4O7WA

Saicar synthetase (type-2) in complex with atp and tdp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
232
structure length
232
Chain Sequence
b'VYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ATP and TDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 77
structure length 232
sequence length 232
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7wA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7wA02
4FEUA 3KRJA 5LWNA 5BVWA 4I24A 4ZTHA 3F3TA 4UZDA 3KK8A 5E92A 4EZ7A 3UO4A 2SCUB 2R3NA 3COHA 3L8XA 1KEEA 4TV9F 4EGQA 3NW7A 5DGZA 5BYLA 1XH9A 4NH1A 3QD3A 3U6HA 1SNUA 1QPCA 1J3HA 4W8EA 4YZNA 4FTQA 5CXHA 4F70A 3ORKA 3ORTA 5EM6A 3OBJA 5HNBA 2W70A 5EHOA 3R9DA 3R23A 2W96B 4GFMA 4BC6A 2UZBA 3GU8A 5AV0A 4KIQA 5IDPA 5I0BA 2YN8A 4KWPA 2ZAZA 3V4SA 4LV5A 5D9HA 4UV0A 3WOWA 4EK6A 3QTIA 2VAGA 3K3IA 3SG9A 2HK5A 3GEQA 2IW8A 4AN3A 4BTJA 1PW2A 4RG0A 3MFUA 2I0YA 2I1MA 4UB7A 2VWBA 1CKIA 1JSUA 4BBFA 3N8DA 2JKKA 2G2FA 5HBRB 2W1ZA 5M08A 4JLCA 2RG6A 3F2AA 4UZHA 4HNIA 4MXCA 2PMOX 4XV1A 3MS9A 5DFPA 2XIXA 3CR0A 5DA3A 5LJJA 2JAMA 4BDDA 3MH2A 1V1KA 3C50A 3OEFX 3BU3A 4ZXTA 2QNJA 4RLLA 3D4QA 3I6UA 4U81A 1KJIA 5DN3A 4ME6A 4EH6A 2Z7LA 3G51A 3C51A 3PPKA 4K9YA 4KS8A 3UIBA 4C3PA 5TR6A 4AOJA 4FIEA 5IA2A 5IH5A 1R3CA 1NW1A 4I6FA 4PMSA 4UN0C 3AC4A 4GUBA 3OVVA 1SZMA 4R78A 3BBTB 3LMGA 3VBVA 4FV2A 4EORA 4U42A 5BUEA 5AAGA 1MRVA 2CNQA 2JDRA 4IHPA 5ICPA 1H1SA 3HV7A 3O51A 3IW7A 4OGRA 4UY9A 3E64A 2REIA 1YXVA 4RQKA 2YCRA 3RV3A 5IPJA 1AUXA 2R3PA 5AUTA 3E3PA 2XNPA 5J9LA 3RVGA 5IEVA 4QPAA 2IG7A 2YAKA 2OJ9A 3R7VA 1XH6A 3ZO1A 2HW7A 1WVXA 4KABA 4R77A 4RIXA 4Z9LA 4DINA 4EG0A 3R8LA 2JD5A 3MVJA 2V0DA 4O0XA 4EK4A 3MDYA 2XYUA 4I55F 3I7CA 2A19B 3O2MA 4BTKA 5KCVA 4IB3A 5HBJA 3PG3A 4U43A 4QTDA 4FFRA 4JDKA 3WI6A 4OTRA 3EYGA 5DNRA 5CU0A 3V51A 3MY0A 3JRWA 4FKIA 1NXKA 2JC6A 4U8ZA 5I5ZA 5J8IA 2ZM1A 3NRMA 4B0GA 1KE9A 4FSUA 4UYAA 3Q9WA 4JIKA 4D4RA 3D94A 4EOQA 4NCTC 3AD5A 2X7GA 3TACA 3D14A 5CALA 4TUYF 5KKNB 4ITJA 1U5RA 4NU1A 3HP5A 4RBLA 3QALE 3R21A 4O96A 3MIAA 4Y8DA 2C1AA 5DG5A 2IW9A 3BZ3A 1U46A 1Y6AA 2OG8A 4PDSA 1CTPE 3DZQA 3TXOA 1H24A 3A7FA 3CKWA 3P79A 3DBQA 2C0IA 3K5VA 3QTWA 2XK9A 3E63A 2GS6A 3TIGA 4JG7A 3ORZA 4CMTA 4FEWA 5CF8A 3FKOA 2OJJA 4AN2A 5DR6A 1T46A 4PMTA 5D1JA 3V5LA 1E1XA 1NVQA 4AA4A 5HI2A 5I9ZA 3VQHA 2YM3A 5E8SA 3DAKA 4GYIA 2QOLA 4GT5A 4AT4A 1G5SA 3NDMA 4D28A 3F7ZA 1NT2A 1S9IA 4FIJA 2RG5A 2Z7QA 3Q5IA 1H1PA 2RL5A 3DFAA 4BCFA 3U6IA 4K0YA 2CHLA 1K3AA 4FV6A 3BGPA 4CTBA 5HVKA 4C2VA 3G0EA 3JYAA 1GIJA 3ORXA 3Q2OA 5A6OA 3KVXA 4NYEA 2V58A 5IH6A 4XG3A 2ZOQA 2Y4IC 4DHFA 2PZYA 4AW2A 4Z55A 5JQWA 3EN5A 3GVUA 3T9TA 5CZHA 2VTTA 3BHTA 4E93A 4XG2A 2VWXA 1PXMA 2QLQA 3TUBA 5E8UA 4FT5A 2JKMA 4I93A 1OPJA 4U5JA 4PY1A 4YZ9A 2R0UA 1GAGA 1OUKA 2P4IA 4FIFA 3PSCA 4CFNA 4ENYA 1PXKA 2PE1A 3AG9A 1IRKA 2QOFA 4XV3A 3I81A 3PIXA 3W16A 2FVDA 4JAIA 4MV1A 4S34A 3D2IA 4KRCA 5F95A 3GCSA 4MYGA 5JFSA 3IOKA 3RWPA 1Y91A 2G9XA 4EK5A 3UGCA 1P14A 4XX0B 3SAYA 4L44A 1OL6A 4C02A 5DHJA 4ASXA 2XCLA 1XQZA 4ZIMA 4RWKA 2R3FA 1WBWA 3JVRA 3C0IA 3Q3BA 4DH5A 1ZARA 3OP5A 2CKPA 3R7EA 2OSCA 5CA1F 4FE2A 4P7EA 2JAVA 4D4SA 2AC3A 2XH5A 4RZWA 5BYYA 4QMLA 4WNKA 2OU7A 3LOKA 1FVTA 4F6WA 3OBGA 2P2IA 4LQMA 3TZ7A 4WO5A 4JDHA 2VGPA 5FXSA 3V5JA 1Y6BA 2IW6A 3DAJA 4ZEGA 4WRGA 2PUNA 4R7HA 5D41A 1O6LA 4CXAA 1OIRA 4QTAA 1H1RA 3D5XA 2O63A 3LPBA 1PXIA 4YC6A 4AE6A 4TN6A 4IB1A 4M84A 3VBWA 1JNKA 3ORLA 3PXZA 4L9IA 1XH7A 4E4MA 4LGGA 1Z5MA 5E8VA 1OPLA 2VTIA 2JGZA 3LVPA 3VBXA 2F2UA 2GTMA 4BBEA 2RFDA 3BU5A 1QPJA 2J9MA 3R22A 4IZ7A 3VS0A 3TTJA 1YI4A 3DKFA 3IDCA 5I9WA 2CKQA 5CA0F 3B2WA 1DI9A 3ATTA 4QP1A 3I79A 4IEBA 5H8BA 2X6DA 3NYNA 5D8DA 5A3XA 4F7JA 4FICA 1GLVA 1DS5A 3C0GA 3IONA 3CSVA 3FHRA 4JBOA 3UOHA 4D5HA 3CY2A 3RGFA 2ONLC 2XJ0A 4FKVA 3EB0A 1UU9A 3QTXA 4IVCA 4YJQA 3KFAA 4FTJA 2WMQA 4CFVA 4ZLYA 3UYSA 2XB7A 3A8WA 4AZVA 4A07A 3K2LA 3QQLA 3VF8A 3ZLYA 4QMNA 1RQQA 3GI3A 3Q9ZA 3QZHA 4G5PA 4NM7A 4YBKA 4RWLA 5AP7A 3HRBA 2H6DA 5EOLA 4F9WA 4CVAA 1OL2A 5L6PA 2WMXA 3ZTXA 5IF1A 4F0FA 5CF6A 3G90X 1YWNA 4O38A 4YNOA 4FMQA 4USDA 5CY3A 3D7TB 5HE1A 3O7LD 1VYZA 3P7AA 4FVRA 2CNVA 4CFUA 5LVPA 2WEIA 3PPJA 3UJGA 4NZWB 3GCVA 4AN9A 2VTJA 3HMNA 2YZGA 4MQ2A 2FP4B 2X4ZA 3L8PA 4ZQIA 1UKIA 3OCSA 2BRMA 3T9IA 4MK0A 4YLJA 2G01A 4EONA 4ZS0A 3DXQA 1YOLA 5EFQA 3PY3A 4ANMA 4O82A 3CJGA 1U54A 2PHKA 3OROA 4KNBA 2QR7A 4JQEA 2R3HA 3JZFA 1KE6A 3FMKA 2QURA 3MFTA 4NFNA 4NWMA 4AW5A 4IJ9A 3KRWA 1ZMUA 1J1CA 4PMMA 2CCHA 2R84A 2HW6A 3H4JA 2C5OA 3I12A 5JH7F 2VO6A 4WNMA 4FNWA 5HU9A 2WMRA 3FHIA 3MVHA 2R7BA 2WQMA 4KKEA 4X3FA 3ZSIA 4IAZA 3VW8A 3LW0A 1YDTE 2XCHA 3OUNB 4DGNA 4W4XA 5ANJA 3BHVA 1I7LA 2CN8A 3VS4A 3R63A 4DLIA 4IQ6A 5L8LA 2OW3A 3R2YA 4IBMA 2YEXA 1IG1A 5KBRA 2W0JA 5B2MA 3UQGA 4AOTA 2DLNA 4GVAA 4C5AA 2NU9B 4YC3A 3NZ0A 2WEVA 4FV4A 4TYJA 4ACCA 3FLZA 2YIQA 5E9EA 5K5XA 2R7LA 4BIDA 3DK3A 3QCQA 3RHXA 3U9NA 1JAMA 2QOIA 3LZBA 2Y9QA 3NYVA 4FOBA 4AFJA 2VZ6A 3EQIA 2XEYA 1YW2A 3PJ2A 5FLFA 3RV4A 3SXRA 4BDCA 3ATSA 2FB8A 3VRYA 1HCLA 4EJ7A 3BQCA 4L6QA 2J0IA 4WG4A 2ITNA 2C6EA 2Y0AA 1YDSE 2WMTA 3OCGA 