4O82A

Saicar synthetase (type-1) in complex with adp and amp in both chains
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-1) in complex with ADP AND AMP in both chains
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 73
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o82A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o82A02
4XOZA 3R22A 5LOHA 2C6KA 3A7FA 4Y72A 3K5UA 4YLJA 5K3YA 1KJIA 3CY3A 1FVVA 3V4SA 3KU2A 1RJBA 4JDJA 3GCUA 4ZJJA 2BKKA 1OMWA 1H24A 2VTIA 4O2ZA 3LMHA 4CG8A 1GY3A 4Y95A 4DFYA 2REIA 4F9AA 4EC9A 3MDYA 3MI9A 4ALVA 4FIFA 4OLIA 4AN2A 1OIYA 3KVWA 3MBLA 4HNVA 4FT7A 2NO3A 2B7AA 2DYLA 4WIHA 4YBKA 3FKOA 3U9TA 3W1FA 3IK3A 4C59A 2J0IA 1UV5A 4FV3A 5DH3A 3DXQA 3RCJA 3CS9A 4UYAA 4ZTNA 3O96A 4YHFA 5C9CA 4XYLB 4F0FA 4MV9A 4HCVA 4D58A 3UOKA 2WB8A 3VF8A 2C30A 2R64A 2DUVA 3QKKA 4IVDA 4RX8A 1RDQE 2DS1A 3CKXA 3F5XA 3DPKA 4L3PA 1W8CA 2HXQA 4F7NA 3NRMA 5KBQA 3FC2A 2PZRA 5IH5A 5JQ8A 2R86A 1QPCA 3QLFA 3VNTA 4YR8A 4I6BA 4K0YA 4OTHA 5ACBC 5EZYF 5CQUA 1NVSA 3K3PA 4IMYA 4AN3A 2XK9A 4IJ9A 2QHNA 3QUEA 4R5YA 1NVQA 1IOWA 4F9WA 4RJ7A 4ASDA 3KY2A 1PMEA 2YCSA 3G9LX 2ETRA 3KMMA 2QODA 3OOGA 5FRIA 4AGDA 3AC8A 3QRUA 2GNLA 4YUQA 1DV1A 3R00A 5DIAA 4G16A 1YXXA 2C69A 2ACXA 1WFCA 3B2TA 3QGYA 4LUEA 5EDPA 4ANQA 3VS3A 3C0HA 2YCFA 3CPBA 1YOJA 3U51A 5ITAA 4PNKA 4YAKB 2PVYA 4YPSA 4FFRA 2GNJA 3AT4A 1FMOE 4G3GA 5EM7A 3ELJA 3DKCA 4FE2A 5AUTA 4ZEGA 5L3AA 4MKCA 3Q9XA 2Z2WA 3OS3A 1J3HA 4L7SA 2PVLA 4XHKB 5EH0A 3MYGA 2XMYA 4RC3A 3DK3A 1XJDA 3ZUUA 2YWPA 2BIKB 3ITZA 2GSFA 3ORKA 4S30A 1PHKA 1NVRA 1YVJA 2G9XA 5DYJA 3TKHA 4BTMA 4EOIA 3H4JA 3QZHA 3C4FA 4IH8A 2WZJA 4KKGA 1Z2PX 3FKNA 4NU1A 5B2LA 4FV6A 5EFQA 1Y8YA 3R30A 3Q9YA 5CU4A 2F7XE 3MJ1A 4OTGA 3CC6A 2JDVA 3EL7A 2BUJA 2RFSA 1HCLA 2UZNA 4LOQA 5E8TA 4BZNA 3FLZA 3CLYA 3QTUA 5H8BA 4ZIMA 5EDQA 1H0VA 3RWPA 1H8FA 4FI1A 1SCUB 4FOCA 4XX0B 2OLSA 5K4JA 3BYOA 2VO7A 3HMMA 5AMNA 4QP4A 3MJFA 4LV8A 2QURA 3QQFA 4S2ZA 1TVOA 2PBZA 2Y4IC 3KFAA 5DG5A 3VS7A 4F7JA 3AC1A 4MD9E 5FG8A 3MB7A 4K6ZA 3RINA 2AC3A 4LG4A 3OUNB 4H39A 2YIWA 4LMUA 5FDPA 3MH3A 5I4NA 3FLWA 4FTKA 4TV9F 2A19B 3GGFA 2V7AA 3BPRA 3EN6A 3T9TA 1ND4A 4FKVA 1IA9A 4XG6A 4A9UA 2VU3A 4U45A 2DIKA 4PNIA 3MS9A 4C61A 2PUUA 4ZTMA 5E8XA 1Y6AA 4MF1A 2IWIA 3LMGA 3PSCA 4O7RA 5BYZA 4ZSJA 4GCJA 3HP2A 1H07A 2YZLA 3W18A 4BGGA 2ZDQA 1OKZA 5JFWA 2R3HA 3AQVA 3W55A 4ERWA 2WQBA 5E8ZA 4Z7GA 4LGHA 2UZVA 4JT3A 4O6EA 1ERKA 3R7UA 4A4LA 3RPVA 4FYOA 4QOXA 4X2NA 4EOOA 5L2WA 2O65A 4U9AA 4EEVA 3QHRA 5J2TF 4RX7A 1Q8YA 3TT0A 2FGIA 3NIEA 1XH5A 4AAAA 2P2HA 3NUUA 3H9OA 4WG3A 3TEIA 2JBPA 4ENXA 3QAME 2WTIA 4JIKA 4EH5A 2VTJA 3H9FA 3TNQB 3WYYA 2XA4A 3KRRA 3IGGA 2WPAA 4K77A 4ALUA 4FNXA 5CEPA 4HJOA 3OXTA 3CTQA 2WMRA 5JZNA 4EH7A 1YXUA 2PVPA 4BCMA 4TYHB 5CAUA 3LFNA 2OG8A 3UTOA 1OPKA 2BCJA 3IOPA 3PPKA 1S9IA 2FSTX 1BI7A 3GT8A 3LCOA 3KGAA 2H9VA 3GEQA 2I40A 5EI2A 4D2RA 2VZ6A 4Y8DA 3U4UA 1BYGA 2WQEA 4L45A 4GK3A 3BRBA 5H8GA 3LXKA 2J5FA 3P7CA 5DRDA 2YFXA 3IQ7A 5KBRA 1OL2A 3G90X 4FSRA 1B6RA 5GIPE 1OIRA 4L7FA 3E7VA 3WIKA 3QU0A 4I5PA 4KUJA 3QA0A 4PP7A 4YC8A 4IDVA 3JS2A 2J0LA 5HLNA 3KALA 5IQGA 4DG3E 4JX3A 4MNEB 3FY2A 3HA8A 3PG3A 2JC6A 3NMUF 4ACHA 4F7SA 5ACKA 4F7LA 4EH3A 4YPDA 4FV9A 1KSWA 2XM9A 3OMVA 4O86A 4O7SA 2SRCA 3AMYA 1W98A 2VAGA 5DVRA 2UZEA 3FY0A 1W93A 2QO2A 3OROA 4G5JA 2VNYA 2GS7A 1QPJA 3ERKA 2CNVA 3EN5A 4EI4A 2WFYA 1U59A 3MH0A 4P5QA 4FT5A 1B6CB 4GKHA 3JVRA 3CD3A 3OUZA 4G9RA 1FGKA 3C0IA 3HP5A 2BMCA 3BGQA 3QRKA 4AP7A 2HJWA 2R87A 2IZUA 2Y7JA 5EW8A 3KRLA 5HTBA 3CKWA 4XS2A 5CEKA 2PE2A 2DLNA 4YLLA 2JFLA 4L6QA 1W7HA 3ZLXA 4XLIA 4FKIA 4DTKA 3RALA 3WZJA 2OJFE 3C4EA 1U54B 2CZGA 2VTOA 5JVLA 5EKNA 4HGLA 4QTDA 4YTFA 4YO6A 3RI1A 4CFNA 2X2KA 3CTHA 5LWMA 3E92A 4LV5A 3RHXA 4RIYB 3QL8A 2V5QA 4AX8A 1VKZA 4C2WA 2PUPA 3KRXA 4QQ5A 3C4ZA 4DITA 2HYYA 4PWNA 5KHWA 4Y73A 3R5XA 4RWKA 3R63A 5DOSA 5CALA 4EQMA 5E7RA 2Q83A 2OLCA 4RWLA 5CENA 3TZMA 4X21A 4GL9A 4IX3A 4J52A 3ZLWA 3R01A 4L68A 1VEBA 3LE6A 2GU8A 3DBCA 4RJ4A 2WGJA 4UZDA 4XNEA 4I23A 5KMMA 3TN8A 1FVRA 1KV1A 4CKRA 3V51A 1JPAA 2XNEA 4PP9A 4D1ZA 3LQ5A 2ITYA 3LFEA 4JL9A 4NCTC 2VPQA 5B0XA 4AT4A 4LMNA 3VQUA 2C5OA 2GPHA 2IN6A 1VYWA 1MRUA 4FNZA 4IFCA 1OPLA 5FEDA 5C1OA 4AU8A 4LRKA 4RJ8A 2X7OA 2VO6A 2YRXA 5FNVF 4FSMA 3NNXA 1H00A 3EFKA 1U4DA 3E87A 2YN8A 3A7JA 1OL7A 1L8TA 2VTTA 3D7TB 1ZYDA 1ATPE 2A0CX 2C68A 1IOVA 2NU7B 2JIUA 3P86A 4O84A 5M57A 2W1ZA 3A8XA 1GOLA 3IO7A 3PJ8A 4D4RA 3MFTA 3PZHA 5BVEA 3ODZX 4ZTHA 5IQFA 1M6VA 2W5HA 3BHTA 3IS5A 2IW9A 4I21A 4I94A 3SXSA 4RVTA 5J8IA 2A4LA 3A60A 1YOLA 4YJ2F 3EKNA 4RGJA 4UYNA 3R28A 4D9TA 5T3QA 3QYZA 3NEWA 4ZLZA 3ZMMA 5A46A 5IQEA 4DGOA 3VRYA 3WZUA 3TJCA 3ULIA 3ZEWA 3CQUA 3I0OA 4X6QC 1JSUA 4PX6A 2ITWA 4BYJA 3G9NA 5FEEA 1Z2OX 4D55A 3FAAA 2IP4A 4S33A 4C3RA 5ANGA 3ATSA 3PA3A 4BDFA 3F2RA 3PY1A 2EUFB 4KSQA 2PE1A 2QOBA 3OWPA 2Y4PA 2ITXA 4LUDA 2JAVA 4J8MA 4QQCA 5CLPA 3I6WA 4QMQA 2CNQA 1W96A 4C5AA 4EH9A 3HO8A 2FSOX 3HRCA 5EYKA 4XP2A 4F65A 4X3FA 3I60A 4U3YA 3UVQA 5HORA 2Y0AA 3II5A 2X8EA 3HMPA 5J9ZA 5ANJA 2H8HA 4FEWA 4D4VA 3HV6A 4QQJA 2WEIA 3ZRLA 