4O7VA

Saicar synthetase (type-2) in complex with adp and udp/ump
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
b'KAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP and UDP/UMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 74
structure length 228
sequence length 228
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7vA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7vA02
2HXQA 2Y4PA 5L6OA 3EN5A 4X3FB 4KS8A 2BROA 4AWIA 4CVAA 2NRYA 2GTNA 3QXOA 1Y6AA 2OJGA 4AN2A 3VF9A 4FKQA 4LOPA 4ANBA 4DH8A 4ZSEA 5IH5A 3DBDA 3OT3A 3GCUA 3LKMA 4FSTA 4OTWA 5GINE 3ZC6A 3NS9A 3QRUA 3WILA 4HGTA 4FFLA 2YWPA 2EU9A 3C1XA 3DCVA 3FMKA 1CTPE 3SX9A 2ZDHA 1OKYA 2GNLA 2O8YA 4O0TA 3K5HA 5HI2A 4QQTA 2PZPA 5IG1A 2JDSA 4WBOA 3R8LA 4GH2A 3PY1A 3HA6A 3HNGA 5CSXA 1KJIA 3LFNA 3NNWA 5AX9A 1O6YA 1JDEA 1VR2A 2XP2A 4AFJA 3MSSA 1XBAA 4XG9A 5IUIA 3IK3A 2R3QA 1FGKA 1BNCA 5EQEA 3SOAA 3GIDA 3LXKA 3PDTA 1GZOA 3SE7A 4V04A 3ZRKA 3ZZEA 3HV7A 4KA3A 1ZMWA 2OKRA 4U3ZA 3UPZA 3TL8A 2JKKA 2XF0A 4NCTC 4NU1A 4RWKA 3WF6A 4NWMA 5ETIA 5HICA 3SVVA 1DV1A 3GLKA 4QMXA 2XEZA 2WFYA 3KULA 3FZPA 4FBXA 2BAQA 4YJTA 2G9XA 5FXRA 3R04A 4EH2A 4JL9A 4U42A 1PXJA 2OG8A 1Z2PX 1FVRA 2W1GA 4JBVA 4UX9A 1R39A 2FB9A 1Q5KA 2CNVA 2IVTA 3BEAA 4J99A 4BTKA 3EH9A 3R22A 2X2MA 3D5WA 3AD4A 3FZ1A 1K3AA 3VBWA 3PY3A 4KWPA 3C5IA 4EH6A 4HVDA 5CAPA 3B8RA 3CC6A 2VTHA 3F5UA 5D9HA 1DAWA 1ZYDA 4C59A 3FLQA 2W4KA 1U46A 2G2HA 2JKMA 5EYMA 4LM5A 3I81A 4GYGA 5CYIA 2GQSA 2JBPA 5AP5A 3VW6A 4S31A 4YLKA 4ZTLA 4MAMA 2XB7A 2WIPA 2YITA 4M67A 2I87A 2R9SA 3Q5IA 2R85A 3OP5A 4KNBA 5HIEA 4JT3A 1W93A 3Q6UA 3HO8A 5CALA 3FLYA 4IAIA 1CKPA 4O27B 2VO0A 3E93A 4ACGA 4EK4A 2ESMA 2BPMA 3E7VA 4O0WA 5J5SA 5DR2A 3DQXA 3IQ7A 4OTGA 2H6DA 4ZAUA 4HNUA 1U5RA 3EHAA 3IW8A 1LEZA 4F1TA 2O5KA 4IAAA 2WTDA 3DS6A 5L2WA 4FVQA 4J53A 3KMUA 5BVOA 1H07A 1O6LA 3FKNA 4FSNA 1Z2NX 4FTTA 3A7GA 3NAYA 3EOCA 3TDWA 1YXSA 4MBLA 2QOKA 4XP3A 5CNOA 4J1RA 5FUTA 3EWHA 4MCVA 5IQCA 1VYZA 2WMQA 4MH7A 2V22A 3MWUA 3SLSA 4HCUA 3VS5A 5HV6A 5FDXA 3V8WA 4C4HA 4Q2AA 2B0QA 1RE8A 2QOBA 3FC1X 3KFAA 3NUUA 5CAVA 4W8DA 3U6IA 5LMBA 3ZDUA 2JIUA 4UWYA 3QYZA 3AOXA 4Y85A 5BYZA 2OLCA 1PXLA 5IZFA 5IQIA 4RWLA 4A9RA 1SVHA 3KL8A 3LMHA 3T9TA 1XH5A 1APME 1XBBA 3LCDA 4O0XA 2ZDUA 2XJ1A 4ZJJA 3BYMA 2H96A 3FQHA 4FIJA 1CQJB 4EORA 4BCIA 4NL0A 4JOAA 1OL1A 4S2ZA 4O7SA 1Z5MA 2R4BA 3BHHA 2IWIA 2OBJA 4IWOA 2IZUA 2JEDA 5L6WL 5F94A 3U4UA 3UO5A 3JZIA 5HNBA 3EZVA 4N4SA 5EKNA 1P2AA 2W6PA 2XEYA 3FWQA 1GOLA 4E73A 1XH8A 2RF9A 3R9NA 2YZGA 1W84A 2PMIA 5EDPA 2C68A 1J1BA 1JKTA 2VWBA 4AW1A 1IRKA 2O64A 3FEGA 3VW8A 3M11A 2BDFA 2C6LA 4O7LA 2CHLA 5FEDA 3FXWA 2LAVA 5CEIA 3AC8A 3GI3A 1YHVA 4ORKA 2ITQA 4R1VA 4JJRA 4QMOA 1UKHA 4EG0A 4IHPA 3LIJA 3ETHA 1GJOA 3KRLA 3P86A 2R7KA 3PXRA 3KN5A 4ITIA 4F63A 4I4TF 4AT3A 3EZRA 2CPKE 4L1KA 3EFJA 4G31A 5M4CA 1L3RE 5DIAA 3PP1A 5KKNB 2XD4A 2ITWA 4B6LA 2JFLA 3DZQA 2WOUA 4XG4A 3FYKX 4XHKB 1E4EA 3F5GA 5E4HA 3C4XA 3HBLA 3D7ZA 4EK8A 2O2UA 2G1TA 4BGHA 4NUSA 4F4PA 5K5XA 2FSLX 1K9AA 3REPA 3PTGA 1CQIB 2IW8A 4HNFA 3RAKA 4MV6A 3Q96A 3P08A 4DBNA 3DJ6A 4R3RA 4ZI7F 3TKUA 4EH9A 1GNGA 4FSYA 2OXYA 3EQIA 4G16A 3ZEPA 3BHUA 5BMSA 1GGOA 2VTQA 2BFXA 4DEIA 4E4XA 3KEXA 5M07A 5HIBA 3HV6A 3BCEA 4IANA 2OSCA 2YERA 3MJFA 2ZMCA 2UZVA 3AT3A 1Q8YA 4YC3A 3VNTA 2XJ0A 4G5PA 3LFEA 4KBAA 3AXWA 3WZDA 4ME6A 3PLSA 2WTWA 5HVYA 5KBRA 2DYLA 5AP2A 3MY1A 3EQRA 4FV9A 3OY1A 3D4QA 2FPGB 2BZJA 4QP4A 3NDMA 1W82A 4WG5A 2A19B 5ICPA 3HMMA 1B6CB 3T3VA 2YDKA 2VWIA 3R1QA 4ZK5A 2IN6A 2BTSA 3BU6A 2R0UA 3LFDA 4TYEA 3FMNA 2XM8A 3R9HA 4IC8A 4X2GA 2YIQA 3LQ5A 3VS4A 3TIZA 5LVPA 2ITTA 3QUPA 4DG2E 4DT9A 4F9WA 4IZOA 1ZYSA 3KAKA 1YKRA 4HPTE 4PL4A 5CU3A 4QMNA 4EUTA 1U5QA 3KA0A 4EC9A 4ANLA 5EDRA 2VAGA 5CU4A 4EGQA 5CU0A 3QZHA 3FPQA 4AZWA 3BWJA 2WMBA 4DGMA 2YCRA 5I5ZA 4BR3A 4FSWA 4IX5A 4BTMA 2GU8A 3GNIB 3WF9A 4D1ZA 4EGJA 3DTWA 3NW6A 3UYSA 2QOFA 3IGOA 1CKIA 2BDJA 3TUBA 2W6ZA 3EJ1A 5FQDC 5JT2A 3QFVA 1ZYJA 2ETKA 1FGIA 2PMLX 1Q61A 2XCHA 4CQEA 3JRWA 2OWBA 3AG9A 2QHMA 4C3FA 2FGIA 2FSMX 3PG3A 1BMKA 2C69A 2YN8A 2YM5A 4JIAA 3RGFA 2UVYA 3DK3A 4DFNA 4ZTMA 1YXTA 4RWJA 1UU7A 2YDIA 3LFCA 2ZM1A 5E90A 4ITJA 2QR7A 4EK5A 2DWCA 5A46A 3VRZA 5HZNA 4FTIA 2CLQA 3ERKA 3MTLA 3NW5A 5C26A 2XUUA 1JDBB 1B39A 1BKXA 3OVVA 1YI4A 2WMWA 3E8NA 4L3LA 5KZ0A 3FZRA 1Q8UA 2ZVAA 3R5FA 4EUUA 3NWWA 4I20A 3W16A 4JDJA 3KF4A 4BI2A 4MBIA 4PP9A 3NIZA 4FV2A 4MNEB 4BBFA 4AOJA 2YCSA 4OLIA 4RSSA 5G6VA 4YJ2F 3IDBA 3AW8A 1Q8WA 4BRXA 4YJPA 1PHKA 4D55A 2QKWB 2AC3A 2YM4A 4G9CA 4Y8DA 5HO8A 4DH7A 1WFCA 3UIMA 3UO6A 4BDCA 2DZDA 2XKCA 2R3NA 4I5PA 2NUAB 2WHBA 3NZ0A 5JVDF 2Q83A 2C30A 3FKLA 5DR6A 3HP2A 4ZZMA 4E8AA 5E92A 3FI2A 3MPAA 4HCTA 2UZOA 1EHIA 4FZAB 2XKFA 3I12A 3PWYA 2YZNA 2H9VA 1YWRA 3MB6A 2R3KA 3MFRA 4YPDA 3D15A 4GIIA 3PJCA 3MVHA 2VO7A 3HAMA 3QRKA 4GU6A 4RLKA 3FAAA 2A4LA 3OHTA 5BYLA 1GZ8A 4S32A 5JH7F 4FT0A 5ETFA 4P90A 2VWVA 5FXSA 3KU2A 5E8WA 4RX5A 5CEOA 4FE2A 1H8FA 3HMOA 3D5UA 1STCE 3KVXA 4TYHA 1WMKA 5JQ8A 4IVDA 3CGFA 2CJMA 1AD5A 4GVJA 2I1MA 4IZ5A 3D2KA 3E5AA 1YRPA 3TZ8A 4M7IA 4E5BA 5H2UA 3RPVA 2WXVA 