4O8KA

Crystal structure of type iii pantothenate kinase from burkholderia thailandensis, apo structure
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
GVCLLIDAGNSRIKWALADTGRHFVTSGAFEHADDTPDWSTLPAPRGAWISNVAGDAAAARIDALIDAHWPALPRTVVRACAAQCGVTNGYAEPARLGSDRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGRFTGGLIAPGWALMMRSLGMHTAQLPTVSIDAATSLLDELAANDAHAPFAIDTPHALSAGCLQAQAGLIERAWRDLEKAWKAPVRLVLSGGAADAIVRALTVPHTRHDTLVLTGLALIAHSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal structure of Type III pantothenate kinase from Burkholderia thailandensis, apo structure
rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 76
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2013-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o8kA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4o8kA02
5TKYA 3GBTA 3DXMA 5B8HA 3CJ9A 5AQUA 1S22A 1NWKA 5AZJB 3W3DA 3ULEB 3WXJA 4B9QA 2QWOA 1Q18A 4K25A 3CQYA 4L3QA 2ASMA 2ZGYA 5EY4A 2KHOA 3D2EB 2W41A 4IO8A 2A41A 4QS9A 3HTVA 4M63C 3KHYA 5AQHA 3RSEB 3EO3A 1MWMA 2P9KB 4BRLA 1E4FT 3AY9A 3I8BA 1SQKA 1HKGA 2IIRA 2YJFA 3ATVA 3WQUA 4BVOA 3CJBA 5LJVA 4Y0WA 1U6ZA 4DQ8A 3O6WA 3JXUA 4BRHA 1DKGD 2QWPA 3IFRA 3VGMA 1IG8A 4GY2B 1GLEG 2V52B 4NO7A 4O8KA 2GTDA 1D4XA 1WOQA 4B1XB 1NGBA 4EIAA 4HWIA 5AQLA 2P9LB 4BRPA 3VESA 2Q1NA 3WUHA 1ZXOA 1BG3A 2A40A 4BRDA 3O1BA 5ELZA 1MWKA 5AQZA 3QFUA 4O5FA 1H1VA 2NRHA 3TPQA 2IVOA 1BU6O 4A2AA 1GLBG 4E1JA 4XEIA 1QQNA 1BWFO 2GUPA 5AZJA 3ULEA 3MDQA 3WEEB 4PL7A 4H5VA 3A0IX 4BRAA 4BGAA 3LM9A 4MO4A 5KPTA 1BUPA 3DXKB 3D2EA 4FWRA 1HKCA 5AZIB 4B1VA 3H1VX 3BF3A 3JS6A 1MA9B 2FSKA 4BRMA 1ZBSA 4WQ4C 3RSEA 3I33A 2IVNA 1X3MA 3QDKA 4BR9A 1QHAA 1NGEA 4FWOA 4PKHA 2F9WA 2FSJA 2YJEA 3CERA 3DAWA 3CIPA 5F0XA 5AQQA 1V4TA 3R9PA 2VCPA 5FPNA 5BPLA 3C7NB 2H3GX 2CH6A 2D1KA 3CETA 3LDQA 2P9LA 3EN9A 4CBUA 1HJOA 2FF6A 4H0OA 2Q31A 3VEXA 4JNEA 3FFKB 2D0PA 4FWQA 3F9MA 5AQVA 2W40A 3OHRA 4J8FA 5BREA 3AARA 4CZJA 4YDUC 3UE5A 4BC2A 1HPMA 2QW9A 2YHXA 3WEEA 4A2BA 4CZFA 5JLFA 1P8ZA 4BR5A 3DXKA 2E2NA 3GDQA 4BR0A 5AZIA 3L4IA 1T6CA 2A6AA 1ATNA 4IJNA 3EZWA 4ISGA 4GNIA 5LJWA 1S3XA 4FOEA 3ENOA 2PBDA 5I9EB 1NBWA 2E20A 4BGBA 3A5LC 1RGIA 5AQFA 5AQRA 1HLUA 1R59O 5EXWA 3LDNA 2A42A 1IJJA 3QB0A 3ZX3A 3VEYA 2CH5A 3AAQA 2P9SB 1BA1A 3LL3A 5AR0A 1XQSC 4MO5A 4H03B 3C7NA 2QWRA 4FWKA 3O08A 3TU5A 2FF3B 3KZBA 5EOYA 3U9DA 4RCHA 4LC9B 3VENA 4K42A 5JICA 1NGCA 4FPBA 3DWLA 1EQYA 3D7EO 3HSCA 3O4WA 3VEVA 4RTFD 3UB5A 3VF2A 2D4WA 1BOTO 4CZHA 5BRHA 4CBWA 4IJAA 4WQ4A 2ZGZA 3BUZB 3FZFA 4BG9A 4BRNA 4XH4A 3S41A 2HMPA 4B1ZA 2A3ZA 4BVPA 5BN9A 4HTLA 3WT0A 4BG8A 3H6EA 3CJAA 4BRIA 3GL1A 5EVZA 4EHTA 1XC3A 2GWKA 2P9UB 3B8AX 1NGAA 4EFHA 3IUCA 2A5XA 4FSVA 1QQOA 3SMPA 3VGKA 2Q0RA 3BP8A 1X3NA 3FE1A 5BRDA 3WXKA 1JCFA 1KXPA 2FLOA 3GG4A 3MMVA 2QWMA 2P9IA 1ATRA 2GWJA 3FLCO 3UKRB 4BRGA 4CZKA 1NGIA 5BPNA 2P9SA 3LDLA 4QS8A 1Z6RA 3GOIA 2ZF5O 3C0BA 4YDUA 2BUPA 3O8MA 1NMDA 3LDPA 2QWQA 2V7ZA 5AQKA 2E8AA 2Q97A 2E1YA 4DB3A 3MN6A 2P9PB 5AQYA 4CZGA 4FOIA 3U8XA 2GELA 2I7PA 4PL8A 4M7XA 5FPEA 4JHDA 3MCPA 3UKUB 2I7NA 4BC3A 1NGJA 3ATUA 2Q0UA 3R6MA 3FGUA 3MK6A 3EKUA 1G99A 3WQTA 3MN5A 2ITMA 1TUUA 1HUXA 3LDOA 4PKGA 3ZEUB 2HF3A 4A62A 3KVGA 4BR4A 1ATSA 1GLLO 2CGJA 5KQ8A 3H45C 3HM8A 5LY3A 3R8EA 2Q2RA 5E84A 3VOVA 5BPMA 1BO5O 2UYTA 5AQSA 2FSNA 3QBXA 2P9UA 3D2FA 1RDWX 1NGFA 1CZAN 3H3NO 4BRQA 1GLDG 1Y64A 3UKRA 3HI0A 3VGLA 4JN4A 2WUSA 3CJ7A 3M3ZA 2E2PA 2AA4A 4CD3A 4CZMA 2PAVA 4JAXA 4AM6A 1DEJA 2E2QA 2QWLA 2QXLA 1QZ6A 3FZKA 2YCHA 4B1UB 1ESVA 5AQOA 1WUAA 3L6QA 2J4RA 3FR0A 2P9PA 4CJ7A 2P9IB 3A8YA 3VERA 3IDHA 4BQZA 3UKUA 4JD2B 1KAZA 1SZ2A 1GLFO 3FZHA 4CZEA 2P9NB 2QM1A 3CJ1A 3ZEUA 3HBTA 4CI6A 1C0FA 4I6MB 2Q36A 2ASOA 4FWNA 5AFUH 4WYBA 3GE1A 4IZ9A 3M1FA 3J8AA 4CZLA 2EWSA 1J6ZA 2F9TA 2ZWHA 1Z05A 5AQGA 4BC4A 3VEWA 3QFPA 3CQXA 4JHDB 2CGLA 4H5NA 4QS7A 4WQ5C 3BEXA 3O5BA 4H5TA 3H3OB 5JMVA 4AM7A 3H46O 2IVPA 4BREA 2ASPA 1YAGA 5AQTA 2HF4A 1NGDA 3A5MC 3VEOA 1K8KA 1V4SA 2FXUA 2V51B 4FWLA 2QWNA 3VF6A 3WXIA 3VETA 2VWBA 1TUYA 1SAZA 5AQWA 5AQPA 4BRFA 3D2FB 3SMSA 4DCHA 3CI5A 3EKSA 1NGHA 1JCGA 3G25A 1OKJA 4K41A 4H0VB 1GLCG 5JLHA 1KAXA 3HZ6A 4JD2A 4CBXA 1NM1A 4B1YB 4C23A 4K43A 1JCEA 3ZX0A 5KPRA 2P9NA 1X9JA 2AP1A 4Z94A 4I6MA 1GLJO 1YUWA 4PKIA 2VYPA 1HX1A 5ADXH 2CGKA 1YXQA 3LM2A 4FWMA 1U2VB 5KQDA 3U4LA 2HOEA 3L0QA 4FL9A 4CD1A 4B1WB 3H1QA 3ZETB 4H5WA 4M7YA 3P4IA 3BF1A 3AAPA 5EX5A 4BR2A 1KAYA 3EL2A 5AQJA 3VF4A 3ID8A 1LOTB 4H0TB 4IWVA 5AQMA 5AFUA 4H5RA 5BR9A 1QZ5A 2YHYA 4EAHD 1RFQA 5BN8A 3VPZA 2OANA 2P9KA 1TYQB 3U9ZA 2V7YA 3QMLA 4NB4A 5BRFA 4BR7A 3DXMB 4FPAA 5E26A 4FO0A 1BA0A 1T6DA 2YHWA 1GLAG 4IXCA 5FPMA 3SJHA 2E1ZA 3ENHA 2E88A 5KPZA 3QICA 4CZIA 4XH5A 4RWTA 4BC5A 5AQIA 4H0PA 1XUPO 2NLXA 4KBOA 5F2RA 3CHWA 1BDGA 2YI1A 1C0GA 4FWPA 5FPDA 4H0XB 5CE3A 4FWSA 3DJCA 2D0OA 1K8KB 1E4GT 4BROA 4DHYA 4ISFA 4WQ5A 3MN7A 1ZC6A 1LCUA 3A5NC 5AQXA 1MDUB 3FZMA 1DGKN 3MN9A 3IMXA 5F1XA 3QBWA 1T44A 3FZLA 3SLCA 3ZX2A 4MLHA 1U2VA 3O80A 4MLEA 4F9OA 3SK3A 1QQMA 2E2OA 3ZETA 3WXLA 4H0YB 2NZTA 3VEZA 4BRKA 3M6GA 4XH1A 4BRCA 2GEMA 1HKBA 4EHUA 5AQNA 5ADXA 2BTFA 3CJCA 4ISEA 3A5OC 4BQLA 1NGGA 4A61A 1TYQA 1YVNA 1NLVA 3O1WA 3W0LA 2DPNA
chains in the Genus database with same CATH superfamily