2F7XE 2UVXA 3CCNA 4ITIA 4FTAA 3R9HA 4AUAA 3ALNA 2X4FA 4CMOA 4LUDA 5JVLA 4MV7A 3N4TA 1AUVA 1H08A 5FG8A 1M0TA 5CVHA 4BCMA 4MNEA 3VUGA 1Q41A 2HWOA 2VV9A 1TQMA 4ID7A 3RTPA 4O2BF 1M2PA 2R2PA 4FKTA 5JQ5A 2VWWA 3SW4A 4UWYA 3ZFYA 2YIYA 4C34A 2GNHA 1XBBA 5ANEA 3PXFA 4BGHA 4CSVA 3NX8A 4H3PA 4MA0A 5DI1A 3E8NA 2XKFA 1UNGA 3QZFA 4DTAA 1B6RA 1AD5A 4YURA 3PFQA 3SXSA 4R3CA 3CKXA 1QPEA 1XH4A 2FGIA 1H4LA 3G9LX 4G6NA 4D9TA 5D12A 3DT1A 4QMPA 3NCZA 4QMOA 3MTFA 1UU3A 4X3JA 5GONF 3E92A 4RLKA 4CNHA 3R5XA 2O5KA 3D5WA 3Q4ZA 2KULA 5E91A 4Y5QA 3C4ZA 3P4KA 3VS7A 3KVWA 3FC1X 3MY5A 2JDSA 5HESA 3W55A 2XS0A 1IOWA 3FL5A 2HELA 2PVMA 2WTIA 3TIZA 3NW5A 4G6OA 3UDBA 5C9CA 3BX5A 3EQPA 5JFWA 2C5NA 1MRUA 3KRRA 4FT0A 3QYZA 3MFSA 5TOZA 1CQIB 4OT6A 3HV6A 4WG5A 4IADA 3BBWA 3C1XA 3P86A 3A99A 2QOQA 4JOAA 4O21A 4OT5A 4Y95A 5M4CA 4PP7A 1B6CB 2WQEA 3MPAA 5EQPA 4E4LA 3OF0A 3E62A 3I0OA 2YISA 2IVUA 3DQWA 5AUZA 1U59A 3ULIA 5DBXA 2XF0A 2PE0A 3FMNA 3HMOA 4FIHA 2JFMA 3CLYA 5CEIA 3UP2A 3GIDA 4AP7A 2RFSA 2ITOA 3C4EA 3TKUA 4TXCA 4EHVA 3EN6A 3ORRA 3R0TA 4FGBA 2NU8B 3QHWA 3PG1A 4YSJA 3NIZA 3DDPA 3EWHA 5HCZA 3WF7A 2R3JA 3QRJA 4QMXA 4U44A 4IW0A 2ZV8A 4GEOA 1SYKA 3AQVA 1ZWSA 3VJOA 4YPDA 4BBMA 5EKNA 1WZYA 1J91A 3GBZA 4L01A 4LRJA 4QOXA 3TZMA 2R3MA 3CTHA 3Q04A 1CKPA 4GJ3A 2VTLA 4D1XA 3HYHA 3C9WA 2FB9A 3P0MA 3LCKA 4OTDA 4FFLA 3JR1A 4EOMA 4FI1A 4J96A 4AW0A 5L3AA 5L2SA 3MYGA 3IG7A 1RJBA 5HG9A 4ZY4A 3NWWA 3TN8A 3ZBXA 1ND4A 2QVSE 3TJCA 5I9VA 2R7NA 2QKWB 3COKA 4GG7A 4E26A 2H96A 3QD0A 4C3RA 1XJDA 3A7IA 4EUTA 4FFPA 4RX7A 3RUPA 3LHJA 4EK8A 2HCKA 4CGAA 4HCTA 4QQTA 2ZMCA 1PMUA 3OW3A 5BMSA 1JSVA 3FYKX 4LOQA 5K5NA 4NCTA 2OJFE 2YJSA 3EYHA 4FEXA 4FTTA 5DR9A 3HDNA 5B2LA 4FKWA 3OXTA 3BCEA 1KE5A 3R8UA 3V5TA 5L2TA 3S2PA 4BDJA 5JGBA 4IX4A 4HVHA 3MWDA 2QG5A 3LFSA 2PMLX 2W9FB 4FL1A 4XCUA 5AP1A 3AT2A 4TWOA 2IVSA 1YRPA 5EYKA 3RPYA 3ZEWA 2GQGA 5LYJF 5FXQA 4I5MA 2OFVA 5J95A 3DY7A 4AT5A 1Z2PX 2YWPA 2GHGA 1WR2A 3BHHA 3QKLA 3FI4A 4XYFA 4BDGA 2G2IA 1ZZ2A 4XS2A 2XK3A 3GQIA 2GHLA 5KO1A 4MKCA 2ZV2A 3TJDA 3DLZA 5F94A 5KBQA 3AXWA 4FTUA 4ANQA 4BCHA 2NU6B 1MRYA 4M68A 4AXAA 4MXYA 2B1PA 5FXRA 1C3OA 5DOSA 4ZJIA 2ZVAA 2BKZA 2CPKE 3H9FA 4CTCA 1Z57A 3CGOA 5KNJA 5L2IA 3AT3A 3OFMA 4FTOA 5CAOA 3AOXA 2LAVA 3RKBA 2UVZA 3DKCA 1M2QA 3VULA 2ZDQA 2B53A 3IW4A 3WBLA 4BDAA 2BZIB 3H0ZA 4FSMA 1UVRA 5J1VA 3KULA 4FEVA 4JX7A 3FMHA 2R3QA 3TKHA 4LL5A 3BE2A 3ACKA 4TT7A 4I6QA 3MVLA 3LFCA 5CEMA 5IYZF 3Q9XA 4CFWA 4ZTLA 4H58A 5EH0A 5I9XA 2UVYA 4JX3A 3OT3A 4P5QA 3F6XA 4O7SA 1AQ1A 1Q8UA 3OXZA 3LFQA 2C1BA 1ZYCA 3Q52A 1M17A 2GSFA 4V05A 4QSHA 2WMSA 4HPTE 2R64A 1YHVA 2QQ7A 2J90A 3NW6A 1DV2A 4RJ7A 2YM8A 4F7NA 1GOLA 3ACJA 2VTPA 3E3BX 5EHLA 4B6LA 2W6QA 5IISA 3KL8A 2J51A 4XHKB 4FODA 3DKGA 3FI8A 4BF2A 2ZV9A 3LCSA 4JVGA 5D7AA 3RM6A 4B4LA 3QCYA 4YZMA 4D1SA 1GSHA 1JBPE 3UG2A 2VUWA 2UW0A 2XIKA 4G3EA 5FTGA 5HVYA 4ZTQA 2UW3A 3E7OA 4IAFA 5DEWA 2BDJA 3DU8A 5CAQA 3MGYA 4YJVA 1O9UA 4AA0A 3Q6UA 4YZCA 1FVVA 1GY3A 3AC3A 4IX6A 3QUDA 4HGSA 2W1CA 2GNLA 2DUVA 2WTWA 3PZEA 5AFVA 4V04A 4AAAA 3VBTA 3ZM4A 4A9UA 1BKXA 3CQWA 2XRWA 4BRXA 4DTBA 4HNVA 3VS2A 4D5KA 5AA8A 4FIGA 5FUTA 2X8DA 3F61A 2GU8A 3MSSA 3NGAA 3ORMA 3AD4A 1OBDA 1P2AA 2EUFB 3I4BA 3KK9A 1MP8A 2ZB1A 4GKHA 3TDWA 2HY81 3W2CA 2EVAA 4JJRA 4WBBB 3HRFA 3FY0A 1W7HA 2WTCA 4QO9A 3IGOA 3ZFXA 5EYCA 3FMMA 3GOKA 2GNIA 4ASEA 2UZEA 4YJSA 3FSKA 3ZFMA 4UBAA 3WZEA 3HV5A 4AOIA 3ZC6A 2UZWE 3ELJA 3MW1A 2ONLA 3R01A 4QNAA 1J7UA 3W10A 2JKQA 4WKQA 3HRCA 2IPXA 4BCIA 4ZSAA 2WGJA 4X7QA 4ZMEA 2ERKA 3V8SA 4LMNA 3N4UA 5CAPA 2YM6A 2PMIA 3U51A 5FNVF 5JSMA 4JAJA 3CTQA 5GHVA 1Q61A 3G8CA 3FAAA 3ORNA 2BAKA 3CS9A 3UQFA 4Q2AA 5FTQA 2BALA 4EUUA 3ZRMA 4XNEA 4F7SA 2BRGA 4KS7A 5F4NA 2UZOA 4GG5A 3F5GA 5HIDA 4N57A 5ANDA 2W17A 3KRLA 4ACDA 4C4HA 3NPCA 1H25A 4QYGA 4JL9A 2OK1A 4X2GA 4IFGA 4P4CA 3RZBA 2OIBA 3FV8A 3G5DA 3L9LA 4RT7A 4YHFA 2OO8X 2P55A 2WHBA 4O4IF 3DK7A 3HP2A 2XJ2A 4WHZA 4XG4A 3MJ1A 4GT3A 4U3ZA 4BTFA 5A14A 4HYSA 5LXMA 3K3PA 4IDTA 3R5FA 2B7AA 5CNOA 2B0QA 2X8EA 2CLXA 4ZTSA 3QGYA 1FMKA 3OMVA 3W18A 3FBVA 3BLHA 4YAJB 2YS7A 3SRVB 1QL6A 3FJQE 3M42A 4U3YA 1VKZA 3IK3A 4PTEA 3TG1A 2PTKA 5M44A 1BLXA 3DF7A 4IACA 4C4EA 3G0FA 4AZSA 1M6VA 3F3UA 3KA0A 5AIRA 2B55A 5KX8A 5IEYA 4XG6A 1JKKA 4ERKA 2DQ7X 5AIKA 2WIHA 5IQGA 4BDBA 4QTBA 2W4OA 3CPCA 3TNPC 3WIGA 3NUSA 1HOWA 1LUFA 3NUYA 4WG3A 4IMYA 5BPFA 3BGQA 4NJ3A 5CSHA 4YPSA 3QFVA 4TY1A 3U4WA 3I0QA 4L3JA 3HKOA 3U8WA 2J4ZA 4CCBA 3BV3A 4HVGA 2GPSA 1JDEA 5A9UA 4ZZNA 3F5PA 5DT0A 1TKIA 4TYGA 4ZTNA 4YC8A 4FL2A 2PVYA 3LXKA 1YWVA 3DB6A 3LFEA 3MY1A 4C38A 2ZDHA 1YXTA 2VQDA 4MTAA 4HZRA 2UW5A 4N6ZA 5HX8A 1OPKA 4L45A 4C0TA 3C5IA 3QHRA 2PVJA 4XG9A 3W2PA 4FKUA 4L42A 1S9JA 3BELA 1GSOA 3FXWA 3QTRA 3KXMA 3WILA 4ZSGA 1FPUA 2IZUA 4O0YA 4I94A 1SVGA 5IDNA 5J9ZA 3FMDA 3UZTA 3KCKA 3H9OA 2BFXA 3QTZA 4YU2A 2OIDA 4QP7A 5DR2A 3QFFA 4DG0E 3KKVA 2CKOA 3FPMA 4L43A 5KMLA 2UZUE 2QONA 4Y83A 3TV4A 1Q8YA 4DEBA 1PHKA 3HLLA 4O0TA 5KZ0A 2X0SA 4K6ZA 4QNYA 3HEGA 2QO7A 3G9NA 4NTTA 1E4EB 4ASZA 4OTWA 1FBNA 3CJFA 3JY0A 4G3DA 3PY0A 4YBJA 4A9TA 3AX6A 3R8ZA 2UW8A 3PXRA 3R8PA 2CGXA 