4I6QA 4AGUA 3RAIA 2PVFA 2CMWA 3C4XA 1SMHA 3OC1A 2XK6A 5C8NA 1YXTA 5AIRA 2QOKA 4DFZE 3FJQE 4QRCA 4GU6A 3HX4A 4O0UA 3JPVA 3MGYA 4UX9A 4D2SA 2VR1A 4AOJA 4PQNA 1ZMUA 3SXFA 3TV4A 4FG7A 4MQ2A 3VAPA 3ZC6A 4EKLA 3A7GA 3POZA 5JQ5A 4D9UA 3FHRA 4R3CA 4YZMA 4GIHA 2X8IA 4YHJA 3DNDA 4L53A 3DAJA 2FB9A 3FLQA 3MFRA 4XOYA 4F0GA 4FSZA 1KOAA 2CKPA 5EM6A 4D0XA 3O7LB 3E8NA 3F7ZA 3R1NA 5E91A 4TUYF 4I5CA 5CEMA 2WQMA 4EOPA 4EUUA 3F66A 5CSVA 4FTOA 5KUPA 1JAMA 1MP8A 2JKKA 3FXZA 3UO4A 3V01A 2OFVA 2VWIA 3CSVA 4PDPA 3ZO3A 4JLCA 4BBEA 3NUXA 3ZUVA 4F64A 3S0OA 4RFZA 5IQAA 3Q2OA 2OFUA 3VC4A 1TQPA 5AP7A 2R3JA 3QYWA 1PXKA 2ZM3A 3EQPA 3NW6A 3VRZA 3VS2A 3OCSA 3HUCA 4R7BA 4A4OA 1JKLA 5C8MA 3AD4A 4AW2A 5C01A 4U43A 3A7HA 4CFUA 5JQWA 3C7QA 4YJVA 4RZWA 4FKGA 4PMPA 4FFPA 2JKQA 3UBDA 5HD4A 1KE9A 1T46A 5D7AA 4NTSA 3VN9A 3MY0A 2ITQA 3NZ0A 4FEQA 3LHJA 4K1BA 5EHYA 3F9NA 3NPCA 2JEDA 4FKJA 5DLSA 2WEVA 3SOAA 4FU0A 5HHWA 2BTSA 4JS8A 4O0SA 4ZS4A 5HV6A 2W0JA 4UXLA 1YI4A 3NWWA 2C6EA 4PV0A 3R7YA 5HGIA 2VWUA 2OIQA 4NTTA 3P0MA 4DFLA 4F09A 2GS2A 2H34A 2ZMCA 4KNBA 3RPSA 4RWIA 2W4JA 4JX7A 5DT4A 5CF4A 5C8YF 2R0UA 1WR2A 3SHEA 1CKPA 4ZOGA 3P08A 1ULZA 2ESMA 2F7EE 4BCGA 2IW6A 4CZTA 3DFAA 3ZYAA 3AG9A 3QCSA 5AUYA 3UG2A 1CSNA 2V55A 4IEBA 2JIIA 4LRMA 4J53A 2JDRA 4UZHA 1WAKA 5G1XA 3FYJX 5BVKA 3WZEA 3Q3BA 4JR3A 1OPJA 4CCUA 4G3DA 4BCNA 1EHIA 4R78A 2FO0A 4FEUA 3OZ6A 1GIHA 3BU5A 2WXVA 3FI2A 3HYHA 5H2UA 5E8VA 3UPXA 1DV2A 4O7VA 2W6MA 4EGQA 4HVIA 4DT9A 3VS6A 4JAIA 3K3JA 5FTOA 4TXCA 5HCZA 4D5HA 2YCQA 3RM7A 2CHLA 4XG9A 3JR1A 4Y5QA 4CT2A 1ZOEA 2PVJA 4FTUA 2G2IA 4HNUA 2OJGA 3HEGA 3NLBA 5EHLA 2YJSA 3PIYA 4K9YA 3TKUA 1KOBA 2W9ZB 2EXMA 4UV0A 5BPHA 5CF8A 4E8AA 5BUIA 2WHBA 3OW3A 4X0MA 3Q53A 5F4NA 4F70A 4EBVA 3S1HA 2RG6A 3ZSHA 4EH4A 2J4ZA 2YM4A 3E93A 1UU8A 4IX5A 4BI0A 3ZZEA 3ENHA 2XP2A 5T68A 5JGDA 1JBPE 3EN7A 4P90A 4Y85A 3UP2A 5E8UA 3VJOA 3EFLA 1BUHA 3CY2A 4BDHA 4P4CA 3MW1A 3LQ8A 1WCCA 5E90A 4C0TA 3PLAE 2NNWB 5L2SA 3KREA 5AADA 5M4FA 1PMNA 3MH1A 2YZAA 2O8YA 3F2AA 3RAWA 4QP1A 4DGMA 3JRWA 4ZTRA 4FFNA 3E8CA 1VBGA 4CG9A 4J98A 3GU5A 1YKRA 1UWHA 1NW1A 4U40A 2R0IA 1CTPE 5C03A 3V5TA 4GS6A 4XV1A 3ACJA 4Z16A 5BYYA 5AUXA 4DLKA 3CXWA 4O83A 1PXJA 1PJKA 1UNLA 4ZMFA 1H28A 2BRHA 3D5XA 3CJGA 3IECA 3ETHA 4XV2A 3SQQA 2JDOA 3K3IA 4U79A 4R3RA 1PRYA 1Q4LA 3V5PA 3D94A 1IA8A 3BBTB 4C38A 4FIHA 4MV4A 3HDMA 3CTJA 5CZIA 4DEGA 2NU8B 4GMYA 2VRXA 2HZNA 4FX3A 3F6XA 3PXYA 5HNGA 4MV6A 3TINA 3PPZA 2QG7A 2PULA 5ANIA 4AUAA 4DH3A 3E8DA 5DI1A 2YDKA 3ORNA 1A9UA 3PVUA 1MRVA 4NKSA 4EQUA 3VJNA 5HX6A 3U87A 5AEPA 3HZTA 3ZOSA 3WOWA 4LOOA 4O91A 5BMMA 4I50F 5BVNA 2VX3A 5LQFA 1CM8A 1STCE 2PVHA 2J50A 2QOLA 1KJ9A 4PY1A 1M2RA 4C4HA 4NM7A 2C0IA 2UVXA 4IM0A 4WUAA 4HGEA 3NYVA 5AUUA 4JDKA 5J1WA 2X9FA 3DDQA 3DV3A 3OTUA 3VHEA 2WTKB 5IUGA 1R0EA 2Y9QA 1OBDA 4FOBA 1URWA 4C37A 4CSVA 3QUPA 4IAZA 3CE3A 2XBJA 3OEFX 3C5IA 4FTCA 1PK8A 3LCSA 4IE9A 3ZUTA 4APCA 2VNWA 4CD0A 4HPUE 4M67A 2XK8A 5C1QB 4ZHQF 3EHAA 3QC4A 4LL5A 1GAGA 3COIA 4L44A 4R6VA 3UMWA 1AQ1A 4OBPA 2BDFA 2H6DA 4DHFA 5A6OA 2HIWA 4I1ZA 4AW1A 3QRJA 3FZRA 3OF0A 2BKZA 3KC3A 4GFGA 2UZOA 1JSVA 3HV4A 4BN1A 2CGXA 4K18A 4ZOLF 5HBEA 2WU7A 1HOWA 3NUYA 3W8QA 1J91A 2F2UA 4KINA 5KO1A 2I0EA 3QCXA 3TV7A 3R23A 3NR9A 2FH9A 3GOKA 3OXZA 4FTIA 5AV2A 3G0FA 3TTJA 4I6FA 3VS1A 4PUZA 2CPKE 4ASEA 3RV4A 3ZU7A 5M56A 4MXAA 4BI2A 1CMKE 3Q5IA 4E5AX 2XF0A 2W1FA 2C00A 3LW0A 3T3UA 3UVRA 3L9NA 3ROCA 2X81A 2XIXA 3R9DA 1QPEA 5HZNA 4ANSA 5CTPA 4ACGA 3OG7A 2PWLA 5L8JA 2YEXA 1OL5A 3OXIA 4JAJA 3S2PA 4I55F 4I4FA 3K5HA 2FP4B 5EI8A 2HXLA 2UW7A 5ETFA 2YS7A 2C0TA 3QXOA 4A06A 3F5PA 3NDMA 4JNWA 4PF4A 5DEYA 5CNOA 5HVJA 3VULA 4J1RA 2QK4A 3W2SA 2C3LA 4CMTA 3RP9A 2V22A 4IZOA 3N6RA 4W8DA 2ZB0A 1GZNA 4CCBA 5HICA 2I8CA 4RSSA 5I9UA 3DU8A 4HCTA 4NWMA 4OT5A 3ZSGA 2XNPA 4YBJA 4O21A 4BTJA 4QPSA 5LWNA 4EK4A 2OIBA 4CKJA 5AV4A 2QKWB 5K4IA 1T45A 3KL8A 3IONA 3OWJA 4BBMA 2R2PA 4FUXA 4YLKA 1FGIA 2IG7A 4JBVA 5FP6A 2VTSA 4ITJA 4MCVA 3QX2A 3ZXTA 2HZIA 4FODA 1OKWA 4BDDA 5IA3A 4JG6A 5IEXA 3EQGA 4FKLA 2IO6A 2BIYA 1R1WA 4Y46A 2CN5A 5FM2A 4BKJA 4NCTA 4Y8VB 4EORA 5E9EA 4G1WA 4ZP5A 2WO6A 3PXRA 4FG8A 4LGGA 1DI9A 4RIXB 4RX9A 2R7IA 2W17A 4FK3A 3DBDA 3VW6A 4I4TF 3U9SA 1U5QA 3Q6UA 3TQTA 4AOTA 1YRPA 4G2FA 2VTAA 4RPVA 2W96B 5KMIA 4W4XA 3Q6WA 2XH5A 4AA4A 4WA9A 2FUMA 1M0WA 5D11A 3OY3A 3HLLA 4FL1A 3PIZA 5HIBA 5CSWA 2XK3A 4DFBA 5L6PA 2F57A 4O4IF 2IJMA 3ORTA 1XH9A 1FMKA 5AV3A 4O4JF 4O7WA 1H1WA 1XH4A 1Y57A 3D15A 2EVAA 4OBOA 1P14A 4O22A 4HGTA 1XWSA 2NPQA 2XYNA 1NY3A 4YSJA 4GT3A 1F3MC 4IM3A 3NAYA 4CXAA 3I5ZA 4FZ7A 4OR5A 5FEQA 3R1QA 5E8SA 4FZFB 5HLPA 4HVHA 5HCYA 2PHKA 3FLNC 4GH2A 3TWJA 4X3FB 2GDOA 3PDTA 3R6XA 3DQWA 3UO5A 4MA5A 1YDSE 4GT5A 4TYEA 2Z02A 5AP0A 1H08A 2P0CA 3D9VA 4FZ6A 1GZKA 4AZWA 3DBEA 3R8PA 3SRVB 1PX2A 3RK7A 4ZTQA 1P5EA 3I0QA 2YZMA 1OL6A 4ZS0A 3K54A 4BZDA 4GVJA 1S9JA 3MN3A 3D14A 3VPCA 3PA4A 3GFEA 4IZAA 1GNGA 4IB1A 2QHMA 2PSQA 5DRBA 4TWPA 3RKBA 3GIDA 1JLUE 1ZY5A 4HZSA 2ZDHA 2BROA 1E1XA 4O0VA 5AM6A 2VGPA 3GU6A 2FSMX 3D2IA 4DEIA 1UNHA 1APME 2XNGA 3QLGA 3OUUA 4E4LA 4HVGA 2UZTA 2GMXA 