KA 3J6JA 2KN6A 2A9IA 1NGRA 2MS7A 3EZQA 2D96A 1D2ZB 1N3KA 4IZ5E 1YGOA 1PN5A 2MJMA 2F1SA 2DBHA 1DGNA 4I16A 4A2QA 2LS7A 4F44A 2MN4A 1UCPA 3MOPA 2MS8A 4E9MA 3CRDA 2L9MA 1WMGA 2O71A 4QOBA 4IZ7B 1A1WA 4JUPA 4O6XA 2DBDA 4EWIA 3MOPG 2YU0A 2DBGA 2N80A 2BBRA 1WXPA 1DDFA 2LWDA 2DBFA 4UZ0A 1CY5A 1E3YA 2VGQA 2OF5A 2NZ7A 4FH0A 2A5YB 4RHWE 3QF2A 4M9SA 1Z6TA 4DWNA 2L6AA 4P4HA 4D8OA 3EZQB 1D2ZA 2MB9A 4M9XA 3YGSC 2OF5H 3CL3A 4O9LA 1FADA 1E41A 3LQRA 4LWDA 4ZBWA 2B1WA 2DO9A
chains in the Genus database with same CATH topology
2LWEA 4NQKA 4M9ZA 2BBZA 4O9FA 2N00A 2XV9A 3YGSP 4P4HI 2N97A 4O7QA 1CWWA 4F42A 1C15A 4RHWA 4IZAB 2NSNA 3KATA 1ICHA 2NAQA 2M5VA 2MPCA 3MOPK 3LQQA 2YGSA 4N1JA 3T6PA 2N83A 4N1LA 2G7RA 2N1FA 2N7ZA 1WH4A 2YQFA 2HM2Q 2P1HA 1A1ZA 2GF5A 4A2WA 4JQWA 2KM6A 2YVIA 2IB1A 3J63A 4N1KA 3J6JA 2KN6A 2A9IA 1NGRA 2MS7A 3EZQA 2D96A 1D2ZB 1N3KA 4IZ5E 1YGOA 1PN5A 2MJMA 2F1SA 2DBHA 1DGNA 4I16A 4A2QA 2LS7A 4F44A 2MN4A 1UCPA 3MOPA 2MS8A 4E9MA 3CRDA 2L9MA 1WMGA 2O71A 4QOBA 4IZ7B 1A1WA 4JUPA 4O6XA 2DBDA 4EWIA 3MOPG 2YU0A 2DBGA 2N80A 2BBRA 1WXPA 1DDFA 2LWDA 2DBFA 4UZ0A 1CY5A 1E3YA 2VGQA 2OF5A 2NZ7A 4FH0A 2A5YB 4RHWE 3QF2A 4M9SA 1Z6TA 4DWNA 2L6AA 4P4HA 4D8OA 3EZQB 1D2ZA 2MB9A 4M9XA 3YGSC 2OF5H 3CL3A 4O9LA 1FADA 1E41A 3LQRA 4LWDA 4ZBWA 2B1WA 2DO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWE A;  4NQK A;  4M9Z A;  2BBZ A;  4O9F A;  2N00 A;  3YGS P;  4P4H I;  2N97 A;  4O7Q A;  1CWW A;  4F42 A;  1C15 A;  4RHW A;  4IZA B;  2NSN A;  3KAT A;  1ICH A;  2NAQ A;  2M5V A;  2MPC A;  3MOP K;  3LQQ A;  2YGS A;  4N1J A;  3T6P A;  2N83 A;  4N1L A;  2G7R A;  2N1F A;  2N7Z A;  1WH4 A;  2YQF A;  2HM2 Q;  2P1H A;  1A1Z A;  2GF5 A;  4A2W A;  4JQW A;  2KM6 A;  2YVI A;  2IB1 A;  3J63 A;  4N1K A;  3J6J A;  2KN6 A;  2A9I A;  1NGR A;  2MS7 A;  3EZQ A;  2D96 A;  1D2Z B;  1N3K A;  4IZ5 E;  1YGO A;  1PN5 A;  2F1S A;  2DBH A;  1DGN A;  4I16 A;  4A2Q A;  2LS7 A;  4F44 A;  2MN4 A;  1UCP A;  3MOP A;  2MS8 A;  4E9M A;  3CRD A;  2L9M A;  1WMG A;  2O71 A;  4QOB A;  4IZ7 B;  1A1W A;  4JUP A;  4O6X A;  2DBD A;  4EWI A;  3MOP G;  2YU0 A;  2DBG A;  2N80 A;  2BBR A;  1WXP A;  1DDF A;  2LWD A;  2DBF A;  4UZ0 A;  1CY5 A;  1E3Y A;  2VGQ A;  2OF5 A;  2NZ7 A;  4FH0 A;  2A5Y B;  4RHW E;  3QF2 A;  4M9S A;  1Z6T A;  4DWN A;  2L6A A;  4P4H A;  4D8O A;  3EZQ B;  1D2Z A;  2MB9 A;  4M9X A;  3YGS C;  2OF5 H;  3CL3 A;  4O9L A;  1FAD A;  1E41 A;  3LQR A;  4LWD A;  4ZBW A;  2B1W A;  2DO9 A; 