4S33A 5IQFA 4PX6A 4DFLA 3RAHA 2OXDA 3FLWA 1Y6BA 5IEXA 5IU2A 3NYOA 5A6OA 4CKRA 2ZV8A 4N70A 4U97A 5CVHA 4DBXA 2PUIA 4Q5HA 2J0IA 2ZB0A 3B8QA 4GFMA 4EHZA 5HD7A 1Q3DA 5JFXA 4WD5A 4EH8A 3FL4A 4X2KA 4BCJA 4EQUA 5I0BA 3BG5A 2RL5A 1VBGA 3QLGA 4L7SA 4FKWA 5CXZA 3CY3A 4XRLA 1GAGA 3N9XA 4NCTA 3K3PA 5DI1A 5JSMA 4NKSA 5J95A 5BUJA 4TPTA 5GHVA 3W2OA 5J2TF 2E9VA 3HLLA 4BZDA 4CFXA 2FPPB 4AAAA 2QG5A 3U9SA 5CEQA 2H34A 3FC2A 4I24A 5IUGA 4HGEA 2C6OA 4I92A 1CM8A 1T45A 4M69B 5J9YA 3U6HA 4YBZB 4K1BA 4QT1A 3ZLXA 1SZMA 3HRFA 4BDGA 2GLTA 2QF7A 2BZHB 4FFNA 5HX6A 3EL8A 5TT7A 3OBJA 3TN8A 1KJJA 3QC4A 3GC8A 2BAJA 5FEEA 3HV5A 4O4HF 3DQWA 3TV4A 1AUVA 4FOBA 1T36A 2RFNA 4O7ZA 5CENA 3ORMA 5FLFA 2Z7LA 2OI4X 1WVWA 5K3YA 2ERKA 2X8EA 4QTEA 4ZOGA 1UA2A 4C34A 1ZOEA 5M53A 5EDQA 3ORIA 4G6NA 3MWDA 4FTRA 4UY9A 3TG1A 4QP9A 4AGUA 2ZV7A 5CVFA 4FNWA 3UVRA 5I9WA 4LL5A 3BBTB 3PZHA 5AP0A 4NYEA 5F95A 3PY0A 2WMRA 2WMXA 3KY2A 1REKA 4PDOA 2GNIA 3G5DA 4O6EA 4Y46A 4AGWA 1Q41A 4QMWA 3TKIA 2IVSA 5JGBA 2HGSA 4JQEA 1WBPA 5E9EA 4UWBA 2W5BA 3FMDA 4C2WA 3G0EA 3VUDA 1ZMVA 2NU9B 5CLPA 4AFEA 5HG7A 4GUBA 2J5FA 3NRMA 5H9BA 2V5QA 4XCUA 3ZO1A 1FVVA 3K54A 3Q32A 3A7FA 3IOPA 4C4JA 5LVMA 2PK9A 4TNBA 5CANA 4TY1A 2B52A 1E9HA 5CTPA 3TNHA 4XG6A 1UNHA 1Q8TA 2PYWA 1YI3A 2X4ZA 3AC3A 5GJGA 4NK9A 3UFXB 3MVLA 4AT4A 1IAJA 1OUYA 4TV9F 3FXZA 1V1KA 2Y6MA 4A06A 2BKZA 5LYJF 3O8UA 4X6RA 2W1DA 4JLCA 5HE1A 3RPRA 5HEZA 4AOTA 2NO3A 4FT3A 3ZEWA 3R5HA 2BTRA 2J51A 4IB3A 1FMOE 4KIQA 3TACA 3TNIA 2VTNA 2PE0A 4GJ3A 2NRUA 3HZTA 4W4YA 3W2SA 5EYKA 4ZTNA 4IX3A 4FTUA 4L42A 3I5NA 1XH6A 5DFPA 3GVUA 3I4BA 4RLLA 3BLQA 2LGCA 5E8UA 4ZS0A 3VQHA 3R8MA 3VUMA 4O7VA 4M9UA 2CSNA 2YABA 1C3OA 1UU8A 4AW0A 2ZYBA 3OUKA 2J50A 4MXZA 4DTKA 5HBJA 3SW4A 4QP2A 3VF8A 3QCXA 4DGLC 4I6HA 5EI2A 4I94A 1HCLA 3LXPA 4FICA 4LGGA 5ANKA 1JKKA 3AC2A 3NUSA 4FZDB 3COHA 2VZ6A 3ID6C 3ZO2A 5AA8A 4DYMA 1B38A 4MAOA 4F99A 4N0SA 4FFOA 1GLVA 1U4DA 4Q9SA 1OIYA 5J2UF 2QG7A 3E3PA 2NP8A 1U59A 1MP8A 1J91A 4O91A 4BCOA 4Y95A 3Q2JA 2WQMA 4EOJA 4MD7E 5KMOA 4HYUA 1H1SA 1M7NA 3DBEA 3F7ZA 4JX3A 3DXPA 4FSZA 4AA4A 4F70A 4HYIA 1PXMA 5E91A 1G8SA 4HW7A 1KE8A 2Y8OA 5EQPA 2VTOA 4TWCA 3ZUTA 1J7UA 1XQZA 3ORPA 3OROA 4JQ8A 4BBMA 4LV8A 3SKCA 2UZDA 4ZY4A 4DLIA 4EH3A 4BVUA 4EZ7A 5AAGA 2YS6A 4HZSA 4C61A 3TZ7A 3WZKA 2QLUA 4JS8A 3ETJA 5C03A 5ANDA 4UEUA 1EZ1A 4FGBA 3M2WA 4O22A 4XX9A 3VBVA 3QKMA 3KB7A 5AP1A 4ZSLA 2W1FA 4DGGA 3OOMA 1J7IA 4EK3A 2C6EA 1M52A 3ZSHA 2RKUA 2R3LA 5LQFA 3MPTA 4H1MA 4RA4A 5C8MA 4L01A 3VUIA 3P1AA 4W4WA 1BUHA 5JK3A 5ITAA 3NVKI 1YW2A 3DB6A 2QONA 2F49A 4E4LA 5K4JA 3TIYA 5DHJA 1OGUA 5A4LA 1DS5A 2PUPA 3VJOA 1AGWA 2UUEA 2QKRA 4JAJA 3EQFA 2XIXA 5JFSA 3QTSA 2RGPA 5EYDA 5D11A 2JC6A 2B4SB 1OIUA 2VWZA 4HOKA 2C6MA 4E4NA 3K5UA 4LRKA 2C3LA 2DWBA 3FMLA 4F7JA 4YUQA 5FDPA 2WU7A 3DBCA 3UO4A 4ZQIA 3F3TA 4CV9A 3HV4A 1ND4A 2QOIA 3ODZX 4R7BA 2B9JA 5AP4A 5H8BA 1CE8A 4GFGA 4BI1A 3P7CA 5BMVF 3VN9A 2GHMA 3FI3A 3RMFA 5E8TA 3GU5A 3BYVA 4H3BA 4XOYA 3UMXA 4FKUA 2X6DA 1EYZA 4PP7A 3QTQA 4ZOLF 2C5XA 4BDEA 2OIBA 3ORRA 5FGKA 2E9NA 3PE1A 4ACHA 4CCBA 3QTXA 4ZSJA 4A9SA 2GHGA 4OUCA 4MYGA 4FSRA 2R82A 4IM3A 4IB0A 2R3JA 2BIYA 4BCFA 3FUPA 3F3VA 2FUMA 2ONLC 3PVWA 5EQYA 4D28A 3QX2A 2J7TA 3Q4TA 2P2HA 3PXKA 4TW9A 4HGLA 2WTKC 4H39A 2UVXA 3Q6WA 4C58A 5C4KA 3DU8A 4H1JA 4YBJA 2I6LA 4G1WA 3CKXA 2HXLA 4AACA 3MH2A 4ZY5A 3CTQA 2ZM3A 5HD4A 2VX1A 3QTIA 3C51A 3BRBA 4FKVA 2VTIA 4IBMA 4XYMB 3CTJA 3NIEA 4ZSGA 4E93A 3DXQA 3VMMA 2YWVA 3CPBA 3FYJX 3ZHPC 5CY3A 4RBLA 3L1SA 3VS7A 5C8YF 1A9UA 3ATSA 2EB3A 3C4CA 2OLSA 2Z2WA 3KXGA 3BGPA 2ACXA 3GQIA 3OT8A 4IM2A 4TWPA 4O96A 5CEMA 5KMIA 5M44A 2JDVA 1M17A 2WMUA 4L8MA 3ZM9A 3ZYAA 2J0KA 3F66A 4IB5A 2XKDA 4J8NA 3V3VA 1CKJA 4D4YA 2QLQA 4BDKA 3OEFX 2PVPA 3VVHA 1XH9A 3ORXA 1H28A 5FD2A 2R3FA 3MBLA 2BKKA 2YIYA 3F69A 5A6NA 3OCBA 5KKRC 2FVDA 1WBSA 3TM0A 3OFMA 2Y6OA 2HWOA 2VU3A 4XG3A 4LQMA 3MPMA 4M3QA 5JRSA 4A07A 4ZMEA 5H8GA 4X2NA 5HG5A 4YGAA 3TI1A 4CFUA 4NH1A 4IB1A 2AYPA 4FZ7A 3LCKA 3LMIA 5CF4A 5GIOE 1JWHA 3ZFXA 4A4OA 4AZEA 4YJOA 3DKCA 3D2IA 4RG0A 5C1QB 4ALVA 4ITHA 5JZNA 4WA9A 4ANSA 1IOWA 3TNPC 4L6QA 4U43A 5HLNA 4UALA 3PRIA 4FNXA 3T9IA 5DN3A 4ONAA 5M4IA 3E3BX 1H1QA 2HW6A 4JG6A 3ORNA 4NM7A 1DI9A 5JKGA 3UNKA 1EUCB 3GT8A 2GHLA 3O17A 2ITZA 3H10A 4X2JA 3Q4UA 1KE6A 5DG5A 4GVAA 5ACBC 3ZSGA 2OJIA 4G5JA 4D5HA 1M2QA 3CQEA 3P4KA 4FKIA 3MA3A 3QX4A 3SDJA 4AZFA 3R02A 4XG8A 4EOIA 4QOXA 1V0PA 2HY81 3IDPA 3V04A 1CS0A 3WZJA 2WQNA 3RI1A 3GBZA 3KC3A 1G3NA 2YZLA 3ZONA 2PVKA 5M57A 5LWMA 4O4IF 1MQ4A 4FYOA 4C3PA 1OKZA 5AFVA 2FH9A 5IDPA 2WTCA 3EQGA 3HKOA 4DF3A 5HTBA 1YOMA 2C3JA 1O9UA 5EG3A 4JI9A 2VTAA 3PXFA 4KRDA 5GJFA 4RFMA 3UVPA 4AU8A 4NT4A 1H26A 5AEPA 2OIQA 3SG8A 2JDRA 1UVRA 3Q60A 4D2RA 4YJ3F 3BU3A 1KE5A 3OEZA 4IDVA 4K9YA 3WIKA 5M4UA 5JRQA 1JLLB 4AP7A 4Z55A 4EJ7A 4A7CA 5HHWA 1MRVA 2XRWA 2Y0AA 5GNKA 5HVJA 1I7NA 2J2IB 3R00A 4K18A 3F61A 4YO4A 5AP6A 2YCFA 3IG7A 4C4FA 4C7TA 3CY2A 3ELJA 4O2ZA 3SG9A 4AE6A 5CF8A 4ANQA 5DEYA 5A54A 2W06A 3DPKA 4PDSA 4WNKA 1YI6A 4S30A 2R84A 3K5IA 2YAAA 4QMMA 4PDYA 1BL6A 4B0GA 3HDNA 5F9EA 2W99B 1YDSE 3I7CA 