3R7VA 3MTLA 4K11A 5DFPA 2KTYA 3WYXA 3GFWA 4L8MA 3ULZA 2QNJA 2W1GA 3DQXA 3UC3A 5CSHA 4G9CA 4G6OA 4KWPA 3FZOA 1GIJA 4IWOA 1CDKA 2X6EA 4ANBA 2W06A 3DF7A 5JZJA 3SV0A 3LFQA 4XYFA 2ONLA 5BVDA 3DCVA 5AP4A 2PTKA 4JQ7A 2R5TA 3COHA 5ANKA 4ZSGA 4Z7HA 5IQCA 5F95A 3O23A 1BL7A 2ZM4A 4O0RA 3K2LA 4AQCA 4OTWA 4TY1A 4BDJA 4IWQA 3O8TA 4IVCA 4R5SA 2CCHA 4RJ3A 2AYPA 4A9YA 4BR3A 5JEBA 3ID6C 5FUTA 4B0GA 5BPFA 1FOTA 3FL5A 3ZO4A 5C1PA 2VD5A 4LM5A 5E8YA 3DY7A 3I4BA 3LIJA 3QQGA 4FKOA 5D10A 5J95A 4EYMA 3K5IA 3FPMA 4IVBA 3EQBA 2P55A 3FI4A 3HV3A 4FBXA 4FSQA 3G8CA 1M0TA 3V8TA 5IQDA 4Q2AA 4TKSA 4WKQA 5A3XA 1H25A 4AWIA 4IIRA 3HMOA 3EJ1A 4ENYA 4ZTLA 1R39A 4ONAA 2WMQA 4JR7A 5KKRC 1UKHA 2UW8A 3Q4UA 2G15A 4TTHB 3AGMA 3ZRKA 4GU9A 5CAVA 4QP8A 4NM5A 3DB8A 2B4SB 2R7NA 3AMBA 3BE2A 2VTMA 2XM8A 3KXZA 3HRBA 4YSMA 5EQYA 3NCGA 1K3AA 4O7ZA 2OZAA 3R9HA 5AP2A 4QNAA 3IW4A 4PMMA 3KEXA 3C9WA 3LVPA 4EGJA 3JXWA 3NVMB 4FGRA 4NZWB 4MVFA 3SOCA 3O2MA 4CTCA 2W6QA 4DH8A 2X39A 2P4IA 2KULA 4KSPA 3RK5A 3ZFMA 5I9XA 1VBHA 2PMOX 2HW6A 3P7BA 3OTVA 3TNHA 4UN0C 3Q60A 3OWLA 2WOUA 4RZVA 4BCQA 4O7TA 2BDJA 4N6ZA 4JBPA 4G31A 4EUTA 2ZMDA 1YHWA 3P5KA 3RFCA 5HG7A 1UA2A 4H3BA 3LFAA 3WILA 2PN1A 4UY9A 1XR1A 2W4KA 2PMLX 4K2RA 2I1MA 3UNJA 4CLJA 2ZDGA 4J8NA 3KF4A 4DGNA 4PL3A 4MHAA 2QR7A 1K9AA 3PJ2A 4GK4A 4E93A 3FZ1A 4EZ3A 3N8DA 3QRTA 2CLXA 2YM8A 3MSSA 3TUBA 2R9SA 4FFOA 3ZO1A 4ALWA 4EHEA 5LMBA 2A27A 4ZAUA 5JN2A 4P5ZA 2OKRA 3L8XA 4OBQA 4R1YA 2P2IA 3R83A 3DJ7A 3KULA 3PRFA 4EG0A 5CB4F 1ZZLA 2PE0A 4P7EA 5HG9A 4B6LA 4WG5A 4KA3A 4DH1A 1GSOA 3FZTA 5EDRA 2HWOA 1Q24A 3EQFA 5DPVA 1QL6A 3ORLA 4O0WA 4E20A 2CLQA 2W9FB 2QLQA 1PYXA 3PVGA 5CU6A 4TNDA 1SNUA 5HI2A 5IUIA 5KZIA 4CKIA 3O0GA 4EOSA 4WOVA 4RT7A 3WF6A 2XKFA 4L67A 2W70A 5DT3A 2XKEA 3NVKI 5HVKA 2XD4A 2VTQA 3BZ3A 4C7TA 4P2KA 4U8ZA 4B99A 4RFMA 5DN3A 2PY3A 4D5KA 3B2WA 4BZOA 5KNJA 4RIOA 4AW0A 5BMVF 4Q5HA 4C4JA 4NYEA 4RA4A 4WSYA 3MVMA 5J1VA 3HUBA 2WIHA 4K33A 4D4SA 3EB0A 3RCDA 3LJ0A 2YITA 2ZJWA 2J5EA 3R21A 1M17A 4UEUA 2VV9A 4EWHA 2GNIA 5H8EA 2FB8A 1I7NA 4S31A 2B54A 4KRDA 3ROYA 3P9JA 5GHVA 1E1VA 3WARA 5FXSA 3MWEA 3JUHA 5LOVF 1O6KA 4M14A 3NUAA 2C3KA 4C02A 3R73A 2JITA 2BALA 1SVGA 3C1XA 2EB2A 4GFMA 2GNHA 1Q8UA 1ZYSA 3DKGA 4IJPA 3WI6A 1Y6BA 3BYMA 4Z9LA 2QOQA 3PA5A 4E4NA 4MAMA 3BBWA 3D5VA 3QD0A 4R1VA 3R9OA 2ITNA 5FDXA 3ATTA 5DR6A 2ZV7A 3LCDA 4Q5EA 2UZUE 2VTLA 4E1ZA 3BYUA 3LJ2A 3LAUA 3TACA 2OXYA 3QZIA 4F08A 5LXTF 4B4LA 1OGUA 5JRSA 4W4VA 5AP3A 4WHZA 3VBVA 3UYSA 3TUCA 3BCEA 4UALA 3UE4A 1EUCB 4O82A 1FINA 4ACDA 5JFVA 1ZMVA 3DJ5A 1KEEA 4MWHA 5EW9A 4U42A 1PKDA 3ET7A 3UQCA 3LFCA 3SGCA 4F4PA 4A07A 3FL4A 4HVSA 3SC1A 3TDVA 1I7LA 3MB6A 1H1QA 2BTRA 3G5DA 3KN5A 1Q8TA 5CQWA 2ZVAA 1FPUA 2A2AA 3EYGA 2P33A 3ZO2A 5IMEA 2H96A 3DXPA 3T9IA 3Q1KA 4FG9A 4AZTA 4FTAA 2WU6A 4QYFA 3SD0A 4C4GA 5C26A 3U54A 2O63A 1I09A 1UNGA 5A54A 1URCA 2OZAB 1E9HA 3PWYA 1YXSA 3A7IA 1JOWB 3OW4A 4FTNA 4IC7A 3I7BA 4CLIA 4Y83A 3ZBFA 4QMYA 4GIIA 3D0EA 4PL5A 1J7LA 1U46A 4IC8A 3RM6A 4S34A 5F1ZA 3S3IA 5LARA 3UIUA 1WVWA 4N4SA 4ACCA 5KMNA 2XNNA 1FQ1B 4YZCA 4AG8A 4IZ7A 4O6LA 4YMJA 5AAEA 2QU6A 3RZBA 2UW6A 4AGWA 1H1PA 2GHGA 4YTCA 3SA0A 1QPDA 3F88A 5G6VA 5CU2A 2ZB1A 2UW5A 3QHWA 2YAKA 4NSTA 3RWQA 3OCTA 5CSXA 4KIPA 3BWFA 3PY0A 4HYIA 4J99A 4UXQA 5IH6A 1WBTA 3HKOA 2JKOA 3SVVA 3UPZA 2XIKA 2GTMA 3B8QA 2PL0A 3FXWA 3ZFYA 4XYMB 5JKGA 3TNPC 5HTCA 3GB2A 4RX5A 2WMVA 4ZZNA 4XUFA 5M55A 4RIYA 2BFYA 2OH0E 2ETKA 3QTSA 4CFXA 1H01A 4FKSA 1LR4A 3LFBA 2ERZE 3E63A 5CXZA 1M14A 3UOLA 3EFWA 3QTIA 5J9YA 4B7TA 2C6MA 5H80A 3BGZA 3KB7A 5B2KA 5CF5A 1CE8A 3BG5A 3QA8A 4O7NA 1LEWA 3QTZA 4AT5A 3E3PA 1PXNA 5HQ0A 2J9GA 3EZVA 4FSUA 1TQIA 2VWVA 2Z7LA 1EZ1A 3A4OX 5CZHA 5LJJA 2YWVA 2QOIA 4DFNA 5HEZA 3OCGA 4M8TA 3ALOA 4AA0A 2C3JA 2WQOA 4U97A 3WF8A 3QALE 2FPGB 4IWPA 4N57A 4E5WA 4IZ5A 4I20A 3A4PA 4M3QA 3PYYA 4WD5A 4BC6A 1KJ8A 2FPIB 3JRXA 4E6QA 3R8VA 2R3NA 3NIZA 4JBQA 3WO0A 1KV2A 3WF9A 4ZLYA 1JDBB 2F2CB 2WYOA 2ONLC 3RGFA 4D4YA 4KABA 1WVYA 1Q8WA 2PK9A 4HGSA 3HMIA 4FSTA 2G2FA 1MQBA 4UWCA 2GQGA 3EQDA 4OTIA 1Y91A 3ORXA 3Q5ZA 4F6SA 4BDIA 5HBRB 2GPWA 5AA8A 2R3PA 5CT0A 2OW3A 4OW8A 4FUYA 4QTAA 3PJ1A 2VN9A 2OSCA 5DR2A 2B9JA 3KA0A 4Z3VA 5GNKA 4MV7A 4L43A 3SX9A 2J9MA 4A7CA 3VUDA 2RG5A 2OXXA 3QTRA 1ZWSA 5CYIA 2XNOA 3G0EA 4BDBA 5A9UA 5I9ZA 2BAKA 2VWYA 2XB7A 3RNIA 1AGWA 4YZ9A 1P4OA 3O8UA 4GJ3A 4HYHA 1G5SA 3DDPA 1X8BA 2OF4A 3C0GA 3T3VA 4AZSA 1GSAA 3E5NA 5CEQA 3NW7A 5F94A 5IU2A 2VX1A 3LM0A 3VS0A 3I6UA 4N0SA 4TYHA 1OUYA 4DH5A 4QTEA 5KMJA 4YU2A 1ZY4A 2YIRA 4ZY4A 4KIQA 2B9HA 3L9MA 4FK6A 3L1SA 3SKCA 3MJ2A 4BB4A 3BHHA 1K2PA 2V59A 2QI8A 3UOHA 1LEZA 2QU5A 1YQJA 2XCKA 2R3GA 3OFMA 3ZC5A 4QMWA 2FPPB 3JZIA 2YRWA 1M52A 4JVGA 3LLTA 3AW8A 1XQZA 3FMEA 3P4KA 3ENMA 4D1XA 3GBZA 1R78A 4BICA 4ITHA 4LI5A 1DM2A 2BZJA 4TYGA 4YJQA 1J1CA 3PY3A 3ANQA 2VWXA 4LRJA 3CP9A 3EFJA 3Q2MA 3VMMA 3E88A 1PKGA 5CASA 3AC2A 3HL7A 4CT1A 4BDGA 5BQ0A 4MYGA 5FTQA 3HRFA 5HO8A 4CQEA 5LMKC 4FFMA 2G2HA 3FXXA 3VIDA 5KKRB 4E6CA 2JD5A 1JKKA 1OBGA 2R3LA 3G15A 3GQLA 3DA6A 3HA6A 3QCQA 4BY9E 3CGOA 4DBNA 4BIBA 4I5HA 4CFWA 5FP5A 