5TKYA 4LF7K 3GBTA 3DXMA 3CJ9A 1QSSA 1WSJA 4K25A 3CCLN 3TR8A 4L3QA 1QVFM 4DUZK 5EY4A 1Q7YO 2KHOA 3D2EB 3ZSXA 1JL2A 2A41A 4E7JA 1TKTA 4IBNA 3TSPA 1L3VA 4KH6A 5AQHA 3RMDA 3EO3A 3I55N 2YKNA 4BRLA 1E4FT 1BCMA 3AY9A 3I8BA 5KGXA 1SQKA 5C10A 5HLFA 3ATVA 4BVOA 3HSTB 3CC4N 2XRIA 3LAMA 1W97L 1U6ZA 3VA3A 1VQ5N 1GLEG 2V52B 5LMNK 3IG1A 2GTDA 2G8KA 4B1XB 1CZBA 3E66A 4HWIA 3AVNA 3OYJA 2Q1NA 3WUHA 3CPEA 4BRDA 3O1BA 2EX3A 1BI4A 4FW1A 3DLBA 3QFUA 2W6KA 4O5FA 3TPQA 1BU6O 4CF0A 1GLBG 3OYMA 4CJ4A 1NOZA 2O4IA 3NGZA 4BGAA 3LM9A 5KPTA 3VQ6A 3D2EA 3RRGA 3H1VX 1WLJA 1C6VA 4CEBA 4H8KA 4BRMA 1JJ2M 4Z0UA 4A5BA 3HO1A 3MWPA 5DMRA 1RTIA 3TAEA 3LP1A 2FSJA 4BDPA 1VQ6N 4M41A 1IG9A 3CIPA 5F0XA 4E1NA 5AQQA 4CGJA 4ILJA 4LY7A 3LAKA 4FJ5A 1RT6A 3C7NB 4RW6A 1KVCA 3LDQA 1HQEA 4EZ9A 2FF6A 1FK9A 1NK8A 3HOTA 4CIEA 4FM2A 3PV8A 4B8CA 4JNEA 3SPZA 3F9MA 1N33K 1OVYA 2W40A 1KD1O 2YHBA 1MU2A 4CJPA 5BREA 3UE5A 4BC2A 5KGWA 4B9NA 3Q7CA 4I2QA 3SUNA 5CZ2A 1HPZA 4CEFA 3KK7A 3EZWA 3AVCA 3DLRA 4W5TA 2GBZA 3U6FA 4OPAA 5I9EB 3G10A 4A59A 3LWMA 3RMCA 1Q82O 1HLUA 3EE9A 4PUOA 2A1SA 3QB0A 4FJIA 1IBLK 1S1UA 3AAQA 3V6DA 4CE9A 3N4PA 1YJWN 3MXJA 4ELVA 4CF1A 4FJHA 3C7NA 2QWRA 3O08A 2FF3B 4OGCA 4M45A 4OLAA 3KZBA 1BCOA 5EOYA 1NK6A 2HHQA 2VWJA 3VENA 2O8BB 4IOAL 5J2NA 3DWLA 3O4WA 1RBSA 4RTFD 3VF2A 1KC8O 3P1GA 4E19A 4CZHA 4CBWA 4AF1A 1IKYA 2D0BA 1N6QA 1C1BA 3BUZB 4CFCA 4Y1CA 4R79A 1NJYA 4HTLA 4BG8A 3SCXA 4BRIA 2HHHK 3HVRA 1FW6A 3O4QA 1VQ7N 1NGAA 3VGKA 2R7YA 1QQOA 3RVCA 4CJUA 1JLEA 3DRPA 1KXPA 3MMVA 2ZD1A 2P9IA 5C24A 3FLCO 1VQNN 4BRGA 1NGIA 3QIPA 4KH4A 1U45A 1Z6RA 2ZF5O 4EP4A 4YDUA 4KAZA 3J7AP 3VQ7A 2O8BA 1VQPN 4GV3A 4Z4EA 5AQYA 4B9VA 3RR8A 3IRXA 3HK2A 3NVMA 5FPEA 4JKHA 4N56A 1NGJA 3ZT0A 3DLGA 3V9ZA 3MK6A 3EKUA 1NKBA 3HYFA 5CY4A 2OZSA 3ZEUB 1HUXA 1N34K 4M3YA 3K57A 2KFNA 4FJ8A 4DQQA 4CJSA 1GLLO 4Z4CA 3R8EA 5BPMA 2UYTA 5AQSA 3D2FA 2O4GA 1SKRA 5HRRA 3AO2A 1CZAN 4FCYA 4BY9C 1VHXA 1LWEA 1GLDG 1HYSA 1I94K 2KZMA 3CJ7A 3M3ZA 3CXCM 4JI2K 1W9HA 3SUOA 4B3MK 4JAXA 4OLBA 3PX0A 3OS0A 2QWLA 1SL0A 2XY5A 4CGHA 1QZ6A 3C94A 3OS2A 3I8DA 3HM9A 4ZHRA 4KH5A 5AQOA 5C0YA 2WONA 1KRPA 3VERA 4BQZA 1HNVA 1O1WA 1UWBA 3VA0A 1DLOA 2P9NB 4CJVA 3ZEUA 3TI0A 4I6MB 4IFVA 3OJSA 3CD6N 4C8OA 1RTDA 4WYBA 1BGXT 3GE1A 2DTUA 4I9LA 4IZ9A 2YNGA 4CZLA 3OYBA 4G9ZA 4WFNL 5AQGA 4DLGA 3EEQA 3OS1A 2Z1HA 3CQXA 4WQ5C 4QS7A 3HOSA 3BEXA 4LF6K 4H5TA 2YV0X 3H3OB 5JMVA 2XY8A 4BREA 4KHNA 1YAGA 3AVBA 1WBDA 4PY5A 4IKFA 2FXUA 4FWLA 4B3OA 4KV8A 4JRQA 4JI8K 4BRFA 3OYGA 4Z4HA 3ZSQA 1TV6A 2D0AA 4C1NI 1JLQA 1Z25A 1OH7A 3CI5A 3B6OA 1IKVA 4YOUA 4CF8A 2HBKA 3G25A 5EU7A 1NJXA 1T3VA 3HZ6A 3SJJA 4OJRA 4C23A 2P9NA 1WAFA 2X6NA 3RMBA 2QKKA 3ID6A 3T7ZA 4I6MA 1GLJO 4Z94A 3VMFB 4MQ3A 3LM2A 4FWMA 2HNYA 3MEDA 2HOEA 1QTMA 3HL8A 4IOCL 4CD1A 4B1WB 1ZBUA 3V1QA 4JYAK 1QSLA 4H5WA 1HYVA 3AAPA 4DQRA 3PY8A 2DFHA 2VGMA 2HNZA 3VQBA 2ETJA 5K14A 2O8CB 1WSIA 4CIGA 4DV1K 5AFUA 1WAJA 3TWHA 2P9KA 3J81O 1YI2N 4XIUA 1SS6A 4NB4A 2BH1A 2ZE2A 5E26A 4W5RA 5T7BA 4IXCA 1XI1A 3OYHA 5CYQA 3MAQA 3WNHA 3QICA 5F2RA 4RW4A 2YI1A 2A1RA 4FWPA 5KRSA 4ELTA 3CC7N 4H0XB 4V19S 2IS3A 3I0RA 4O5BA 4YOWA 1ZC6A 1MDUB 1UAXA 1YHQN 3MN9A 2HMIA 1RT1A 4TSXA 3FZLA 3SLCA 3OW2M 4CK3A 1QS4A 4KHPK 1ASWA 3FFIA 4MLEA 1QQMA 2E2OA 1IV0A 3AVJA 3VEZA 3SQ4A 3OA9A 3DLEA 2O8CA 5AQNA 3CJCA 3KK3A 3CPWM 3HT3A 2RF2A 3OYDA 3T69A 2NNWA 3LP0A 4E0DA 1NLVA 3S3OA 1YT3A 3G71N 3HJFA 3W0LA 2DPNA 4JI0K 5B8HA 3SBTA 5D3GA 1S22A 4DTXA 4DTUA 1QQCA 3WXJA 5HROA 1S1WA 4I7FA 2OA8A 2ASMA 4NXMK 3K0SA 2ZJRL 3LWLA 1XC9A 2FBTA 2W41A 4QS9A 4IG0A 3KHYA 3ZT1A 4NYNA 4FK0A 3V1OA 4KB1A 4B9UA 4DQ8A 3MEEA 3L2UA 3SUQA 4BRHA 3IFRA 3VGMA 5HL7L 4GY2B 4BWJA 4NO7A 4O8KA 4CHPA 4PWDA 1G15A 1WOQA 1VSHA 1IBMK 4CK1A 4EIAA 5AQLA 3LANA 3O9UA 4JS4A 1ZXOA 1BHLA 2P51A 1BG3A 1EXQA 4FK2A 3EZ5A 3HVTA 1H1VA 2NRHA 1K8AO 4XEIA 4DKWA 4U7BA 1QQNA 1BWFO 4DSJA 4JEPA 1RBUA 3WEEB 1TK5A 4KRFA 4PL7A 2G8FA 1D8YA 3ISNC 4MO4A 4YOYA 4LFCK 3DXKB 2HSTA 4FWRA 1MA9B 1ZBSA 1I39A 3CCRN 2G8VA 1NOYA 2VQFK 2HB5A 3CFRA 3A2FA 5C42A 4PKHA 3VQDA 3TAMA 1N36K 3DAWA 4JI4K 2VCPA 5FPNA 4CF9A 4CHQA 2H3GX 3MXMA 2OTLN 4F2SA 1RTJA 3QETA 4Z4IA 1M90O 4H0OA 4KHQA 2Q31A 1KFSA 3SAHA 5HRSA 1Q9YA 3KWGA 3OHRA 4CEAA 5KTQA 5E41A 1X9WA 3VQ5A 1WN7A 4YFUA 2NRZA 3WEEA 3TTFA 4CZFA 1P8ZA 4BR5A 3DXKA 2E2NA 1TVRA 3GDQA 4K8XA 1JLBA 4DF8A 1B9FA 1T6CA 1JLGA 1DTQA 4GNIA 4ISGA 3VQCA 3AO4A 1EWRA 4DQPA 1XWLA 5LJWA 1S3XA 1C1AA 1BQNA 3ENOA 1W7AA 4BGBA 3A5LC 3M8RA 4O44A 3QLHA 3VEYA 3DLLL 3SNNA 2P5OA 1BA1A 1XQSC 2PYJA 3LZJA 4MO5A 4CJ3A 2XO7A 2HHWA 4FW2A 1P90A 4FWKA 3G0ZA 1JL1A 3TU5A 5GADP 3TSQA 4O0IA 2IGIA 4N47A 3U9DA 3VQQA 3PO4A 1NGCA 4GMJB 2PY5A 3VEVA 3J7YP 1EO1A 2JWLA 2AJQA 1SUQA 2UXDK 4CIFA 2ZGZA 4JK8A 1ASUA 3FZFA 1QSYA 2ATQA 4KTQA 5C15A 3S41A 2YX6A 3L2RA 3E9OA 3T3FA 3ULDA 1VQLN 2JGUA 4YOXA 3PUFA 3GL1A 4M3UA 4M3XA 4EHTA 3SV3A 1XC3A 2GWKA 2P9UB 1OH5A 4EFHA 3IUCA 3SMPA 2Q0RA 3BP8A 1X3NA 4JKDA 1VSDA 1Y97A 5IWAK 1EWQA 3O4NA 2NRVA 2GWJA 2O8DA 4CZKA 2PZSA 1O13A 4QS8A 1WSHA 4DTOA 4DQIA 3OY9A 3GOIA 4CGIA 3NF9A 1NMDA 5GAEP 2QWQA 2E8AA 2E1YA 4GKKK 4EP5A 3O3HA 4QAGA 3SPYA 5I3UA 1VSIA 4FJGA 2HHVA 4FOIA 1NNEA 2I7PA 4FVMA 3SAFA 4JHDA 2Q0UA 3LP3A 3FGUA 2E6LA 4KTWA 1U49A 3K2PA 1G99A 3C95A 4RG8A 3LDOA 3KLIA 4DU4A 4BDZA 3VQAA 3L8BA 2CGJA 5KQ8A 5LY3A 1LWCA 2IDOA 3AVKA 4YOTA 2FSNA 3TAPA 3QBXA 1T05A 2P9UA 4HTUA 4QOZB 1RDWX 1NGFA 2JWKA 4WFAL 4BRQA 5GINA 3CCSN 4C1NK 3MCAB 3L2VA 4DR3K 2WUSA 2E2PA 3K5MA 4DU1A 4CF2A 4FZXC 4CD3A 4J2AA 1S6QA 4E7HA 4AM6A 4CJTA 1WSEA 2UUCK 3ZSOA 1JLFA 1VSLA 2QXLA 3I0SA 4DSIA 2DY4A 3ZT4A 1KVAA 1WUAA 3L6QA 4E7LA 4LFAK 2P9IB 4KI4A 3OJUA 4DTSA 2UXBK 2BDPA 3IDHA 2E6MA 2QI2A 3K9KA 4NXNK 4DV7K 4OO1J 1SZ2A 4DTNA 4CZEA 2Q3SA 2QM1A 3HBTA 5J1EA 2JLEA 3VQEA 3HPHA 4CEDA 3OYCA 3ALYA 4DR6K 1VQ4N 5HRNA 2EWSA 1JXBA 3H08A 3VQ4A 3WNGA 4JKFA 1L3SA 1XMQK 4BC4A 2FBVA 3HRGA 3EE8A 4H5NA 4DSFA 3NVKA 2IVPA 5AQTA 1KLNA 4FJKA 2HF4A 4PQUA 1NGDA 1CXUA 3DYAA 1ZBHA 4B9TA 3IKMA 2HW3A 2OCEA 4GV6A 3WXIA 3M5RA 4LD0A 3CCUN 5AQWA 3AVAA 3D2FB 3SMSA 4RW9A 4CFAA 4IOXA 3SQ2A 3DRSA 2VG5A 4DCHA 2YNIA 3ZSWA 1Q81O 3S9HA 4DTRA 1JCGA 3OBWA 1S5JA 2BANA 4NCGA 3P83D 4K41A 3O9QA 4CJEA 3NFAA 1YJ9N 1NM1A 3T1AA 4CGGA 4CECA 1T03A 4K43A 2I5JA 3P31A 5FRNA 4BWMA 4I9QA 3U3YA 2AP1A 1IKXA 4PKIA 5ADXH 2CGKA 5HBMA 4NLCA 1BIZA 2DFEA 3ZSRA 4N5SA 2ITGA 3OYIA 1T7PA 3H1QA 4E89A 3P4IA 2RKIA 4BR2A 3KLHA 3LPUA 3EL2A 4G1QA 3VF4A 3ID8A 5AQMA 4H0TB 3T1HK 3THWA 4H5RA 1J53A 3J80O 1TYQB 3AO1A 4YNQA 3RMAA 4FJLA 4GW6A 3SQ0A 1U4BA 4BR7A 4FPAA 4CJLA 1KCFA 1T6DA 2YHWA 4CEEA 4JI7K 3CCMN 4XH5A 4RWTA 3E9PA 4BC5A 1XUPO 4KBOA 5CE3A 4FWSA 3B6PA 2D0OA 3DJCA 4H4OA 1E4GT 1HR0K 1JLCA 3EY1A 4FM0A 4F4KA 3AVFA 4WQ5A 1LCUA 3A5NC 2F4VK 1VQ8N 1YVUA 3FZMA 3IMXA 4KO0A 3AA5X 3QBWA 3ZX2A 4MLHA 1A5WA 4O55A 1L3UA 3MECA 4NCAA 4KFBA 3SK3A 1RT7A 4DTJA 5CZ1A 3TARA 4KHUA 4XH1A 3OYKA 4JV5K 2Z1IA 1N8RO 1HKBA 4DV3K 4EHUA 4CCHA 4OKEA 2FC0A 1QHTA 4ISEA 3A5OC 2HHTA 4A61A 3QESA 1TYQA 4B9MA 4HVJA 4LSNA 