3BE9A 2VWYA 1W82A 3GU4A 5AP3A 4LFIA 3F2RA 1IR3A 4AE9A 1W83A 5JKGA 4GV1A 2O8YA 4FKQA 5AV2A 2ITVA 1Q99A 2W5AA 2QHMA 4PV0A 3ZUVA 2BDWA 2QG7A 3QKKA 4JBPA 4XG7A 3KXXA 4CRLA 4FYNA 5JH6A 2YCFA 2WQBA 4FIIA 4F0GA 4HCVA 2W5HA 5J2UF 4DFLA 3CC6A 2OH4A 5F20A 1FGIA 5AP5A 3JY9A 2XNMA 2WYOA 2CGWA 3BEAA 4Y73A 4GS6A 3QLGA 5H3QA 4USFA 4DG2E 3PSBA 4P2KA 3C0HA 4LRMA 2OJIA 3R00A 1YWRA 1L3RE 4IZ5A 5CF5A 1JKTA 5G1XA 3R7UA 4PNIA 4EH7A 1PYXA 3FPQA 2PVPA 4LGHA 5AUVA 2B9IA 5FGKA 3TTIA 4HNUA 2XEZA 3QC9A 3HO8A 5IU2A 4O81A 4AZTA 3ZO3A 2VX1A 5KMNA 2OGVA 3PLSA 3GXLA 3BV2A 2QU6A 4RJ8A 4U40A 5HG5A 3W2QA 4L1KA 3O96A 2PMNX 2Z7SA 2BAJA 4GKIA 1JKSA 3LMIA 4DFUA 2QKRA 5IA4A 2ZDGA 4BI0A 4IH8A 4W4WA 3QQFA 5CXZA 2IO6A 5CU3A 2VRXA 4X6QC 1JLUE 4YO6A 3ZEPA 4QYHA 4DFXE 2VO7A 3SLSA 4FKLA 2FSMX 2BRHA 3JUHA 5CB4F 2IVVA 3OWKA 4H05A 4O7ZA 4C4FA 4EOOA 3R73A 2Q0NA 3HECA 4P5ZA 3NLBA 5CSWA 4HQ6A 3PJ3A 5C8YF 2QC6A 2VO3A 5GJDA 4PF4A 5DRBA 1W96A 1TQIA 3R7OA 4U6RA 4O84A 2WELA 1XH8A 4FG9A 2B9FA 2QI8A 3GT8A 2HJWA 2R5TA 1KE7A 4BDIA 5BNJA 2W71A 4IB0A 3P23A 2W99B 5BX0A 3G6GA 3Q9YA 4PP9A 2YS6A 1IA8A 5AP2A 1GSAA 4XV9A 4C36A 5DT4A 4R7IA 4FTKA 4WIHA 2CDZA 2VTQA 4EYJA 3BLRA 5CNNA 3HBLA 1H28A 2AYPA 4BIEA 3CQEA 5EM7A 2FA2A 4XP0A 4I92A 4BCQA 3WIKA 4XRLA 2OBJA 4IVBA 5H9BA 2PZIA 4GMYA 1H1WA 1VR2A 2J9GA 3OC1A 3QGWA 5GNKA 1J7IA 1EUDB 4UXQA 4A06A 2C3LA 3ZSHA 4O7RA 1FVRA 3U87A 4ANSA 2ITWA 4XX9A 1K9AA 4CKJA 4IANA 4QT1A 4G2FA 4QP3A 4YJNA 1WVYA 4ERWA 4JR3A 3L9PA 3O8UA 4O22A 4ARKA 4CV9A 2YM7A 3LQ8A 3BYOA 2QOOA 1VZOA 4NKAA 4ZOGA 2XRUA 3V5WA 3RAHA 5HO7A 2PBZA 2FPIB 3EN9A 2W6ZA 3OHTA 5IUHA 1JVPP 4L00A 5DLSA 3L8VA 2G1TA 4EH4A 4G9CA 4EZ3A 4I22A 3ZM9A 1U54B 3VUMA 3QTQA 3MBLA 4GK4A 5BMMA 3LFFA 4BN1A 4E4NA 5D10A 1EYZA 1Z2NX 3A7GA 5HU3A 3UC3A 5HTBA 5HTCA 3PLAE 2BAQA 3VRZA 4LI5A 4KKGA 4AZFA 4I5HA 3KAJA 4H36A 4QMWA 4UYNA 5M4UA 2EU9A 3O71A 3JPVA 4G1WA 2YA9A 4G17A 2X2LA 4G31A 4C58A 4X0MA 2WU7A 4HGEA 4BB4A 5C8NA 4GIHA 5C8KA 3OG7A 3DTCA 2R7KA 1ZAOA 3WZDA 1YKRA 2WQOA 3POOA 4NK9A 3FLQA 5AJQA 3HAMA 4ZLOA 2J0MB 1REJA 4AA5A 4USEA 3AW8A 2QF7A 3S0OA 3NEWA 3PJ1A 4FSZA 3QA0A 3S00A 4HNTA 3PPZA 4ZTMA 3IW5A 4L7SA 2Y6OA 3NNXA 4PDYA 3L8SA 5H8GA 5LCKA 4APPA 5M51A 4ZY6A 2UW7A 4XZ3B 3HNGA 4EH9A 1ZMWA 4FSWA 4MD9E 3BPRA 3FQHA 2F4JA 2HIWA 1UNLA 3TWJA 5M57A 1Q5KA 1STCE 2H9VA 1P4FA 2NRYA 3S3IA 4O27B 5EHYA 1CE8A 3PJ8A 3GC7A 5LMKC 3VQUA 3VUHA 2X0GA 1ZOHA 1WCCA 2FSLX 3KEXA 3VHKA 4NW5A 4RJ4A 1ZZLA 2PSQA 5HIBA 1DAYA 2NNWB 3RCJA 5A54A 5CSPA 4C4IA 1I7NA 3LQ5A 4YTCA 4MNEB 4DFBA 3E8CA 1W0XC 5M53A 5LMBA 4HYIA 3OTUA 3QQUA 1WMKA 3PVBA 1GGOA 5G6VA 5IQBA 3IO7A 4QP2A 5CQWA 2YRXA 2HGSA 5ANKA 2NUAB 1H0VA 2PZ5A 1JSTA 1V0BA 4FNZA 3RMFA 4ANBA 4ZS4A 3OWJA 1OMWA 3A60A 2UUEA 2FYSA 4J98A 4MXZA 3H0YA 4B9DA 5BPHA 1GZNA 5HG7A 4D1ZA 1Q24A 2GQSA 2WTVA 3JRXA 2IZTA 1B6SA 1PMVA 2C6MA 3KXNA 2YFXA 3ET7A 4AX8A 4I6HA 4DEHA 1WBSA 2G15A 2J6MA 3T8OA 4IM3A 4V01A 3W2RA 4CT1A 1OKVA 1OIUA 2QCSA 3FLYA 2EB3A 5AP6A 4MAOA 4O86A 3ZLXA 2I6LA 4NW6A 3GNIB 4GUEA 5HCXA 4C62A 5KHXA 2Y4PA 1UWHA 2EB2A 4I1ZA 4ITHA 2VX0A 3WE8A 1UWJA 2BPMA 2GHMA 4U41A 2XD4A 1Q8TA 3BQRA 3KN6A 4ANLA 4K11A 3WYXA 4QMQA 1NVRA 4XUFA 1OIYA 3JZIA 4W4YA 3ZBFA 2OFUA 2YACA 2WMAA 3VJNA 4XV2A 5EOBA 1JWHA 3W2SA 3II5A 5IQCA 4AGUA 2W06A 1ZMVA 2EWAA 2WZJA 4XRJA 5EW3A 3ODYX 3FXZA 4B8MA 2W1EA 2DS1A 2VTOA 4RX5A 4ZSJA 3EMGA 4J99A 5ACKA 4TWNA 1H1QA 3L1SA 2IZSA 1WFCA 1KBLA 3PE2A 4QMZA 5L2WA 5FP6A 1LPUA 1P5EA 5FDPA 3R2BA 1JDBB 4FVPA 2A4LA 3JXWA 4FT7A 4TPTA 4F65A 1GIIA 4NM3A 5CZIA 4PDOA 5JGAA 1P4OA 4JXFA 2BRNA 2C00A 3UIMA 5CQUA 1LR4A 1OI9A 3QRKA 3Q4TA 4I21A 4JDJA 5AAFA 4BZNA 3ETHA 4PTGA 4O7LA 4F4PA 2PUPA 3CE3A 3RI1A 4ASDA 4FEQA 3OEZA 3OUUA 2GFCA 4BI1A 3EQDA 1JPAA 5LP6F 3D9VA 3WARA 4GK3A 5HE2A 5BVDA 4DTKA 4QMUA 3V4ZA 1TVOA 3ZMMA 2BTRA 2QOCA 4RVLA 4ALWA 5EI6A 1YVJA 1IA9A 5EI2A 4DLJA 4EQUA 1OL7A 4UWBA 4ZSLA 2ERZE 4EWHA 3PDTA 4XH6A 3TCPA 3KF4A 4X2FA 4IB5A 4EOJA 3GENA 3GUBA 3LMHA 1R0PA 2W5BA 4GCJA 4MXXA 5EW9A 3R9RA 2UW6A 3ZOSA 3FEGA 4K77A 2Z2WA 3WYYA 3EQFA 1KWPA 3C4FA 3PXQA 2XBAA 1OIQA 4MV4A 5L6WL 3DNDA 3KC3A 3KMWA 3OWLA 3QUEA 4J95A 4EBWA 2I0VA 4GRBA 4F64A 1GZ8A 1KJQA 4LV8A 2WOTA 5AUUA 3UMXA 2E2BA 4K18A 2GS2A 4M67A 3MA6A 4O0WA 2R86A 2C47A 1M7QA 5DWRA 1L8TA 5A4CA 2GCDA 3KXHA 1YHWA 4LOPA 3TM0A 3OZ6A 1CMKE 4FZDB 3D5VA 4NFMA 3LLAA 1MUOA 5HICA 3QXOA 3POZA 3PXKA 4BCGA 3PP1A 3VBQA 2R0IA 5EKOA 2VU3A 4I4TF 3FQSA 3D15A 1VBGA 5E4HA 4AGCA 2W4KA 3RP9A 3TEIA 5BVKA 2SRCA 4YNEA 3BLQA 1YOJA 1APME 2GFSA 3IGGA 5IUGA 3R7YA 2QODA 3V04A 4ZZOA 3DPKA 5M4FA 4M0ZA 2F9GA 5GIOE 1SVEA 3D0EA 3PTGA 4GL9A 4L52A 1E1VA 2UW4A 3ENMA 5DYJA 4TWCA 4E20A 1PRYA 3Q32A 3KULB 5H8EA 4F9BA 2PVKA 4QMVA 5BUJA 4RRVA 4CFMA 4PL4A 4RZQA 2AUHA 4N4SA 4XYMB 3QAME 3D7TA 3QC4A 4DBNA 3B8RA 1UNHA 2C6KA 3A61A 3BU6A 3PVUA 1BI8A 4WUNA 3D5UA 2YM4A 3NUPA 3U54A 5AP4A 4HVIA 1Y8GA 4JR7A 2C3JA 2UZDA 3BYSA 4V0GB 4TL0A 2GTNA 4HNFA 4M14A 4EC9A 4JG6A 1XR1A 2VTRA 4O0UA 5EM8A 2R4BA 3BGZA 4WOVA 2QLUA 2YRWA 4E5AX 3MB7A 4FR4A 4XEYA 5CF4A 3SC1A 5A4TA 1YQJA 4X2KA 4NKSA 4NT4A 4YJPA 3U9CA 4O7VA 5CYIA 4I3ZA 5JZNA 3UVPA 