2CSNA 1FVTA 3KXHA 4X2JA 2CKEA 3FQSA 4MBJA 4YTIA 4J96A 2BRBA 2CCIA 2XRWA 5GJFA 1B39A 3QUDA 4JXFA 3V8SA 2YM3A 4F9YA 2O3PA 4H36A 1OI9A 5HIEA 3OCBA 3EZRA 3BU3A 2PYWA 5EYDA 5TKDA 4EK5A 1KE6A 4L3JA 3PP1A 1CS0A 4C58A 2CJMA 3HAVA 4GFOA 2RF9A 2ZDTA 3PJCA 2PMIA 4U81A 1E4EA 4FZAB 2W6OA 3VBWA 2NUAB 5HBJA 5LCJA 2WTJA 4RQVA 3IKAA 3WE4A 4EHVA 3U6HA 4QMUA 2V62A 3JVSA 3IW8A 3C51A 3TNIA 3IDCA 4FV0A 4BI1A 2X2MA 1DI8A 4TNBA 3FYKX 3DBQA 4WNKA 4L46A 1E4EB 4I0SA 5KMLA 4FYNA 3G6GA 4AN9A 4F1OA 3OD6X 3EH9A 3TIYA 3GCVA 5ICPA 2YL2A 4RLKA 3GU7A 3FC1X 4G5PA 2GCDA 2X7GA 3L8SA 2ITOA 2W05A 4GJ2A 4IX6A 4QMXA 4XH6A 1IAHA 4C62A 4C4EA 5BPYA 4U7ZA 3SDJA 3SW7A 3W2QA 3WF7A 5A6NA 4ANLA 5M08A 3QKMA 3DS6A 5IUHA 3BYSA 5LMAA 2GHLA 3AD6A 4A9SA 4QMOA 5EQPA 1U5RA 2W7XA 2WOTA 2C47A 1ZOGA 2I6LA 3A8WA 4FV8A 2YZNA 3UGCA 1AUXA 4BHNA 1CKIA 2BPMA 4IB0A 2AUHA 1RE8A 2C4GA 4QMTA 4RVLA 5AAFA 5M07A 1BX6A 3ZEPA 5M44A 2B0QA 2BILB 2UZWE 3FV8A 3W33A 3U6JA 5JH6A 4TWCA 3L8PA 2X7FA 3U6IA 3E8EA 2BHEA 3OBJA 2Y4IB 2Z7SA 3TIIA 3P7AA 1YHVA 3SXRA 2CN8A 4GG7A 4BGQA 4DC2A 5IDPA 4I3ZA 3AC5A 4W4YA 3NGAA 3PTGA 3QWJA 4GRBA 5IDNA 1BKXA 3ODYX 1KJQA 4H1MA 3QTWA 4UB7A 4UWBA 1UWJA 3BWJA 3DT1A 3BELA 4RMZA 2R3IA 4BVUA 5CX9A 4JQ8A 5B2MA 3LJ1A 1SZMA 3LLAA 1RW8A 4FC0A 2HOGA 1NT2A 3DLZA 4FV5A 4FKPA 3ZBXA 4J95A 3O7LD 1AD5A 1YI3A 3JY0A 3PZEA 4QMVA 4FEVA 2WIPA 4RVKA 3RAHA 3SAYA 5D8DA 4KKHA 4LYNA 3VHKA 1REKA 1WBOA 3PSDA 4C4IA 4DEEA 4FIEA 4NJ3A 5CEIA 2BZIB 3FBVA 3KXNA 4XJ0A 3QD3A 3FMHA 3P1AA 1AUVA 2PZYA 1G3NA 4KB8A 2BZKB 4Q9SA 2C6OA 4AZEA 3D4QA 4DLJA 3GXLA 2HGSA 3MPMA 2E9NA 3PPJA 4FTRA 1J1BA 2PUIA 3JY9A 5HD7A 4R77A 2EWAA 4ZJVA 3NUSA 4ZMEA 3BKBA 5LVLA 5D7VA 4FZDB 4ZI7F 2GLTA 3IOKA 2QR8A 4DCEA 4BDKA 4LL0A 3DB6A 2QLUA 3GC7A 4O27B 4RJ5A 2BRMA 3GENA 4I22A 5BX0A 1H1RA 3LPBA 3OOMA 2C6TA 3BEAA 2NRUA 3F61A 2YS6A 3FQHA 3EOCA 3IG7A 2WQNA 3QQHA 3OVVA 2B9FA 2OK1A 4TT7A 2HW7A 3P23A 5J9LA 5I9YA 4ASXA 3REPA 5AJQA 2VX0A 4E7WA 1XH6A 3R0TA 1M2PA 3DOGA 2V7OA 3GP0A 5AFVA 2VGOA 3UJGA 2NU6B 4FIGA 5IA2A 4AE6A 2WMAA 4WO5A 3F3WA 3NW5A 3LM5A 1O9UA 2B53A 2OICA 3KVXA 3QFFA 4ID7A 3PXQA 4F63A 1XH7A 4HNIA 3ETJA 4FTQA 4AS0A 4E73A 1ZZ2A 4WBOA 3R7EA 2XBAA 5FLFA 3TKIA 3UODA 2O2UA 4RC2A 2HY0A 2G01A 3NUNA 1KUTA 1SVEA 4TZRA 4YNEA 4DG2E 1GIIA 1UKIA 2AC5A 1Q5KA 2GNFA 5CU0A 5GIOE 4G3EA 2C5XA 3CEKA 2W1IA 3MIAA 4MD7E 3U9NA 4F1MA 1IASA 2F9GA 3F2NA 3O71A 5EK7A 4DLIA 4FKRA 3PXFA 3MV5A 4RVMA 3EIDA 4FGBA 2CGUA 4CEGA 1PXIA 4FNWA 1IRKA 3FPQA 4QYHA 3ZDUA 2RGPA 3KAJA 5LMKA 1JNKA 2Q0NA 3D7ZA 3MIYA 2P0AA 2HAKA 5HE2A 2QF7A 4GYIA 2QOOA 4J97A 3QTXA 4USDA 4XX9A 4JQEA 4DA5A 4L1KA 3O17A 2DWCA 3G6HA 3ORMA 4H58A 5LP6F 1UU9A 3I1AA 4IAFA 3ORZA 4MEDA 3RJCA 3ZS5A 4AFEA 3GOPA 2BRGA 4M15A 5HCXA 5BUEA 2GQSA 2EU9A 2OJ9A 3DFCB 5AP6A 3ZSIA 4EOJA 1EUDB 4NFMA 4H05A 4M7IA 3QBNA 2C1BA 4U5JA 4EJNA 5JRQA 3M2WA 2CKQA 2YCRA 3F3VA 3EKKA 3HV7A 3OP5A 4YJNA 3R04A 2CDZA 4WBBB 4CV9A 3WIGA 3ZZWA 4JG7A 4YJRA 4U44A 1W82A 2VO0A 4XRLA 2DZDA 3KKVA 1U54A 4MQ1A 4ORKA 2WMSA 5CEOA 4NKAA 3E7OA 4QSHA 3D5UA 3ZXZA 2Z8CA 2XS0A 2VTNA 2ZDUA 1OITA 1YDRE 2FSLX 3BHYA 4J71A 2BAJA 5TOZA 5HX8A 4QT1A 4KD1A 3GCPA 2R7MA 3TG1A 5IA0A 4Y5HA 3CCNA 1Q99A 3COKA 4V04A 1H0WA 4OUCA 5LCKA 2WMXA 2XYUA 3EQHA 4HPTE 4XV3A 2GQRA 5KE0A 4TYJA 2OU7A 4ANMA 1H4LA 3M11A 2UVYA 4C35A 5I9WA 5HBHA 1ZYCA 2SCUB 4JRNA 4OTDA 5ANOA 3Q32A 3VUHA 3OEZA 4DFXE 3BQCA 3MWDA 1C3OA 4CFVA 1GZOA 3FZSA 2J2IB 3OUKA 4RWJA 3UIMA 2PZPA 1MUOA 3HGKA 4JIAA 4MNEA 3N4TA 3LQ3A 4XBUA 2QOFA 4BTFA 3UIXA 2IW8A 4DTAA 4RJ6A 4X6RA 4DT8A 3EYHA 2PVNA 1JSTA 3LZBA 2XJ0A 4PL4A 4ZZMA 1ZXEA 4MBLA 2J0KA 2XKCA 3FMMA 4QP9A 1Z2NX 5L6WL 3E62A 2X9EA 4QTBA 3MVHA 1ZLTA 4ZY6A 3TI1A 3ZONA 4YO4A 5A4TA 4IB5A 4NIFB 5F9EA 1KE7A 4C36A 2P3GX 4IBMA 3DAEA 5AM7A 2XUUA 5D9HA 5K5XA 1KJJA 2R3KA 3UP7A 5DGZA 3GUBA 3QZGA 5EKOA 4DCAA 2BFXA 2LGCA 3AD5A 3AMAA 3UDBA 3V04A 5IQHA 5HG5A 2BR1A 4XRJA 2R4BA 3R9RA 1EYZA 3ORIA 4YBZB 2ERKA 3I5NA 4IFGA 3R1YA 5HNBA 2WNTA 4QMPA 3ZLYA 2X0SA 1SYKA 2PVMA 3VOTA 3QCYA 3V8WA 3TDWA 2G1TA 2FVDA 4TV8F 4NW6A 4M68A 2IZTA 3G8DA 5J2UF 1TKIA 4FSNA 1W0XC 4E6AA 3UYTA 4IHJF 1OM1A 3ALNA 2OGVA 3VO3A 1OIQA 4BDEA 1P2AA 1BXRA 2YM7A 3HV5A 3R2YA 3QTQA 4MBIA 2QO9A 2R3FA 3FUPA 3LFFA 1UU7A 1BNCA 1DIKA 4BIEA 3V6SA 3HNGA 2ITZA 3R1SA 3R8MA 5IEYA 3PG1A 2XNBA 3GI3A 3V6RA 3OY1A 2XK4A 4FA2A 3MY1A 4V05A 4C34A 3QF9A 4RIXA 1VYZA 3VS4A 3TUDA 2UW3A 3CBLA 1IAJA 2WAJA 3FMKA 3OT8A 5FQDC 5LXMA 3KULB 4MAOA 4YJTA 5KHXA 1XHAA 3BGPA 4CZUA 1WBNA 3RK9A 3AC3A 3VVHA 2ITTA 4MXXA 4BCKA 2R3MA 4O0YA 3DNEA 3ZM9A 5HE3A 4GUBA 1SM2A 5CAPA 1LUFA 3KMWA 1UU3A 5HIDA 2YACA 5KKNB 4YGAA 5EG3A 2C1AA 3TNWA 1GJOA 3MY5A 4OTQA 3DLSA 5A14A 3MA3A 1JKJB 2ITPA 4M13A 1DAWA 3EL8A 3FI8A 1KE5A 3W2OA 2YDJA 1YDTE 2C0OA 2YABA 5H9BA 3ZHPC 5GONF 1JWHA 3QD2B 3GCSA 2X6DA 2JFMA 2E2BA 4MK0A 3C13A 4RC4A 4YJSA 3D7TA 3F5GA 3W2RA 4EOQA 4YURA 3FMJA 2GHMA 3R2BA 4NK9A 2R7LA 3UOJA 2X2LA 5IQIA 3NNWA 3OWKA 3LXLA 3ZFXA 4G6NA 2W1CA 2W71A 1BMKA 3AC4A 4GEOA 1RQQA 2DQ7X 4TWNA 4WNPA 3VUIA 3EMGA 1KE8A 2HZ0A 3PLSA 4DN5A 5IF1A 4EK6A 2XEZA 3C4WA 3LMIA 3WZKA 4BCOA 2QD9A 