1QVGM 3L2QA 1NK9A 3W3DA 1Q18A 4X64K 3PSIA 3C6TA 4ID5A 4IDHA 3V81A 2QXFA 1WNSA 1NJZA 3BZCA 4O4GA 2NRWA 2F8SA 3HTVA 1VK0A 4NYFA 3WXMB 4DS4A 2P9KB 2ZQBA 2IIRA 2YJFA 3R3LA 2QA4N 1TL3A 1YTUA 2QKBA 3KK2A 5J2MA 3ITHA 1D4XA 4E7KA 3K59A 4DG1A 3KJVA 4DTMA 2P9LB 4BRPA 3VESA 4DFMA 4BE1A 2KQ2A 2GUIA 5ELZA 3SI6A 1MWKA 4BACA 1ITGA 3KLFA 4JK7A 3IAYA 2HVHA 2IVOA 5JVHL 5FRMA 3P39A 3QEIA 2HBJA 3L3VA 3AGKA 2GUPA 3F2KA 3QEVA 2UXCK 3K58A 3MDQA 3ZSYA 4H5VA 3A0IX 5J2QA 1BL3A 3K9JA 1N32K 4C8NA 5AZIB 3JYTA 4CJ5A 4HCCA 4DQSA 4IEIA 3BF3A 3JS6A 4JLHA 4WQ4C 3SZ2A 3TAGA 4DFPA 3KD5E 3ENBA 2IVNA 4FJMA 1X3MA 2QK9A 2KZZA 5C2FA 4BR9A 1QHAA 3O9SA 3NBPA 1LW0A 2YJEA 3CERA 4ICLA 2YKMA 1V4TA 1Q8IA 3R9PA 1X9MA 4CJRA 3TABA 1HNXK 4PHTX 5BPLA 4CHNA 1LAWA 2QTDA 1RBTA 3KLGA 4DR4K 4DR2K 4KPYA 4OGEA 2P9LA 1JXEA 3NH0A 1TGOA 4C8KA 4DR7K 4W5OA 1HJOA 3CM6A 3SQ1A 1FKOA 1YIJN 3VEXA 4E1MA 4FWQA 4CGFA 4OKJA 4W5QA 5AJ3K 3AARA 4KB0A 1HPMA 2QW9A 1WSGA 2YHXA 1UA0A 5HOOA 1SKWA 1D9FA 4FLYA 1KLMA 2B5JA 4C8MA 4BR0A 5AZIA 2A6AA 1ATNA 4Q5VA 5FDLA 4FLUA 2PBDA 5M1OA 2E20A 2XY6A 3CYMA 4I2PA 2G8HA 1LAVA 1YTAA 1RGIA 5GAHP 4JI5K 1DTTA 1S6PA 5AQRA 1NK7A 3LDNA 1Q86O 2YNFA 2P9SB 4B9SA 3LL3A 1FJGK 5J2PA 3LALA 1E3MA 1TL1A 1LV5A 3MEGA 5CR4A 2X78A 4DUYK 1WSFA 3QEWA 4LC9B 3R1XA 4FPBA 4JS5A 3D7EO 4B8AB 3HXMA 3UB5A 3WNFA 3C6UA 4DWIA 1BOTO 2LSNA 2OPPA 5BRHA 4IJAA 3L3UA 5CHIA 2E4LA 4ZTFA 2IAJA 3NE6A 4BE2A 3ZLJA 3DOKA 3QEPA 4FXDA 1NJIO 4FLXA 4X62K 2WTUA 3O9RA 4M3ZA 4CERA 2A3ZA 5BN9A 2DFFA 4E7IA 1L3TA 3D6RA 3H6EA 5DM6L 2UU9K 1VSJA 3G6EN 1NMNA 5M1KA 1JKHA 3OVNA 5KI6A 4L8RB 3NAEA 4E3SA 2WFBA 1GOCA 3QNNA 5BRDA 4KHSA 3FE1A 4FLTA 2G8WA 3WXKA 4AHVA 3V9UA 2FLOA 2QWMA 2X6SA 1S9GA 5BPNA 3VTIA 3AVLA 2P9SA 1TAQA 4M3WA 4LF8K 3QO9A 2BUPA 3O8MA 5AQKA 3ZYYX 2Q97A 2GX9A 4HUEA 4DB3A 1VSMA 1KQSM 4AHSA 1RDBA 4AHUA 2P9PB 4CZGA 2GELA 4FVUA 4PL8A 4M7XA 5KRTA 3UKUB 4BC3A 4Z4FA 2Z1GA 1VSEA 3ZSZA 4BE0A 3BGRA 2F7TA 2NRTA 3WQTA 3LPTA 3MN5A 4DS5A 3AA4A 3D45A 5HRPA 4M3TA 4A62A 3KVGA 2D5RA 5FLXO 4A57A 4BR4A 1TK0A 2Z1JA 1ATSA 3HM8A 3MX2A 2Q2RA 2NRXA 2VG7A 5E84A 3VOVA 4FLWA 4ZTJA 3F5TA 3SYZA 2Y1IA 4KREA 3V9XA 3CMAN 4Z4GA 1RILA 1R0AA 4WF9L 3HI0A 3VGLA 3CCEN 2XY7A 4JN4A 3AVGA 4CFDA 2AA4A 3AVHA 3SV4A 4DTPA 2PAVA 4IFEA 1DEJA 3O3GA 2G8UA 1XNQK 2YCHA 3ZT2A 1ESVA 1U04A 3AA2A 1Q9XA 2J4RA 2P9PA 4CJ7A 1TAUA 4YORA 3A8YA 4DV6K 2O8DB 5JVGL 1FKPA 3UKUA 2ZM6K 1TKXA 1KAZA 1GLFO 4YY3K 3VQ8A 1EP4A 3PO5A 3CJ1A 1T8EA 1C0FA 3CCJN 3PX4A 2Q36A 2ASOA 3AGRA 5AFUH 2D0CA 2FBXA 3C65A 3M1FA 1LWFA 3J8AA 2ZWHA 1Z05A 3KKSA 2P1JA 4CK2A 1IO2A 3VEWA 4O0JA 3M8SA 3QFPA 4FZZA 3AO3A 4JHDB 4CHZA 3AO5A 5CYMA 4FM1A 2ASPA 4LF4K 4AQYK 4CHOA 3VEOA 3T19A 2P5GA 1K8KA 1V4SA 1JLAA 3VF6A 3M8QA 3RR7A 2HHUA 1TUYA 4B3RK 1NKCA 5AQPA 1SKSA 1K9MO 1U48A 3DI6A 3EKSA 1NGHA 5A2QO 5M1QA 4B3TK 4H0VB 4K0KK 1NKEA 1C0UA 1S1TA 1RDDA 1LW2A 4B1YB 5KPRA 3ZX0A 3TSUA 4FJ7A 1HX1A 1ASVA 1YXQA 2Y1JA 3L0QA 4FL9A 3NH2A 5FROA 1RCHA 4M7YA 3NF7A 4DLEA 5EX5A 1KAYA 1IKWA 2PYLA 5AQJA 4IWVA 1REVA 2GV9A 1QZ5A 2FBYA 2YHYA 4WFBL 1RFQA 4PA1A 4ID1A 2HVIA 1A5XA 2OANA 4OVLA 4X65K 4U67L 4B9LA 4JI3K 1VQKN 4BDYA 1NK5A 4FO0A 1BA0A 1GLAG 4DSEA 2HHXA 4NLBA 4OX9K 2OPSA 1HQUA 4UQGA 4KHWA 4H0PA 3CCQN 2NLXA 3CHWA 1C0GA 5FPDA 3THVA 5M1FA 4DHYA 4JKCA 4ISFA 4KHYA 3MN7A 2OPQA 2VQEK 1RBRA 1DGKN 2IOCA 1GOAA 3Q7BA 3O9TA 4FJNA 1ZBIA 1T44A 4CJQA 1W0HA 3ZSVA 2NUBA 3O80A 4F9OA 3WXLA 3LP2A 4FJ9A 1CLQA 4BRKA 3M6GA 3CC2N 2GEMA 4J2DA 1KVBA 3RRHA 4DFKA 4LFBK 1S9EA 3RWUA 4KI6A 4AH9A 3WNEA 4FYDA 1IH7A 2BE2A 3O1WA 3J7ZO 3E9LA 2W42A 5AQUA 1NWKA 5AZJB 3M8PA 3ULEB 4B9QA 3EYZA 3NGYA 2QWOA 4LH4A 1TK8A 3OBYA 3CQYA 1XNRK 2ZGYA 1RBVA 3NDKA 5JS2A 3TAFA 4IO8A 3KLEA 4O8UA 3THWB 2ZJPL 3S3NA 3P5JA 4M63C 1QE1A 3RSEB 2HBMA 1MWMA 3NGIA 3QIOA 1HKGA 4K8ZA 3ZT3A 3KKRA 3WQUA 3CJBA 5LJVA 3D0PA 2OYQA 4KKOA 4Y0WA 3O6WA 3CF5L 4IDKA 3JXUA 1DKGD 2QWPA 1IG8A 1NGBA 2RN2A 3QEXA 1S1XA 1XHZA 4YHHK 3HPOA 2A40A 3CCVN 3F9KA 5AQZA 2F96A 2B6AA 1B9DA 1VQON 3OYLA 4A2AA 4E1JA 1J5OA 1D9DA 2E5LK 5AZJA 3ULEA 2XHBA 3V1RA 4CHYA 1NJWA 4BRAA 1HMVA 1BUPA 1VRUA 5DK5A 1HKCA 4B1VA 4X66K 4B08A 2FSKA 3RSEA 5M1PA 4DFJA 1K73O 1UA1A 3HP9A 3I33A 1EX4A 3QDKA 4DV5K 1VSKA 2F8TA 4J2EA 1NGEA 4CEOA 4FWOA 4JKAA 3QERA 2F9WA 3DLHA 2KLAA 4DV4K 4HUGA 3OYNA 4GVEA 3L4QA 1OVQA 3OYEA 2CH6A 4DSKA 2D1KA 3CETA 1XMOK 3DM2A 3EN9A 4CBUA 4MFBA 3UIQA 1EETA 2B4JA 3FFKB 3RTVA 2D0PA 5GAGP 3C6HA 1RT4A 5LMUK 5AQVA 2VG6A 4WCEL 2W6LA 4J8FA 1VQ9N 1NU0A 2WOMA 5LL6Z 4CZJA 3OYFA 4B3SK 4YDUC 3CQ8A 4CW7B 1KFDA 4GV9A 4ILHA 4A2BA 2UUAK 5JLFA 3CFPA 3TTDA 3L4IA 4ILGB 4IJNA 4FZYA 1K6YA 2YNHA 1CXQA 4FOEA 1VAZA 2VGNA 1NBWA 2RPIA 3ASMA 1C1CA 5AQFA 1R59O 1RT2A 5EXWA 4JKBA 4LF5K 2A42A 5IT9O 1IJJA 3BZKA 3ZX3A 4AHTA 2OTJN 4JRPA 2CH5A 2ZJQL 1BQMA 5AR0A 3KTQA 4H03B 2O8FB 4DF4A 4RW8A 3P38A 3HPGA 4RCHA 5C12A 1J9AA 4K42A 5JICA 1XHXA 5MLCQ 3PIOL 2UUBK 1EQYA 3HSCA 5M1NA 3BDPA 2OPRA 1RTHA 1RT3A 2D4WA 1UOCA 5C2DA 2QEXN 3NF8A 4WQ4A 1A5VA 1F21A 4BG9A 4CGDA 4BRNA 3SUPA 4XH4A 4Y1DA 2HMPA 4HUFA 4B1ZA 1X9SA 4BVPA 1C0MA 3WT0A 5JS1A 5GIPA 2WC9A 3CJAA 3VN5A 4JK9A 3KWIA 5EVZA 3AA3A 3V4IA 4WE1A 3B8AX 2A5XA 4FSVA 4IG3A 3G4SN 4CEQA 1WB9A 1D5AA 1JCFA 3GG4A 1ATRA 3UKRB 1I3AA 1BISA 1TKDA 4ELUA 3HP6A 3LDLA 1TKZA 1X1PA 1YJNN 1IBKK 2BGGA 2KTQA 4YOVA 1RDUA 3C0BA 2O8FA 3LDPA 2V7ZA 4F3TA 5H1SQ 4JI6K 4GVMA 2EHGA 4LH5A 3VQ9A 3MN6A 4FK4A 1GOBA 3CFOA 4AHCA 1Z26A 4CEZA 3L2WA 3K5OA 4DR5K 3KD1E 3U8XA 3PSFA 5SZTA 1HNWK 4NCBA 3K5LA 3MCPA 1NK0A 2I7NA 1N5YA 3ATUA 4IEEA 3PLAA 4M3RA 3R6MA 3AVMA 3NMUA 2ITMA 4IFYA 1TUUA 4PKGA 2HF3A 3TANA 1YITN 2HNDA 4FJJA 4LF9K 3H45C 3OYAA 5TKWA 1BO5O 3F73A 1S72N 1ILYA 3H3NO 1B92A 4IO9L 4GKJK 1Y64A 3UKRA 1NG9A 4CESA 4FLZA 3C6AA 3LDSA 1FXXA 3MXIA 3JSMA 4CZMA 2HHSA 1VRTA 4HCBA 2E2QA 1C0TA 1ZBLA 3FZKA 4B1UB 3BY5A 4JKGB 3NF6A 3FR0A 4Q0BA 1HRHA 1NK4A 4DMNA 2PFUA 4JD2B 3ZCMA 2VWKA 1RDCA 3CG7A 4LSLA 4UY8O 3FZHA 4CJWA 3KIOA 4CI6A 4N76A 4FWNA 3THXB 3NCIA 5HP1A 3DLKA 1J6ZA 2F9TA 1VSFA 4AILC 2KW4A 2CGLA 4DU3A 1HJRA 3O5BA 1RDAA 4AHRA 4AM7A 3H46O 4F8RA 1RT5A 1ZBFA 4JKEA 2RHKA 3A5MC 2V51B 2QWNA 4OKKA 1HNZK 4C8LA 1M1KO 1OH8A 