#chains in the Genus database with same CATH topology
 2LWE A;  4NQK A;  4M9Z A;  2BBZ A;  4O9F A;  2N00 A;  2XV9 A;  3YGS P;  4P4H I;  2N97 A;  4O7Q A;  1CWW A;  4F42 A;  1C15 A;  4RHW A;  4IZA B;  2NSN A;  3KAT A;  1ICH A;  2NAQ A;  2M5V A;  2MPC A;  3MOP K;  3LQQ A;  2YGS A;  4N1J A;  3T6P A;  2N83 A;  4N1L A;  2G7R A;  2N1F A;  2N7Z A;  1WH4 A;  2YQF A;  2HM2 Q;  2P1H A;  1A1Z A;  2GF5 A;  4A2W A;  4JQW A;  2KM6 A;  2YVI A;  2IB1 A;  3J63 A;  4N1K A;  3J6J A;  2KN6 A;  2A9I A;  1NGR A;  2MS7 A;  3EZQ A;  2D96 A;  1D2Z B;  1N3K A;  4IZ5 E;  1YGO A;  1PN5 A;  2MJM A;  2F1S A;  2DBH A;  1DGN A;  4I16 A;  4A2Q A;  2LS7 A;  4F44 A;  2MN4 A;  1UCP A;  3MOP A;  2MS8 A;  4E9M A;  3CRD A;  2L9M A;  1WMG A;  2O71 A;  4QOB A;  4IZ7 B;  1A1W A;  4JUP A;  4O6X A;  2DBD A;  4EWI A;  3MOP G;  2YU0 A;  2DBG A;  2N80 A;  2BBR A;  1WXP A;  1DDF A;  2LWD A;  2DBF A;  4UZ0 A;  1CY5 A;  1E3Y A;  2VGQ A;  2OF5 A;  2NZ7 A;  4FH0 A;  2A5Y B;  4RHW E;  3QF2 A;  4M9S A;  1Z6T A;  4DWN A;  2L6A A;  4P4H A;  4D8O A;  3EZQ B;  1D2Z A;  2MB9 A;  4M9X A;  3YGS C;  2OF5 H;  3CL3 A;  4O9L A;  1FAD A;  1E41 A;  3LQR A;  4LWD A;  4ZBW A;  2B1W A;  2DO9 A; 
#chains in the Genus database with same CATH homology
 2LWE A;  4NQK A;  4M9Z A;  2BBZ A;  4O9F A;  2N00 A;  2XV9 A;  3YGS P;  4P4H I;  2N97 A;  4O7Q A;  1CWW A;  4F42 A;  1C15 A;  4RHW A;  4IZA B;  2NSN A;  3KAT A;  1ICH A;  2NAQ A;  2M5V A;  2MPC A;  3MOP K;  3LQQ A;  2YGS A;  4N1J A;  3T6P A;  2N83 A;  4N1L A;  2G7R A;  2N1F A;  2N7Z A;  1WH4 A;  2YQF A;  2HM2 Q;  2P1H A;  1A1Z A;  2GF5 A;  4A2W A;  4JQW A;  2KM6 A;  2YVI A;  2IB1 A;  3J63 A;  4N1K A;  3J6J A;  2KN6 A;  2A9I A;  1NGR A;  2MS7 A;  3EZQ A;  2D96 A;  1D2Z B;  1N3K A;  4IZ5 E;  1YGO A;  1PN5 A;  2MJM A;  2F1S A;  2DBH A;  1DGN A;  4I16 A;  4A2Q A;  2LS7 A;  4F44 A;  2MN4 A;  1UCP A;  3MOP A;  2MS8 A;  4E9M A;  3CRD A;  2L9M A;  1WMG A;  2O71 A;  4QOB A;  4IZ7 B;  1A1W A;  4JUP A;  4O6X A;  2DBD A;  4EWI A;  3MOP G;  2YU0 A;  2DBG A;  2N80 A;  2BBR A;  1WXP A;  1DDF A;  2LWD A;  2DBF A;  4UZ0 A;  1CY5 A;  1E3Y A;  2VGQ A;  2OF5 A;  2NZ7 A;  4FH0 A;  2A5Y B;  4RHW E;  3QF2 A;  4M9S A;  1Z6T A;  4DWN A;  2L6A A;  4P4H A;  4D8O A;  3EZQ B;  1D2Z A;  2MB9 A;  4M9X A;  3YGS C;  2OF5 H;  3CL3 A;  4O9L A;  1FAD A;  1E41 A;  3LQR A;  4LWD A;  4ZBW A;  2B1W A;  2DO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...