4I0TA 3NAXA 3TZ8A 2QG5A 4FV2A 3AT2A 4I92A 4QMLA 1XBCA 3UMXA 4EZ5A 5ETAA 3RVGA 3LXPA 3NX8A 4QP3A 5JSMA 1WBSA 1SNXA 3U55A 4AXAA 4CRSA 4HNTA 3UNKA 2ZM1A 3MWUA 4USFA 5EYCA 2IZSA 3Q04A 4M0YA 4QMSA 3P78A 3O8PA 3H10A 2RIOA 2DWBA 5FGKA 5KCVA 4C33A 4GK2A 4G3CA 2PPQA 1OECA 1V0OA 3FZPA 2R85A 3FQEA 1F0QA 4JJRA 4NW5A 4EKKA 2B1PA 3NUPA 4FIIA 4KKEA 3I12A 3ANRA 2C3IB 5EOBA 3QX4A 5D1JA 3WO1A 3GU4A 2UW0A 2J0JA 4YTHA 4HQ6A 2JDSA 5D41A 5A4QA 4FFLA 4HYUA 2BAQA 3BLQA 4LFIA 4ME6A 4H3QA 5JMSA 2E9PA 5M4UA 2Z7RA 5DWRA 4BCHA 3TZ7A 4MV3A 4QYGA 4GVAA 4F9CA 4ZSLA 4L3LA 4Q9ZA 4FL2A 1Q8ZA 4QTCA 2J6MA 4GV1A 4X3JA 5M4IA 2FA2A 4W4WA 4WRGA 2JKMA 1JKSA 1PXMA 5H3QA 3R7IA 3SG9A 4C2VA 4HR7A 2W4OA 2YDIA 4YZBA 3VBQA 4CFMA 2XVDA 4M9UA 5DHJA 4IW0A 4DEHA 2XZSA 2V0DA 4FIJA 4BBFA 4MV8A 4MXOA 4DG0E 1WBPA 2GS6A 5C8KA 2IZRA 1Z57A 2OJIA 5CI6A 4G17A 4B8MA 1NXKA 1GSHA 3UO6A 5AUZA 4EONA 2EB3A 4R7IA 4EL9A 3I7CA 3EN4A 1B38A 3MPAA 3S00A 5HLWA 2YHVA 4D28A 3H3CA 5IA4A 3FWQA 4GT4A 4BCJA 3U9CA 4IAKA 4ZLOA 4ZY5A 1ZARA 4XEYA 5M09A 2WTCA 3HB9A 4F1TA 1WBVA 2W1DA 1W84A 4YJOA 3VW8A 2YIYA 1WVXA 2ZV2A 4ZTSA 1JLLB 4G6LA 4BDAA 2HELA 5EOLA 5CNNA 4IM2A 5JT2A 4MH7A 3H0ZA 4TYIA 4EH6A 4YZDA 2C5YA 3HECA 3TCPA 4FTLA 4GSBA 4O96A 4V0GA 4A9RA 4CFFA 4DEAA 5CXHA 4GG5A 5BVFA 3NNVA 2W6ZA 2ZV9A 4QMZA 2QCSA 4FKTA 4LOPA 3DK6A 4MXZA 3R7OA 1IG1A 5A4LA 3FDNA 2ITVA 3F82A 4RBLA 4YHTA 3WZDA 2NU9B 3E5AA 4OTRA 3TJDA 4L52A 3A61A 2YISA 4JOAA 4AT3A 4O0TA 4EHGA 3LWBA 3ORQA 2QKRA 3KXXA 3HDNA 3S95A 5M06A 4U6RA 5AWMA 4QYYA 2GNGA 4LQMA 4YC6A 4U3ZA 4HCUA 3CGFA 3FSFA 1YWVA 4WG4A 1CQJB 4U41A 3FEGA 4KIOA 2PVRA 3A62A 3KCKA 5HG8A 3V5QA 3FHIA 1FBNA 4UWYA 5HESA 4BHZA 1Q97A 3NNUA 3IPHA 3BQRA 3N4UA 5IQBA 4F9BA 1XBBA 3Q4ZA 4TWOA 5J7HA 3VA7A 1BL6A 4ITIA 3Q4CA 2J90A 2RKUA 4U80A 4FVRA 2WELA 3GC8A 4BTKA 2O0UA 4A4XA 3VUKA 4IIJF 2JDTA 4RG0A 4JRVA 4O7YA 2VWZA 5JH7F 4KS7A 4X2GA 4ZZOA 2XIZA 3VBYA 2UUEA 2CGVA 2IVTA 4WRSA 4ASZA 4EH2A 2R82A 4L01A 5CI7A 3QFVA 5K5NA 2XRUA 3TW6A 1XH8A 3EWHA 4FVQA 4EZ7A 3G51A 4DE4A 4NH1A 4HVDA 2HZ4A 2B52A 4QNYA 2UW4A 5EM5A 5IA5A 2F49A 3ZM4A 5JFXA 3W2CA 3GC9A 2E9OA 2Y8OA 5L2IA 4X3FC 1XBAA 3H30A 1PXOA 4NUSA 3KQ7A 3PJ3A 4IAAA 3A2CA 4OTFA 4U0IA 2VQDA 1QCFA 1P4FA 2J0MB 5CANA 3OT3A 3VUGA 2R7BA 3F5UA 3UVPA 3TM0A 1H1SA 5CA1F 2YIQA 4TW9A 5TO8A 4MA0A 2EXCX 4QP2A 4W8EA 4G3FA 3BE9A 3VUMA 4TL0A 5DR9A 3DKFA 5BNJA 4EOMA 4AOIA 4RZQA 4H3PA 3BU6A 4FT9A 1KC7A 4FMQA 4E26A 1QMZA 1W83A 3L9LA 3GLKA 4G34A 4C3FA 2XJ2A 4GUEA 5FXRA 1I44A 4E6DA 1Z5MA 5DNRA 4XP3A 4EJ7A 5L6OA 4M69B 4IB3A 5M51A 4M84A 4RFYA 3WE8A 3VWAA 5I9VA 3IGOA 2YM6A 4XMOA 3N9XA 3FLSA 3VBTA 4E4XA 5E4HA 3PFQA 4DIMA 2HENA 2YERA 4XG3A 4EK8A 3F3TA 4EC8A 2OZOA 3DTWA 3IDPA 3LFDA 5HNIX 3BLRA 3QQUA 5HKMA 5DT0A 3MFUA 5IMXA 3F7WA 2W6NA 4X2FA 4AGCA 2WKMA 2Y6OA 4QP7A 4NJDA 3ZRMA 5DEWA 4PDYA 4I6HA 4YAJB 5CAQA 3PWDA 3L9PA 5KMKA 2R3RA 5IYZF 2J51A 3Q4TA 2UZBA 4PRJA 5AIKA 3PSBA 2VUWA 3RPYA 2E9VA 1PMUA 4NT4A 4XG2A 4MNFA 2IVUA 5T6KA 1NA7A 4R7HA 3Q9ZA 4AACA 1ZRZA 4C5BA 2W6PA 1JVPP 1OIUA 2VTHA 1DAYA 5BVWA 3ZDIA 4DAWA 5JFSA 1GLVA 3KCFA 3W32A 5FBNC 1KBLA 3PRIA 4UBAA 3IW5A 4RIWA 5BMSA 1A06A 1H27A 1ZOHA 1OUKA 5A4CA 2I87A 3A99A 3V5WA 5EW3A 2XIRA 5CU3A 3OBGA 3TIGA 1MRYA 4I24A 1XKKA 2W1HA 1JQHA 3DBFA 4KBCA 4PMTA 3RAKA 5DMXA 4O4HF 2QOHA 5HU3A 1WZYA 1HCKA 4DBXA 3H0YA 1H26A 2WTWA 3NYNA 3OHTA 3QGWA 4BCIA 4DTBA 1GGOA 3CJFA 3ZLSA 5ETCA 3HBLA 3V5JA 4X2KA 3WF5A 2A1AB 1Q3DA 4YC3A 2XCLA 2V5AA 1YI6A 4V0GB 4D1SA 5CVFA 5AUVA 2BHHA 2HCKA 5AP1A 4FL3A 1YHSA 1ZAOA 3QRIA 2GPSA 4FR4A 3KF7A 1TQMA 2VO3A 4F6UA 3R5HA 3AGLA 3MA6A 2OO8X 4II5A 1R3CA 4EOKA 5M4CA 2CKOA 2QC6A 3MFSA 5AP5A 3RUPA 4BYIA 1OKVA 4DF3A 4EYJA 2QVSE 5EM8A 2X1NA 1OVEA 4X7QA 3RTPA 3UZPA 3EQRA 3PE2A 2HY81 1L3RE 4KBKA 3CQWA 5EHOA 1J7IA 2X0GA 3PVWA 4ARKA 3D5WA 2IPXA 3U8WA 1Q62A 5AAGA 3MTFA 4PTCA 4GYGA 3RV3A 2C6DA 4RQKA 1DS5A 4MTAA 3LP8A 2GFSA 2JIVA 4QYEA 2VWBA 4EQCA 3M1SA 2WMWA 2PUNA 3FI3A 3FMLA 3TL8A 1YOMA 2BVAA 1CKJA 5AV0A 2CNUA 3BI6A 4FV4A 2BZHB 4HNFA 5F20A 3RMFA 5FM3A 4CMUA 5LA6F 4K8AA 4APPA 3CIKA 3NYOA 5CAOA 3N51A 3W16A 5IEVA 4QPAA 3LOKA 4MXYA 3TTIA 1B6SA 3WNZA 3F3UA 5DBXA 2OJJA 3EQIA 5CWZA 4F6WA 3GQIA 5IA1A 1UVRA 5L8LA 1OB3A 1LPUA 4B8LA 5JGBA 2XJ1A 4DEBA 4WNMA 2XKDA 3MESA 4D0WA 3WBLA 2XIYA 1Q61A 3HAMA 4XG7A 1PXPA 3G2FA 4RLLA 2O64A 3K5VA 1V1KA 3HVCA 4PDSA 4CGAA 4DINA 3ORRA 2W1EA 4GW8A 2X4ZA 5C27A 3ACKA 4YNOA 4YJ3F 5TT7A 2R3QA 2RFDA 3FMNA 3GCQA 2YIXA 3ZH8A 3D2KA 3Q96A 4JI9A 2UW9A 2Q0BA 4I41A 3SE7A 3CPCA 2IVVA 4N6YA 4OGRA 2NRYA 4H1JA 3GC0A 4V01A 4CMOA 4PMSA 4S32A 4WNOA 5CT7A 3VBXA 4BCPA 2VTRA 5BUJA 2YYAA 3BX5A 3UZTA 2F4JA 4XG4A 3L8VA 3PXKA 3S4QA 3I79A 4QMMA 4AW5A 1PF8A 1PXLA 1R0PA 1WBWA 3GNIB 5CA0F 3IW7A 5ANEA 3EQCA 4ZK5A 5L2TA 2YA9A 2GFCA 1IEPA 3AX6A 5TF9A 1CQIB 5JVDF 5DE2A 4HW7A 5CVHA 2I7QA 1PW2A 3QZFA 2JAMA 5JQGF 4IWDA 5J87A 1Y8GA 5EI6A 2BDWA 2PZ5A 4XP0A 5J5SA 4PTEA 3GU8A 4FV1A 4HYSA 4IACA 1OKYA 2PU8A 3IW6A 4DGGA 4EK3A 2ITUA 1M7NA 3FMDA 4XBRA 4BIDA 2I0VA 5IH4A 4ACMA 2UVZA 2IVSA 3SW4A 4WBNF 3BIZA 2B55A 2C6IA 3FE3A 3V4ZA 1J7UA 4FV7A 5HVYA 