2A27A 5LQFA 4BGGA 4GJ2A 3FUPA 4JQ8A 5DE2A 5T3QA 1EHIA 5F9EA 2P0CA 5E7RA 4BGQA 4E8AA 4RVTA 3A62A 1YOMA 4YJRA 3MPMA 3BEGA 4FFNA 4NJDA 4ALVA 3DBFA 2FSOX 3IQ7A 3DNEA 3BYMA 3UPZA 4EOPA 4MEDA 4Y46A 3N9XA 4E5WA 5BQ0A 4ACHA 4L7FA 3UZRA 3DTWA 5JFXA 3DLSA 1ZXEA 1WVWA 3PWDA 4RX9A 4YTFA 2YDJA 5BVFA 2X39A 4NSTA 3ZRLA 4W8DA 4TW9A 4D58A 3PA4A 4U9AA 3CTJA 4YJTA 1KJJA 4O4JF 2VTHA 3DK6A 3F82A 3HMIA 5E90A 3WF5A 3UOJA 4E4XA 4C7TA 2V22A 3LP8A 2WXVA 3I5ZA 3F66A 4OTHA 4WRSA 2VTMA 1YI6A 2W05A 2XM9A 3EQBA 4EKLA 3AC8A 4O2AF 4C5CA 2I40A 4TYHB 1Y8YA 3FKLA 2CGVA 2XKDA 3N4VA 4G34A 4GVJA 4P90A 3DOGA 4EWQA 3ZYAA 5C1OA 5CS6A 4IWDA 3GCPA 3ZLWA 3E87A 4YB8B 2PVLA 3EZVA 2HZ4A 3R28A 2V5QA 4FVQA 4M12A 5C03A 4TNDA 2WOUA 3CD8A 3CBLA 3DJ5A 4U80A 5CASA 3Q1KA 4LUEA 1DV1A 1WBTA 2WTJA 4ZP5A 5KX5F 4DG3E 4DEEA 4EL9A 4FU0A 4AZWA 3HAVA 2B54A 4EH3A 3HB9A 1X8BA 4K2RA 3E8EA 4BIBA 2E9NA 4Z16A 1EZ1A 3NIEA 4GK2A 4QMTA 4KINA 2PWLA 3R04A 4F1OA 4PMPA 5H80A 4N70A 3FZPA 3EFLA 2JDOA 3PRFA 4RJ5A 2PUIA 3B2TA 2QOBA 3CY3A 4Q5EA 3ITZA 4FV9A 4KAOA 2ITQA 2PVNA 4PDPA 4U79A 3QUPA 1NA7A 2YW2A 3GGFA 2CCIA 1UV5A 3MI9A 4L3LA 3SKCA 3VWAA 2XVDA 5EK7A 3W8LA 3MTLA 4E6CA 3NAXA 3ORPA 4RIWB 2BCJA 4HPUE 5FEEA 3VF9A 1W8CA 3LJ1A 3DV3A 1W84A 3ORIA 2XNGA 4YAKB 3KN5A 4F1MA 4BCPA 3Q6WA 3OUKA 4H39A 4CEGA 3M2WA 3TI1A 4I6BA 3WO1A 2IZRA 3VS5A 3Q53A 4RIYB 5CAEB 1GNGA 3TT0A 5AA9A 1MQ4A 2VR1A 3BWJA 1W98A 3CP9A 4MBJA 4PQNA 3SD0A 3W1FA 3CEKA 1WBPA 3MWUA 3QZGA 4FV3A 3HUCA 4DGLC 3BG5A 4QRCA 2ESMA 2BKKA 3FKNA 4QP6A 2XUUA 3LQ3A 4IVAA 4O7TA 1EH4A 2VGOA 1QMZA 3SW7A 1A48A 2C6TA 2UZLA 2XK8A 3BI6A 2XNEA 3GP0A 3LJ2A 3CIKA 3OT8A 4OLIA 1Y57A 4UEUA 4CCUA 2B52A 1CKJA 4RFZA 3DA6A 3U4UA 4M8TA 3LXNA 4D0XA 3TW6A 3QL8A 3DJ7A 2NP8A 3QKMA 3QRUA 3NUXA 4C61A 2VWIA 1H8FA 2VN9A 4FX3A 4DBXA 2HXLA 3SGCA 2ITZA 3UMWA 3UZPA 4MCVA 3UVQA 4FK3A 3UO5A 3U9TA 2PVFA 2ZM4A 4II5A 1O6YA 2OZAB 4IZOA 3KXZA 3WF8A 5LMKA 3QZIA 4M7IA 3GFEA 3BWFA 4YUQA 4AGDA 5ANGA 2IN6A 4F6SA 3UOKA 4QP9A 4JT3A 4QP4A 2YABA 1PYEA 3P08A 5KMJA 3QYWA 2J2IB 2XKEA 5K9IA 2I87A 5J1WA 4JRNA 2HXQA 5E8ZA 4FT3A 2J0JA 3ZU7A 3I6WA 4HGTA 4K1BA 1T36A 4NM0A 3DAEA 3N51A 3OS3A 5IQHA 4KSPA 4RVKA 1JQHA 3EL7A 4QMMA 3FXXA 3QQJA 2R82A 1VYWA 2CMWA 3AT4A 5ANOA 4RJ6A 3PA3A 3UTOA 3T3UA 4AW1A 4MWIA 3GOPA 3GC0A 2JFLA 4X2JA 3ALOA 3GU7A 3NNVA 4C5BA 4Z7GA 1QCFA 5ETIA 5HD7A 3RK5A 4BKJA 4ZAUA 2CLQA 3I60A 4FSRA 1KOBA 5BMVF 1YXSA 2P3GX 1B38A 1OZ1A 3C7QA 4YHJA 4JRVA 4CFXA 1WBNA 4YLLA 2R87A 4I50F 4TYIA 1Q3DA 3K5HA 3RNIA 3NS9A 3RPRA 3K3JA 3OD6X 3VS3A 4RZVA 5LOHA 3UNJA 4MWHA 3FC2A 3PJCA 5EDQA 3RK9A 4O0SA 2C6OA 4MNFA 3IW6A 2XYNA 3TNHA 3LFAA 2W1DA 2WIPA 4MH7A 5K4IA 5DMXA 4ZHQF 5DPVA 3I7BA 4FV1A 5CSVA 2C5XA 4OTFA 3T3VA 5AM6A 1G8AA 1DM2A 1M52A 1QPDA 4RVMA 2Z8CA 1F5QA 2P33A 5C26A 3NUUA 3EN4A 3BYUA 3OXIA 4JI9A 5JRSA 1CQJB 3Q60A 2E9VA 3R02A 4KIPA 2OF4A 3IW8A 3Q5ZA 2XCKA 3HA6A 4DGGA 3LFNA 4UALA 3E93A 1Z9XA 2F7EE 5IA0A 5TO8A 1OKYA 4B8LA 4DGMA 5B7VA 3EFJA 5HG8A 4A9RA 3LXPA 4GH2A 4EQMA 3GCUA 4E6QA 2C5YA 4GFGA 5EQEA 4G9RA 3FE3A 3FYJX 3LM0A 5HBEA 2XP2A 4A7CA 1I44A 1U5QA 3P5KA 1LEZA 4IIJF 4JQ7A 1XBCA 3OW4A 3QRIA 1K2PA 5C27A 2W9ZB 4ZY5A 1KSWA 2QR8A 3NSZA 3SOCA 1VEBA 5LA6F 3HMMA 4LG4A 3EQRA 4I4FA 3MIYA 2UW9A 4RIXB 4X2NA 4QP8A 3OOGA 3V5QA 2RFNA 3SG8A 3GB2A 3HUBA 4GU9A 1DAWA 2HWPA 2YHVA 1OUYA 1PXJA 5E1SA 3V8TA 3MWEA 5EW8A 4EC8A 4MV3A 2JLDA 2C5VA 4FKPA 4B99A 3HA8A 4DEGA 2DWCA 4I4EA 1ZY4A 3ZC5A 3EIDA 2X9EA 1H0WA 1OGUA 1GZOA 2XBJA 3DZOA 3F2NA 3FMEA 4IJPA 3ZS5A 4J7BA 3MH3A 3EKKA 4YHTA 4DFZE 4JDIA 1YI3A 3ID6C 4FSTA 2ETKA 1Q8ZA 4I0RA 4MVFA 5CU2A 4OR5A 2C6LA 5AM7A 4FNYA 4FOCA 3RM7A 4DH1A 4WNOA 5HBHA 2FO0A 5C01A 3VHEA 4DYMA 1R1WA 2HZIA 2NU7B 5IQEA 2BROA 3FLSA 4A9SA 4AFEA 3MPTA 4BICA 3E8DA 1FINA 3K5UA 5HEZA 1V0PA 3GU5A 5ITAA 3F69A 5CX9A 3TUCA 4AQCA 4OTQA 5LVNA 2F2CB 5EYMA 3G15A 4MV9A 5CU6A 4ZTRA 4DITA 5F1ZA 3VO3A 3W2OA 3C4WA 3SA0A 3MN3A 3QLFA 3FZRA 2YIXA 2X7OA 2OJGA 4DCEA 3TUDA 3P7CA 3GC8A 3SHEA 4FZFB 4RWJA 1OVEA 3A7HA 3G33A 3ZZWA 1JKJB 2WKMA 1FOTA 5CT7A 1FQ1B 4IM2A 4J97A 1CSNA 3R6XA 4FKOA 4FUXA 4WNPA 3LFBA 5J9YA 3R8VA 4PL5A 4FG8A 4E6AA 3HZTA 3UC4A 4D55A 4FFMA 3L9NA 2RFEA 5HO8A 4O2ZA 4H1MA 2WU6A 3EFKA 3F5UA 3AC2A 3QTSA 5K3YA 5C8MA 5GINE 3IOPA 2I80A 4G3CA 4MV8A 3BRBA 2C0TA 2YDIA 1CM8A 1ZYSA 2YIWA 3PXYA 3Q2JA 2O3PA 2P2HA 3EJ1A 5HLPA 5M07A 5KHWA 4IX5A 4FSQA 2JBPA 4IM0A 2XK6A 3ETAA 3ANQA 3VOTA 4BZDA 1BX6A 2VD5A 2V7AA 3HMPA 4FT9A 4K8AA 3LLTA 3UVRA 4DH3A 4EJNA 2PY3A 3G6HA 4XJ0A 1A9XA 4R1VA 2ITYA 3WZUA 1KV2A 3O17A 1BL7A 2OLCA 4G16A 3R1YA 3NNUA 4HJOA 1UA2A 4YZDA 4DEDA 4BHZA 4U97A 1ZOEA 5CENA 2I8CA 2YZMA 3SV0A 4YTHA 4BR3A 4ZZMA 1H01A 4O4LF 4TRLA 5EDRA 3W33A 3SRVA 1KOAA 3FQEA 2XNBA 4HCUA 2FSTX 4UWCA 5T6KA 2BZHB 3QD2B 2OIQA 2OXXA 4MHAA 5KKRC 1SM2A 3C5UA 3ETJA 2X8IA 2QK4A 2X2MA 2C6IA 4R7BA 3WE4A 3RFCA 2J5FA 4M13A 4XLVA 4QYYA 3RPOA 3IDBA 3UIXA 3ZLSA 3A7JA 4JBVA 4S31A 4BVUA 3IKAA 5FEQA 2LGCA 3H10A 5HE0A 3TNWA 3PVGA 4F0IA 4Z3VA 4DH8A 4EOLA 3ROCA 2HAKA 2VNWA 3UG1A 5LOVF 4DLKA 2NRUA 2WTKB 4N0SA 1UU7A 3ROYA 4R6VA 3V6RA 2XIRA 4H3QA 1UU8A 4YP8A 3MB6A 2PN1A 