4NW6A 3WO1A 5BNJA 4FTJA 4ZTQA 4ZZOA 4I5MA 4II5A 3H4JA 4Q5EA 4U79A 4ERWA 4KS7A 1JOWB 1KJ9A 3E63A 4PWNA 5E8YA 1JKSA 4FC0A 3IO7A 5IF1A 4Y72A 5C4LA 4CTBA 5J87A 4QP3A 2R3GA 2UZBA 5H8EA 4GJ2A 5BPHA 2XNBA 3FZOA 3MI9A 1KE9A 3R8UA 2ZDTA 1NA7A 3PJ3A 4FTMA 2NPQA 4EL9A 4EOLA 2I8CA 4FV1A 3NUAA 2W4OA 3OWPA 4YAJB 5DT0A 4QYHA 4WNOA 2OH4A 4AX8A 4DG3E 2PVHA 3EFWA 4MF1A 1QPCA 4AGDA 4QTAA 2C5YA 3MVJA 2XK4A 4FTAA 4O86A 4P5ZA 2PUNA 4RIYB 5CQUA 5AX3A 4EEVA 1BX6A 1OL6A 4D4RA 3LPBA 5EHYA 3ENHA 3V8SA 1NT2A 3OUNB 4RVLA 3AD5A 3F3WA 4JRNA 2R3HA 3LLAA 3OCSA 3MESA 4G6LA 3UNJA 1PMNA 1XWSA 5HCZA 5IQHA 4XX0B 3QD4A 4MXYA 5IMEA 2PU8A 5KBQA 3LXLA 5J1WA 3ULIA 2C6DA 2QHNA 4MNEA 2WU6A 4G3EA 3R7UA 2C1BA 2W9ZB 3A8XA 2RG6A 2GNGA 2O65A 4LI5A 3PFQA 3QYWA 5AM6A 3NCZA 5IA5A 4E5WA 4JDKA 3R8VA 2VWYA 3O51A 1FVTA 4HCVA 3RVGA 3VJNA 4EC8A 3JVSA 4K77A 4HYSA 3BE2A 3BQRA 4NM3A 4QMSA 1H1WA 2WMVA 3MVMA 4QP7A 3BGQA 4YTHA 2QR8A 5DRBA 5ANJA 3TT0A 2NU6B 2P2IA 3MGYA 3PP0A 3QTZA 3FZTA 4FKRA 3BI6A 4LYNA 4FGRA 4WG4A 2O63A 3R7VA 3MFTA 2IVVA 4NW5A 4EOMA 3VS6A 4CG9A 1Q4LA 2BDWA 3POZA 4J52A 4XS2A 3KRWA 2PZIA 3W55A 5ANIA 4BDJA 1W98A 2CGWA 3MJ2A 5B0XA 4CFWA 2JDOA 3RKBA 2E9UA 5FTGA 2CKQA 2BRBA 3HUBA 4AQCA 5IUHA 1B6RA 1W96A 1JPAA 1X8BA 2OGVA 3RK9A 4AT5A 2BRNA 5FM2A 2AC5A 2EXMA 3AC4A 2XIRA 2QNJA 2BRGA 4QMQA 4G3GA 4ACCA 1IA9A 4K0YA 5HESA 4RX8A 4ZXTA 3LFQA 3UYTA 4IADA 5AUTA 2QODA 3A7JA 4F09A 2YZAA 3FZSA 5LVOA 4YTIA 5A4QA 4IZ7A 3OG7A 3HMIA 4HVIA 4IMYA 5HU9A 1GIHA 3G9LX 4FSMA 3ALOA 4QQJA 4CRSA 4JQ7A 4FKLA 3HL7A 3L8XA 1OKVA 4K11A 4BCNA 4DCAA 3V4ZA 3G8DA 3MYGA 2O3PA 3DKGA 3AMBA 1A06A 3HRCA 5JQGF 4ZSAA 3QCQA 4QNYA 4F1OA 2E2BA 4YJRA 2CKOA 1OPJA 5FTOA 3ZH8A 4FG9A 2XNGA 4DHFA 3HAVA 2PTKA 4FTOA 2G2IA 2XNNA 4B7TA 2HZ0A 2J5EA 4EOQA 3COMA 3FLSA 3GOPA 5JEBA 2I80A 4MV3A 2UZEA 4D4SA 1LUFA 3R2YA 4IC7A 4CT2A 3S00A 1JSTA 5KHXA 1WAKA 4C4EA 4O81A 4MA5A 4H05A 3GC9A 4OT6A 1KOAA 4CMOA 3MH1A 1ZMUA 3H30A 3I7BA 3R1SA 2OJJA 3R6XA 3DLSA 1JSUA 3MY0A 4FOCA 4UXQA 3V5WA 3ZO4A 1OBDA 1AUXA 1JKJB 5IYZF 2YM6A 2GS2A 4FKSA 4G3FA 3U9CA 1OKWA 3SHEA 5DT3A 4WO5A 2JITA 5AUVA 5HTCA 4ZHQF 3OWKA 1TKIA 3VBQA 4YZNA 4ASZA 3PJ2A 2PMNX 2XH5A 4FKJA 2WYOA 4P7EA 3VS0A 3R63A 1WBNA 3DK6A 1YXVA 2O0UA 3HRBA 4EONA 1UV5A 4IWDA 2PE2A 3GOKA 5F20A 2JD5A 3UC3A 5I9YA 4F0FA 4ALUA 3R2BA 4FUYA 4UB7A 5L6PA 4FFRA 4O4LF 5J7HA 4IFGA 4WIHA 5HKMA 4AZTA 4O7WA 4BDBA 1DI8A 5AV0A 5CF5A 4KUJA 3MV5A 3C4EA 1BXRA 3FJQE 1FOTA 3GC7A 5DR9A 3K2LA 1H27A 2QU5A 5G1XA 4M15A 3G2FA 2ONLA 3GU6A 4KIOA 4X21A 4JBQA 4U3YA 3R7OA 3TV6A 4D58A 3C4ZA 3JY9A 5CI7A 1E1XA 2HAKA 2PZYA 3MA6A 5CZIA 1YXXA 4CMUA 4U0IA 5HQ0A 4BTFA 4DEAA 2VQDA 1A9XA 4RX9A 5L8KA 3HV3A 1MUOA 1Z57A 3WYXA 4RC2A 4QMPA 3AC5A 4IAKA 1ZY5A 4YZCA 4GRBA 1RJBA 5HCYA 3CS9A 5AV1A 3OY3A 3BIZA 3I6UA 4TYGA 3LQ3A 2F7EE 2X8DA 2Z60A 3UZRA 3EQHA 1IG1A 4LRJA 2YRXA 4J7BA 1NXKA 4AA0A 2RFSA 5CASA 2VPQA 2ITNA 4EOPA 3DGKA 1H08A 3RPYA 3A4PA 4E1ZA 3AX6A 1PMEA 3TNQB 3I1AA 4FIFA 2F2CB 3MH3A 2OICA 4HNIA 4TNDA 4XBUA 2W6OA 3C0IA 3NW7A 4NFNA 4JG8A 4AN3A 4BTJA 3TUDA 1MRUA 4I1ZA 4JAIA 3V6SA 2UW5A 3QQHA 4I6FA 4YLLA 4C35A 4RQVA 3QF9A 4L43A 1Y8GA 4X6QC 5LCKA 5TO8A 4BCPA 3PG1A 4RIWA 4WOVA 3LWBA 1ZLTA 3E62A 1ZRZA 2Q0BA 5DH3A 3PSDA 4GT3A 4HNTA 3RPSA 4FZFB 4MXCA 2GMXA 3CSVA 4BDHA 3P78A 2ZOQA 3RINA 4F7LA 4TYIA 4DLKA 5CA1F 2GS7A 4PMSA 4G34A 2QOCA 3FHIA 3Q53A 5KNJA 2V7OA 5CSVA 1LPUA 3DAKA 3OCGA 3TTIA 4OTRA 2KTYA 3G51A 4K6ZA 4RJ4A 1YHWA 4KBKA 5AV3A 3WI6A 3Q1KA 2HZIA 3F2RA 4TRLA 3ZFMA 1CDKA 4M14A 3GENA 4L7FA 3I0QA 3QUEA 1OIRA 2BALA 2BUJA 4JIKA 5AIRA 4YJUA 2VTTA 4MXAA 3VPBA 4FYNA 3R28A 5KX5F 4BC6A 4Z3VA 2R3OA 2HCKA 3CD8A 3D14A 3QZIA 3FXXA 4YNOA 1SCUB 2VTMA 4FIHA 4Z16A 2XK9A 1BI8A 3EQCA 4OGRA 3IONA 4FODA 4WUNA 2IVUA 3TINA 2YM7A 2XNMA 3GFEA 2WGJA 3HA8A 4JBPA 4EH5A 4MD9E 4TYJA 3K3JA 5CEKA 2HY0A 5TF9A 4DFZE 4KKHA 4QYGA 2Q0NA 2X6EA 3PPKA 3LAUA 4E6QA 3QRJA 3PPZA 4FEUA 3E5NA 1JNKA 4BCGA 1I44A 3RV4A 3UP7A 4XOZA 3VWAA 3QLFA 4UV0A 5HG9A 1M0TA 5C1PA 4AW5A 3RM6A 4N6ZA 5CB4F 5EM7A 3E88A 2IW9A 4BDFA 4L44A 1PXOA 3CPCA 3IW4A 4RJ6A 5BVFA 5EW8A 3CQWA 3DB8A 3UQFA 1URWA 2XJ2A 2VX3A 1ERKA 3EN6A 2VWXA 4FT7A 4TUYF 2HWPA 1PW2A 1VBHA 5BVDA 3F5PA 4O82A 1P14A 1OL2A 3EFLA 3WNZA 4Z9LA 4FV5A 2ZJWA 4QQCA 3JXWA 1A48A 2YDJA 5CNNA 3DFAA 2JIVA 5DLSA 2R5TA 1GSHA 3IW7A 2GSFA 3W2CA 3G6HA 4AG8A 1XH4A 4OBOA 3A2CA 4RJ8A 1ZZLA 5A14A 2YAKA 5BVKA 2CGUA 4AS0A 4FV6A 4JXFA 4HVHA 2WQOA 5M4FA 3UODA 2CN8A 1Y91A 4A9UA 1OMWA 1WVXA 1NVQA 4K33A 4EBWA 3QD3A 2PE1A 5HGIA 1JAMA 3QAME 2CDZA 2WTIA 5IEVA 4EHGA 2CZGA 2FB8A 3LLTA 2C3IB 2X7GA 4TTHB 2SCUB 4I4EA 3C0GA 4ZLZA 3NNUA 4QTDA 4MQ2A 4EZ3A 2C0TA 1H0WA 2QO9A 2QOOA 4N6YA 3GXLA 3JPVA 4XBRA 4E20A 4GK2A 4Z7HA 3OZ6A 4UXLA 2VRXA 3RAIA 1QCFA 3F3ZA 2X81A 2GPSA 2ETMA 4BICA 3G9NA 2WTVA 4YO6A 3BV3A 3H9OA 2I7QA 2JGZA 3FE3A 2XCKA 3R83A 3FMMA 4YHJA 3JVRA 4MHAA 3KALA 2P3GX 3KRJA 4QO9A 4AOIA 3DJ5A 4I93A 4QMZA 4PRJA 2YIXA 1Q62A 4EWQA 3ATTA 2OW3A 3FMEA 5IQBA 2W71A 4M0YA 4L46A 3UVQA 4M8TA 3V51A 4CNHA 3UZTA 4YMJA 3UTOA 3HECA 2X9EA 5CT0A 1L8TA 2ETRA 2WD1A 4ZLYA 3CXWA 1P4OA 5IMXA 4FIIA 2VTPA 