4DFUA 3PP0A 4JDHA 3THBA 2VWWA 4ZQIA 3QQJA 1M7QA 4Z55A 2YW2A 4EBWA 1Q3WA 4EOLA 3BHVA 2W5AA 5FBOA 3UQGA 4E4MA 2Z04A 4FKWA 3KN6A 4NL0A 4XG8A 4KAOA 1PMVA 3HMNA 5ANDA 5FTGA 3R8ZA 3SRVA 5IPJA 3MH2A 1O6YA 5CSPA 2XCHA 4XV9A 3TZ9A 1JDEA 3MVLA 2ETMA 1ZMWA 2LAVA 1V0PA 3FKLA 3LCTA 3LKMA 5AX3A 3C5UA 4I93A 5GJDA 4CTBA 3FLYA 4BF2A 4CV8A 1BLXA 3DGKA 2HK5A 2YAAA 2WTDA 3ZCLA 4BGHA 1EH4A 4DYMA 1WMKA 2I0YA 3VQHA 4C3PA 2V58A 3Q9WA 3B8RA 2WD1A 3KRWA 4PDOA 3M42A 3ETAA 4HZRA 3ZTXA 3POOA 2C5VA 3NSZA 1GZ8A 4O4LF 3VPBA 3RPOA 2Z7QA 1MQ4A 3H9RA 3U4WA 4IANA 3O51A 3R71A 3KAKA 4XLVA 3I81A 3NYXA 4RIWB 4KRCA 3PVBA 5AUWA 4BDCA 2R3OA 2QONA 3PUPA 4AF3A 1T36A 3RHKA 3QQLA 5HO7A 4HOKA 4JBOA 3RPRA 4IDTA 1LP4A 4RRVA 5M53A 5CAEB 2ZOQA 3QQKA 4NM3A 5AA9A 2O5KA 5GJGA 1G8AA 2ZV8A 2J7TA 1XO2B 4OT6A 3T8OA 2QO7A 4ZSAA 5I5ZA 5K9IA 5EQEA 4A9TA 4QQTA 4E4TA 1G8SA 3KK8A 4AA5A 1IR3A 3PE1A 2F7ZE 1A9XA 4TRLA 2GTNA 5EYMA 1A48A 3R5FA 4L9IA 1KWPA 4FICA 2OBJA 3Q52A 4N70A 2PVKA 2QOCA 4O2AF 5LVMA 5KX5F 5A4EA 5FXQA 3ORPA 4IAYA 5CVGA 1Z9XA 4WUNA 4AFJA 5DA3A 4BRXA 5B7VA 4JG8A 4ERKA 1VZOA 3LCKA 5E92A 4IQ6A 5KMOA 1VJYA 3AOXA 4FNYA 3O50A 4GKIA 4NM0A 4FSYA 1YW2A 3UZRA 2I80A 2FYSA 4TN6A 2W5BA 4MXCA 3DXNA 3MVJA 4L00A 3V3VA 2RFEA 4JDIA 5LVOA 3UFXB 1ZYJA 2XNMA 3QD4A 1SVHA 2X8DA 3BV3A 3E64A 4YZNA 4ZJIA 2W99B 4IZYA 5AV1A 2YJRA 4RA5A 5E1EA 4C5CA 1PYEA 3NS9A 1BI8A 3R8UA 5BYLA 3TV6A 4QMNA 3G33A 3UQFA 3R02A 2RFNA 2OF2A 3CD8A 3KK9A 2QQ7A 3KXMA 4I5MA 5TR6A 5LYJF 1YXVA 4YJPA 5IISA 1V0BA 5AX9A 4QP6A 3UG1A 5BVOA 2PZIA 3UC4A 4IADA 2WTKC 3DJ6A 3AT3A 4KBAA 4C4FA 4KS8A 4MWIA 4CNHA 4F0IA 4J7BA 4TPTA 3SG8A 2JBOA 4I4EA 2YM5A 4AZVA 1C30A 2JLDA 1M2QA 4ZXTA 3KXGA 3MPTA 3VF9A 5KZ0A 4EHZA 5E8WA 5JGAA 4CVAA 3DK7A 4PTGA 2WMUA 4B9DA 4FSWA 3VS5A 2CGWA 3EN9A 5LVPA 4M0ZA 4MX9A 3DTCA 1PY5A 5IG1A 3AXWA 2C5NA 2VTPA 1OL1A 4M97A 2R84A 5CY3A 3CR0A 2WTVA 4FTTA 4O2PA 4FT0A 3BEGA 5E1SA 3W8LA 5FD2A 3QXPA 3NCZA 3LFSA 3JZFA 2JGZA 4F99A 3C50A 4YB8B 1F5QA 4EWQA 4FTMA 3TIZA 5ETIA 4FVPA 4MD8E 1Q41A 3N4VA 3KRJA 3COMA 3BV2A 3E3BX 3PXZA 1YWRA 2UZDA 3BYVA 5D12A 4R3PA 3R8LA 2Y6MA 4O0XA 4WT6A 1O6LA 3BLHA 3IDBA 4DH7A 5GINE 4M12A 5HU9A 3SLSA 4MV1A 2OI4X 3W2PA 2Z60A 2UV2A 4IAIA 2NP8A 2ZYBA 3QWKA 5IZFA 4NFNA 5I0BA 4XCUA 5C4KA 4AE9A 4ZSEA 5HE0A 4YJUA 3DZOA 1YWNA 3DZQA 4XZ3B 3PIXA 3Q2JA 2I0HA 4YP8A 4EH8A 5JK3A 3UNZA 4I0RA 4CRLA 4FT3A 2C6LA 3V5LA 5CF6A 5KX8A 2WMBA 3QC9A 2PMNX 3FSKA 3DAKA 2RL5A 5L8KA 5HE1A 2YZGA 3P79A 3W10A 1REJA 4USEA 4FKUA 3LXNA 3QKLA 2BRNA 3CQEA 3TXOA 5LVNA 1OZ1A 1VR2A 2XEYA 4FTJA 2OWBA 2OIDA 3R9NA 4FEXA 2XK7A 4O7LA 4E5BA 4DEDA 5C4LA 2WMTA 2X4FA 3DKOA 3JYAA 5CS6A 4O2BF 4IHPA 4L42A 4O38A 2HWPA 2B9IA 2R7KA 4DGLC 3F3ZA 2OH4A 4QO9A 3KMUA 2UZLA 2OXDA 3F69A 3C4CA 3D83A 4IVAA 4BCFA 2ZAZA 2E9UA 4FKQA 3GVUA 4IX4A 3BHUA 4O81A 1JKTA 3UIBA 4AZFA
chains in the Genus database with same CATH superfamily
4XOZA 3R22A 5LOHA 2C6KA 3A7FA 4Y72A 3K5UA 4YLJA 5K3YA 1KJIA 3CY3A 1EKVA 1FVVA 3V4SA 3KU2A 1RJBA 4JDJA 3GCUA 4ZJJA 2BKKA 1OMWA 1H24A 2VTIA 4O2ZA 3LMHA 4CG8A 1GY3A 4Y95A 4DFYA 2REIA 4F9AA 4EC9A 3BLAA 3MDYA 3MI9A 4ALVA 4FIFA 4OLIA 4AN2A 1OIYA 3KVWA 3MBLA 4HNVA 4FT7A 2NO3A 2B7AA 2DYLA 4WIHA 4YBKA 3FKOA 3U9TA 3W1FA 3IK3A 4C59A 2J0IA 1UV5A 4FV3A 5DH3A 3DXQA 3RCJA 3CS9A 4UYAA 4ZTNA 3O96A 4YHFA 5C9CA 4XYLB 4F0FA 4MV9A 4HCVA 4D58A 3UOKA 3DTGA 2WB8A 3VF8A 2C30A 2R64A 2DUVA 3QKKA 4IVDA 4RX8A 1RDQE 2DS1A 3CKXA 3F5XA 4QDVA 2EIYA 3DPKA 4L3PA 3T7AA 1W8CA 2HXQA 4F7NA 3NRMA 5KBQA 3FC2A 2PZRA 5IH5A 5JQ8A 2R86A 1QPCA 3QLFA 3VNTA 4YR8A 4I6BA 4K0YA 4OTHA 5ACBC 5EZYF 5CQUA 1NVSA 3K3PA 4IMYA 4AN3A 3TY8A 2XK9A 4IJ9A 2QHNA 3QUEA 4R5YA 4EFEA 1NVQA 1IOWA 4F9WA 4RJ7A 4ASDA 3KY2A 1PMEA 2YCSA 3G9LX 2ETRA 3KMMA 2QODA 3OOGA 5FRIA 4AGDA 3AC8A 3QRUA 2GNLA 4YUQA 1DV1A 3R00A 5DIAA 4G16A 1YXXA 2C69A 2ACXA 1WFCA 3B2TA 3QGYA 4LUEA 5EDPA 4ANQA 3VS3A 3C0HA 2YCFA 3CPBA 1YOJA 3U51A 5ITAA 4PNKA 4YAKB 2PVYA 4YPSA 4FFRA 2GNJA 3AT4A 1FMOE 4G3GA 5EM7A 3ELJA 3DKCA 4FE2A 5AUTA 4ZEGA 5L3AA 4MKCA 3Q9XA 2Z2WA 3OS3A 1J3HA 4L7SA 2PVLA 4XHKB 5EH0A 3MYGA 2XMYA 4RC3A 3DK3A 1XJDA 3ZUUA 2YWPA 2BIKB 3ITZA 2GSFA 3ORKA 4S30A 1PHKA 1NVRA 1YVJA 2G9XA 5DYJA 3TKHA 4BTMA 4EOIA 3H4JA 3QZHA 3C4FA 4IH8A 2WZJA 4KKGA 1Z2PX 3FKNA 4NU1A 5B2LA 4FV6A 5EFQA 1Y8YA 3R30A 3Q9YA 5CU4A 2F7XE 3MJ1A 4OTGA 3CC6A 3W0PA 2JDVA 3EL7A 2BUJA 2RFSA 1HCLA 2UZNA 1ST4A 4LOQA 5E8TA 3FLZA 4BZNA 3CLYA 3QTUA 5H8BA 4ZIMA 5EDQA 1H0VA 3RWPA 1H8FA 4FI1A 1SCUB 4FOCA 4XX0B 2OLSA 5K4JA 3BYOA 2VO7A 3HMMA 5AMNA 4QP4A 3MJFA 4LV8A 2QURA 3QQFA 4S2ZA 1TVOA 2PBZA 2COIA 2Y4IC 3KFAA 5DG5A 3VS7A 4F7JA 3AC1A 4MD9E 5FG8A 3MB7A 4K6ZA 3RINA 2AC3A 4LG4A 3OUNB 4H39A 2YIWA 4LMUA 5FDPA 3MH3A 3PFYA 3FLWA 4FTKA 5I4NA 4TV9F 2A19B 3GGFA 2V7AA 3BPRA 3EN6A 3T9TA 1ND4A 4FKVA 1IA9A 4XG6A 4A9UA 2VU3A 4U45A 3W1BA 2DIKA 4PNIA 3BAAA 3MS9A 4DDIA 4C61A 2PUUA 4ZTMA 5E8XA 1Y6AA 4MF1A 2IWIA 3LMGA 3PSCA 4O7RA 5BYZA 4ZSJA 4GCJA 3HP2A 1H07A 2YZLA 3W18A 4BGGA 4DHZA 2ZDQA 1OKZA 5JFWA 2R3HA 3AQVA 3W55A 4ERWA 2WQBA 5E8ZA 4Z7GA 4LGHA 2UZVA 4JT3A 4O6EA 1ERKA 3R7UA 4A4LA 3RPVA 4FYOA 