5SWMA 3VETA 2VWBA 1SAZA 4CJFA 4KTZA 3THYB 4R5PA 3E01A 3SAGA 4QCLA 4JKGA 1W2BM 4N41A 4FJXA 2IC3A 5C25A 2O8EB 1OKJA 1HYZA 3DMJA 1GLCG 5JLHA 1EKEA 1KAXA 3AVIA 4JD2A 4CBXA 4DR1K 3DRRA 1HNIA 1JCEA 3NHGA 2YHAA 1BIUA 1KTQA 3VQPA 1X9JA 2NRRA 1RNHA 1YUWA 3LZIA 2VYPA 3THXA 1U2VB 4FLVA 5GIOA 4OPKA 3PIPL 3MWTA 5KQDA 3U4LA 4EZ6A 3ZETB 4MDBA 3BF1A 3CMEN 2G8IA 1J54A 3MX5A 4W5NA 1LOTB 5BR9A 4OPHA 3VTHA 3N4QA 4EAHD 5BN8A 3E1YA 3VPZA 1OH6A 3TTCA 3K5NA 3U9ZA 4M42A 2V7YA 1ZYQA 3QMLA 5BRFA 2RE2A 3PX6A 3DXMB 1S1VA 4CVNE 3THYA 2KFZA 5I42A 2KKZA 5FPMA 3SJHA 4H4MA 2E1ZA 4RW7A 1SL2A 4J2BA 3ENHA 2E88A 5KPZA 1YF5L 4CZIA 3U3GA 3DOLA 5AQIA 1KSPA 1SV5A 1J5EK 2OZMA 2O8EA 1BDGA 3QINA 4F2RA 4DV2K 4F3OA 1DT9A 3JAMO 1K8KB 4BROA 3V9WA 5AQXA 4CFBA 3TAQA 2HBLA 5F1XA 1CZ9A 3OTOK 5BR8K 1VQMN 3AV9A 1U2VA 1U47A 3CM5A 3S3MA 3IS9A 3ZETA 3O3FA 4H0YB 2NZTA 4DSLA 4HHTA 4JI1K 3QNOA 1SL1A 3SBGA 4BRCA 3KK1A 3V9SA 5ADXA 4A5AA 2BTFA 2X74A 4OPJA 1BI4B 3I56N 1L5UA 4DV0K 2WBNA 4BQLA 1NGGA 3T1YK 4MDAA 5DM7L 1YVNA 4CJKA 3NH1A 1WBBA
chains in the Genus database with same CATH topology
5TKYA 1QVGM 3GBTA 3E9LA 3DXMA 5B8HA 3CJ9A 5AQUA 3SBTA 1S22A 1NWKA 5AZJB 3W3DA 3ULEB 3WXJA 4B9QA 2QWOA 1Q18A 4K25A 3OBYA 3CQYA 3CCLN 4L3QA 4IDHA 2ASMA 1QVFM 2ZGYA 5EY4A 1Q7YO 2ZJRL 2KHOA 3D2EB 2W41A 4IO8A 4O8UA 2A41A 2NRWA 4QS9A 2ZJPL 3TSPA 3HTVA 4M63C 3KHYA 4KH6A 5AQHA 3WXMB 3RSEB 2HBMA 3EO3A 1MWMA 2P9KB 3I55N 4BRLA 1E4FT 3AY9A 3I8BA 1SQKA 5C10A 1HKGA 2IIRA 2YJFA 3ATVA 3R3LA 3WQUA 4BVOA 3CJBA 3CC4N 2QA4N 5LJVA 1W97L 4Y0WA 1U6ZA 4DQ8A 3O6WA 3CF5L 3JXUA 4BRHA 1DKGD 2QWPA 3IFRA 3VGMA 1IG8A 5HL7L 1VQ5N 4GY2B 1GLEG 2V52B 4NO7A 4O8KA 2GTDA 1D4XA 1WOQA 4B1XB 1NGBA 3E66A 4EIAA 4HWIA 5AQLA 3O9UA 2P9LB 4BRPA 3VESA 2Q1NA 3WUHA 1ZXOA 1BG3A 3CPEA 2A40A 4BRDA 3O1BA 5ELZA 3CCVN 1MWKA 5AQZA 3QFUA 4JK7A 4O5FA 1H1VA 2NRHA 1VQON 3TPQA 2IVOA 1BU6O 5JVHL 4A2AA 1GLBG 3P39A 1K8AO 4E1JA 4XEIA 2HBJA 4DKWA 4U7BA 1QQNA 3AGKA 1BWFO 2GUPA 3F2KA 5AZJA 4JEPA 3ULEA 3MDQA 3WEEB 4PL7A 4H5VA 3A0IX 4BRAA 4BGAA 3LM9A 4MO4A 4YOYA 5KPTA 3K9JA 1BUPA 3DXKB 3D2EA 2HSTA 4FWRA 1HKCA 5AZIB 4B1VA 3H1VX 4IEIA 3BF3A 3JS6A 1MA9B 2FSKA 4BRMA 1ZBSA 4WQ4C 3RSEA 1JJ2M 5M1PA 1K73O 5BPMA 3CCRN 4A5BA 3ENBA 3I33A 2IVNA 1X3MA 3QDKA 5C2FA 3MWPA 4BR9A 1QHAA 1NGEA 3O9SA 4FWOA 4JKAA 4PKHA 2F9WA 2FSJA 2KLAA 2YJEA 3CERA 1VQ6N 3DAWA 3CIPA 5F0XA 4GVEA 1V4TA 5AQQA 3R9PA 2VCPA 5FPNA 3L4QA 4ILJA 4PHTX 5BPLA 3C7NB 2QTDA 2H3GX 2CH6A 2D1KA 3CETA 3LDQA 2OTLN 2P9LA 3EN9A 4CBUA 1HJOA 2FF6A 1M90O 4H0OA 3HOTA 2Q31A 1YIJN 3VEXA 4JNEA 3FFKB 2D0PA 4FWQA 5GAGP 3SAHA 3C6HA 3F9MA 5AQVA 4WCEL 1OVYA 2W40A 3KWGA 3OHRA 4J8FA 1KD1O 5BREA 1VQ9N 3AARA 4CZJA 4YDUC 3UE5A 4BC2A 1HPMA 2QW9A 4GV9A 2NRZA 3Q7CA 2YHXA 5HOOA 3WEEA 4ILHA 3TTFA 4A2BA 4CZFA 5JLFA 3KK7A 1P8ZA 4BR5A 3DXKA 2E2NA 3GDQA 4BR0A 5AZIA 3TTDA 3L4IA 4ILGB 1T6CA 2A6AA 1ATNA 4IJNA 3EZWA 4ISGA 4GNIA 5LJWA 1S3XA 4OPAA 4FOEA 3ENOA 2PBDA 1VAZA 2VGNA 5M1OA 1NBWA 2E20A 4A59A 5I9EB 4BGBA 3A5LC 1RGIA 5GAHP 1Q82O 5AQFA 5AQRA 1HLUA 1R59O 5EXWA 4JKBA 3EE9A 3LDNA 2A42A 1IJJA 3QB0A 3ZX3A 3VEYA 1Q86O 3DLLL 2CH5A 3AAQA 2OTJN 2P9SB 1BA1A 2ZJQL 3LL3A 3N4PA 5AR0A 1XQSC 1YJWN 4MO5A 4H03B 1P90A 3C7NA 2QWRA 4FWKA 3O08A 3TU5A 2FF3B 5CR4A 5GADP 3KZBA 5EOYA 3TSQA 3P38A 3U9DA 4RCHA 4LC9B 3VENA 4K42A 3R1XA 5C12A 5JICA 5MLCQ 3PIOL 4IOAL 1NGCA 4FPBA 3DWLA 1EQYA 3D7EO 3HSCA 5M1NA 3O4WA 3VEVA 4RTFD 3UB5A 2JWLA 3VF2A 1KC8O 2D4WA 1EO1A 1BOTO 4CZHA 5BRHA 5C2DA 2QEXN 4CBWA 4IJAA 4WQ4A 4AF1A 2ZGZA 4JK8A 5CHIA 3BUZB 3FZFA 4BG9A 5C15A 4BRNA 1NJIO 4XH4A 3S41A 2YX6A 2HMPA 3O9RA 4B1ZA 2A3ZA 4BVPA 5BN9A 3E9OA 4HTLA 3WT0A 4R79A 4BG8A 5GIPA 1VQLN 3D6RA 3H6EA 5DM6L 4YOXA 2WC9A 3CJAA 4BRIA 3G6EN 3GL1A 4JK9A 5M1KA 3KWIA 5EVZA 4EHTA 1XC3A 2GWKA 2P9UB 2WFBA 3B8AX 1VQ7N 1NGAA 4EFHA 3IUCA 2A5XA 4FSVA 1QQOA 3SMPA 3VGKA 2Q0RA 3BP8A 1X3NA 3FE1A 3RVCA 5BRDA 4JKDA 3G4SN 3WXKA 1JCFA 1KXPA 2FLOA 3GG4A 3MMVA 2QWMA 2P9IA 1ATRA 2GWJA 2NRVA 3FLCO 3UKRB 1VQNN 4BRGA 4CZKA 1NGIA 1O13A 5BPNA 3VTIA 2P9SA 3LDLA 4KH4A 4QS8A 1Z6RA 1YJNN 3GOIA 4YOVA 2ZF5O 1RDUA 3C0BA 4YDUA 2BUPA 3O8MA 1NMDA 3LDPA 5GAEP 2QWQA 2V7ZA 5AQKA 2E8AA 3ZYYX 5H1SQ 2Q97A 2E1YA 2GX9A 4DB3A 3MN6A 1VQPN 1KQSM 4GV3A 2P9PB 5AQYA 4CZGA 4FOIA 3U8XA 2GELA 2I7PA 4FVUA 3NVMA 4PL8A 4M7XA 5FPEA 4JHDA 4JKHA 3SAFA 3MCPA 3UKUB 2I7NA 4BC3A 1NGJA 3ATUA 4IEEA 3PLAA 2Q0UA 3R6MA 2F7TA 3FGUA 2NRTA 3EKUA 3MK6A 1G99A 3WQTA 3MN5A 3NMUA 2ITMA 1TUUA 1HUXA 3LDOA 4PKGA 3ZEUB 2HF3A 4A62A 3KVGA 1YITN 4A57A 4BR4A 1ATSA 1GLLO 2CGJA 5KQ8A 3H45C 3HM8A 5LY3A 3MX2A 3R8EA 2Q2RA 2NRXA 5E84A 5TKWA 1BO5O 2UYTA 5AQSA 2FSNA 4YOTA 3QBXA 3VOVA 2P9UA 3D2FA 1RDWX 1S72N 1ILYA 1NGFA 2JWKA 4WFAL 1CZAN 3F5TA 3H3NO 4BRQA 4BY9C 3CMAN 4IO9L 5GINA 1GLDG 3CCSN 1Y64A 3MCAB 3UKRA 4C1NK 4WF9L 3HI0A 3VGLA 3CCEN 3C6AA 4JN4A 2WUSA 3CJ7A 3M3ZA 2E2PA 3CXCM 2AA4A 4CD3A 4CZMA 2PAVA 4JAXA 4AM6A 4IFEA 1DEJA 2E2QA 2QWLA 2QXLA 1QZ6A 3FZKA 2YCHA 4B1UB 4JKGB 1ESVA 4KH5A 1WUAA 3L6QA 5AQOA 2J4RA 5C0YA 3FR0A 2P9PA 4CJ7A 2P9IB 4YORA 3A8YA 3VERA 5JVGL 2PFUA 3IDHA 4BQZA 2QI2A 3UKUA 4JD2B 3K9KA 1KAZA 4OO1J 1SZ2A 4UY8O 1GLFO 3FZHA 4CZEA 2P9NB 2QM1A 3CJ1A 3ZEUA 3HBTA 4CI6A 1C0FA 4I6MB 3CCJN 3CD6N 2Q36A 2ASOA 3AGRA 4FWNA 5AFUH 4WYBA 3GE1A 3C65A 1VQ4N 4IZ9A 3M1FA 3J8AA 4CZLA 2EWSA 1J6ZA 2F9TA 2ZWHA 4G9ZA 4WFNL 1Z05A 5AQGA 4JKFA 4BC4A 3VEWA 3QFPA 3HRGA 3CQXA 4JHDB 2CGLA 3EE8A 4H5NA 4QS7A 4WQ5C 3BEXA 3O5BA 4H5TA 3HOSA 3NVKA 3H3OB 5JMVA 4AM7A 3H46O 2IVPA 4BREA 2ASPA 1YAGA 5AQTA 2HF4A 4JKEA 1NGDA 2RHKA 3A5MC 3VEOA 1K8KA 1V4SA 2FXUA 2V51B 3IKMA 4FWLA 2QWNA 4GV6A 3VF6A 3WXIA 3M5RA 1M1KO 3VETA 2VWBA 1TUYA 1SAZA 3CCUN 5AQWA 5AQPA 4BRFA 3D2FB 3SMSA 4IOXA 4C1NI 1K9MO 3SAGA 4DCHA 3CI5A 1Q81O 4YOUA 3EKSA 4JKGA 1NGHA 1W2BM 1JCGA 2HBKA 3OBWA 3G25A 5M1QA 1OKJA 4K41A 4H0VB 1T3VA 3O9QA 1GLCG 5JLHA 1KAXA 3HZ6A 4JD2A 4CBXA 1YJ9N 1NM1A 4B1YB 4C23A 4K43A 1JCEA 3ZX0A 5KPRA 3P31A 3TSUA 2P9NA 1X9JA 2NRRA 2AP1A 3ID6A 4I6MA 1GLJO 1YUWA 3T7ZA 4Z94A 4PKIA 2VYPA 1HX1A 3VMFB 5ADXH 2CGKA 1YXQA 3LM2A 4FWMA 1U2VB 5GIOA 4NLCA 3PIPL 3MWTA 5KQDA 3U4LA 2HOEA 3L0QA 4FL9A 4IOCL 4CD1A 