2UW0A 3Q9ZA 3R01A 4JNWA 4DINA 2WQBA 4XP2A 2YRWA 4MKCA 4YNEA 4J71A 5C27A 3MJ1A 5EK7A 4CV8A 3NX8A 3FBVA 4U44A 4FK3A 4EBVA 5AA9A 3OTVA 5IA0A 3UOJA 3GP0A 4GUEA 5DEWA 4D2SA 5CAOA 3RWQA 2X0SA 2UZNA 3HP5A 3N51A 2WTKB 5FEQA 1H24A 2BHHA 2HOGA 2W5AA 4M68A 5DT4A 1SM2A 2CLXA 3JYAA 1KV2A 4O7TA 4XG7A 4AE9A 3CTHA 2ITVA 3FI8A 4EQCA 3W1FA 3BV2A 1UU9A 3PVBA 4RC4A 4DTAA 4FR4A 2R7MA 1KE7A 4DGOA 3SXSA 4QRCA 2OF2A 1PKDA 3Q9WA 3PJ8A 3ZBXA 3AC1A 4G3DA 1BYGA 1H1PA 4EH7A 4IACA 1WBVA 3HVCA 2I0EA 5DPVA 3BE9A 4O4JF 4L00A 4E6DA 4F1MA 1FMKA 3H9RA 3DT1A 4J95A 4DIMA 5HE3A 3BEGA 4KRCA 4R5SA 4A4XA 1KWPA 2PVYA 3DLZA 3NGAA 3PIZA 4MV8A 5EI6A 5CI6A 3S3IA 2BFYA 1IA8A 4IAZA 4BCQA 5KMMA 4HR7A 5EKOA 3PVUA 3TZMA 4R3CA 1WZYA 2PBZA 3OS3A 3T3UA 5AUXA 3KREA 3DOGA 3IGGA 4I21A 5FBOA 3R9RA 3VUHA 2I0HA 3A99A 4BDDA 1E1VA 2BHEA 2GTMA 2VTSA 5HIDA 5FP6A 3VS3A 5KKRB 3L9NA 1GZNA 3UBDA 4HQ6A 3I0OA 3H0ZA 3LJ2A 5K4IA 2C47A 2AUHA 3E8EA 2REIA 4U9AA 2ZDQA 4RIWB 1OB3A 5A4TA 4A4LA 3LFFA 3PXZA 3FDNA 3Q9XA 4QP8A 1MQBA 4XEYA 3MTFA 3ZZWA 4P2KA 4HGSA 2GDOA 2QU6A 5JFWA 2B1PA 4Y8VB 5BVEA 3KRRA 1HOWA 4R1YA 5ETCA 2QQ7A 3WYYA 1TQMA 5A3XA 4BI0A 3O8TA 4R6VA 2VO6A 5CWZA 1WVYA 5AIKA 3ZCLA 4XZ3B 2BMCA 5F1ZA 3NAXA 3R8PA 4YURA 2VX0A 4FTKA 4IWPA 5FTQA 3CD3A 1WBOA 3R1YA 5F4NA 5C8NA 4FTNA 4PTCA 2OFVA 2HYYA 4O0UA 1YQJA 2R3PA 2PVRA 3ORLA 3DK7A 3RK5A 1OITA 3NMUF 2W1EA 4D0XA 2RIOA 4FEWA 3E87A 2BR1A 5TOZA 3ZXTA 4F6SA 5E1EA 3R7YA 2W6MA 2KULA 2Y9QA 2YIWA 3F88A 5CAUA 4PTEA 4P4CA 1OL5A 4QYFA 4G3CA 3E64A 2B9HA 4DT8A 1H4LA 1XHAA 2J6MA 4DEDA 2W0JA 4C38A 1G8AA 4RQKA 5T68A 3O7LB 4MNFA 4HYHA 3GCQA 5LP6F 1FPUA 4RZWA 4G6OA 5LMAA 3AD6A 5B2MA 4BB4A 5HLWA 3LM5A 3ITZA 4FA2A 4FNYA 1ZYCA 2J9MA 4FTLA 4KIPA 2VTRA 5JVLA 4WT6A 4RMZA 4PV0A 4EQMA 3NUXA 5BUEA 4XYFA 3SV0A 5IISA 2W1IA 2ITYA 5LWNA 3D94A 4DFXE 2R86A 2ITXA 1YVJA 4Z7GA 2JKQA 3AMYA 4M0ZA 4QP6A 4U41A 2WIHA 4NJ3A 4RIYA 4ZJVA 2VN9A 4YHTA 3ZRMA 4OTDA 1TQIA 3S2PA 2XVDA 4LV5A 4XUFA 3A4OX 1O6KA 1DM2A 2F7ZE 1GIIA 2BRHA 2X39A 3FL5A 4L45A 5KMKA 4OW8A 2Z8CA 4RZQA 2FYSA 1PXIA 2WAJA 1IOVA 3DTCA 4I6QA 4YZDA 4EZ5A 4FUXA 2XS0A 3UG2A 3RNIA 4FEXA 3Q04A 3ANQA 4G17A 3DKFA 4J97A 5I9XA 3D7TA 3GCPA 3U9TA 4AUAA 3EFKA 3O7LD 4S34A 5C01A 4E4TA 5CF6A 4HVGA 5EM8A 1T46A 3BYUA 3D9VA 3O0GA 4ENYA 1J7LA 3AT2A 5A4CA 3BBWA 3LW0A 4FV4A 5CAEB 2B9IA 4OTHA 5HU3A 3VIDA 3IDCA 5LARA 2PZRA 3BHYA 3ZMMA 2C5OA 4PL3A 3N8DA 1J3HA 3GCVA 4DEBA 3ETAA 4NZWB 4CMTA 4IVCA 4NTTA 1PRYA 5AAFA 2C0IA 4DH3A 3LXNA 3QA8A 2JAMA 1XJDA 2WNTA 3LJ0A 1S9IA 3S0OA 4BDAA 1PMUA 3SGCA 3AMAA 2R87A 4BY9E 2VGOA 1SMHA 1WCCA 2WTJA 5I9UA 4MA0A 5LMKC 3C4FA 3RAWA 1JSVA 5JFVA 4YP8A 3KVWA 2W1ZA 3NYVA 5AP3A 4CTCA 3UDBA 1UKIA 3UC4A 3VPCA 4UYAA 1XBCA 4F08A 5EH0A 4XV9A 5EFQA 4F64A 3PUPA 4L67A 1PX2A 3RPOA 2B53A 1J1CA 2ZM4A 3VOTA 3D5VA 3U55A 1LR4A 4FEVA 4FKGA 4JR3A 3ZOSA 1PXPA 3FV8A 4E5AX 1ZZ2A 2HW7A 4FX3A 3KCKA 4EHEA 3KMWA 3NYNA 4F9BA 3TIIA 1U54A 4CEGA 3R5XA 3TV7A 3WF5A 1Y57A 3PRFA 3KXMA 1M0WA 5CAQA 3W33A 4KBCA 4QMVA 1H25A 4I55F 3MIAA 3LM0A 2XA4A 4EYJA 2ITPA 3P7BA 3TTJA 4RPVA 3D5XA 4IH8A 3UOKA 5BVWA 1PK8A 2V62A 3VS1A 3EIDA 4U8ZA 2EVAA 3TIGA 5CQWA 2F2UA 2UV2A 3W2PA 3KKVA 2WB8A 3HEGA 1NVSA 3OD6X 1Z9XA 2W1HA 2IG7A 4FV8A 5JGDA 3B2TA 2G15A 2YFXA 2J0JA 4QMYA 1EUDB 4DITA 1PKGA 4D0WA 3W18A 5CT7A 5E8ZA 3LJ1A 2ZV2A 4I4FA 4X3JA 5JGAA 3RUPA 3JRXA 2XNEA 1KUTA 3AGLA 3TJDA 2VWWA 1OM1A 5D10A 2C4GA 4CZTA 4HZRA 4DGNA 3DBFA 5EZYF 1YDRE 1PJKA 2JIIA 3O96A 1Q24A 3ODYX 4JRVA 2QURA 3KN6A 4U7ZA 3KRXA 1CMKE 4GYIA 4MK0A 5EM6A 3TEIA 3UOHA 4AXAA 4C37A 3U6JA 2W70A 2YCQA 4FKPA 3SRVA 2BZKB 3KXNA 5CX9A 3UMWA 3PYYA 4O7YA 1GZKA 4KSQA 3EQDA 4E26A 2G2FA 2YW2A 3JUHA 4V0GA 4USEA 2XMYA 4YJVA 2F4JA 3EN9A 4WNMA 2XNOA 3P7AA 2YJRA 3CQUA 3V5PA 4RA5A 3TUCA 5KMJA 1QPDA 1W7HA 3MFUA 2JDTA 2OZOA 5HBHA 4EKKA 2XIYA 4FSUA 5A9UA 5LVNA 1OUKA 3IPHA 3F5XA 3GU4A 4GL9A 5D7AA 3OCTA 3PXQA 4Y5QA 3UQGA 4CFFA 5AJQA 3OBGA 2Z7RA 3IKAA 4FSQA 4M13A 4K8AA 5IPJA 4RWIA 1KBLA 3PSBA 5H80A 5DBXA 3S4QA 3GGFA 2PWLA 2VV9A 4GK3A 3I6WA 4RJ3A 4ZTHA 4G9RA 4QTCA 3CLYA 3NVMB 1KJ8A 2CGXA 4YSMA 2XCLA 2P0CA 4R77A 4YBKA 4L3JA 4TWNA 2GPHA 1C30A 4IDTA 2OO8X 4GMYA 4IWQA 5BQ0A 5KO1A 2WZJA 3QQKA 4YZ9A 5J9ZA 4H36A 5AADA 2PUUA 4M84A 3WZEA 4H3QA 3R1NA 3F3UA 4O0YA 3MY5A 5GJDA 5AAEA 3A8WA 3PLAE 5BMMA 3P5KA 1M7QA 3N4TA 3QTWA 4LMUA 2EWAA 2JFMA 3QFFA 5E8VA 3GCSA 3GFWA 3P9JA 1ZY4A 1QPEA 3MW1A 3LP8A 2Z7QA 3ET7A 3VRYA 5IDNA 5LXMA 2OZAB 1VEBA 3IOKA 3ZFYA 2HIWA 3Q2MA 4NM5A 5JH6A 3S95A 5LVLA 4MEDA 2UW3A 2ZAZA 3CBLA 1JBPE 2C5NA 3BKBA 3HMNA 3OMVA 5AUYA 5KE0A 2JAVA 4LGHA 3MS9A 3ULZA 3FHRA 3Q5ZA 5L8LA 5C1OA 1XH7A 3EL7A 3R9OA 4ENXA 1PYEA 5CXHA 4BYIA 3VA7A 1PMVA 2QCSA 3IECA 4IZYA 3BGZA 1JQHA 3BLHA 3G90X 4MXXA 4PQNA 5FM3A 4RVMA 4FEQA 4LUDA 5AWMA 1UWJA 4EK6A 3NUNA 3VHEA 3NEWA 3JR1A 5L8JA 5HVKA 3ZO3A 5M09A 2Z04A 3DNDA 4R7IA 4FL3A 4APCA 3D7TB 4C0TA 3DV3A 4BCKA 4RGJA 4B99A 4CCUA 5J1VA 2X1NA 4FL1A 4DFUA 2J9GA 3P79A 4GFOA 3QQGA 4C33A 5CSPA 4FMQA 4ACMA 3QUDA 3R23A 1VJYA 2R3IA 2R2PA 3A62A 3FQEA 4HJOA 4GG5A 1UWHA 4JVGA 5LA6F 2IW6A 2YIRA 4DTBA 3C0HA 1RQQA 4F6WA 2C0OA 2IPXA 