1OBGA 3QTUA 2ZYBA 5CWZA 4S2ZA 2R7IA 3H30A 2HY0A 1ZYDA 3TNQB 2GNFA 3E88A 2CNUA 3DFCB 4C4JA 4BCNA 4S33A 5AV3A 2GPHA 2AC5A 2W6MA 1ERKA 4ZI7F 3O23A 4J53A 1I09A 3EHAA 3E7VA 4BCJA 2FPGB 3F3WA 1ZLTA 2YZLA 4PWNA 3QRTA 2ZDUA 4FKSA 4FBXA 4HOKA 5DIAA 3HDMA 4KBKA 2ZB0A 2J7TA 2QHNA 3TV7A 2YJRA 4D4YA 4YO4A 4APCA 5HQ0A 4FC0A 4KIOA 4YLKA 3O8PA 1PY5A 1V0OA 4FG7A 1OM1A 5BVOA 5BPYA 2ZV7A 1URWA 3ODZX 3PUPA 1R39A 1WBVA 3LIJA 4XG8A 4DF3A 5AV1A 4KSQA 4QQJA 3KQ7A 5HORA 1JOWB 1RE8A 2RIOA 2X9FA 4IWQA 4XBUA 5ACBC 3UPXA 2C3IB 3UNKA 3V5PA 4CD0A 3O7LB 4J52A 3C4XA 1IASA 2WB8A 3QF9A 1KE8A 4ZJVA 2CKEA 2JITA 5AP0A 5IZFA 5JEBA 4M69B 4WBOA 2F49A 1PX2A 3FMLA 4CG9A 2YZAA 2GNGA 4CG8A 4ZLZA 1SCUB 3LFDA 5BVEA 2PVHA 3R1SA 4ENXA 1E4EA 4AGWA 2YCQA 1LP4A 1OITA 1OKZA 2BIYA 3DBEA 3FSFA 2C0OA 5A46A 2A2AA 3DGKA 3RPVA 4G3GA 3GU6A 3WO0A 1M2RA 3NAYA 2WD1A 1KJ9A 4NTSA 3RHKA 2OXYA 2ITTA 1BNCA 5FM2A 5J5SA 2BFYA 5LVOA 2ZJWA 4RJ3A 4AACA 2BZKB 1PK8A 4DE4A 4BDKA 3RINA 4EKKA 4BDEA 5KMOA 3K5IA 4LL0A 4S30A 4GSBA 4RPVA 2B4SB 3F5XA 5EI8A 3V6SA 2HZ0A 3LAUA 4MF1A 4FUYA 4Y85A 2B9HA 5J2TF 5JQGF 3MA3A 4JS8A 4N6YA 5A4LA 1M14A 3TIYA 5DRDA 4U0IA 4X3FB 3V01A 3PY1A 4Z7HA 4MX9A 5JQ8A 2C69A 1O6KA 4EOIA 3VA7A 3WZKA 3RJCA 5M4IA 2PPQA 4YJ3F 3ZXTA 5CU4A 2DYLA 4O6EA 4BI2A 4CV8A 4AZEA 5AV4A 3U6JA 1Z2OX 1RDQE 5KUPA 5L6OA 4C37A 4GIIA 4XP2A 5GJFA 3HL7A 1F3MC 2HENA 3UBDA 4D4VA 4ZSEA 4CLJA 3C13A 3R5HA 3SE7A 3A4PA 3PIZA 4G6LA 2YWVA 4H3BA 3R8MA 4EZ5A 1GIHA 5CEQA 4CRSA 2PULA 5AX9A 2F57A 3FLWA 1NVSA 4HGLA 3WF9A 5I4NA 5HNIX 1VBHA 3D7ZA 1BI7A 1AGWA 3OUZA 2V59A 4EH5A 2J0LA 2PK9A 3DQXA 3COIA 3RAIA 3ZHPC 4DA5A 4MD8E 2EXCX 4DAWA 5FM3A 5HZNA 4YJOA 4WBNF 2WAJA 4I5PA 2PVRA 3P1AA 2WQNA 3KB7A 2CGUA 3D2KA 2WTDA 4Q9SA 3R1NA 4GT4A 3PVWA 2C3KA 3S4QA 4D2RA 1DIKA 3HVCA 5M55A 4QYFA 5FBOA 2VTNA 1OKWA 1YXUA 2FH9A 1JKLA 3QWKA 3R71A 4EOSA 5CAUA 4OW8A 4MXOA 5B2KA 2ETMA 4C4GA 2R85A 3AMYA 3H9RA 5E8TA 4EH2A 4WD5A 3O8TA 5E8WA 3UIUA 2BZJA 1VJYA 2V62A 4EI4A 3TL8A 5CLPA 1PJKA 3ZZEA 5BVNA 3TDVA 2W1GA 4FTRA 4M97A 5IG1A 5K4JA 3VUDA 4IWOA 3WF6A 3QQGA 3QBNA 4I0TA 4I23A 1J1BA 4DT9A 5EQYA 5HVJA 4QYEA 2WO6A 4OUCA 4CFFA 4L53A 3LM5A 4GU6A 3QX4A 4E5BA 1IOVA 4M15A 5HE3A 5KE0A 2GPWA 5TKDA 4Y8VB 3KY2A 5BYZA 4IHJF 3DB8A 3PWYA 4YGAA 3BHYA 2OICA 3P78A 4WA9A 4Y72A 2GDOA 2X6EA 4O7WA 3LE6A 3NMUF 4F6UA 4W4VA 1Q3WA 5DH3A 4MAMA 4YSMA 3LJ0A 5C4LA 3KREA 4YMJA 3EH9A 1XKKA 5KKRB 3FI2A 5JFVA 3DXNA 4LMUA 4R3RA 4IIRA 2UZTA 4GW8A 3W8QA 4O0RA 2BVAA 5BUIA 4FKRA 5LARA 2UZNA 4LOOA 4KB8A 2RGPA 5CANA 4ZK5A 1IAHA 2OF2A 1OL5A 2DIKA 3EFWA 4EGJA 3LKMA 4TNBA 3OTVA 5L8KA 3I1AA 2R9SA 4OBOA 3UQCA 4IZAA 4OBQA 3W32A 5L8JA 4O7YA 3NNWA 4RGJA 3UODA 4RWIA 4FKJA 2HZNA 2BRBA 3KMUA 2YITA 3WZJA 4MXAA 3MVMA 3S95A 4BZOA 3BHUA 4F9CA 2O64A 3NVMB 3RK7A 2WMVA 4ACGA 3MJFA 3CD3A 3BYVA 4RA4A 1PKGA 4E6DA 3A8XA 4YR8A 5J7HA 4MV6A 1KC7A 4DGOA 3R7IA 4I20A 3UNZA 1CS0A 1EUCB 5GIPE 2CZGA 4BY9E 1ZYJA 2PU8A 2VWVA 4HW7A 2Y7JA 3FZSA 4HYHA 5LCJA 4GYGA 3A4OX 5ETFA 3KF7A 2GS7A 3ZDIA 2XJ1A 4IAKA 2W6OA 5E8YA 1PXPA 2XIZA 2ETRA 1PMEA 1GZKA 5CEOA 2A1AB 2JEDA 2R3RA 5EZYF 4CKIA 4D2SA 1OB3A 3KXGA 5IQAA 4C59A 4IX3A 2QU5A 3EN7A 4OTIA 5T68A 4DFYA 4QTEA 3VW6A 2OWBA 3PZHA 4FGRA 4NM5A 3ZCLA 4DEIA 3VUKA 4ZMFA 2YYAA 3KRXA 4O6LA 3LCTA 1T45A 4HZSA 1XWSA 3WNZA 2BHHA 3H3CA 4OTGA 2BHEA 3VNTA 5FQDC 5CTPA 5C1QB 1ZRZA 3QU0A 2WMWA 1M0WA 3DCVA 4MBIA 5CVGA 3IS5A 3TZ8A 4DFNA 2PYWA 4F63A 3EKNA 1H07A 4ZOLF 3F88A 2PZRA 3UE4A 4EYMA 3QWJA 4FYOA 4FKGA 4JG8A 2ZM3A 2B9JA 2VWZA 4RQVA 3RALA 2R3IA 3VVHA 4C3FA 4FFOA 2IWIA 2Z60A 3GFWA 3QA8A 3FWQA 2ITPA 5C4KA 1Q4LA 1XO2B 2Y4IB 1BXRA 1A9UA 4FV8A 3VS6A 5ETAA 4QTCA 3R9NA 2A0CX 4L8MA 2X7FA 3K54A 4FL3A 3QCXA 3G2FA 1MQBA 4XBRA 3ZDUA 3GLKA 4S32A 3R83A 2VTAA 1R78A 2V7OA 4RSSA 1PXOA 4XP3A 5CI7A 4Q9ZA 2BTSA 2OI4X 3IECA 5J87A 2JDVA 4FV5A 4QMSA 5IA3A 3DBDA 4IC7A 2DZDA 1BYGA 4YJ2F 3KU2A 4LRKA 3FL4A 3VAPA 2O0UA 3SOAA 5CAVA 4JBQA 2NPQA 3UP7A 2BR1A 4AS0A 5LWMA 4R5YA 4DT8A 4C35A 3SVVA 2J0KA 3R1QA 4OBPA 4EHZA 4L67A 3V3VA 2Q0BA 3FLNC 3CPBA 4WUAA 4EK3A 4MD7E 3N6RA 4KA3A 4BYJA 1ZOGA 4CQEA 3ZONA 1SVHA 5HLWA 3QQHA 5DVRA 3SQQA 4KBAA 4RC2A 4BCOA 5JVDF 1PKDA 3FZOA 4M9UA 3COMA 3RAKA 3VUIA 3NUAA 3ZRKA 3O50A 4E4TA 2BIKB 4CZUA 1A06A 4FV7A 3MJ2A 4PUZA 4UXLA 2XNOA 2VPQA 2Z7RA 3NVKI 3ZH8A 5KMKA 3FI3A 4MQ1A 5AUWA 2HOGA 4I41A 4KBCA 4O7NA 4HYUA 3ERKA 3RPSA 4L3PA 4FA2A 3HGKA 4O4HF 4J71A 3RCDA 1E9HA 4HR7A 5TF9A 1LEWA 4EH8A 5HX6A 3NYXA 3PE1A 4AWIA 2YZNA 2C6DA 2UV2A 3TKIA 3EOCA 4IVDA 3JVSA 5HD4A 2W4JA 5IQFA 3EZRA 3CXWA 5EDPA 4ACMA 1H26A 3NR9A 4RIOA 4DCAA 2Y6MA 3FZ1A 4EOKA 1PXNA 2QO2A 4TWPA 4QMYA 5CEPA 5HIEA 4O0VA 2XMYA 2GNJA 4FZAB 5CVFA 2RKUA 4J1RA 4ORKA 4YTIA 4DN5A 5IMEA 3AD6A 4ZJJA 3S1HA 2YL2A 5TT7A 5FEDA 2IP4A 2FUMA 2VO0A 5IQDA 4O2PA 3EQHA 3P7BA 3OY3A 3OCBA 3VPCA 5E1EA 3AC5A 4QQCA 1ULZA 5HGIA 4DIMA 3BIZA 1R0EA 1HCKA 4FNXA 5JN2A 3GC9A 2GQRA 5H2UA 3TV6A 2JIIA 4NUSA 2P0AA 2WPAA 4U7ZA 4XYLB 2R3LA 5C1PA 4IAYA 4EEVA 3Q4UA 3ZXZA 3M11A 3LCOA 3PSDA 5JZJA 2PZPA 3MESA 3ZSGA 4FSNA 3VC4A 4CMUA 2OKRA 3L9MA 3KCFA 3U9SA 4F9AA 4R1YA 3ULZA 4DC2A 4PNKA 2BUJA 