4B1WB 3H1QA 3ZETB 4H5WA 4M7YA 4MDBA 3P4IA 3BF1A 3AAPA 5EX5A 4BR2A 2VGMA 3CMEN 1KAYA 3EL2A 5AQJA 3MX5A 3VF4A 3ID8A 1LOTB 4H0TB 4IWVA 5AQMA 5AFUA 4H5RA 4OPHA 5BR9A 1QZ5A 3N4QA 2YHYA 3VTHA 4EAHD 1RFQA 4WFBL 5BN8A 3E1YA 3VPZA 2OANA 3TTCA 2P9KA 1TYQB 4U67L 3U9ZA 2V7YA 1YI2N 1SS6A 3QMLA 2BH1A 2RE2A 4NB4A 4BR7A 3DXMB 4FPAA 5BRFA 1VQKN 5E26A 4FO0A 1BA0A 1T6DA 2YHWA 1GLAG 2KKZA 4IXCA 5FPMA 3SJHA 2E1ZA 3CCMN 3ENHA 2E88A 4NLBA 1YF5L 3QICA 4CZIA 5KPZA 4XH5A 4RWTA 3E9PA 4BC5A 5AQIA 4H0PA 3CCQN 1XUPO 2NLXA 4KBOA 5F2RA 3CHWA 1BDGA 2YI1A 1C0GA 4FWPA 5FPDA 3CC7N 4H0XB 5CE3A 1DT9A 4FWSA 3DJCA 2D0OA 1K8KB 5M1FA 1E4GT 4BROA 4DHYA 4JKCA 4ISFA 4WQ5A 4YOWA 3MN7A 1ZC6A 1LCUA 3A5NC 5AQXA 1VQ8N 1MDUB 3FZMA 1DGKN 1YHQN 3MN9A 3IMXA 2HBLA 5F1XA 3Q7BA 3O9TA 3QBWA 1T44A 3FZLA 3SLCA 3ZX2A 1VQMN 4MLHA 1U2VA 3OW2M 3O80A 4MLEA 4F9OA 3SK3A 1QQMA 2E2OA 3ZETA 3WXLA 4H0YB 2NZTA 3VEZA 4BRKA 3M6GA 4XH1A 3CC2N 3OA9A 3SBGA 4BRCA 1N8RO 2GEMA 1HKBA 4EHUA 5AQNA 5ADXA 4A5AA 2BTFA 3CJCA 3I56N 3CPWM 4ISEA 3A5OC 2WBNA 4BQLA 1NGGA 4A61A 4MDAA 5DM7L 1TYQA 1YVNA 2NNWA 3T69A 1NLVA 3G71N 3O1WA 3J7ZO 3W0LA 2DPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKY A;  3GBT A;  3DXM A;  5B8H A;  3CJ9 A;  5AQU A;  1S22 A;  1NWK A;  5AZJ B;  3W3D A;  3ULE B;  3WXJ A;  4B9Q A;  2QWO A;  1Q18 A;  4K25 A;  3CQY A;  4L3Q A;  2ASM A;  2ZGY A;  5EY4 A;  2KHO A;  3D2E B;  2W41 A;  4IO8 A;  2A41 A;  4QS9 A;  3HTV A;  4M63 C;  3KHY A;  5AQH A;  3RSE B;  3EO3 A;  1MWM A;  2P9K B;  4BRL A;  1E4F T;  3AY9 A;  3I8B A;  1SQK A;  1HKG A;  2IIR A;  2YJF A;  3ATV A;  3WQU A;  4BVO A;  3CJB A;  5LJV A;  4Y0W A;  1U6Z A;  4DQ8 A;  3O6W A;  3JXU A;  4BRH A;  1DKG D;  2QWP A;  3IFR A;  3VGM A;  1IG8 A;  4GY2 B;  1GLE G;  2V52 B;  4NO7 A;  4O8K A;  2GTD A;  1D4X A;  1WOQ A;  4B1X B;  1NGB A;  4EIA A;  4HWI A;  5AQL A;  2P9L B;  4BRP A;  3VES A;  2Q1N A;  3WUH A;  1ZXO A;  1BG3 A;  2A40 A;  4BRD A;  3O1B A;  5ELZ A;  1MWK A;  5AQZ A;  3QFU A;  4O5F A;  1H1V A;  2NRH A;  3TPQ A;  2IVO A;  1BU6 O;  4A2A A;  1GLB G;  4E1J A;  4XEI A;  1QQN A;  1BWF O;  2GUP A;  5AZJ A;  3ULE A;  3MDQ A;  3WEE B;  4PL7 A;  4H5V A;  3A0I X;  4BRA A;  4BGA A;  3LM9 A;  4MO4 A;  5KPT A;  1BUP A;  3DXK B;  3D2E A;  4FWR A;  1HKC A;  5AZI B;  4B1V A;  3H1V X;  3BF3 A;  3JS6 A;  1MA9 B;  2FSK A;  4BRM A;  1ZBS A;  4WQ4 C;  3RSE A;  3I33 A;  2IVN A;  1X3M A;  3QDK A;  4BR9 A;  1QHA A;  1NGE A;  4FWO A;  4PKH A;  2F9W A;  2FSJ A;  2YJE A;  3CER A;  3DAW A;  3CIP A;  5F0X A;  5AQQ A;  1V4T A;  3R9P A;  2VCP A;  5FPN A;  5BPL A;  3C7N B;  2H3G X;  2CH6 A;  2D1K A;  3CET A;  3LDQ A;  2P9L A;  3EN9 A;  4CBU A;  1HJO A;  2FF6 A;  4H0O A;  2Q31 A;  3VEX A;  4JNE A;  3FFK B;  2D0P A;  4FWQ A;  3F9M A;  5AQV A;  2W40 A;  3OHR A;  4J8F A;  5BRE A;  3AAR A;  4CZJ A;  4YDU C;  3UE5 A;  4BC2 A;  1HPM A;  2QW9 A;  2YHX A;  3WEE A;  4A2B A;  4CZF A;  5JLF A;  1P8Z A;  4BR5 A;  3DXK A;  2E2N A;  3GDQ A;  4BR0 A;  5AZI A;  3L4I A;  1T6C A;  2A6A A;  1ATN A;  4IJN A;  3EZW A;  4ISG A;  4GNI A;  5LJW A;  1S3X A;  4FOE A;  3ENO A;  2PBD A;  5I9E B;  1NBW A;  2E20 A;  4BGB A;  3A5L C;  1RGI A;  5AQF A;  5AQR A;  1HLU A;  1R59 O;  5EXW A;  3LDN A;  2A42 A;  1IJJ A;  3QB0 A;  3ZX3 A;  3VEY A;  2CH5 A;  3AAQ A;  2P9S B;  1BA1 A;  3LL3 A;  5AR0 A;  1XQS C;  4MO5 A;  4H03 B;  3C7N A;  2QWR A;  4FWK A;  3O08 A;  3TU5 A;  2FF3 B;  3KZB A;  5EOY A;  3U9D A;  4RCH A;  4LC9 B;  3VEN A;  4K42 A;  5JIC A;  1NGC A;  4FPB A;  3DWL A;  1EQY A;  3D7E O;  3HSC A;  3O4W A;  3VEV A;  4RTF D;  3UB5 A;  3VF2 A;  2D4W A;  1BOT O;  4CZH A;  5BRH A;  4CBW A;  4IJA A;  4WQ4 A;  2ZGZ A;  3BUZ B;  3FZF A;  4BG9 A;  4BRN A;  4XH4 A;  3S41 A;  2HMP A;  4B1Z A;  2A3Z A;  4BVP A;  5BN9 A;  4HTL A;  3WT0 A;  4BG8 A;  3H6E A;  3CJA A;  4BRI A;  3GL1 A;  5EVZ A;  4EHT A;  1XC3 A;  2GWK A;  2P9U B;  3B8A X;  1NGA A;  4EFH A;  3IUC A;  2A5X A;  4FSV A;  1QQO A;  3SMP A;  3VGK A;  2Q0R A;  3BP8 A;  1X3N A;  3FE1 A;  5BRD A;  3WXK A;  1JCF A;  1KXP A;  2FLO A;  3GG4 A;  3MMV A;  2QWM A;  2P9I A;  1ATR A;  2GWJ A;  3FLC O;  3UKR B;  4BRG A;  4CZK A;  1NGI A;  5BPN A;  2P9S A;  3LDL A;  4QS8 A;  1Z6R A;  3GOI A;  2ZF5 O;  3C0B A;  4YDU A;  2BUP A;  3O8M A;  1NMD A;  3LDP A;  2QWQ A;  2V7Z A;  5AQK A;  2E8A A;  2Q97 A;  2E1Y A;  4DB3 A;  3MN6 A;  2P9P B;  5AQY A;  4CZG A;  4FOI A;  3U8X A;  2GEL A;  2I7P A;  4PL8 A;  4M7X A;  5FPE A;  4JHD A;  3MCP A;  3UKU B;  2I7N A;  4BC3 A;  1NGJ A;  3ATU A;  2Q0U A;  3R6M A;  3FGU A;  3MK6 A;  3EKU A;  1G99 A;  3WQT A;  3MN5 A;  2ITM A;  1TUU A;  1HUX A;  3LDO A;  4PKG A;  3ZEU B;  2HF3 A;  4A62 A;  3KVG A;  4BR4 A;  1ATS A;  1GLL O;  2CGJ A;  5KQ8 A;  3H45 C;  3HM8 A;  5LY3 A;  3R8E A;  2Q2R A;  5E84 A;  3VOV A;  5BPM A;  1BO5 O;  2UYT A;  5AQS A;  2FSN A;  3QBX A;  2P9U A;  3D2F A;  1RDW X;  1NGF A;  1CZA N;  3H3N O;  4BRQ A;  1GLD G;  1Y64 A;  3UKR A;  3HI0 A;  3VGL A;  4JN4 A;  2WUS A;  3CJ7 A;  3M3Z A;  2E2P A;  2AA4 A;  4CD3 A;  4CZM A;  2PAV A;  4JAX A;  4AM6 A;  1DEJ A;  2E2Q A;  2QWL A;  2QXL A;  1QZ6 A;  3FZK A;  2YCH A;  4B1U B;  1ESV A;  5AQO A;  1WUA A;  3L6Q A;  2J4R A;  3FR0 A;  2P9P A;  4CJ7 A;  2P9I B;  3A8Y A;  3VER A;  3IDH A;  4BQZ A;  3UKU A;  4JD2 B;  1KAZ A;  1SZ2 A;  1GLF O;  3FZH A;  4CZE A;  2P9N B;  2QM1 A;  3CJ1 A;  3ZEU A;  3HBT A;  4CI6 A;  1C0F A;  4I6M B;  2Q36 A;  2ASO A;  4FWN A;  5AFU H;  4WYB A;  3GE1 A;  4IZ9 A;  3M1F A;  3J8A A;  4CZL A;  2EWS A;  1J6Z A;  2F9T A;  2ZWH A;  1Z05 A;  5AQG A;  4BC4 A;  3VEW A;  3QFP A;  3CQX A;  4JHD B;  2CGL A;  4H5N A;  4QS7 A;  4WQ5 C;  3BEX A;  3O5B A;  4H5T A;  3H3O B;  5JMV A;  4AM7 A;  3H46 O;  2IVP A;  4BRE A;  2ASP A;  1YAG A;  5AQT A;  2HF4 A;  1NGD A;  3A5M C;  3VEO A;  1K8K A;  1V4S A;  2FXU A;  2V51 B;  4FWL A;  2QWN A;  3VF6 A;  3WXI A;  3VET A;  2VWB A;  1TUY A;  1SAZ A;  5AQW A;  5AQP A;  4BRF A;  3D2F B;  3SMS A;  4DCH A;  3CI5 A;  3EKS A;  1NGH A;  1JCG A;  3G25 A;  1OKJ A;  4K41 A;  4H0V B;  1GLC G;  5JLH