2QD9A 3Q4ZA 3ZM4A 3FLNC 4TV8F 2HENA 1I09A 5C9CA 3WE8A 5AV4A 4GKIA 4QPAA 3OF0A 4O83A 5I9ZA 4KSPA 2XK7A 1W0XC 4F7SA 3SOCA 3N6RA 1UNLA 2PSQA 2XKEA 1ZARA 2PULA 3NNVA 4FK6A 3NR9A 3PSCA 1UU3A 3ZBFA 4MV4A 4C2VA 1R0PA 5CZHA 4NJDA 1GSAA 3BLRA 2PY3A 3UJGA 4MV7A 3UIUA 4XJ0A 3NCGA 4YHFA 3V5JA 5JQWA 4U45A 3F7WA 4B9DA 5HO7A 3JZFA 5LOVF 1IR3A 2Z7SA 3R71A 5HNIX 3OTUA 4MVFA 4ARKA 5M56A 4I41A 3KQ7A 1V0BA 3E92A 2WMTA 4GK4A 3HGKA 3TWJA 2GNFA 2I0YA 4O38A 1U54B 3FY2A 4AF3A 5JZJA 4YAKB 5JN2A 2UW9A 5CSWA 3K3IA 4C4GA 2XIKA 5DYJA 4W4XA 4FIEA 4W8EA 2UZUE 2IZTA 3QQJA 4RIXA 5HNGA 2VNWA 3PXYA 2RG5A 4BBEA 5LJJA 1QL6A 1YDTE 2UW7A 1QMZA 2R3MA 2X2LA 4C5AA 4YTFA 3BYOA 5IA4A 1DIKA 3OXZA 3WIGA 2DUVA 5B2KA 5CVGA 5EYCA 2R7IA 4OT5A 2QVSE 5I4NA 4PMPA 1OZ1A 3VBYA 1KJQA 4FVPA 5CU6A 2YL2A 3O23A 3RHKA 4XMOA 4AZVA 3QTUA 4O2AF 3NUYA 3IW6A 4FL2A 4FT9A 4RVTA 4E6CA 1YXUA 4FZ6A 4M97A 5DGZA 2QC6A 3WARA 1M6VA 2UZWE 2Y4IC 5DWRA 2BZIB 2V58A 3BELA 3RALA 2OH0E 2CCIA 1ATPE 3POOA 2XNPA 3N4UA 2RFEA 4D9TA 4R3PA 4X3FC 3VULA 4CT1A 1NY3A 1GIJA 3L8SA 3SRVB 4DE4A 3LE6A 2IP4A 3KF7A 1WBWA 1F3MC 3C13A 4EYMA 5EM5A 5KMNA 3ACKA 5IQAA 2XIZA 3QHRA 3LHJA 1PYXA 3SXRA 2GNJA 3QQUA 4IX4A 3ZSIA 4FV0A 4YU2A 4V0GB 2EXCX 5IQEA 4I5CA 3G15A 3EYGA 3NUPA 4RRVA 4C5BA 4CLJA 3QGWA 2R7BA 2YEXA 4B4LA 4UN0C 4JR7A 5FNVF 3RM7A 4K2RA 5CS6A 2C3KA 3PA5A 2DS1A 3VUKA 2E9OA 2R0IA 5EOBA 2DQ7X 4V01A 1ZOHA 2R7LA 4DFYA 2HK5A 1OI9A 4DA5A 5K9IA 3WF7A 3V01A 1YOJA 3IS5A 2B55A 3ORQA 2HZ4A 2SRCA 3PA3A 4LUEA 3RJCA 1OL7A 3ZRLA 3DXNA 4BHZA 5LMKA 3FLZA 2QOLA 2W05A 1I7LA 2GPWA 3QL8A 3CEKA 1OBGA 4JDIA 3B2WA 3TCPA 2DIKA 4HNVA 1REJA 2X7OA 4LMNA 3L8PA 3ZS5A 4FKOA 1TQPA 3PIYA 4IVBA 2ZDGA 3CR0A 3CCNA 3PPJA 4CKIA 3FSFA 4BYJA 4NFMA 3L9PA 5JQ5A 4IQ6A 3H0YA 4D9UA 5AUUA 4EOOA 1Z2OX 2QI8A 4TWOA 4DLJA 4IM0A 3W2QA 3CJGA 4QMUA 3UNZA 3IW5A 4R7HA 3V8TA 4EWHA 1V0OA 4I6BA 4WRSA 1MRYA 1S9JA 4XYLB 3UG1A 5IH6A 3LZBA 3UGCA 4PMMA 3BHTA 4XG2A 4MWIA 3KXZA 3ROYA 2FSTX 3E8CA 1SVEA 1H01A 4OTFA 3EN4A 4C4IA 3FQSA 2OFUA 4RJ7A 3RCJA 4FV3A 2BVAA 4ZP5A 4IFCA 3R7EA 4ZMFA 4G2FA 4ASXA 2WELA 1ULZA 4V05A 3VBTA 3KULB 3RP9A 2J0MB 3KAJA 5D12A 3CJFA 3G8CA 3RFCA 2PMOX 2UVZA 4QMLA 2VTJA 4BZOA 4EOSA 5BPYA 3UQCA 3N4VA 3DAEA 3EYHA 4DH1A 5E8XA 3NYXA 5IA3A 5DRDA 4CD0A 3CIKA 5HE0A 4XLVA 2CNQA 4OR5A 4WNPA 4YLJA 4EJNA 1PXNA 3EB0A 3O50A 1H1RA 2WEVA 1FBNA 3TJCA 2CGVA 4BIBA 1LP4A 2UW4A 3EMGA 1Q3WA 3F82A 3LFAA 4RZVA 3V5LA 3AT4A 3DA6A 5EHOA 5B7VA 2WO6A 4RFZA 4AGCA 2OU7A 3TKHA 3QWJA 4QNAA 2OJFE 3W8QA 4LOQA 4KABA 4IIRA 4DCEA 2YZMA 4QYYA 3M1SA 1YHSA 3GUBA 4F7NA 5BYYA 2C6TA 2W9FB 1SNXA 4YSJA 4GSBA 1QPJA 2I40A 5M55A 3QKKA 5IQGA 2P0AA 4I5HA 4TL0A 4U40A 4CFVA 5BX0A 4E6AA 2BCJA 1SNUA 4HVSA 5BVNA 3U9NA 5AV2A 5CA0F 3ORZA 1WBTA 5FG8A 2Y7JA 4RC3A 3R8ZA 5FRIA 4QSHA 4YR8A 4E4MA 2YS7A 4ZTSA 3BQCA 4DG0E 4GEOA 4EOKA 1IASA 2GCDA 2X7FA 3NLBA 4FFMA 1KSWA 4PTGA 4L53A 4O6LA 4ZTRA 2B7AA 3G33A 3ZUVA 4F0GA 4A9YA 4ACDA 4BZNA 3FI4A 3KK9A 4FTCA 2YM8A 4MX9A 2E9PA 3SC1A 4OTQA 4MQ1A 3D0EA 1OPKA 4OBQA 2HELA 2WKMA 4IAYA 4KKEA 2PN1A 5M08A 4BKJA 3PVGA 4RIXB 4RFYA 4UWCA 5HBEA 1R3CA 3Q3BA 4QTBA 3SAYA 2NU7B 4ZEGA 1W83A 2GS6A 2WPAA 3R0TA 3OWLA 4ZIMA 3MDYA 4F65A 4IAFA 3WOWA 2CMWA 4FT5A 3QD2B 4BHNA 4PNIA 3F2NA 3MH0A 1PY5A 1DV2A 5DA3A 4BN1A 3FY0A 3F6XA 3EQPA 1NVRA 2XYUA 3QALE 4GT4A 4Y5HA 4YTCA 4KB8A 4ZLOA 1OPLA 3KK8A 3EQBA 4FNZA 4WRGA 5EW3A 1H0VA 4BF2A 4IHJF 2YHVA 3RWPA 1URCA 1P5EA 2VUWA 2W5HA 3QGYA 3VC4A 4ASDA 5AM7A 4UYNA 5D7VA 4ALWA 2V55A 2XM9A 3EKKA 4PF4A 5T3QA 4EHVA 4M12A 3COIA 5DMXA 4LOOA 4CXAA 3II5A 4F0IA 1BL7A 4IIJF 1RW8A 4FIGA 3DY7A 2IZRA 4UBAA 2CCHA 4B8LA 3O71A 3OXIA 3G6GA 2FPIB 3WBLA 2PVJA 5AP7A 4D5KA 1ZOGA 4Y73A 1EH4A 3LQ8A 3R9DA 2B54A 3QQLA 4O7RA 4QP1A 3ZTXA 1VKZA 2V0DA 2R64A 4O2BF 2P33A 3L9MA 5D8DA 3WE4A 5ANOA 5AUWA 5HBRB 1F5QA 3COKA 1Q99A 4KAOA 4GIHA 4YJSA 2XK3A 4J96A 1YWVA 4GT5A 2H8HA 4N57A 5BPFA 4L68A 5KZIA 1E4EB 5HCXA 2OJ9A 5KHWA 5EW9A 1KOBA 4XV3A 4LL0A 1NW1A 3WF8A 4XRJA 1Q97A 2ZMDA 1YWNA 4IVAA 3E7OA 3FSKA 5E7RA 4APPA 4BDIA 1RDQE 2J0LA 1M2RA 2YACA 5IQDA 5IH4A 2BILB 5LXTF 3DDPA 1VZOA 4WHZA 4MV9A 4ZS4A 4JDHA 5H3QA 4U80A 4JG7A 2NU8B 5ACKA 4O7NA 3H3CA 4QYEA 3SQQA 2RFDA 2A1AB 4YPSA 3NSZA 2DLNA 3QD0A 2EB2A 1OVEA 2VO3A 3QCYA 2BIKB 4C36A 4Q9ZA 1LEWA 2VD5A 4TKSA 4U5JA 5EHLA 3BWFA 3ZLSA 3PJ1A 1Y8YA 2P4IA 3TW6A 4GKHA 4XV2A 4ZY6A 5A4EA 3DDQA 4RT7A 3W10A 3TQTA 3AQVA 1KV1A 4W4VA 4EH4A 2WMAA 4ASEA 4EI4A 3QZFA 5FXQA 3U87A 5IA1A 2XK8A 3MFSA 4C3RA 1XKKA 4O21A 3I79A 3ORTA 2X4FA 5DOSA 3W8LA 5B2LA 2WMSA 4ID7A 4DEHA 2QOQA 3R30A 5IEYA 1IEPA 3QRTA 3UIBA 3A7HA 3V4SA 1DAYA 3UOLA 2ITUA 5DE2A 4OTIA 3CGOA 4R5YA 2OIDA 3BX5A 1JKLA 4QMTA 2XBJA 3NNXA 3QQFA 4IW0A 4ZZNA 2W6QA 1ZAOA 2ZB1A 3U4WA 5D41A 3ENMA 3SW7A 5L2TA 3KGAA 4O84A 2R3RA 4X7QA 3QCSA 3CKWA 2A2AA 4LFIA 5ETAA 3ZC5A 1BLXA 2OK1A 3QC9A 2CNUA 1XR1A 5DNRA 3VBXA 2JLDA 4I0SA 4L9IA 3W2RA 4B8MA 4JBOA 2PZ5A 5KCVA 3CP9A 2CKPA 4BIEA 4FU0A 5AUZA 3QWKA 3QTRA 3ANRA 4BCMA 3QBNA 2X8IA 4IX6A 4J98A 2IZSA 3MIYA 3THBA 3ZDIA 5KX8A 3DFCB 4RX7A 1OIQA 2G01A 4FFPA 2YJSA 4OBPA 3ACJA 3VS2A 3LFSA 4CZUA 1KC7A 