4QOXA 4X2NA 4EOOA 5L2WA 2EJ0A 2O65A 4U9AA 4EEVA 3QHRA 5J2TF 4RX7A 1Q8YA 3TT0A 2FGIA 3NIEA 1XH5A 4AAAA 2P2HA 3NUUA 3H9OA 4WG3A 3TEIA 2JBPA 4ENXA 3QAME 2WTIA 4JIKA 4EH5A 2VTJA 3H9FA 3TNQB 3WYYA 2XA4A 3KRRA 3IGGA 2WPAA 4K77A 4ALUA 4FNXA 5CEPA 4HJOA 3OXTA 3CTQA 2WMRA 5JZNA 4DDGA 1YXUA 4EH7A 2PVPA 4BCMA 4TYHB 5CAUA 3LFNA 2OG8A 3UTOA 1OPKA 2BCJA 3IOPA 3PPKA 3BA8A 1S9IA 2FSTX 1BI7A 3GT8A 3LCOA 3KGAA 2H9VA 3GEQA 2I40A 5EI2A 4D2RA 4BJJA 2VZ6A 4Y8DA 3U4UA 1BYGA 3NBYB 2WQEA 4L45A 4GK3A 3BRBA 5H8GA 3LXKA 2J5FA 3P7CA 5DRDA 2YFXA 3IQ7A 5KBRA 1OL2A 3G90X 4FSRA 1B6RA 5D1PA 5GIPE 1OIRA 4L7FA 3E7VA 5D1OB 3WIKA 3QU0A 4I5PA 4KUJA 3QA0A 4PP7A 4YC8A 4IDVA 2CFMA 3JS2A 2J0LA 5HLNA 4RCNA 3KALA 5IQGA 4DG3E 4JX3A 4MNEB 3FY2A 3HA8A 3PG3A 2JC6A 3NMUF 4ACHA 4F7SA 5ACKA 4F7LA 4EH3A 4YPDA 4FV9A 1KSWA 2XM9A 3OMVA 4O86A 4O7SA 2SRCA 3AMYA 1W98A 2VAGA 5DVRA 2UZEA 3FY0A 1W93A 2QO2A 3OROA 4G5JA 2VNYA 2GS7A 1QPJA 3ERKA 2CNVA 3EN5A 4EI4A 2WFYA 1U59A 3MH0A 4P5QA 4FT5A 1B6CB 4GKHA 3JVRA 3CD3A 3OUZA 4G9RA 1FGKA 3C0IA 3HP5A 1TAEA 2BMCA 3BGQA 3QRKA 4AP7A 2HJWA 2R87A 2IZUA 2Y7JA 5EW8A 3KRLA 5HTBA 3CKWA 4XS2A 5CEKA 2PE2A 2DLNA 4YLLA 2JFLA 4L6QA 1W7HA 3ZLXA 4XLIA 4FKIA 4DTKA 2HGWA 3RALA 3WZJA 3UQ8A 2OJFE 3C4EA 1U54B 2CZGA 2VTOA 5JVLA 5EKNA 4HGLA 4QTDA 4YTFA 4YO6A 3RI1A 4CFNA 2X2KA 3CTHA 5LWMA 3E92A 4LV5A 3RHXA 4EEQA 4RIYB 3QL8A 2V5QA 4AX8A 1VKZA 4C2WA 2PUPA 3KRXA 4QQ5A 3C4ZA 4AAYA 4DITA 2HYYA 4PWNA 3SNOA 5KHWA 4Y73A 3R5XA 4RWKA 3R63A 5DOSA 5CALA 4EQMA 5E7RA 2Q83A 2OLCA 4RWLA 5CENA 3TZMA 4X21A 4GL9A 3TY5A 4IX3A 4J52A 3ZLWA 3R01A 4E6NA 4L68A 1VEBA 3LE6A 2GU8A 3DBCA 4RJ4A 2WGJA 4UZDA 4XNEA 4I23A 5KMMA 3TN8A 1FVRA 1KV1A 4CKRA 3V51A 1JPAA 2XNEA 4PP9A 4D1ZA 3LQ5A 2ITYA 3LFEA 4JL9A 4NCTC 2VPQA 5B0XA 4AT4A 4LMNA 3VQUA 2C5OA 2GPHA 2IN6A 1VYWA 1MRUA 4FNZA 4M0JA 4IFCA 1OPLA 5FEDA 5C1OA 4AU8A 4LRKA 4RJ8A 5I5WA 2X7OA 2VO6A 2YRXA 5FNVF 4FSMA 3NNXA 1H00A 1U4DA 3EFKA 1OL7A 2YN8A 3A7JA 1L8TA 2VTTA 3D7TB 3E87A 1ZYDA 1ATPE 2A0CX 2C68A 1IOVA 2NU7B 2JIUA 3T9DA 3P86A 4CE5A 4O84A 5M57A 2W1ZA 3A8XA 1GOLA 3IO7A 3PJ8A 4D4RA 2HVRA 3MFTA 3PZHA 5BVEA 3ODZX 4ZTHA 5IQFA 1M6VA 2W5HA 3BHTA 3IS5A 2IW9A 4I21A 4I94A 3SXSA 3UDSA 4RVTA 5J8IA 2A4LA 3A60A 1YOLA 4YJ2F 3EKNA 4RGJA 5BWRA 4UYNA 3R28A 4D9TA 5T3QA 3QYZA 3NEWA 4ZLZA 3ZMMA 5A46A 5IQEA 4DGOA 3VRYA 3WZUA 3TJCA 3ULIA 3ZEWA 3CQUA 3I0OA 4X6QC 1JSUA 4PX6A 2ITWA 4BYJA 3G9NA 5FEEA 1Z2OX 4D55A 3FAAA 2IP4A 4S33A 4C3RA 5ANGA 3ATSA 3PA3A 4BDFA 3F2RA 3PY1A 2EUFB 4KSQA 2PE1A 2QOBA 3OWPA 2Y4PA 2ITXA 4LUDA 2JAVA 4J8MA 4QQCA 5CLPA 3I6WA 3TYKA 2CNQA 1W96A 4C5AA 4CC5A 4EH9A 3HO8A 2FSOX 3HRCA 5EYKA 4XP2A 4F65A 4X3FA 3I60A 4U3YA 3UVQA 5HORA 3W0MA 2Y0AA 3II5A 3S24A 2X8EA 3HMPA 2XALA 5J9ZA 5ANJA 2H8HA 4FEWA 4D4VA 3HV6A 4QQJA 2WEIA 3ZRLA 4I6QA 4AGUA 3RAIA 2PVFA 2CMWA 3C4XA 1SMHA 3OC1A 2XK6A 5C8NA 1YXTA 5AIRA 2QOKA 4DFZE 3FJQE 4QRCA 4GU6A 3HX4A 4O0UA 3JPVA 3MGYA 4UX9A 4D2SA 2VR1A 4AOJA 4PQNA 1ZMUA 3SXFA 3TV4A 4FG7A 4MQ2A 3VAPA 3ZC6A 4EKLA 3A7GA 3POZA 1ZYLA 5JQ5A 4D9UA 3FHRA 4R3CA 4YZMA 4GIHA 2X8IA 4YHJA 3DNDA 4L53A 3DAJA 2FB9A 3UYYA 3FLQA 3MFRA 4XOYA 4F0GA 4FSZA 1KOAA 2CKPA 5EM6A 4D0XA 3O7LB 3E8NA 3F7ZA 3R1NA 5E91A 4TUYF 1B04A 4I5CA 5CEMA 2WQMA 4EOPA 4EUUA 3F66A 5CSVA 4FTOA 5KUPA 1JAMA 1MP8A 2JKKA 3FXZA 4Q4CA 3UO4A 1UC9A 3V01A 3JSNA 2OFVA 2VWIA 3CSVA 4PDPA 3ZO3A 4JLCA 4BBEA 3NUXA 3ZUVA 4F64A 3S0OA 4RFZA 5IQAA 3Q2OA 2OFUA 3VC4A 2COGA 1TQPA 5AP7A 2R3JA 3QYWA 1PXKA 2ZM3A 3EQPA 3NW6A 1OGYA 3VRZA 3VS2A 3OCSA 3HUCA 4R7BA 4A4OA 1JKLA 5C8MA 3AD4A 4AW2A 5C01A 4U43A 3A7HA 4CFUA 5JQWA 3C7QA 4YJVA 4RZWA 4FKGA 4PMPA 4FFPA 2JKQA 3UBDA 5HD4A 1KE9A 1T46A 5D7AA 4NTSA 3VN9A 5DGHA 3MY0A 2ITQA 3NZ0A 4FEQA 3LHJA 4K1BA 5EHYA 3F9NA 3NPCA 2JEDA 4FKJA 5DLSA 2WEVA 3SOAA 4FU0A 5HHWA 1I1MA 2BTSA 4JS8A 4O0SA 4ZS4A 3BABA 2W0JA 4UXLA 1YI4A 5HV6A 3NWWA 2C6EA 4PV0A 3R7YA 5HGIA 2VWUA 4UUGA 2OIQA 4NTTA 3P0MA 4DFLA 4F09A 3AKLA 2GS2A 2H34A 2ZMCA 4KNBA 3RPSA 4RWIA 2W4JA 4JX7A 5DT4A 5CF4A 5C8YF 2R0UA 1WR2A 3SHEA 1CKPA 4ZOGA 3P08A 5BV3A 2ESMA 2F7EE 4BCGA 1ULZA 2IW6A 4CZTA 3DFAA 3ZYAA 3AG9A 3QCSA 5AUYA 3UG2A 1CSNA 2V55A 4IEBA 2JIIA 4LRMA 4J53A 2JDRA 4UZHA 1WAKA 5G1XA 3FYJX 5BVKA 3RNYA 3Q3BA 4JR3A 1OPJA 4CCUA 4G3DA 4BCNA 1EHIA 4R78A 2FO0A 4FEUA 3OZ6A 1GIHA 3BU5A 2WXVA 3FI2A 3HYHA 5H2UA 5E8VA 3UPXA 1DV2A 4O7VA 2W6MA 3UZBA 4EGQA 4HVIA 4DT9A 3VS6A 4AXFA 4JAIA 3K3JA 5FTOA 4TXCA 5HCZA 4D5HA 2YCQA 3RM7A 2CHLA 4XG9A 3JR1A 4Y5QA 4CT2A 1ZOEA 2PVJA 4FTUA 2G2IA 4HNUA 2OJGA 3HEGA 3NLBA 2HVQA 5EHLA 2YJSA 3PIYA 4K9YA 3TKUA 1KOBA 2W9ZB 2EXMA 4UV0A 5BPHA 5CF8A 4E8AA 5BUIA 2WHBA 3OW3A 4X0MA 3Q53A 5F4NA 4F70A 4EBVA 3S1HA 2RG6A 3ZSHA 4EH4A 2J4ZA 2YM4A 3E93A 1UU8A 4IX5A 4BI0A 3ZZEA 3ENHA 2XP2A 5T68A 5JGDA 4TVIA 1JBPE 3EN7A 4P90A 1IYEA 4Y85A 3UP2A 5E8UA 3VJOA 3EFLA 1BUHA 3CY2A 3CEBA 4BDHA 4P4CA 3MW1A 3LQ8A 1WCCA 5E90A 4C0TA 3PLAE 2NNWB 5L2SA 3KREA 5AADA 5M4FA 1PMNA 3MH1A 2YZAA 2O8YA 3F2AA 3RAWA 4QP1A 4DGMA 3JRWA 4ZTRA 4FFNA 3E8CA 1VBGA 4CG9A 4J98A 3GU5A 1YKRA 1UWHA 1NW1A 4U40A 2R0IA 1CTPE 5C03A 3V5TA 4GS6A 4XV1A 