2I0HA 3F3VA 4RA5A 2ZDTA 1SMHA 5LVMA 3KMMA 4IAIA 1XHAA 2C30A 5AEPA 2VWUA 4ONAA 4IZYA 2E9UA 4RFYA 2C4GA 2BILB 3QX2A 2G2HA 2E9PA 5M06A 3VMMA 1J7LA 2YM5A 2YERA 4BTMA 1U4DA 5D7VA 2YCSA 3CGFA 2OLSA 1DI8A 1WBOA 1FGKA 2XNNA 4XOZA 4DH7A 2XK4A 2OH0E 2Z02A 3Q96A 4HVSA 2W6PA 4PTCA 2YDKA 5M09A 2VX3A 4GFOA 4JIAA 4DEAA 4E7WA 3Q4CA 2OZOA 2RF9A 4R5SA 1H27A 2C68A 5DT3A 4A4OA 5IUIA 4IAAA 2R7MA 2Z04A 3OOMA 4TV8F 1KUTA 4F7LA 4F09A 3ORQA 4UX9A 3MFRA 1Q8WA 4CKRA 5I9YA 2WMUA 4F99A 2JBOA 3MH0A 3F7WA 4C33A 4FSYA 1OL1A 3VPBA 3F3ZA 3U55A 2X2KA 3HV4A 4E1ZA 2QOHA 3F9NA 4FZ7A 2VTSA 2J5EA 2OXDA 3DXPA 4JNWA 1TQPA 5IA5A 3M1SA 5LVLA 5FP5A 4V0GA 4U45A 3TQTA 2X1NA 3P9JA 4KUJA 2VNYA 4LYNA 3AC1A 2PE2A 4QQ5A 3TZ9A 4B7TA 4F1TA 3FZTA 4RC4A 5IA1A 2XKCA 4NIFB 5IH4A 3KALA 3FY2A 4M3QA 3ZO2A 2V5AA 4A9YA 5HNGA 4RC3A 2O2UA 4AU8A 5JMSA 2I7QA 4PX6A 1UKHA 4IDVA 1KV1A 4FTIA 4HVDA 4AF3A 3OCTA 2V55A 1M7NA 3VIDA 1C30A 4IE9A 3KGAA 3HV3A 3OWPA 4G3FA 3FDNA 2QO9A 3C4CA 1PXLA 2CSNA 3ANRA 3MV5A 3QD4A 4RMZA 4J8MA 4CT2A 3SXFA 1G8SA 1PF8A 4YZBA 3THBA 5JGDA 2R3OA 5HLNA 5AUYA 3VN9A 5ANIA 3NYOA 1W93A 1SNXA 3CQUA 3R30A 2WTKC 5B0XA 2Y8OA 3V8WA 3ZUUA 5A4EA 2O65A 2WFYA 5FBNC 1H00A 3PP0A 5FDXA 5FTOA 5HHWA 4AG8A 5KMMA 5KZIA 2XM8A 5CI6A 5IMXA 3G8DA 3PIYA 4FK6A 1XH5A 4XOYA 5CT0A 4K33A 4Q5HA 5EM5A 5GJGA 1OECA 3DDQA 4TYHA 4AT3A 3LXLA 3TINA 2XA4A 3TIIA 2Q83A 4J8NA 4EHEA 2R3KA 1PMNA 4PL3A 2IVTA 4ALUA 4IWPA 5IEXA 4E73A 3FMJA 5HV6A 3MH1A 5AWMA 2BMCA 4QPSA 4BDHA 2H34A 2QOKA 5AAEA 3LWBA 5DEYA 3VBYA 1ATPE 2ACXA 4WSYA 3IPHA 3AGMA 4H1JA 4WT6A 2YIRA 4F08A 4XMOA 5EYDA 4Y5HA 4TYEA 5IQIA 4D0WA 3ZUTA 2E9OA 2W1HA 1Q62A 3Q2MA 5ETCA 3UO6A 1G3NA 2KTYA 4EHGA 3EL8A 3R9OA 3GQLA 3SX9A 1IEPA 3B8QA 4BDFA 5LXTF 2J50A 2PUUA 4BYIA 2CJMA 1YDRE 5FRIA 1CDKA 2XK7A 1BL6A 2W1FA 5AX3A 5FD2A 2W7XA 4C2WA 2EXMA 3RAWA 3IDPA 3ENHA 4CZTA 4F9YA 3QQKA 1BUHA 4PRJA 5AUXA 4LM5A 5KMIA 5D11A 2IJMA 1KJ8A 4RIWA 4X6RA 1URCA 4M0YA 4EBVA 4EQCA 5CEKA 5JK3A 1RW8A 4I0SA 4O83A 1GJOA 3E5AA 2CN5A 2NO3A 1Q97A 3DS6A 3NUNA 3D83A 5EG3A 3O0GA 4RIYA 2JIUA 4TTHB 2YAAA 3DBCA 5HCYA 2I0EA 4KRDA 5I9UA 2ZMDA 3UYTA 5JRQA 1B39A 2H8HA 3BKBA 2HYYA 2XZSA 4IFCA 3DKOA 2ITXA 4TKSA 3LCDA 1IAJA 4NL0A 2XIYA 4D9UA 4A4LA 2W1IA 3E5NA 2DWBA 2X81A 4FZ6A 2FPPB 3UFXB 4KD1A 2PL0A 1XBAA 3A2CA 1ZY5A 4TZRA 1REKA 4CLIA 5CSXA 5A6NA 2W6NA 1WAKA 4A4XA 4X3FC 3RWQA 3GCQA 3REPA 3AMBA 4FTCA 4IC8A 4FTLA 3AMAA 2ITUA 1F0QA 4YBZB 3OY1A 1FMOE 4MBLA 5AMNA 3TNIA 2JDTA 3PRIA 3ZO4A 1BMKA 3NCGA 4MA5A 1YHSA 3UOLA 4G5JA 2JIVA 3EQGA 3JS2A 4FV0A 2R3GA 2UZVA 4FTNA 4R3PA 4XLIA 4RX8A 3DJ6A 3QXPA 3VS1A 5LMAA 5AADA 5M56A 4KKHA 2QD9A 4I5CA 5E8XA 1YXXA 5HKMA 4L68A 2WNTA 3AGLA 3EQCA 2GLTA 2OZAA 3KAKA 3PA5A 5A4QA 4O91A 2WMBA 4BHNA 4BCKA 3QCSA 2BDFA 2F7ZE 4RFMA 3SDJA 3HX4A 2JKOA 4FTMA 1JLLB 4YJUA 5JT2A 3PYYA 4X21A 2GMXA 1NY3A 3I5NA 4L46A
chains in the Genus database with same CATH superfamily
4FEUA 1I2LA 3KRJA 5LWNA 5BVWA 4I24A 4ZTHA 3F3TA 4I6LA 4UZDA 3KK8A 5E92A 4EZ7A 3UO4A 2SCUB 2R3NA 4DQNA 3COHA 3L8XA 1KEEA 4TV9F 4EGQA 3NW7A 5DGZA 5BYLA 4RCNA 1XH9A 4UCOA 4NH1A 3QD3A 3U6HA 1SNUA 1QPCA 1J3HA 4W8EA 4YZNA 4FTQA 5CXHA 4F70A 3ORKA 3ORTA 5EM6A 3OBJA 5HNBA 2W70A 3TEKA 5EHOA 3R9DA 3R23A 2W96B 4GFMA 4BC6A 2UZBA 3GU8A 5AV0A 4KIQA 5IDPA 5I0BA 2YN8A 4KWPA 2ZAZA 3V4SA 4LV5A 5D9HA 4UV0A 3WOWA 4EK6A 3QTIA 2VAGA 3K3IA 3SG9A 2HK5A 3GEQA 2IW8A 4AN3A 4BTJA 1PW2A 4RG0A 3MFUA 2I0YA 2I1MA 4UB7A 2VWBA 1CKIA 1JSUA 4BBFA 3N8DA 2JKKA 2G2FA 5HBRB 2W1ZA 5M08A 4JLCA 2RG6A 3F2AA 4UZHA 4HNIA 4MXCA 2PMOX 4XV1A 3MS9A 5DFPA 2XIXA 3CR0A 5DA3A 5LJJA 2JAMA 4BDDA 3MH2A 1V1KA 3C50A 3OEFX 3BU3A 4ZXTA 2QNJA 4RLLA 3D4QA 3I6UA 4U81A 1KJIA 5DN3A 3QQMA 4ME6A 4EH6A 2Z7LA 3G51A 3C51A 3PPKA 4K9YA 4KS8A 3UIBA 4C3PA 5TR6A 4AOJA 4FIEA 5IA2A 5IH5A 1R3CA 1NW1A 4I6FA 4PMSA 4UN0C 1XMLA 3AC4A 3OVVA 4GUBA 2COGA 1SZMA 4R78A 3BBTB 3KYHC 3LMGA 3VBVA 4FV2A 4EORA 4U42A 5BUEA 5AAGA 1MRVA 2CNQA 2JDRA 4IHPA 5ICPA 1H1SA 3HV7A 3O51A 3IW7A 4OGRA 4UY9A 5D1OA 3W0RA 3E64A 2REIA 1YXVA 4RQKA 2YCRA 3RV3A 5IPJA 1AUXA 2R3PA 3HT5A 5AUTA 3E3PA 2XNPA 5J9LA 3RVGA 5IEVA 4QPAA 2IG7A 2YAKA 2OJ9A 3R7VA 5DAAA 1XH6A 3ZO1A 2HW7A 1WVXA 4KABA 4R77A 4RIXA 4Z9LA 4DINA 4EG0A 3R8LA 2JD5A 3MVJA 2V0DA 4O0XA 4EK4A 3MDYA 2XYUA 4I55F 3I7CA 2A19B 3O2MA 4BTKA 5KCVA 4IB3A 5HBJA 3PG3A 4U43A 4QTDA 4FFRA 4JDKA 3WI6A 4OTRA 3EYGA 5DNRA 5CU0A 3V51A 3MY0A 3JRWA 4FKIA 1NXKA 2JC6A 3P5JC 4U8ZA 5I5ZA 1CKMA 5J8IA 2ZM1A 3NRMA 4B0GA 1KE9A 4FSUA 4UYAA 3Q9WA 4JIKA 4D4RA 3D94A 3W1GA 4EOQA 3NBYB 4NCTC 3AD5A 2X7GA 3TACA 3D14A 5CALA 4TUYF 5KKNB 4ITJA 1U5RA 4NU1A 3HP5A 4RBLA 3QALE 3R21A 4O96A 3MIAA 4Y8DA 2C1AA 5DG5A 2IW9A 3BZ3A 1U46A 1Y6AA 2OG8A 4PDSA 1CTPE 3DZQA 2CFMA 3TXOA 1H24A 3A7FA 3CKWA 3P79A 3DBQA 2C0IA 3K5VA 3QTWA 2XK9A 3E63A 2GS6A 3TIGA 4JG7A 3ORZA 4AXDA 3GB8B 4CMTA 4FEWA 5CF8A 3FKOA 2OJJA 4AN2A 5DR6A 1T46A 4PMTA 5D1JA 3V5LA 1E1XA 1NVQA 4AA4A 5HI2A 5I9ZA 3VQHA 2YM3A 5E8SA 2HHFA 3DAKA 4GYIA 2QOLA 4GT5A 4AT4A 1G5SA 3NDMA 4D28A 3F7ZA 1NT2A 1S9IA 4FIJA 2RG5A 2Z7QA 3Q5IA 1H1PA 2RL5A 3DFAA 4BCFA 3U6IA 4K0YA 1TFFA 1K3AA 2CHLA 