2C6KA 4PUZA 4F9YA 2IO6A 3MB7A 4NM0A 3A61A 4RVKA 1BI7A 4PDPA 4P5QA 5HLPA 3UIXA 5HE2A 3NPCA 3KMMA 4I22A 1PF8A 4X3FA 3I5ZA 4RIOA 4E7WA 1GSOA 3WZUA 2YISA 2V5AA 4H58A 2PVMA 2C1AA 5CU2A 4NSTA 3P0MA 3MWEA 4L52A 4GG7A 2C6IA 2J4ZA 3HMPA 2X2KA 2OF4A 4IZAA 2W1CA 4MXOA 1K2PA 4IJPA 3JS2A 1OECA 3L9LA 4CG8A 2JKOA 3VHKA 2VR1A 1R1WA 4O2PA 5I9VA 2VNYA 3BHVA 4JX7A 5FP5A 1UNGA 4A9TA 4I0RA 1YOLA 2QO2A 2ERZE 4KKGA 2J90A 1JVPP 2W7XA 5E8SA 5KMLA 2F57A 3ORKA 5L3AA 4MWHA 3UE4A 3C50A 3PA4A 3U54A 4RJ5A 3SD0A 3V6RA 2GFCA 4CKJA 3MN3A 2UW8A 2YM3A 3FMJA 2OZAA 2UW6A 4PMTA 1WR2A 3T8OA 4F9CA 2GNHA 3BZ3A 3LMGA 2W6NA 4XH6A 1CSNA 3ROCA 3GB2A 4U81A 5D1JA 4MTAA 1TVOA 4YJQA 4HPUE 3R7IA 3FKOA 3BYSA 5LCJA 1FINA 4NTSA 3Q9YA 2GQRA 4DEGA 3S1HA 3RHXA 2CN5A 4FG8A 2C00A 3A7IA 4C62A 1ZWSA 4CFNA 4XLIA 2UZLA 4X2FA 4QPSA 2ITOA 2QK4A 3C5UA 3EKNA 3LCSA 3L8VA 1IAHA 3LFBA 4PL5A 3TZ9A 4D1XA 3Q2OA 1R78A 2A27A 2W17A 4TYHB 4BCHA 2PHKA 4YZBA 2F9GA 3OUUA 3RV3A 4KINA 4TT7A 2JBOA 3GEQA 1FQ1B 4O0VA 2V7AA 5HX8A 5M51A 3V5QA 4CGAA 5HG8A 3C7QA 3OUZA 4DAWA 2PVNA 2FP4B 4GU9A 2NNWB 4C02A 2WQEA 4R78A 1M2PA 3LCTA 3HYHA 5J8IA 3VUGA 2XK6A 3QKLA 3QU0A 4USFA 2VTLA 3R21A 3K5VA 3LOKA 4X0MA 4BGGA 4I50F 4MV1A 4USDA 1KEEA 4DC2A 4F9AA 2R7NA 2PL0A 2UZTA 3ZLWA 5KUPA 3E8DA 4GCJA 4Y83A 4ANMA 2FA2A 4FG7A 1VYWA 5JMSA 4AN9A 4DN5A 4GW8A 3RTPA 2X0GA 3C9WA 4DH5A 2W96B 4AZSA 2EUFB 5LOHA 3ALNA 4CLIA 3ZU7A 3Q4CA 2FO0A 3HDMA 1M14A 4BIDA 4XV1A 4D4VA 2XBAA 4YC6A 4AW2A 3I60A 4L3PA 4TXCA 5ANEA 3TNWA 3ZXZA 4CSVA 3P23A 4F6UA 4LG4A 3KCFA 3FMHA 2QOHA 3KXHA 4FV7A 4XP0A 4YJNA 5DVRA 4ZJIA 5EI8A 3VAPA 3DJ7A 2I0VA 2BRMA 3G0FA 3ZLYA 4CRLA 5CSHA 3UP2A 5TR6A 3ZUUA 3DNEA 5FBNC 3H9FA 3OXTA 3W32A 4D1SA 3OC1A 3UZPA 3V5TA 3TXOA 1AQ1A 3AGMA 1P4FA 3DKOA 3DZOA 2XRUA 4CFMA 2WEIA 1Q8ZA 3BPRA 5T6KA 3QHWA 2GQGA 4TN6A 3LVPA 3O2MA 3PZEA 3RZBA 5C8KA 1F0QA 3C4WA 5J9LA 4O0RA 3QA0A 5CEPA 2BAKA 5K5NA 2YYAA 3R73A 2P55A 4IJ9A 4UZDA 4YB8B 3Q52A 1XO2B 2HZNA 1SYKA 2XZSA 4FKTA 4I23A 2GFSA 4H3PA 4WBNF 3PWDA 3SXFA 3QXPA 3DF7A 4KD1A 2PPQA 3D83A 4BGQA 4WG3A 1SVGA 3F9NA 3OOGA 5GONF 3LCOA 2IJMA 5EOLA 4C5CA 3RK7A 5E1SA 3F2AA 4IE9A 4WKQA 2HJWA 5TKDA 2VWUA 1R0EA 2F7XE 1B6SA 3OWJA 4MBJA 2WOTA 4LRMA 2YA9A 5AMNA 2ZV9A 2XYNA 3RCDA 4WUAA 4WSYA 2X9FA 1ZXEA 4NKAA 2VGPA 1W8CA 4FTQA 5L2IA 3A60A 5M06A 4J8MA 4QQ5A 3DBQA 1H00A 3CE3A 3WO0A 2A0CX 4I3ZA 3GQLA 3PE2A 4TZRA 3QRIA 4WBBB 4YC8A 3HUCA 1GY3A 2B9FA 1G5SA 4GV1A 3U8WA 5HORA 3PIXA 1PXKA 3FPMA 3DAJA 3QZGA 5GIPE 4PY1A 4UZHA 3EN7A 5ANGA 3VO3A 3TDVA 4YZMA 4O0SA 4FVRA 3GU7A 3VQUA 5IA2A 3OW3A 3O8PA 3U51A 4XNEA 2QO7A 4ERKA 2Z02A 4I0TA 3HB9A 3BU5A 3JY0A 4AA5A 4GS6A 1JLUE 5L2SA 3HX4A 1HCKA 4MD8E 2OXXA 4NIFB 2C5VA 2PVLA 4U6RA 3SA0A 2Y4IB 4FI1A 4EKLA 3UPXA 5BUIA 3OW4A 4DEEA 2FSOX 3GC0A 3M42A 2V59A 2CKEA 4PNKA 3KXXA 2W4JA 3GU8A 4DFBA 4IEBA 2PVFA
chains in the Genus database with same CATH superfamily
2HXQA 2Y4PA 5L6OA 3EN5A 4X3FB 4KS8A 2BROA 4AWIA 4CVAA 1TAEA 2NRYA 2GTNA 3QXOA 2COIA 1Y6AA 2OJGA 3KIOC 4AN2A 3VF9A 2NYAA 4FKQA 4LOPA 4ANBA 4DH8A 4ZSEA 5IH5A 3DBDA 3OT3A 3GCUA 3LKMA 4FSTA 4OTWA 5GINE 3ZC6A 3NS9A 3QRUA 3WILA 4HGTA 4FFLA 2YWPA 2EU9A 3C1XA 3DCVA 3FMKA 1CTPE 3SX9A 2ZDHA 1OKYA 2GNLA 2O8YA 4O0TA 3K5HA 5HI2A 4QQTA 2PZPA 3W0NA 5IG1A 2JDSA 4WBOA 3R8LA 4GH2A 3PY1A 3HA6A 3HNGA 2X5RA 5CSXA 1KJIA 3LFNA 3NNWA 5AX9A 1O6YA 1JDEA 1VR2A 2XP2A 4AFJA 3MSSA 1XBAA 4XG9A 5IUIA 3IK3A 2R3QA 1FGKA 1BNCA 5EQEA 3SOAA 3GIDA 3LXKA 3PDTA 1GZOA 3SE7A 4V04A 3BLAA 3ZRKA 3ZZEA 3HV7A 4KA3A 1ST4A 1ZMWA 2OKRA 4U3ZA 3UPZA 3TL8A 2JKKA 2XF0A 4NCTC 4NU1A 4RWKA 3WF6A 4NWMA 5ETIA 5HICA 3SVVA 1DV1A 3GLKA 4QMXA 2XEZA 2WFYA 3KULA 3FZPA 4FBXA 2BAQA 4YJTA 2EJ2A 2G9XA 5FXRA 3R04A 4EH2A 4JL9A 4U42A 1PXJA 2OG8A 1Z2PX 1FVRA 2W1GA 4JBVA 4UX9A 1R39A 2FB9A 1Q5KA 2CNVA 5FR9A 2IVTA 3BEAA 4J99A 4BTKA 3EH9A 3R22A 2X2MA 3D5WA 3AD4A 3FZ1A 1K3AA 3VBWA 3PY3A 4KWPA 3C5IA 4EH6A 4HVDA 5CAPA 3B8RA 3CC6A 2VTHA 3F5UA 5D9HA 1DAWA 1ZYDA 4C59A 3FLQA 2W4KA 1U46A 2G2HA 2JKMA 5EYMA 4LM5A 3I81A 4GYGA 5CYIA 2GQSA 2JBPA 5AP5A 3VW6A 4S31A 4YLKA 4ZTLA 4MAMA 2XB7A 2WIPA 2YITA 4M67A 2I87A 2R9SA 3Q5IA 2R85A 3OP5A 4KNBA 5HIEA 4JT3A 1W93A 3Q6UA 3HO8A 5CALA 3FLYA 4IAIA 1CKPA 4O27B 2VO0A 3E93A 4ACGA 4EK4A 1I2LA 2ESMA 4HN2A 2BPMA 3E7VA 4O0WA 5J5SA 5DR2A 3DQXA 3IQ7A 4OTGA 2H6DA 4ZAUA 4HNUA 3NBYB 1U5RA 3EHAA 3IW8A 1LEZA 4F1TA 2O5KA 4IAAA 2WTDA 3DS6A 5L2WA 4FVQA 4J53A 3KMUA 5BVOA 5FPOA 1H07A 1O6LA 3FKNA 4FSNA 1Z2NX 4FTTA 3A7GA 3NAYA 3EOCA 3TDWA 1YXSA 5BYAA 4MBLA 2QOKA 4XP3A 5CNOA 4J1RA 5FUTA 3EWHA 4MCVA 5IQCA 1VYZA 2WMQA 4MH7A 2V22A 3MWUA 3SLSA 4HCUA 3VS5A 5HV6A 5FDXA 3V8WA 1X9NA 4C4HA 4Q2AA 2B0QA 1RE8A 2QOBA 3FC1X 3KFAA 3RTXA 3NUUA 5CAVA 4W8DA 3U6IA 5LMBA 3ZDUA 2JIUA 4UWYA 3QYZA 3AOXA 4Y85A 5BYZA 2OLCA 1PXLA 5IZFA 5IQIA 2ZFYA 4RWLA 4A9RA 1SVHA 3KL8A 3LMHA 3T9TA 1XH5A 1APME 1XBBA 3LCDA 4O0XA 2ZDUA 2XJ1A 4ZJJA 3BYMA 2H96A 3FQHA 4FIJA 1CQJB 4EORA 4BCIA 4NL0A 4JOAA 1OL1A 4S2ZA 4O7SA 1Z5MA 2R4BA 3BHHA 2IWIA 2OBJA 4IWOA 2IZUA 2JEDA 5L6WL 5F94A 3U4UA 3UO5A 3JZIA 4PZ7A 5HNBA 3EZVA 4N4SA 5EKNA 1P2AA 2W6PA 2XEYA 3FWQA 