A;  1KAX A;  3HZ6 A;  4JD2 A;  4CBX A;  1NM1 A;  4B1Y B;  4C23 A;  4K43 A;  1JCE A;  3ZX0 A;  5KPR A;  2P9N A;  1X9J A;  2AP1 A;  4Z94 A;  4I6M A;  1GLJ O;  1YUW A;  4PKI A;  2VYP A;  1HX1 A;  5ADX H;  2CGK A;  1YXQ A;  3LM2 A;  4FWM A;  1U2V B;  5KQD A;  3U4L A;  2HOE A;  3L0Q A;  4FL9 A;  4CD1 A;  4B1W B;  3H1Q A;  3ZET B;  4H5W A;  4M7Y A;  3P4I A;  3BF1 A;  3AAP A;  5EX5 A;  4BR2 A;  1KAY A;  3EL2 A;  5AQJ A;  3VF4 A;  3ID8 A;  1LOT B;  4H0T B;  4IWV A;  5AQM A;  5AFU A;  4H5R A;  5BR9 A;  1QZ5 A;  2YHY A;  4EAH D;  1RFQ A;  5BN8 A;  3VPZ A;  2OAN A;  2P9K A;  1TYQ B;  3U9Z A;  2V7Y A;  3QML A;  4NB4 A;  5BRF A;  4BR7 A;  3DXM B;  4FPA A;  5E26 A;  4FO0 A;  1BA0 A;  1T6D A;  2YHW A;  1GLA G;  4IXC A;  5FPM A;  3SJH A;  2E1Z A;  3ENH A;  2E88 A;  5KPZ A;  3QIC A;  4CZI A;  4XH5 A;  4RWT A;  4BC5 A;  5AQI A;  4H0P A;  1XUP O;  2NLX A;  4KBO A;  5F2R A;  3CHW A;  1BDG A;  2YI1 A;  1C0G A;  4FWP A;  5FPD A;  4H0X B;  5CE3 A;  4FWS A;  3DJC A;  2D0O A;  1K8K B;  1E4G T;  4BRO A;  4DHY A;  4ISF A;  4WQ5 A;  3MN7 A;  1ZC6 A;  1LCU A;  3A5N C;  5AQX A;  1MDU B;  3FZM A;  1DGK N;  3MN9 A;  3IMX A;  5F1X A;  3QBW A;  1T44 A;  3FZL A;  3SLC A;  3ZX2 A;  4MLH A;  1U2V A;  3O80 A;  4MLE A;  4F9O A;  3SK3 A;  1QQM A;  2E2O A;  3ZET A;  3WXL A;  4H0Y B;  2NZT A;  3VEZ A;  4BRK A;  3M6G A;  4XH1 A;  4BRC A;  2GEM A;  1HKB A;  4EHU A;  5AQN A;  5ADX A;  2BTF A;  3CJC A;  4ISE A;  3A5O C;  4BQL A;  1NGG A;  4A61 A;  1TYQ A;  1YVN A;  1NLV A;  3O1W A;  3W0L A;  2DPN A; 
#chains in the Genus database with same CATH topology
 5TKY A;  4LF7 K;  3GBT A;  3DXM A;  3CJ9 A;  1QSS A;  1WSJ A;  4K25 A;  3CCL N;  3TR8 A;  4L3Q A;  1QVF M;  4DUZ K;  5EY4 A;  1Q7Y O;  2KHO A;  3D2E B;  3ZSX A;  1JL2 A;  2A41 A;  4E7J A;  1TKT A;  4IBN A;  3TSP A;  1L3V A;  4KH6 A;  5AQH A;  3RMD A;  3EO3 A;  3I55 N;  2YKN A;  4BRL A;  1E4F T;  1BCM A;  3AY9 A;  3I8B A;  5KGX A;  1SQK A;  5C10 A;  5HLF A;  3ATV A;  4BVO A;  3HST B;  3CC4 N;  2XRI A;  3LAM A;  1W97 L;  1U6Z A;  3VA3 A;  1VQ5 N;  1GLE G;  2V52 B;  5LMN K;  3IG1 A;  2GTD A;  2G8K A;  4B1X B;  1CZB A;  3E66 A;  4HWI A;  3AVN A;  3OYJ A;  2Q1N A;  3WUH A;  3CPE A;  4BRD A;  3O1B A;  2EX3 A;  1BI4 A;  4FW1 A;  3DLB A;  3QFU A;  2W6K A;  4O5F A;  3TPQ A;  1BU6 O;  4CF0 A;  1GLB G;  3OYM A;  4CJ4 A;  1NOZ A;  2O4I A;  3NGZ A;  4BGA A;  3LM9 A;  5KPT A;  3VQ6 A;  3D2E A;  3RRG A;  3H1V X;  1WLJ A;  1C6V A;  4CEB A;  4H8K A;  4BRM A;  1JJ2 M;  4Z0U A;  4A5B A;  3HO1 A;  3MWP A;  5DMR A;  1RTI A;  3TAE A;  3LP1 A;  2FSJ A;  4BDP A;  1VQ6 N;  4M41 A;  1IG9 A;  3CIP A;  5F0X A;  4E1N A;  5AQQ A;  4CGJ A;  4ILJ A;  4LY7 A;  3LAK A;  4FJ5 A;  1RT6 A;  3C7N B;  4RW6 A;  1KVC A;  3LDQ A;  1HQE A;  4EZ9 A;  2FF6 A;  1FK9 A;  1NK8 A;  3HOT A;  4CIE A;  4FM2 A;  3PV8 A;  4B8C A;  4JNE A;  3SPZ A;  3F9M A;  1N33 K;  1OVY A;  2W40 A;  1KD1 O;  2YHB A;  1MU2 A;  4CJP A;  5BRE A;  3UE5 A;  4BC2 A;  5KGW A;  4B9N A;  3Q7C A;  4I2Q A;  3SUN A;  5CZ2 A;  1HPZ A;  4CEF A;  3KK7 A;  3EZW A;  3AVC A;  3DLR A;  4W5T A;  2GBZ A;  3U6F A;  4OPA A;  5I9E B;  3G10 A;  4A59 A;  3LWM A;  3RMC A;  1Q82 O;  1HLU A;  3EE9 A;  4PUO A;  2A1S A;  3QB0 A;  4FJI A;  1IBL K;  1S1U A;  3AAQ A;  3V6D A;  4CE9 A;  3N4P A;  1YJW N;  3MXJ A;  4ELV A;  4CF1 A;  4FJH A;  3C7N A;  2QWR A;  3O08 A;  2FF3 B;  4OGC A;  4M45 A;  4OLA A;  3KZB A;  1BCO A;  5EOY A;  1NK6 A;  2HHQ A;  2VWJ A;  3VEN A;  2O8B B;  4IOA L;  5J2N A;  3DWL A;  3O4W A;  1RBS A;  4RTF D;  3VF2 A;  1KC8 O;  3P1G A;  4E19 A;  4CZH A;  4CBW A;  4AF1 A;  1IKY A;  2D0B A;  1N6Q A;  1C1B A;  3BUZ B;  4CFC A;  4Y1C A;  4R79 A;  1NJY A;  4HTL A;  4BG8 A;  3SCX A;  4BRI A;  2HHH K;  3HVR A;  1FW6 A;  3O4Q A;  1VQ7 N;  1NGA A;  3VGK A;  2R7Y A;  1QQO A;  3RVC A;  4CJU A;  1JLE A;  3DRP A;  1KXP A;  3MMV A;  2ZD1 A;  2P9I A;  5C24 A;  3FLC O;  1VQN N;  4BRG A;  1NGI A;  3QIP A;  4KH4 A;  1U45 A;  1Z6R A;  2ZF5 O;  4EP4 A;  4YDU A;  4KAZ A;  3J7A P;  3VQ7 A;  2O8B A;  1VQP N;  4GV3 A;  4Z4E A;  5AQY A;  4B9V A;  3RR8 A;  3IRX A;  3HK2 A;  3NVM A;  5FPE A;  4JKH A;  4N56 A;  1NGJ A;  3ZT0 A;  3DLG A;  3V9Z A;  3MK6 A;  3EKU A;  1NKB A;  3HYF A;  5CY4 A;  2OZS A;  3ZEU B;  1HUX A;  1N34 K;  4M3Y A;  3K57 A;  2KFN A;  4FJ8 A;  4DQQ A;  4CJS A;  1GLL O;  4Z4C A;  3R8E A;  5BPM A;  2UYT A;  5AQS A;  3D2F A;  2O4G A;  1SKR A;  5HRR A;  3AO2 A;  1CZA N;  4FCY A;  4BY9 C;  1VHX A;  1LWE A;  1GLD G;  1HYS A;  1I94 K;  2KZM A;  3CJ7 A;  3M3Z A;  3CXC M;  4JI2 K;  1W9H A;  3SUO A;  4B3M K;  4JAX A;  4OLB A;  3PX0 A;  3OS0 A;  2QWL A;  1SL0 A;  2XY5 A;  4CGH A;  1QZ6 A;  3C94 A;  3OS2 A;  3I8D A;  3HM9 A;  4ZHR A;  4KH5 A;  5AQO A;  5C0Y A;  2WON A;  1KRP A;  3VER A;  4BQZ A;  1HNV A;  1O1W A;  1UWB A;  3VA0 A;  1DLO A;  2P9N B;  4CJV A;  3ZEU A;  3TI0 A;  4I6M B;  4IFV A;  3OJS A;  3CD6 N;  4C8O A;  1RTD A;  4WYB A;  1BGX T;  3GE1 A;  2DTU A;  4I9L A;  4IZ9 A;  2YNG A;  4CZL A;  3OYB A;  4G9Z A;  4WFN L;  5AQG A;  4DLG A;  3EEQ A;  3OS1 A;  2Z1H A;  3CQX A;  4WQ5 C;  4QS7 A;  3HOS A;  3BEX A;  4LF6 K;  4H5T A;  2YV0 X;  3H3O B;  5JMV A;  2XY8 A;  4BRE A;  4KHN A;  1YAG A;  3AVB A;  1WBD A;  4PY5 A;  4IKF A;  2FXU A;  4FWL A;  4B3O A;  4KV8 A;  4JRQ A;  4JI8 K;  4BRF A;  3OYG A;  4Z4H A;  3ZSQ A;  1TV6 A;  2D0A A;  4C1N I;  1JLQ A;  1Z25 A;  1OH7 A;  3CI5 A;  3B6O A;  1IKV A;  4YOU A;  4CF8 A;  2HBK A;  3G25 A;  5EU7 A;  1NJX A;  1T3V A;  3HZ6 A;  3SJJ A;  4OJR A;  4C23 A;  2P9N A;  1WAF A;  2X6N A;  3RMB A;  2QKK A;  3ID6 A;  3T7Z A;  4I6M A;  1GLJ O;  4Z94 A;  3VMF B;  4MQ3 A;  3LM2 A;  4FWM A;  2HNY A;  3MED A;  2HOE A;  1QTM A;  3HL8 A;  4IOC L;  4CD1 A;  4B1W B;  1ZBU A;  3V1Q A;  4JYA K;  1QSL A;  4H5W A;  1HYV A;  3AAP A;  4DQR A;  3PY8 A;  2DFH A;  2VGM A;  2HNZ A;  3VQB A;  2ETJ A;  5K14 A;  2O8C B;  1WSI A;  4CIG A;  4DV1 K;  5AFU A;  1WAJ A;  3TWH A;  2P9K A;  3J81 O;  1YI2 N;  4XIU A;  1SS6 A;  4NB4 A;  2BH1 A;  2ZE2 A;  5E26 A;  