4DHIB 3ACJA 4Z16A 5BYYA 5AUXA 4DLKA 3CXWA 4O83A 1PXJA 1PJKA 1UNLA 4ZMFA 1H28A 2BRHA 3D5XA 3CJGA 3IECA 1V9PA 3ETHA 4XV2A 3SQQA 2JDOA 3K3IA 4U79A 4R3RA 1PRYA 1Q4LA 3V5PA 3D94A 1IA8A 2AEGA 3BBTB 4C38A 4FIHA 4MV4A 3HDMA 3CTJA 5CZIA 4DEGA 2A1HA 2NU8B 4GMYA 2VRXA 2HZNA 4PBCA 4FX3A 3F6XA 3PXYA 5HNGA 3LQSA 4MV6A 3TINA 3PPZA 2QG7A 2PULA 5ANIA 4AUAA 4DH3A 3E8DA 5DI1A 2YDKA 3ORNA 1A9UA 3PVUA 1MRVA 4NKSA 4EQUA 3VJNA 5HX6A 3U87A 5AEPA 3HZTA 3ZOSA 2XANA 3WOWA 4LOOA 4O91A 5BMMA 4I50F 5BVNA 2VX3A 5LQFA 1CM8A 1STCE 1FVIA 2PVHA 2J50A 2QOLA 4CC6A 1KJ9A 4PY1A 1M2RA 4C4HA 4NM7A 2C0IA 2UVXA 4IM0A 4WUAA 4HGEA 3NYVA 5AUUA 4JDKA 5J1WA 2X9FA 3DDQA 3BACA 3DV3A 3OTUA 3VHEA 2WTKB 5IUGA 1R0EA 2Y9QA 1OBDA 4FOBA 1URWA 4C37A 4CSVA 3QUPA 4IAZA 3CE3A 2XBJA 3OEFX 3C5IA 4FTCA 1PK8A 3LCSA 4IE9A 3ZUTA 4APCA 2VNWA 4CD0A 4HPUE 4M67A 3GJXB 3VPDA 2XK8A 5C1QB 3JSLA 3EHAA 3QC4A 4LL5A 4ZHQF 1GAGA 3COIA 4L44A 4R6VA 3UMWA 1AQ1A 4OBPA 2BDFA 2H6DA 4DHFA 5A6OA 2HIWA 4I1ZA 4AW1A 3QRJA 3FZRA 3OF0A 2BKZA 3KC3A 4GFGA 2UZOA 1JSVA 3HV4A 4BN1A 2CGXA 4K18A 4ZOLF 5HBEA 2WU7A 1HOWA 3NUYA 3W8QA 1J91A 2F2UA 4KINA 5KO1A 2I0EA 3QCXA 3WZEA 3TV7A 3R23A 3NR9A 2FH9A 3GOKA 3OXZA 3DTFA 4FTIA 5AV2A 3G0FA 3TTJA 4I6FA 3VS1A 4PUZA 3ML1A 2CPKE 4ASEA 3RV4A 3ZU7A 5M56A 4MXAA 4BI2A 1CMKE 3Q5IA 4E5AX 2XF0A 4AXDA 4UCUA 2W1FA 2C00A 3LW0A 3T3UA 3UVRA 3L9NA 3ROCA 2X81A 2XIXA 3R9DA 1QPEA 5HZNA 4ANSA 5CTPA 4ACGA 3OG7A 2PWLA 5L8JA 2YEXA 1OL5A 3OXIA 4JAJA 3S2PA 4I55F 4I4FA 3K5HA 2FP4B 5EI8A 2HXLA 2UW7A 5ETFA 2YS7A 2C0TA 3QXOA 4A06A 3F5PA 3NDMA 4JNWA 4PF4A 5DEYA 5CNOA 5HVJA 3VULA 2Q2UA 4J1RA 2QK4A 3W2SA 2C3LA 3TMOA 4CMTA 3RP9A 2V22A 4IZOA 3N6RA 4W8DA 2ZB0A 1GZNA 4CCBA 5HICA 2I8CA 4RSSA 5I9UA 1CKOA 3DU8A 4HCTA 4NWMA 4OT5A 3ZSGA 2XNPA 4YBJA 4O21A 4BTJA 4QPSA 5LWNA 4EK4A 2OIBA 4CKJA 5AV4A 2QKWB 5K4IA 1T45A 3KL8A 3IONA 3OWJA 4BBMA 2R2PA 4FUXA 4YLKA 1FGIA 2IG7A 4JBVA 5FP6A 2VTSA 4ITJA 3W1GA 4MCVA 3QX2A 3ZXTA 2HZIA 3BL9A 4FODA 1OKWA 4BDDA 5IA3A 4MUQA 4JG6A 5IEXA 2HDKA 3EQGA 4FKLA 2IO6A 2BIYA 1R1WA 4Y46A 2CN5A 5FM2A 4BKJA 4NCTA 4Y8VB 4EORA 5E9EA 2NYAA 4G1WA 4ZP5A 2WO6A 3PXRA 4FG8A 4LGGA 1DI9A 4RIXB 4RX9A 2R7IA 2W17A 5I5YA 4FK3A 3DBDA 3VW6A 2ZGIA 4I4TF 3U9SA 1U5QA 3Q6UA 3TQTA 4AOTA 1YRPA 4G2FA 2VTAA 4RPVA 2W96B 5KMIA 4W4XA 3Q6WA 2XH5A 4AA4A 2X5RA 4WA9A 2FUMA 1M0WA 5D11A 3OY3A 3HLLA 4FL1A 3PIZA 5HIBA 5CSWA 2XK3A 4DFBA 5L6PA 2F57A 4O4IF 2IJMA 3ORTA 1XH9A 1FMKA 5AV3A 4O4JF 4O7WA 1H1WA 1XH4A 1Y57A 3D15A 2EVAA 4OBOA 1P14A 4O22A 4HGTA 1XWSA 2NPQA 2XYNA 1NY3A 4YSJA 4GT3A 1F3MC 4IM3A 3NAYA 4CXAA 3I5ZA 4FZ7A 4OR5A 5FEQA 3R1QA 5E8SA 4FZFB 5HLPA 4HVHA 5HCYA 2PHKA 3FLNC 4GH2A 3TWJA 4X3FB 2GDOA 3PDTA 3R6XA 3DQWA 3UO5A 3NBZB 1YDSE 4GT5A 4TYEA 2Z02A 5AP0A 1H08A 2P0CA 3D9VA 4FZ6A 1GZKA 1XDNA 4AZWA 3DBEA 3R8PA 3SRVB 1PX2A 3RK7A 4ZTQA 1P5EA 3I0QA 2YZMA 1OL6A 4ZS0A 3K54A 4BZDA 4GVJA 3RTXA 1S9JA 3MN3A 3D14A 3VPCA 1XMMA 3PA4A 3GFEA 4IZAA 1GNGA 4IB1A 2QHMA 2PSQA 5DRBA 4TWPA 3RKBA 3GIDA 1JLUE 1ZY5A 4HZSA 2ZDHA 2BROA 1E1XA 4O0VA 5AM6A 2VGPA 3GU6A 2FSMX 3D2IA 4DEIA 1UNHA 1APME 1EKFA 2XNGA 3QLGA 3OUUA 4E4LA 4HVGA 4TM5A 2UZTA 2GMXA 3R7VA 3MTLA 4K11A 5DFPA 2KTYA 3WYXA 1ST0A 3GFWA 4L8MA 3ULZA 2QNJA 2W1GA 3DQXA 3UC3A 5CSHA 4G9CA 4G6OA 4KWPA 3FZOA 1GIJA 4IWOA 1CDKA 2X6EA 4ANBA 2W06A 3DF7A 5JZJA 3SV0A 2ODTX 3LFQA 4XYFA 2ONLA 5BVDA 3DCVA 5AP4A 2PTKA 4JQ7A 2R5TA 3COHA 5ANKA 4ZSGA 4Z7HA 5IQCA 3QQMA 5F95A 3O23A 1BL7A 2ZM4A 4O0RA 3K2LA 4AQCA 4OTWA 4UCRA 4TY1A 4BDJA 4IWQA 3O8TA 4IVCA 4R5SA 5I5VA 2CCHA 4RJ3A 2AYPA 4A9YA 4BR3A 5JEBA 3ID6C 5FUTA 4B0GA 5BPFA 1FOTA 3FL5A 3ZO4A 5C1PA 2VD5A 4LM5A 5E8YA 3DY7A 3I4BA 3LIJA 3QQGA 4FKOA 5D10A 5J95A 4EYMA 3K5IA 3FPMA 4IVBA 3EQBA 2P55A 3FI4A 3HV3A 4FBXA 4FSQA 3G8CA 1M0TA 3V8TA 5IQDA 4Q2AA 4TKSA 4WKQA 5A3XA 1H25A 4AWIA 4IIRA 3HMOA 4GLXA 3EJ1A 4ENYA 4ZTLA 1R39A 4ONAA 2WMQA 4JR7A 5KKRC 1UKHA 2UW8A 3Q4UA 2G15A 4TTHB 3AGMA 3ZRKA 4GU9A 5CAVA 4QP8A 4NM5A 3DB8A 2B4SB 2R7NA 3AMBA 3BE2A 2VTMA 2XM8A 3KXZA 3HRBA 4YSMA 5EQYA 3NCGA 1K3AA 4O7ZA 2OZAA 3R9HA 5AP2A 4QNAA 3IW4A 4PMMA 3KEXA 3C9WA 3LVPA 4EGJA 3JXWA 3NVMB 4FGRA 4NZWB 4MVFA 3SOCA 3O2MA 4CTCA 1A0IA 4DH8A 2X39A 2P4IA 2KULA 4KSPA 3RK5A 3ZFMA 5I9XA 1VBHA 2PMOX 2HW6A 3P7BA 3OTVA 3TNHA 4UN0C 3Q60A 3OWLA 2WOUA 4RZVA 4BCQA 4O7TA 2BDJA 4N6ZA 4JBPA 4G31A 4EUTA 2ZMDA 1YHWA 5FPRA 3P5KA 3RFCA 5HG7A 1UA2A 4H3BA 3LFAA 3WILA 2PN1A 4AQKA 4UY9A 1XR1A 2W4KA 2PMLX 4K2RA 4UFZA 2I1MA 3UNJA 4CLJA 2ZDGA 4J8NA 3KF4A 4DGNA 4PL3A 4MHAA 2QR7A 1K9AA 3PJ2A 4GK4A 4E93A 3FZ1A 4EZ3A 3N8DA 3QRTA 2CLXA 2YM8A 3MSSA 3TUBA 1TFFA 2R9SA 4FFOA 3ZO1A 4ALWA 4EHEA 5LMBA 2A27A 4ZAUA 5JN2A 4P5ZA 2OKRA 3L8XA 4OBQA 4R1YA 2P2IA 3R83A 3DJ7A 3W0QA 3KULA 3PRFA 4DQNA 4EG0A 5CB4F 1ZZLA 2PE0A 4P7EA 5HG9A 4B6LA 4WG5A 4KA3A 4DH1A 1GSOA 3FZTA 5EDRA 2HWOA 1Q24A 3EQFA 5DPVA 1QL6A 3ORLA 4O0WA 3T9CA 4E20A 2CLQA 2W9FB 2QLQA 1PYXA 3PVGA 5CU6A 2EJ2A 4TNDA 1SNUA 5HI2A 5IUIA 5KZIA 4CKIA 3O0GA 4EOSA 4WOVA 4RT7A 3WF6A 2XKFA 4L67A 2W70A 5DT3A 2XKEA 3NVKI 5HVKA 2XD4A 2VTQA 3BZ3A 5CR5A 4C7TA 4P2KA 4U8ZA 4B99A 4RFMA 5DN3A 5DAAA