1GOLA 4E73A 1XH8A 2RF9A 3R9NA 2YZGA 4CC5A 1W84A 2PMIA 5EDPA 2C68A 1J1BA 1JKTA 2VWBA 4AW1A 1IRKA 2O64A 3FEGA 3VW8A 4DAAA 3M11A 2BDFA 2C6LA 4O7LA 2CHLA 5FEDA 3FXWA 2LAVA 5CEIA 3AC8A 3GI3A 1YHVA 4ORKA 2ITQA 4R1VA 4JJRA 4QMOA 1UKHA 4EG0A 4IHPA 3LIJA 3ETHA 1GJOA 3KRLA 3P86A 2R7KA 3PXRA 3KN5A 4ITIA 4F63A 4I4TF 4AT3A 3EZRA 2CPKE 4L1KA 3EFJA 4G31A 5M4CA 1L3RE 5DIAA 3PP1A 5KKNB 2XD4A 2ITWA 4B6LA 2JFLA 3DZQA 2WOUA 4XG4A 3FYKX 4XHKB 1E4EA 3F5GA 5E4HA 3C4XA 3HBLA 3D7ZA 4EK8A 2O2UA 2G1TA 4BGHA 4NUSA 4F4PA 5K5XA 2FSLX 1K9AA 3REPA 3PTGA 1CQIB 2IW8A 4HNFA 5BWWA 3RAKA 4MV6A 3Q96A 3P08A 4DBNA 3DJ6A 4R3RA 1CKNB 3TKUA 4EH9A 3T9BA 4ZI7F 1GNGA 4FSYA 2OXYA 3EQIA 4G16A 3ZEPA 3BHUA 5BMSA 1GGOA 2VTQA 2BFXA 4DEIA 4E4XA 3KEXA 5M07A 5HIBA 3HV6A 3BCEA 4IANA 2OSCA 2YERA 3MJFA 2ZMCA 2UZVA 3UDSA 3AT3A 1Q8YA 4YC3A 3VNTA 2XJ0A 4G5PA 3LFEA 4KBAA 3AXWA 3WZDA 4ME6A 3PLSA 2WTWA 5HVYA 5KBRA 2DYLA 5AP2A 3MY1A 3EQRA 4FV9A 3OY1A 3D4QA 2FPGB 2BZJA 4QP4A 3NDMA 1W82A 4WG5A 2A19B 5ICPA 3HMMA 1B6CB 3T3VA 2YDKA 2VWIA 3R1QA 4ZK5A 2IN6A 2BTSA 3BU6A 2R0UA 3LFDA 4TYEA 3FMNA 2XM8A 3R9HA 4IC8A 4X2GA 4M0JA 2YIQA 3LQ5A 3VS4A 3TIZA 5LVPA 2ITTA 3QUPA 4DG2E 4DT9A 4F9WA 4IZOA 1ZYSA 3KAKA 1YKRA 4HPTE 4PL4A 5CU3A 4QMNA 4EUTA 1U5QA 3KA0A 4EC9A 4ANLA 5EDRA 2VAGA 5CU4A 4CMDA 4EGQA 5CU0A 3QZHA 3FPQA 4AZWA 3BWJA 2WMBA 4DGMA 2YCRA 5I5ZA 4BR3A 4FSWA 4IX5A 4BTMA 2GU8A 3GNIB 3WF9A 4D1ZA 5E25A 4EGJA 3DTWA 3NW6A 3UYSA 1ET0A 2QOFA 3IGOA 4UCUA 1CKIA 2BDJA 3TUBA 2W6ZA 3DTGA 5K3WA 3EJ1A 5FQDC 5JT2A 3QFVA 1ZYJA 2ETKA 3DTFA 1FGIA 2PMLX 1Q61A 2XCHA 4CQEA 3JRWA 2OWBA 3AG9A 2QHMA 4C3FA 1V9PA 2FGIA 2FSMX 3PG3A 1BMKA 2C69A 2YN8A 2YM5A 4JIAA 3RGFA 2UVYA 3DK3A 4DFNA 4ZTMA 1YXTA 2HVSA 4RWJA 1UU7A 2YDIA 3LFCA 2ZM1A 5E90A 4ITJA 2QR7A 4EK5A 2DWCA 5A46A 3VRZA 5HZNA 4FTIA 2CLQA 3ERKA 3MTLA 3NW5A 5C26A 2XUUA 1JDBB 1B39A 1BKXA 3OVVA 1YI4A 2WMWA 3E8NA 4L3LA 5KZ0A 1EKPA 3FZRA 1Q8UA 4EFBA 2ZVAA 3R5FA 4EUUA 3NWWA 4I20A 3W16A 4JDJA 3KF4A 4BI2A 4MBIA 4PP9A 3NIZA 4FV2A 4MNEB 4BBFA 4AOJA 2YCSA 3SGIA 4OLIA 4RSSA 5G6VA 4YJ2F 3IDBA 1CKMA 3AW8A 1Q8WA 4BRXA 4YJPA 1PHKA 4D55A 2QKWB 2AC3A 2YM4A 4G9CA 4Y8DA 5HO8A 4DH7A 1WFCA 3UIMA 3UO6A 4BDCA 2DZDA 2XKCA 2R3NA 4I5PA 2NUAB 2WHBA 2XAOA 3NZ0A 5JVDF 2Q83A 2C30A 3FKLA 5DR6A 3HP2A 4ZZMA 4E8AA 5E92A 3FI2A 4TM5A 3MPAA 4HCTA 2UZOA 1EHIA 4FZAB 2XKFA 3I12A 4IWXA 3PWYA 2YZNA 2H9VA 1YWRA 3MB6A 2R3KA 3MFRA 4YPDA 3D15A 4GIIA 3PJCA 3MVHA 2VO7A 3HAMA 3QRKA 4GU6A 4RLKA 3FAAA 2A4LA 3OHTA 5BYLA 1GZ8A 4S32A 5FPRA 4FT0A 5ETFA 4P90A 2VWVA 5FXSA 3KU2A 5E8WA 4RX5A 5CEOA 4FE2A 1IYEA 1H8FA 3HMOA 3D5UA 1STCE 3KVXA 2CFMA 4TYHA 1WMKA 5JQ8A 4IVDA 3CGFA 2CJMA 1AD5A 4GVJA 2I1MA 4IZ5A 3D2KA 3E5AA 1YRPA 3TZ8A 4M7IA 4E5BA 5H2UA 3RPVA 2WXVA 4S33A 5IQFA 4PX6A 4DFLA 3RAHA 2OXDA 3FLWA 1Y6BA 5IEXA 5IU2A 3NYOA 5A6OA 4CKRA 2ZV8A 4N70A 4U97A 5CVHA 4DBXA 2PUIA 2HIXA 4Q5HA 2J0IA 2ZB0A 3B8QA 4GFMA 4EHZA 5HD7A 1Q3DA 5JFXA 4WD5A 4EH8A 3FL4A 4X2KA 3T99A 4BCJA 4EQUA 5I0BA 3BG5A 2RL5A 1VBGA 3QLGA 4L7SA 4FKWA 5CXZA 3CY3A 4XRLA 1GAGA 3N9XA 4NCTA 3GDEA 5DI1A 3K3PA 5JSMA 4NKSA 5J95A 5BUJA 4TPTA 5GHVA 3W2OA 1P16A 3W1BA 2HGXA 5J2TF 2E9VA 3HLLA 4BZDA 4CFXA 2FPPB 4AAAA 2QG5A 3U9SA 5CEQA 2H34A 3FC2A 4I24A 5IUGA 4HGEA 2C6OA 4I92A 1CM8A 1T45A 4M69B 5J9YA 3U6HA 4YBZB 4K1BA 4QT1A 3ZLXA 1SZMA 3HRFA 4BDGA 2GLTA 2QF7A 2BZHB 4FFNA 5HX6A 3EL8A 5TT7A 3OBJA 3TN8A 1KJJA 3QC4A 3GC8A 2EJ0A 2BAJA 5FEEA 3HV5A 4O4HF 2HVRA 3DQWA 3TV4A 1AUVA 4FOBA 1T36A 2RFNA 4O7ZA 5CENA 3QQMA 3ORMA 5FLFA 2Z7LA 2OI4X 1WVWA 5K3YA 2ERKA 2X8EA 4QTEA 4ZOGA 1UA2A 4C34A 1ZOEA 5M53A 5EDQA 3ORIA 4G6NA 3MWDA 4FTRA 4UY9A 3TG1A 4QP9A 4AGUA 2ZV7A 5CVFA 4FNWA 3UVRA 5I9WA 4LL5A 3BBTB 3PZHA 5AP0A 3VNNA 4NYEA 5F95A 3PY0A 2WMRA 2WMXA 3KY2A 1REKA 4PDOA 2GNIA 3G5DA 4O6EA 4Y46A 3W0SA 4AGWA 1Q41A 4QMWA 1VS0A 3TKIA 2IVSA 5JGBA 2HGSA 4JQEA 1WBPA 5E9EA 4UWBA 2W5BA 3FMDA 4C2WA 3G0EA 3VUDA 1ZMVA 2NU9B 5CLPA 4AFEA 5HG7A 4GUBA 2J5FA 3NRMA 5H9BA 2V5QA 4XCUA 3ZO1A 1FVVA 3K54A 3Q32A 3A7FA 3IOPA 4C4JA 5LVMA 2PK9A 4TNBA 5CANA 4TY1A 2B52A 1E9HA 5CTPA 3TNHA 4XG6A 1UNHA 1Q8TA 2PYWA 1YI3A 2X4ZA 3AC3A 5GJGA 4NK9A 3UFXB 3MVLA 4AT4A 1IAJA 3TW7A 1OUYA 4TV9F 3FXZA 1V1KA 2Y6MA 4A06A 2BKZA 5LYJF 3O8UA 4X6RA 3TY8A 2W1DA 4JLCA 5HE1A 3RPRA 1UC8A 3TY5A 5HEZA 4AOTA 5BYBA 2NO3A 4FT3A 3ZEWA 3R5HA 2BTRA 2J51A 4IB3A 1FMOE 4KIQA 4DHJA 3TACA 3TNIA 2VTNA 2PE0A 4GJ3A 2NRUA 3HZTA 4W4YA 3W2SA 5EYKA 4ZTNA 4IX3A 4FTUA 4L42A 3I5NA 1XH6A 5DFPA 3GVUA 3I4BA 4RLLA 3BLQA 2LGCA 5E8UA 4ZS0A 3VQHA 4MUQA 3R8MA 4O7VA 3VUMA 4M9UA 2CSNA 2YABA 1C3OA 1UU8A 4AW0A 2ZYBA 3OUKA 2J50A 4MXZA 4DTKA 5HBJA 3SW4A 4UFZA 5I5YA 4QP2A 3VF8A 3QCXA 4DGLC 4I6HA 5EI2A 4I94A 3TMOA 1HCLA 3LXPA 4FICA 5BWXA 4LGGA 5ANKA 1JKKA 3AC2A 3NUSA 4FZDB 3COHA 2VZ6A 3ID6C 3ZO2A 5AA8A 4DYMA 1B38A 4MAOA 4F99A 4N0SA 4FFOA 1GLVA 1U4DA 4LH7A 4Q9SA 1OIYA 5J2UF 2QG7A 3E3PA 2NP8A 1U59A 1MP8A 1J91A 4O91A 4BCOA 4Y95A 3Q2JA 2WQMA 4EOJA 4MD7E 5KMOA 4HYUA 1H1SA 1M7NA 3DBEA 3F7ZA 4JX3A 3DXPA 4FSZA 4AA4A 4F70A 4HYIA 1PXMA 5E91A 1G8SA 4HW7A 1KE8A 2Y8OA 5EQPA 2VTOA 4TWCA 3ZUTA 1J7UA 1XQZA 