4W5R A;  5T7B A;  4IXC A;  1XI1 A;  3OYH A;  5CYQ A;  3MAQ A;  3WNH A;  3QIC A;  5F2R A;  4RW4 A;  2YI1 A;  2A1R A;  4FWP A;  5KRS A;  4ELT A;  3CC7 N;  4H0X B;  4V19 S;  2IS3 A;  3I0R A;  4O5B A;  4YOW A;  1ZC6 A;  1MDU B;  1UAX A;  1YHQ N;  3MN9 A;  2HMI A;  1RT1 A;  4TSX A;  3FZL A;  3SLC A;  3OW2 M;  4CK3 A;  1QS4 A;  4KHP K;  1ASW A;  3FFI A;  4MLE A;  1QQM A;  2E2O A;  1IV0 A;  3AVJ A;  3VEZ A;  3SQ4 A;  3OA9 A;  3DLE A;  2O8C A;  5AQN A;  3CJC A;  3KK3 A;  3CPW M;  3HT3 A;  2RF2 A;  3OYD A;  3T69 A;  2NNW A;  3LP0 A;  4E0D A;  1NLV A;  3S3O A;  1YT3 A;  3G71 N;  3HJF A;  3W0L A;  2DPN A;  4JI0 K;  5B8H A;  3SBT A;  5D3G A;  1S22 A;  4DTX A;  4DTU A;  1QQC A;  3WXJ A;  5HRO A;  1S1W A;  4I7F A;  2OA8 A;  2ASM A;  4NXM K;  3K0S A;  2ZJR L;  3LWL A;  1XC9 A;  2FBT A;  2W41 A;  4QS9 A;  4IG0 A;  3KHY A;  3ZT1 A;  4NYN A;  4FK0 A;  3V1O A;  4KB1 A;  4B9U A;  4DQ8 A;  3MEE A;  3L2U A;  3SUQ A;  4BRH A;  3IFR A;  3VGM A;  5HL7 L;  4GY2 B;  4BWJ A;  4NO7 A;  4O8K A;  4CHP A;  4PWD A;  1G15 A;  1WOQ A;  1VSH A;  1IBM K;  4CK1 A;  4EIA A;  5AQL A;  3LAN A;  3O9U A;  4JS4 A;  1ZXO A;  1BHL A;  2P51 A;  1BG3 A;  1EXQ A;  4FK2 A;  3EZ5 A;  3HVT A;  1H1V A;  2NRH A;  1K8A O;  4XEI A;  4DKW A;  4U7B A;  1QQN A;  1BWF O;  4DSJ A;  4JEP A;  1RBU A;  3WEE B;  1TK5 A;  4KRF A;  4PL7 A;  2G8F A;  1D8Y A;  3ISN C;  4MO4 A;  4YOY A;  4LFC K;  3DXK B;  2HST A;  4FWR A;  1MA9 B;  1ZBS A;  1I39 A;  3CCR N;  2G8V A;  1NOY A;  2VQF K;  2HB5 A;  3CFR A;  3A2F A;  5C42 A;  4PKH A;  3VQD A;  3TAM A;  1N36 K;  3DAW A;  4JI4 K;  2VCP A;  5FPN A;  4CF9 A;  4CHQ A;  2H3G X;  3MXM A;  2OTL N;  4F2S A;  1RTJ A;  3QET A;  4Z4I A;  1M90 O;  4H0O A;  4KHQ A;  2Q31 A;  1KFS A;  3SAH A;  5HRS A;  1Q9Y A;  3KWG A;  3OHR A;  4CEA A;  5KTQ A;  5E41 A;  1X9W A;  3VQ5 A;  1WN7 A;  4YFU A;  2NRZ A;  3WEE A;  3TTF A;  4CZF A;  1P8Z A;  4BR5 A;  3DXK A;  2E2N A;  1TVR A;  3GDQ A;  4K8X A;  1JLB A;  4DF8 A;  1B9F A;  1T6C A;  1JLG A;  1DTQ A;  4GNI A;  4ISG A;  3VQC A;  3AO4 A;  1EWR A;  4DQP A;  1XWL A;  5LJW A;  1S3X A;  1C1A A;  1BQN A;  3ENO A;  1W7A A;  4BGB A;  3A5L C;  3M8R A;  4O44 A;  3QLH A;  3VEY A;  3DLL L;  3SNN A;  2P5O A;  1BA1 A;  1XQS C;  2PYJ A;  3LZJ A;  4MO5 A;  4CJ3 A;  2XO7 A;  2HHW A;  4FW2 A;  1P90 A;  4FWK A;  3G0Z A;  1JL1 A;  3TU5 A;  5GAD P;  3TSQ A;  4O0I A;  2IGI A;  4N47 A;  3U9D A;  3VQQ A;  3PO4 A;  1NGC A;  4GMJ B;  2PY5 A;  3VEV A;  3J7Y P;  1EO1 A;  2JWL A;  2AJQ A;  1SUQ A;  2UXD K;  4CIF A;  2ZGZ A;  4JK8 A;  1ASU A;  3FZF A;  1QSY A;  2ATQ A;  4KTQ A;  5C15 A;  3S41 A;  2YX6 A;  3L2R A;  3E9O A;  3T3F A;  3ULD A;  1VQL N;  2JGU A;  4YOX A;  3PUF A;  3GL1 A;  4M3U A;  4M3X A;  4EHT A;  3SV3 A;  1XC3 A;  2GWK A;  2P9U B;  1OH5 A;  4EFH A;  3IUC A;  3SMP A;  2Q0R A;  3BP8 A;  1X3N A;  4JKD A;  1VSD A;  1Y97 A;  5IWA K;  1EWQ A;  3O4N A;  2NRV A;  2GWJ A;  2O8D A;  4CZK A;  2PZS A;  1O13 A;  4QS8 A;  1WSH A;  4DTO A;  4DQI A;  3OY9 A;  3GOI A;  4CGI A;  3NF9 A;  1NMD A;  5GAE P;  2QWQ A;  2E8A A;  2E1Y A;  4GKK K;  4EP5 A;  3O3H A;  4QAG A;  3SPY A;  5I3U A;  1VSI A;  4FJG A;  2HHV A;  4FOI A;  1NNE A;  2I7P A;  4FVM A;  3SAF A;  4JHD A;  2Q0U A;  3LP3 A;  3FGU A;  2E6L A;  4KTW A;  1U49 A;  3K2P A;  1G99 A;  3C95 A;  4RG8 A;  3LDO A;  3KLI A;  4DU4 A;  4BDZ A;  3VQA A;  3L8B A;  2CGJ A;  5KQ8 A;  5LY3 A;  1LWC A;  2IDO A;  3AVK A;  4YOT A;  2FSN A;  3TAP A;  3QBX A;  1T05 A;  2P9U A;  4HTU A;  4QOZ B;  1RDW X;  1NGF A;  2JWK A;  4WFA L;  4BRQ A;  5GIN A;  3CCS N;  4C1N K;  3MCA B;  3L2V A;  4DR3 K;  2WUS A;  2E2P A;  3K5M A;  4DU1 A;  4CF2 A;  4FZX C;  4CD3 A;  4J2A A;  1S6Q A;  4E7H A;  4AM6 A;  4CJT A;  1WSE A;  2UUC K;  3ZSO A;  1JLF A;  1VSL A;  2QXL A;  3I0S A;  4DSI A;  2DY4 A;  3ZT4 A;  1KVA A;  1WUA A;  3L6Q A;  4E7L A;  4LFA K;  2P9I B;  4KI4 A;  3OJU A;  4DTS A;  2UXB K;  2BDP A;  3IDH A;  2E6M A;  2QI2 A;  3K9K A;  4NXN K;  4DV7 K;  4OO1 J;  1SZ2 A;  4DTN A;  4CZE A;  2Q3S A;  2QM1 A;  3HBT A;  5J1E A;  2JLE A;  3VQE A;  3HPH A;  4CED A;  3OYC A;  3ALY A;  4DR6 K;  1VQ4 N;  5HRN A;  2EWS A;  1JXB A;  3H08 A;  3VQ4 A;  3WNG A;  4JKF A;  1L3S A;  1XMQ K;  4BC4 A;  2FBV A;  3HRG A;  3EE8 A;  4H5N A;  4DSF A;  3NVK A;  2IVP A;  5AQT A;  1KLN A;  4FJK A;  2HF4 A;  4PQU A;  1NGD A;  1CXU A;  3DYA A;  1ZBH A;  4B9T A;  3IKM A;  2HW3 A;  2OCE A;  4GV6 A;  3WXI A;  3M5R A;  4LD0 A;  3CCU N;  5AQW A;  3AVA A;  3D2F B;  3SMS A;  4RW9 A;  4CFA A;  4IOX A;  3SQ2 A;  3DRS A;  2VG5 A;  4DCH A;  2YNI A;  3ZSW A;  1Q81 O;  3S9H A;  4DTR A;  1JCG A;  3OBW A;  1S5J A;  2BAN A;  4NCG A;  3P83 D;  4K41 A;  3O9Q A;  4CJE A;  3NFA A;  1YJ9 N;  1NM1 A;  3T1A A;  4CGG A;  4CEC A;  1T03 A;  4K43 A;  2I5J A;  3P31 A;  5FRN A;  4BWM A;  4I9Q A;  3U3Y A;  2AP1 A;  1IKX A;  4PKI A;  5ADX H;  2CGK A;  5HBM A;  4NLC A;  1BIZ A;  2DFE A;  3ZSR A;  4N5S A;  2ITG A;  3OYI A;  1T7P A;  3H1Q A;  4E89 A;  3P4I A;  2RKI A;  4BR2 A;  3KLH A;  3LPU A;  3EL2 A;  4G1Q A;  3VF4 A;  3ID8 A;  5AQM A;  4H0T B;  3T1H K;  3THW A;  4H5R A;  1J53 A;  3J80 O;  1TYQ B;  3AO1 A;  4YNQ A;  3RMA A;  4FJL A;  4GW6 A;  3SQ0 A;  1U4B A;  4BR7 A;  4FPA A;  4CJL A;  1KCF A;  1T6D A;  2YHW A;  4CEE A;  4JI7 K;  3CCM N;  4XH5 A;  4RWT A;  3E9P A;  4BC5 A;  1XUP O;  4KBO A;  5CE3 A;  4FWS A;  3B6P A;  2D0O A;  3DJC A;  4H4O A;  1E4G T;  1HR0 K;  1JLC A;  3EY1 A;  4FM0 A;  4F4K A;  3AVF A;  4WQ5 A;  1LCU A;  3A5N C;  2F4V K;  1VQ8 N;  1YVU A;  3FZM A;  3IMX A;  4KO0 A;  3AA5 X;  3QBW A;  3ZX2 A;  4MLH A;  1A5W A;  4O55 A;  1L3U A;  3MEC A;  4NCA A;  4KFB A;  3SK3 A;  1RT7 A;  4DTJ A;  5CZ1 A;  3TAR A;  4KHU A;  4XH1 A;  3OYK A;  4JV5 K;  2Z1I A;  1N8R O;  1HKB A;  4DV3 K;  4EHU A;  4CCH A;  4OKE A;  2FC0 A;  1QHT A;  4ISE A;  3A5O C;  2HHT A;  4A61 A;  3QES A;  1TYQ A;  4B9M A;  4HVJ A;  4LSN A;  1QVG M;  3L2Q A;  1NK9 A;  3W3D A;  1Q18 A;  4X64 K;  3PSI A;  3C6T A;  4ID5 A;  4IDH A;  3V81 A;  2QXF A;  1WNS A;  1NJZ A;  3BZC