3BGPA 4FV6A 4CTBA 5HVKA 4C2VA 3G0EA 3JYAA 1GIJA 3ORXA 3Q2OA 5A6OA 3KVXA 4NYEA 2V58A 3T9DA 5IH6A 4XG3A 2ZOQA 2Y4IC 4DHFA 2PZYA 4AW2A 4Z55A 5JQWA 3EN5A 3GVUA 3T9TA 5CZHA 2VTTA 3BHTA 4E93A 4XG2A 2VWXA 1PXMA 2QLQA 3TUBA 5E8UA 4FT5A 2JKMA 4I93A 1OPJA 4U5JA 4PY1A 4YZ9A 2R0UA 1GAGA 1OUKA 2P4IA 1ST4A 3PSCA 4FIFA 4CFNA 1PXKA 2PE1A 3AG9A 1IRKA 2QOFA 4XV3A 3I81A 3PIXA 3W16A 2FVDA 4JAIA 4MV1A 3UYYA 4S34A 3D2IA 4KRCA 5F95A 3GCSA 4MYGA 5JFSA 3IOKA 2Q2UA 3RWPA 1Y91A 2G9XA 4EK5A 2EIYA 3UGCA 1P14A 4XX0B 3SAYA 3BA8A 4L44A 1OL6A 4C02A 5DHJA 4ASXA 3T54A 5BWTA 2XCLA 1XQZA 4ZIMA 4RWKA 2R3FA 1WBWA 3JVRA 1I1KA 3C0IA 3Q3BA 4DH5A 1ZARA 3OP5A 2CKPA 3R7EA 2OSCA 4CMFA 4FE2A 5CA1F 4P7EA 2JAVA 4D4SA 2AC3A 2XH5A 4RZWA 5BYYA 4QMLA 4WNKA 3T9CA 2OU7A 3LOKA 1FVTA 4F6WA 3OBGA 2P2IA 4LQMA 3TZ7A 4WO5A 4JDHA 2VGPA 5FXSA 3V5JA 1Y6BA 2IW6A 3DAJA 4ZEGA 3W0SA 4WRGA 2PUNA 4R7HA 5D41A 1O6LA 4CXAA 1OIRA 5BWVA 4QTAA 1H1RA 3D5XA 2O63A 3LPBA 1PXIA 4YC6A 4AE6A 4TN6A 4IB1A 4M84A 3VBWA 1JNKA 3ORLA 3PXZA 4L9IA 1XH7A 4E4MA 4LGGA 1Z5MA 5E8VA 1OPLA 2VTIA 2JGZA 3LVPA 3VBXA 2F2UA 2GTMA 4BBEA 2RFDA 3BU5A 1I1MA 1QPJA 2J9MA 3R22A 4IZ7A 3VS0A 3TTJA 1YI4A 3DKFA 3IDCA 5I9WA 2CKQA 5CA0F 3B2WA 1DI9A 3ATTA 4QP1A 3I79A 4IEBA 5H8BA 2X6DA 3NYNA 5D8DA 5A3XA 4F7JA 4FICA 1GLVA 1DS5A 3C0GA 3IONA 3CSVA 3FHRA 4JBOA 3UOHA 4D5HA 5BWUA 3CY2A 3RGFA 2ONLC 2XJ0A 4FKVA 3EB0A 1UU9A 3QTXA 4IVCA 4YJQA 3KFAA 4FTJA 2WMQA 4CFVA 4ZLYA 3UYSA 2XB7A 3A8WA 4AZVA 4A07A 3K2LA 3QQLA 3VF8A 3ZLYA 4QMNA 1RQQA 3GI3A 3Q9ZA 3QZHA 4G5PA 4NM7A 4YBKA 4RWLA 5AP7A 3HRBA 2H6DA 5EOLA 4F9WA 4CVAA 1OL2A 5L6PA 2WMXA 3ZTXA 1G8KA 5IF1A 4F0FA 5CF6A 3G90X 1YWNA 4O38A 4YNOA 4FMQA 4USDA 5CY3A 3D7TB 5HE1A 3O7LD 1VYZA 3P7AA 4FVRA 2CNVA 4CFUA 5LVPA 2WEIA 3PPJA 3UJGA 4NZWB 3GCVA 4AN9A 2VTJA 3HMNA 2YZGA 4MQ2A 2FP4B 2X4ZA 3L8PA 4ZQIA 1UKIA 3OCSA 2BRMA 3T9IA 4MK0A 4YLJA 2G01A 4EONA 4ZS0A 3DXQA 1YOLA 5EFQA 3PY3A 4ANMA 4O82A 3CJGA 1U54A 2PHKA 3OROA 4KNBA 2QR7A 4JQEA 2R3HA 3JZFA 1KE6A 3FMKA 2QURA 3MFTA 4NFNA 4NWMA 4AW5A 4UCTA 4IJ9A 3KRWA 1ZMUA 1J1CA 4PMMA 2CCHA 2R84A 2HW6A 3H4JA 2C5OA 3I12A 4DHIB 2VUGA 5JH7F 2VO6A 4WNMA 4FNWA 5HU9A 5FPRA 2WMRA 3FHIA 3MVHA 2R7BA 2WQMA 4KKEA 4X3FA 3ZSIA 4IAZA 3VW8A 3LW0A 1YDTE 2XCHA 3OUNB 4DGNA 3W0MA 4W4XA 5ANJA 3BHVA 1I7LA 2CN8A 3VS4A 3R63A 2HVSA 1CKNA 4DLIA 4IQ6A 5L8LA 2OW3A 3R2YA 4IBMA 2YEXA 1IG1A 5KBRA 2W0JA 5B2MA 3UQGA 4AOTA 2DLNA 4GVAA 4C5AA 2NU9B 4YC3A 3NZ0A 2WEVA 4FV4A 4TYJA 4ACCA 3FLZA 2YIQA 5E9EA 5K5XA 2R7LA 4BIDA 3DK3A 3QCQA 3RHXA 3U9NA 1JAMA 2QOIA 3LZBA 2Y9QA 3NYVA 4FOBA 4AFJA 2VZ6A 3EQIA 2XEYA 1YW2A 3PJ2A 5FLFA 3RV4A 3SXRA 4BDCA 2XARA 2FB8A 3ATSA 3VRYA 1HCLA 4EJ7A 3BQCA 4L6QA 2J0IA 4WG4A 2ITNA 2C6EA 2Y0AA 1YDSE 2WMTA 3OCGA 2F7XE 2UVXA 3CCNA 4ITIA 4FTAA 3R9HA 4AUAA 3ALNA 2X4FA 4CMOA 4LUDA 5JVLA 4MV7A 3N4TA 1AUVA 1H08A 5FG8A 1M0TA 5CVHA 4BCMA 4MNEA 3VUGA 1Q41A 2HWOA 2VV9A 1TQMA 4ID7A 3RTPA 4O2BF 1M2PA 2R2PA 4FKTA 5JQ5A 2VWWA 3SW4A 4UWYA 3ZFYA 2YIYA 4C34A 2GNHA 1XBBA 5ANEA 3PXFA 4BGHA 4CSVA 3NX8A 4H3PA 4MA0A 5DI1A 3L2PA 3E8NA 2XKFA 1UNGA 3QZFA 4DTAA 1B6RA 1AD5A 4YURA 3PFQA 3SXSA 4R3CA 1CKOA 3CKXA 1QPEA 1XH4A 2FGIA 1H4LA 3G9LX 4G6NA 2AEGA 4D9TA 5D12A 3DT1A 4QMPA 3NCZA 4QMOA 3MTFA 1UU3A 4X3JA 5GONF 3E92A 4RLKA 4CNHA 3R5XA 2O5KA 3D5WA 3Q4ZA 4K6NA 2KULA 5E91A 4Y5QA 3C4ZA 3P4KA 3VS7A 3KVWA 3FC1X 3MY5A 2JDSA 5HESA 3W55A 2XS0A 1IOWA 3FL5A 2HELA 2PVMA 2WTIA 3TIZA 3NW5A 4G6OA 3UDBA 5C9CA 3BX5A 3EQPA 5JFWA 2C5NA 1MRUA 3KRRA 4FT0A 3QYZA 3MFSA 5TOZA 1P8LA 1CQIB 4OT6A 3HV6A 4F78A 4WG5A 4IADA 3BBWA 3C1XA 3P86A 3A99A 2QOQA 4JOAA 4O21A 4OT5A 4Y95A 5M4CA 4PP7A 1B6CB 2WQEA 3MPAA 5EQPA 4E4LA 3OF0A 3GJXB 3E62A 3I0OA 2YISA 2IVUA 3DQWA 5AUZA 1U59A 3ULIA 5DBXA 2XF0A 2PE0A 3FMNA 3HMOA 4FIHA 2JFMA 3CLYA 5CEIA 3UP2A 3GIDA 4CC6A 4AP7A 3VONA 2RFSA 2ITOA 3C4EA 3TKUA 4TXCA 4EHVA 3EN6A 3ORRA 5I5WA 3R0TA 4FGBA 3QWUA 3QHWA 3PG1A 4AQKA 3NIZA 4YSJA 3DDPA 3EWHA 5HCZA 3WF7A 2R3JA 3QRJA 4QMXA 4U44A 4IW0A 2ZV8A 4GEOA 1SYKA 4GLWA 3AQVA 1ZWSA 3VJOA 4YPDA 4BBMA 5EKNA 1WZYA 1J91A 3GBZA 4L01A 4LRJA 4QOXA 3TZMA 2R3MA 3CTHA 3Q04A 1CKPA 4GJ3A 2VTLA 3BACA 4D1XA 3AKJA 3HYHA 3C9WA 2FB9A 3P0MA 3LCKA 4OTDA 4FFLA 3JR1A 4EOMA 4FI1A 4J96A 4AW0A 5L3AA 5L2SA 3MYGA 3IG7A 1RJBA 5HG9A 3TMOA 3NWWA 4ZY4A 3TN8A 4BJJA 3ZBXA 1ND4A 2QVSE 3TJCA 5I9VA 2R7NA 2QKWB 3COKA 4GG7A 4E26A 2H96A 3QD0A 4C3RA 1XJDA 3WWIA 3A7IA 4EUTA 4FFPA 4RX7A 3RUPA 3LHJA 4EK8A 2HCKA 4CGAA 4HCTA 4QQTA 2ZMCA 1PMUA 1A0GA 3OW3A 5BMSA 1JSVA 3FYKX 4LOQA 5K5NA 4NCTA 5DGIA 2OJFE 2YJSA 3EYHA 4FEXA 4FTTA 5DR9A 3HDNA 5B2LA 3BA9A 4FKWA 3OXTA 3BCEA 1KE5A 3R8UA 3V5TA 3W0NA 5L2TA 3S2PA 4BDJA 5JGBA 4IX4A 4HVHA 3MWDA 2QG5A 3LFSA 2PMLX 2W9FB 4FL1A 4XCUA 5AP1A 4TM5A 3AT2A 4TWOA 2IVSA 1YRPA 5EYKA 3RPYA 3ZEWA 2GQGA 5LYJF 1G2WA 5FXQA 4I5MA 2OFVA 5J95A 3DY7A 4AT5A 1Z2PX 2YWPA 2GHGA 1WR2A 3BHHA 3QKLA 3FI4A 4XYFA 4BDGA 4QDEA 2HGXA 2G2IA 1ZZ2A 4XS2A 2XK3A 3GQIA 2GHLA 5KO1A 4MKCA 2ZV2A 3TJDA 3DLZA 5F94A 5KBQA 3AXWA 4FTUA 4ANQA 4BCHA 2NU6B 1MRYA 4M68A 4AXAA 4MXYA 2B1PA 5FXRA 1C3OA 2HIVA 5DOSA 4ZJIA 2ZVAA 2BKZA 2CPKE 3H9FA 