3ORPA 3OROA 4JQ8A 4BBMA 4LV8A 3SKCA 2UZDA 4ZY4A 4DLIA 4EH3A 4BVUA 4CC6A 4EZ7A 5AAGA 2YS6A 4HZSA 4C61A 3TZ7A 3WZKA 2QLUA 4JS8A 3ETJA 5C03A 5ANDA 4UEUA 4QEBA 1EZ1A 4AXDA 4FGBA 3M2WA 4O22A 4XX9A 3VBVA 3QKMA 3KB7A 5AP1A 4ZSLA 2W1FA 4RCNA 4DGGA 3OOMA 1J7IA 4EK3A 2C6EA 5I60A 1M52A 3ZSHA 2RKUA 2R3LA 5LQFA 3T9FA 3MPTA 4H1MA 4RA4A 5C8MA 4L01A 3VUIA 3P1AA 4W4WA 1BUHA 5JK3A 5ITAA 3NVKI 1YW2A 3DB6A 2QONA 2F49A 4E4LA 5K4JA 3JZ6A 2XAMA 3TIYA 5DHJA 1OGUA 5A4LA 1DS5A 2PUPA 3VJOA 1AGWA 2UUEA 2QKRA 4JAJA 3EQFA 2XIXA 5JFSA 3QTSA 3LQSA 2RGPA 5EYDA 5D11A 2JC6A 2B4SB 1OIUA 2VWZA 4HOKA 2C6MA 4E4NA 3K5UA 4LRKA 2C3LA 2DWBA 3FMLA 4F7JA 4YUQA 5FDPA 2WU7A 3DBCA 3UO4A 1FVIA 4ZQIA 3F3TA 4CV9A 3HV4A 1ND4A 2QOIA 1KT8A 3ODZX 4R7BA 2B9JA 5AP4A 5H8BA 1CE8A 4GFGA 4BI1A 3P7CA 5BMVF 3VN9A 2GHMA 3FI3A 3RMFA 5E8TA 3GU5A 3BYVA 4H3BA 4XOYA 3UMXA 4FKUA 2X6DA 1EYZA 4PP7A 3QTQA 4ZOLF 2C5XA 4BDEA 2OIBA 3ORRA 5FGKA 2E9NA 3PE1A 4ACHA 4CCBA 3QTXA 4ZSJA 4A9SA 2GHGA 4OUCA 4MYGA 4FSRA 2R82A 4IM3A 4IB0A 2R3JA 2BIYA 4BCFA 3FUPA 3F3VA 2FUMA 2ONLC 3PVWA 5EQYA 4D28A 3QX2A 2J7TA 3Q4TA 2P2HA 3PXKA 4TW9A 4HGLA 2WTKC 4H39A 2UVXA 3Q6WA 5CE8A 4C58A 5C4KA 3DU8A 4H1JA 4YBJA 2I6LA 4G1WA 3CKXA 2HXLA 4AACA 3MH2A 4ZY5A 3CTQA 2ZM3A 5HD4A 2VX1A 3QTIA 3C51A 3BRBA 4F78A 4FKVA 2VTIA 4IBMA 4XYMB 3CTJA 3KYHC 3NIEA 4ZSGA 4E93A 3DXQA 3VMMA 2YWVA 3CPBA 3FYJX 3ZHPC 5CY3A 4RBLA 3L1SA 3VS7A 5C8YF 1A9UA 3ATSA 2EB3A 3C4CA 2OLSA 2Z2WA 3KXGA 3BGPA 2ACXA 3GQIA 3OT8A 4IM2A 4TWPA 4O96A 5CEMA 5KMIA 5M44A 2JDVA 4WHXA 1M17A 1XMMA 2WMUA 4L8MA 3ZM9A 2J0KA 3F66A 4IB5A 2XKDA 4J8NA 3V3VA 1CKJA 4D4YA 2QLQA 4BDKA 3OEFX 2PVPA 3VVHA 1XH9A 3ORXA 1H28A 5FD2A 2R3FA 3MBLA 4DHZA 2BKKA 2YIYA 3F69A 5A6NA 3OCBA 5KKRC 2FVDA 1WBSA 1ZYLA 3TM0A 3OFMA 2Y6OA 2HWOA 2VU3A 4XG3A 4LQMA 3MPMA 4M3QA 1I1LA 5JRSA 4A07A 4ZMEA 5H8GA 4X2NA 5HG5A 4YGAA 3TI1A 4CFUA 4NH1A 4IB1A 2AYPA 4FZ7A 3LCKA 3LMIA 5CF4A 5GIOE 1JWHA 3ZFXA 4A4OA 4AZEA 4YJOA 3DKCA 3D2IA 4RG0A 5C1QB 1B04A 4ALVA 4ITHA 5JZNA 4WA9A 4ANSA 1IOWA 3UQ8A 3TNPC 4L6QA 4U43A 5HLNA 4UALA 3PRIA 4FNXA 3T9IA 5DN3A 4ONAA 5M4IA 3E3BX 1H1QA 2HW6A 4JG6A 3ORNA 4NM7A 1DI9A 5JKGA 3UNKA 1EUCB 3GT8A 2GHLA 3O17A 2ITZA 3H10A 4X2JA 3Q4UA 1KE6A 5DG5A 4GVAA 5ACBC 3ZSGA 2OJIA 4G5JA 4D5HA 1M2QA 3CQEA 3P4KA 4FKIA 3MA3A 3QX4A 3SDJA 4AZFA 3R02A 4XG8A 4EOIA 4QOXA 1V0PA 2HY81 3IDPA 3V04A 1CS0A 3WZJA 2WQNA 3RI1A 3GBZA 3KC3A 1G3NA 2YZLA 3ZONA 2PVKA 5M57A 5LWMA 4O4IF 1MQ4A 4FYOA 4C3PA 1OKZA 5AFVA 2FH9A 5IDPA 1CKNA 2WTCA 3EQGA 3HKOA 4DF3A 5HTBA 1YOMA 2C3JA 1O9UA 5EG3A 4JI9A 2VTAA 3PXFA 4KRDA 5GJFA 4RFMA 3UVPA 4AU8A 4NT4A 1H26A 5AEPA 2OIQA 3SG8A 2JDRA 1UVRA 3Q60A 4D2RA 4YJ3F 3BU3A 1KE5A 3OEZA 4IDVA 4K9YA 5I5TA 3WIKA 5M4UA 5JRQA 1JLLB 4AP7A 4Z55A 4EJ7A 4A7CA 5HHWA 1MRVA 2XRWA 2Y0AA 5GNKA 1I2KA 5HVJA 1I7NA 2J2IB 3R00A 4K18A 4TVIA 3F61A 4YO4A 5AP6A 2YCFA 3IG7A 4C4FA 4C7TA 3CY2A 3ELJA 4O2ZA 3SG9A 4AE6A 5CF8A 4ANQA 5DEYA 4UCVA 3NFFB 5A54A 2W06A 3DPKA 4PDSA 4WNKA 1YI6A 4S30A 2R84A 3K5IA 2YAAA 4QMMA 4PDYA 1BL6A 4B0GA 3HDNA 5F9EA 2W99B 1YDSE 3I7CA 4NW6A 3WO1A 5BNJA 4FTJA 4ZTQA 4ZZOA 4I5MA 4II5A 3H4JA 4Q5EA 4U79A 4ERWA 4KS7A 1JOWB 1KJ9A 3E63A 4PWNA 5E8YA 1JKSA 2COGA 4FC0A 3IO7A 5IF1A 4Y72A 5C4LA 4CTBA 5J87A 4QP3A 2R3GA 2UZBA 5H8EA 4GJ2A 5BPHA 2XNBA 3FZOA 3MI9A 1KE9A 3R8UA 2ZDTA 1NA7A 3PJ3A 4FTMA 2NPQA 4EL9A 4EOLA 2I8CA 4FV1A 3NUAA 2W4OA 3OWPA 4YAJB 5DT0A 4QYHA 4WNOA 2OH4A 3S24A 4AX8A 4DG3E 2PVHA 3EFWA 4MF1A 1QPCA 4AGDA 4QTAA 2C5YA 3MVJA 2XK4A 4FTAA 4O86A 4P5ZA 2PUNA 4RIYB 5CQUA 5AX3A 4EEVA 1BX6A 1OL6A 4D4RA 3LPBA 5EHYA 3ENHA 3V8SA 1A0GA 1NT2A 1UC9A 3OUNB 4RVLA 3AD5A 3F3WA 4JRNA 3O5AA 3GJXB 2R3HA 3LLAA 3OCSA 3MESA 4G6LA 3UNJA 1PMNA 3VONA 1XWSA 5HCZA 5IQHA 4XX0B 3QD4A 4MXYA 5IMEA 2PU8A 5KBQA 3LXLA 5J1WA 3ULIA 2C6DA 2QHNA 4MNEA 2WU6A 4G3EA 3R7UA 2C1BA 2W9ZB 3A8XA 2RG6A 2GNGA 2O65A 4LI5A 3PFQA 3QYWA 5AM6A 3NCZA 5IA5A 4E5WA 4JDKA 3R8VA 2VWYA 3O51A 1FVTA 4HCVA 3RVGA 3VJNA 4EC8A 3JVSA 4K77A 4HYSA 3BE2A 3BQRA 4NM3A 4QMSA 3QWUA 1H1WA 2WMVA 3MVMA 4QP7A 3BGQA 4YTHA 2QR8A 5DRBA 5ANJA 3TT0A 2NU6B 4CE5A 2P2IA 3MGYA 3PP0A 3QTZA 3FZTA 4FKRA 3BI6A 4LYNA 4FGRA 4WG4A 2O63A 3R7VA 3MFTA 2IVVA 4NW5A 4EOMA 3VS6A 4CG9A 1Q4LA 2BDWA 3POZA 4J52A 4XS2A 3KRWA 2PZIA 3W55A 5ANIA 4BDJA 1W98A 2CGWA 3MJ2A 3PFYA 5B0XA 3VPDA 4CFWA 2JDOA 3RKBA 2E9UA 5FTGA 2CKQA 2BRBA 3HUBA 4AQCA 5IUHA 1B6RA 1W96A 1JPAA 1X8BA 2OGVA 5DGIA 3RK9A 4AT5A 2BRNA 5FM2A 2AC5A 2EXMA 3AC4A 2XIRA 2QNJA 2BRGA 4QMQA 4G3GA 4ACCA 1IA9A 4K0YA 5HESA 4RX8A 4ZXTA 3LFQA 3UYTA 4IADA 5AUTA 2QODA 3A7JA 4F09A 2YZAA 3FZSA 5LVOA 4YTIA 4AXCA 4IZ7A 5A4QA 5BWRA 3OG7A 3RNYA 3HMIA 4HVIA 4IMYA 5HU9A 1GIHA 3G9LX 4FSMA 3ALOA 4QQJA 4CRSA 4JQ7A 4FKLA 3HL7A 3L8XA 1OKVA 4K11A 4BCNA 4LDTA 4DCAA 3V4ZA 3G8DA 3MYGA 2O3PA 3DKGA 3AMBA 1A06A 3HRCA 5JQGF 4ZSAA 3QCQA 4QNYA 4F1OA 2E2BA 4YJRA 4IWYA 2CKOA 1OPJA 5FTOA 3ZH8A 4FG9A 2XNGA 2Q7DA 5K2MA 4DHFA 3UDTA 3HAVA 2PTKA 4FTOA 2G2IA 2XNNA 4B7TA 2HZ0A 2J5EA 4EOQA 3COMA 3FLSA 3GOPA 5JEBA 2I80A 4MV3A 2UZEA 4D4SA 1LUFA 3R2YA 4IC7A 4CT2A 3S00A 1JSTA 5KHXA 1WAKA 4C4EA 4O81A 4MA5A