4AAYA 4CTCA 1Z57A 3CGOA 5KNJA 5L2IA 1XK5A 3AT3A 3OFMA 4FTOA 5CAOA 3AOXA 2LAVA 3RKBA 2UVZA 3DKCA 1M2QA 3VULA 4LDTA 2ZDQA 2B53A 4UCUA 5I5SA 3IW4A 3WBLA 4BDAA 2BZIB 3H0ZA 4FSMA 1UVRA 5J1VA 3KULA 4FEVA 4JX7A 3FMHA 2R3QA 1WRVA 3TKHA 4LL5A 3BE2A 3ACKA 4TT7A 4I6QA 3MVLA 3LFCA 5CEMA 5IYZF 3Q9XA 4CFWA 4ZTLA 4H58A 5EH0A 5I9XA 2UVYA 4JX3A 4JXUA 3OT3A 4P5QA 3F6XA 4O7SA 1AQ1A 1Q8UA 3OXZA 3LFQA 2C1BA 3T9EA 1ZYCA 3Q52A 5BWXA 1M17A 2GSFA 4V05A 4QSHA 2WMSA 4HPTE 2R64A 3TY5A 1YHVA 2QQ7A 2J90A 3NW6A 3PFYA 1DV2A 4RJ7A 2YM8A 4F7NA 1GOLA 3ACJA 2VTPA 3E3BX 5EHLA 4B6LA 2W6QA 5IISA 3KL8A 2J51A 4XHKB 4FODA 3DKGA 3FI8A 4BF2A 2ZV9A 3LCSA 4JVGA 5D7AA 3RM6A 4B4LA 3QCYA 4YZMA 4D1SA 1GSHA 1JBPE 2HVRA 3TY8A 3UG2A 2VUWA 2UW0A 2XIKA 4G3EA 5FTGA 5HVYA 4ZTQA 3U0GA 2UW3A 3E7OA 4IAFA 5DEWA 2BDJA 3DU8A 5CAQA 3MGYA 4YJVA 1O9UA 4AA0A 3Q6UA 4YZCA 1FVVA 1GY3A 3AC3A 4IX6A 3QUDA 4HGSA 2W1CA 2GNLA 2DUVA 2WTWA 3PZEA 5AFVA 4V04A 4AAAA 3VBTA 3ZM4A 4A9UA 1BKXA 3CQWA 2XRWA 4BRXA 4DTBA 2DAAA 5E25A 3VS2A 4D5KA 5AA8A 4FIGA 5FUTA 2EJ0A 2X8DA 3F61A 2GU8A 3MSSA 3NGAA 3ORMA 3AD4A 1OBDA 1P2AA 2EUFB 3I4BA 3KK9A 1MP8A 2ZB1A 4GKHA 3TDWA 2HY81 3W2CA 2EVAA 2COIA 4JJRA 4WBBB 3HRFA 3FY0A 1W7HA 2WTCA 4QO9A 3IGOA 3ZFXA 4MUQA 5EYCA 3FMMA 3GOKA 2GNIA 4ASEA 2UZEA 4YJSA 3FSKA 3ZFMA 4UBAA 3WZEA 3HV5A 4AOIA 3ZC6A 2UZWE 3ELJA 3MW1A 2ONLA 3R01A 4QNAA 1J7UA 3W10A 2JKQA 4WKQA 3HRCA 2IPXA 4BCIA 4ZSAA 2WGJA 4X7QA 4ZMEA 2ERKA 3V8SA 4DDIA 4LMNA 3N4UA 5CAPA 4UCVA 2YM6A 2PMIA 3U51A 4IWXA 5JSMA 4JAJA 5FNVF 3CTQA 5GHVA 1Q61A 3G8CA 3FAAA 3ORNA 2BAKA 3CS9A 3UQFA 4Q2AA 5FTQA 2BALA 4EUUA 3ZRMA 4XNEA 4F7SA 2BRGA 4KS7A 5F4NA 4E6NA 2X5RA 2UZOA 4GG5A 3F5GA 5HIDA 4N57A 5ANDA 2W17A 3RR5A 3KRLA 4ACDA 4C4HA 3NPCA 1H25A 3NBZB 4QYGA 1EKVA 4JL9A 2OK1A 4X2GA 4IFGA 4P4CA 3RZBA 2OIBA 3FV8A 3G5DA 3L9LA 3AKKA 4RT7A 4YHFA 2OO8X 2P55A 2WHBA 4O4IF 3DK7A 3HP2A 2XJ2A 4WHZA 4XG4A 3MJ1A 4GT3A 4U3ZA 4BTFA 5A14A 4HYSA 5LXMA 3K3PA 4IDTA 3NC0B 3R5FA 2B7AA 5CNOA 2B0QA 2X8EA 1ST0A 2CLXA 3QGYA 1FMKA 4ZTSA 5FR9A 3OMVA 3W18A 3FBVA 3BLHA 4DHZA 4YAJB 2YS7A 3SRVB 1QL6A 3FJQE 3M42A 4U3YA 1VKZA 3IK3A 4PTEA 2OWOA 3TG1A 2PTKA 5M44A 1BLXA 3DF7A 4CHIA 4IACA 4C4EA 3G0FA 4AZSA 1M6VA 4EQ5A 3F3UA 3KA0A 5AIRA 4Q4DA 2B55A 5KX8A 5IEYA 4XG6A 1JKKA 4ERKA 1UC9A 2DQ7X 5AIKA 2WIHA 5IQGA 4AXEA 4BDBA 4QTBA 2W4OA 3CPCA 3TNPC 3WIGA 3NUSA 1HOWA 1LUFA 3NUYA 4WG3A 2NYAA 4IMYA 5BPFA 3BGQA 4NJ3A 5CSHA 4YPSA 3QFVA 4TY1A 3U4WA 3I0QA 4L3JA 3HKOA 3U8WA 2J4ZA 4CCBA 3BV3A 4HVGA 4LV7A 1JDEA 2GPSA 5A9UA 4ZZNA 3F5PA 5DT0A 1TKIA 4TYGA 4ZTNA 4YC8A 4FL2A 2PVYA 3LXKA 1YWVA 3DB6A 3LFEA 3MY1A 4EFBA 4C38A 4PZ6A 2ZDHA 1YXTA 2VQDA 4MTAA 4HZRA 2UW5A 4N6ZA 5HX8A 1OPKA 4L45A 4C0TA 3C5IA 3QHRA 2PVJA 4XG9A 3W2PA 4FKUA 4L42A 1S9JA 3BELA 1GSOA 3FXWA 3QTRA 3KXMA 3WILA 4ZSGA 3PUFC 1FPUA 2IZUA 4O0YA 4I94A 1SVGA 5IDNA 5J9ZA 3FMDA 3UZTA 3KCKA 3H9OA 2BFXA 3QTZA 4YU2A 2OIDA 4QP7A 5DR2A 3QFFA 4DG0E 3KKVA 2CKOA 3FPMA 2QB5A 4L43A 5KMLA 2UZUE 2QONA 4Y83A 3TV4A 1Q8YA 4DEBA 1PHKA 3HLLA 4O0TA 5KZ0A 2X0SA 4K6ZA 4QNYA 3HEGA 2QO7A 3G9NA 4NTTA 1E4EB 4ASZA 4OTWA 1FBNA 3CJFA 3JY0A 4G3DA 3PY0A 4YBJA 4A9TA 3AX6A 3R8ZA 2UW8A 3PXRA 3R8PA 2CGXA 3BE9A 2VWYA 1W82A 3GU4A 3NFGB 3BL9A 5AP3A 4LFIA 3F2RA 1IR3A 4AE9A 1W83A 5JKGA 4GV1A 2O8YA 4FKQA 5AV2A 2ITVA 1Q99A 2W5AA 5FPOA 2QHMA 4PV0A 1FVIA 3ZUVA 2BDWA 2QG7A 3QKKA 4JBPA 4XG7A 3KXXA 4CRLA 4FYNA 5JH6A 2YCFA 2WQBA 4FIIA 4F0GA 4HCVA 2W5HA 5J2UF 4DFLA 3CC6A 2OH4A 5F20A 1FGIA 5AP5A 3JY9A 2XNMA 2WYOA 2CGWA 4CKCA 3BEAA 4Y73A 4GS6A 1ZYLA 3QLGA 5H3QA 4USFA 4DG2E 3PSBA 4P2KA 3UDZA 3C0HA 4LRMA 2OJIA 3R00A 1YWRA 1L3RE 4IZ5A 5CF5A 1JKTA 5G1XA 3R7UA 4PNIA 4EH7A 1PYXA 3FPQA 3UDSA 2PVPA 4LGHA 5AUVA 2B9IA 5FGKA 3TTIA 4HNUA 3BL7A 2XEZA 3QC9A 3HO8A 5IU2A 4O81A 4AZTA 3ZO3A 2VX1A 5KMNA 2OGVA 3PLSA 3GXLA 3BV2A 3CSWA 2QU6A 4RJ8A 4U40A 5HG5A 3W2QA 4L1KA 3O96A 2PMNX 2Z7SA 2BAJA 4GKIA 1JKSA 3LMIA 4DFUA 2QKRA 5IA4A 2ZDGA 4BI0A 4IH8A 4W4WA 3QQFA 5CXZA 2IO6A 5CU3A 2VRXA 3T9AA 4X6QC 1JLUE 4YO6A 3ZEPA 3DAAA 4DRFA 4QYHA 4DFXE 2VO7A 3SLSA 5CM0A 4FKLA 2FSMX 2BRHA 3JUHA 5CB4F 2IVVA 3OWKA 4H05A 4O7ZA 4C4FA 4EOOA 3R73A 2Q0NA 3HECA 4P5ZA 3NLBA 5CSWA 4HQ6A 3PJ3A 5C8YF 1P16A 2QC6A 2VO3A 4NZMA 5GJDA 4PF4A 5DRBA 1W96A 1TQIA 3R7OA 4U6RA 3TY9A 4O84A 2WELA 1XH8A 4FG9A 2B9FA 2QI8A 3GT8A 2HJWA 2R5TA 1KE7A 4BDIA 5BNJA 2W71A 4IB0A 3P23A 2W99B 5BX0A 3G6GA 3Q9YA 4PP9A 2YS6A 1IA8A 5AP2A 1GSAA 4XV9A 4C36A 5DT4A 4R7IA 4FTKA 4WIHA 2CDZA 2VTQA 4EYJA 3BLRA 5CNNA 3HBLA 1H28A 2AYPA 4BIEA 3CQEA 5EM7A 2FA2A 4XP0A 4I92A 4BCQA 3WIKA 4XRLA 2OBJA 4IVBA 5H9BA 2PZIA 3W5OA 4GMYA 1H1WA 1VR2A 2J9GA 3OC1A 3QGWA 5GNKA 1J7IA 1EUDB 4UXQA 4A06A 2C3LA 3ZSHA 4O7RA 1FVRA 3U87A 4ANSA 2ITWA 4XX9A 1K9AA 4CKJA 4IANA 1TAEA 4QT1A 4G2FA 4QP3A 4YJNA 1WVYA 4ERWA 4JR3A 3L9PA 3O8UA 4O22A 4ARKA 3UZBA 4CV9A 2YM7A 3LQ8A 3BYOA 2QOOA 1VZOA 4NKAA 4ZOGA 4AXFA 2XRUA 3V5WA 3RAHA 5HO7A 2PBZA 2FPIB 3EN9A 2W6ZA 3OHTA 5IUHA 1JVPP 4L00A 5DLSA 3L8VA 2G1TA 4EH4A 4G9CA 4EZ3A 4I22A 3ZM9A 1U54B 3SGIA 3VUMA 3QTQA 3MBLA 4GK4A 3W1BA 5BMMA 3LFFA 4BN1A 4E4NA 1VS0A 5D10A 1EYZA 1Z2NX