A;  4O4G A;  2NRW A;  2F8S A;  3HTV A;  1VK0 A;  4NYF A;  3WXM B;  4DS4 A;  2P9K B;  2ZQB A;  2IIR A;  2YJF A;  3R3L A;  2QA4 N;  1TL3 A;  1YTU A;  2QKB A;  3KK2 A;  5J2M A;  3ITH A;  1D4X A;  4E7K A;  3K59 A;  4DG1 A;  3KJV A;  4DTM A;  2P9L B;  4BRP A;  3VES A;  4DFM A;  4BE1 A;  2KQ2 A;  2GUI A;  5ELZ A;  3SI6 A;  1MWK A;  4BAC A;  1ITG A;  3KLF A;  4JK7 A;  3IAY A;  2HVH A;  2IVO A;  5JVH L;  5FRM A;  3P39 A;  3QEI A;  2HBJ A;  3L3V A;  3AGK A;  2GUP A;  3F2K A;  3QEV A;  2UXC K;  3K58 A;  3MDQ A;  3ZSY A;  4H5V A;  3A0I X;  5J2Q A;  1BL3 A;  3K9J A;  1N32 K;  4C8N A;  5AZI B;  3JYT A;  4CJ5 A;  4HCC A;  4DQS A;  4IEI A;  3BF3 A;  3JS6 A;  4JLH A;  4WQ4 C;  3SZ2 A;  3TAG A;  4DFP A;  3KD5 E;  3ENB A;  2IVN A;  4FJM A;  1X3M A;  2QK9 A;  2KZZ A;  5C2F A;  4BR9 A;  1QHA A;  3O9S A;  3NBP A;  1LW0 A;  2YJE A;  3CER A;  4ICL A;  2YKM A;  1V4T A;  1Q8I A;  3R9P A;  1X9M A;  4CJR A;  3TAB A;  1HNX K;  4PHT X;  5BPL A;  4CHN A;  1LAW A;  2QTD A;  1RBT A;  3KLG A;  4DR4 K;  4DR2 K;  4KPY A;  4OGE A;  2P9L A;  1JXE A;  3NH0 A;  1TGO A;  4C8K A;  4DR7 K;  4W5O A;  1HJO A;  3CM6 A;  3SQ1 A;  1FKO A;  1YIJ N;  3VEX A;  4E1M A;  4FWQ A;  4CGF A;  4OKJ A;  4W5Q A;  5AJ3 K;  3AAR A;  4KB0 A;  1HPM A;  2QW9 A;  1WSG A;  2YHX A;  1UA0 A;  5HOO A;  1SKW A;  1D9F A;  4FLY A;  1KLM A;  2B5J A;  4C8M A;  4BR0 A;  5AZI A;  2A6A A;  1ATN A;  4Q5V A;  5FDL A;  4FLU A;  2PBD A;  5M1O A;  2E20 A;  2XY6 A;  3CYM A;  4I2P A;  2G8H A;  1LAV A;  1YTA A;  1RGI A;  5GAH P;  4JI5 K;  1DTT A;  1S6P A;  5AQR A;  1NK7 A;  3LDN A;  1Q86 O;  2YNF A;  2P9S B;  4B9S A;  3LL3 A;  1FJG K;  5J2P A;  3LAL A;  1E3M A;  1TL1 A;  1LV5 A;  3MEG A;  5CR4 A;  2X78 A;  4DUY K;  1WSF A;  3QEW A;  4LC9 B;  3R1X A;  4FPB A;  4JS5 A;  3D7E O;  4B8A B;  3HXM A;  3UB5 A;  3WNF A;  3C6U A;  4DWI A;  1BOT O;  2LSN A;  2OPP A;  5BRH A;  4IJA A;  3L3U A;  5CHI A;  2E4L A;  4ZTF A;  2IAJ A;  3NE6 A;  4BE2 A;  3ZLJ A;  3DOK A;  3QEP A;  4FXD A;  1NJI O;  4FLX A;  4X62 K;  2WTU A;  3O9R A;  4M3Z A;  4CER A;  2A3Z A;  5BN9 A;  2DFF A;  4E7I A;  1L3T A;  3D6R A;  3H6E A;  5DM6 L;  2UU9 K;  1VSJ A;  3G6E N;  1NMN A;  5M1K A;  1JKH A;  3OVN A;  5KI6 A;  4L8R B;  3NAE A;  4E3S A;  2WFB A;  1GOC A;  3QNN A;  5BRD A;  4KHS A;  3FE1 A;  4FLT A;  2G8W A;  3WXK A;  4AHV A;  3V9U A;  2FLO A;  2QWM A;  2X6S A;  1S9G A;  5BPN A;  3VTI A;  3AVL A;  2P9S A;  1TAQ A;  4M3W A;  4LF8 K;  3QO9 A;  2BUP A;  3O8M A;  5AQK A;  3ZYY X;  2Q97 A;  2GX9 A;  4HUE A;  4DB3 A;  1VSM A;  1KQS M;  4AHS A;  1RDB A;  4AHU A;  2P9P B;  4CZG A;  2GEL A;  4FVU A;  4PL8 A;  4M7X A;  5KRT A;  3UKU B;  4BC3 A;  4Z4F A;  2Z1G A;  1VSE A;  3ZSZ A;  4BE0 A;  3BGR A;  2F7T A;  2NRT A;  3WQT A;  3LPT A;  3MN5 A;  4DS5 A;  3AA4 A;  3D45 A;  5HRP A;  4M3T A;  4A62 A;  3KVG A;  2D5R A;  5FLX O;  4A57 A;  4BR4 A;  1TK0 A;  2Z1J A;  1ATS A;  3HM8 A;  3MX2 A;  2Q2R A;  2NRX A;  2VG7 A;  5E84 A;  3VOV A;  4FLW A;  4ZTJ A;  3F5T A;  3SYZ A;  2Y1I A;  4KRE A;  3V9X A;  3CMA N;  4Z4G A;  1RIL A;  1R0A A;  4WF9 L;  3HI0 A;  3VGL A;  3CCE N;  2XY7 A;  4JN4 A;  3AVG A;  4CFD A;  2AA4 A;  3AVH A;  3SV4 A;  4DTP A;  2PAV A;  4IFE A;  1DEJ A;  3O3G A;  2G8U A;  1XNQ K;  2YCH A;  3ZT2 A;  1ESV A;  1U04 A;  3AA2 A;  1Q9X A;  2J4R A;  2P9P A;  4CJ7 A;  1TAU A;  4YOR A;  3A8Y A;  4DV6 K;  2O8D B;  5JVG L;  1FKP A;  3UKU A;  2ZM6 K;  1TKX A;  1KAZ A;  1GLF O;  4YY3 K;  3VQ8 A;  1EP4 A;  3PO5 A;  3CJ1 A;  1T8E A;  1C0F A;  3CCJ N;  3PX4 A;  2Q36 A;  2ASO A;  3AGR A;  5AFU H;  2D0C A;  2FBX A;  3C65 A;  3M1F A;  1LWF A;  3J8A A;  2ZWH A;  1Z05 A;  3KKS A;  2P1J A;  4CK2 A;  1IO2 A;  3VEW A;  4O0J A;  3M8S A;  3QFP A;  4FZZ A;  3AO3 A;  4JHD B;  4CHZ A;  3AO5 A;  5CYM A;  4FM1 A;  2ASP A;  4LF4 K;  4AQY K;  4CHO A;  3VEO A;  3T19 A;  2P5G A;  1K8K A;  1V4S A;  1JLA A;  3VF6 A;  3M8Q A;  3RR7 A;  2HHU A;  1TUY A;  4B3R K;  1NKC A;  5AQP A;  1SKS A;  1K9M O;  1U48 A;  3DI6 A;  3EKS A;  1NGH A;  5A2Q O;  5M1Q A;  4B3T K;  4H0V B;  4K0K K;  1NKE A;  1C0U A;  1S1T A;  1RDD A;  1LW2 A;  4B1Y B;  5KPR A;  3ZX0 A;  3TSU A;  4FJ7 A;  1HX1 A;  1ASV A;  1YXQ A;  2Y1J A;  3L0Q A;  4FL9 A;  3NH2 A;  5FRO A;  1RCH A;  4M7Y A;  3NF7 A;  4DLE A;  5EX5 A;  1KAY A;  1IKW A;  2PYL A;  5AQJ A;  4IWV A;  1REV A;  2GV9 A;  1QZ5 A;  2FBY A;  2YHY A;  4WFB L;  1RFQ A;  4PA1 A;  4ID1 A;  2HVI A;  1A5X A;  2OAN A;  4OVL A;  4X65 K;  4U67 L;  4B9L A;  4JI3 K;  1VQK N;  4BDY A;  1NK5 A;  4FO0 A;  1BA0 A;  1GLA G;  4DSE A;  2HHX A;  4NLB A;  4OX9 K;  2OPS A;  1HQU A;  4UQG A;  4KHW A;  4H0P A;  3CCQ N;  2NLX A;  3CHW A;  1C0G A;  5FPD A;  3THV A;  5M1F A;  4DHY A;  4JKC A;  4ISF A;  4KHY A;  3MN7 A;  2OPQ A;  2VQE K;  1RBR A;  1DGK N;  2IOC A;  1GOA A;  3Q7B A;  3O9T A;  4FJN A;  1ZBI A;  1T44 A;  4CJQ A;  1W0H A;  3ZSV A;  2NUB A;  3O80 A;  4F9O A;  3WXL A;  3LP2 A;  4FJ9 A;  1CLQ A;  4BRK A;  3M6G A;  3CC2 N;  2GEM A;  4J2D A;  1KVB A;  3RRH A;  4DFK A;  4LFB K;  1S9E A;  3RWU A;  4KI6 A;  4AH9 A;  3WNE A;  4FYD A;  1IH7 A;  2BE2 A;  3O1W A;  3J7Z O;  3E9L A;  2W42 A;  5AQU A;  1NWK A;  5AZJ B;  3M8P A;  3ULE B;  4B9Q A;  3EYZ A;  3NGY A;  2QWO A;  4LH4 A;  1TK8 A;  3OBY A;  3CQY A;  1XNR K;  2ZGY A;  1RBV A;  3NDK A;  5JS2 A;  3TAF A;  4IO8 A;  3KLE A;  4O8U A;  3THW B;  2ZJP L;  3S3N A;  3P5J A;  4M63 C;  1QE1 A;  3RSE B;  2HBM A;  1MWM A;  3NGI A;  3QIO A;  1HKG A;  4K8Z A;  3ZT3 A;  3KKR A;  3WQU A;  3CJB A;  5LJV A;  3D0P A;  2OYQ A;  4KKO A;  4Y0W A;  3O6W A;  3CF5 L;  4IDK A;  3JXU A;  1DKG D;  2QWP A;  1IG8 A;  1NGB A;  2RN2 A;  3QEX A;  1S1X A;  1XHZ A;  4YHH K;  3HPO A;  2A40 A;  3CCV N;  3F9K A;  5AQZ A;  2F96 A;  2B6A A;  1B9D A;  1VQO N;  3OYL A;  4A2A A;  4E1J A;  1J5O A;  1D9D A;  2E5L K;  5AZJ A;  3ULE A;  2XHB A;  3V1R A;  4CHY A;  1NJW A;  4BRA A;  1HMV A;  1BUP A;  1VRU A;  5DK5 A;  1HKC A;  4B1V A;  4X66 K;  4B08 A;  2FSK A;  3RSE A;  5M1P A;  4DFJ A;  1K73 O;  1UA1 A;  3HP9 A;  3I33 A;  1EX4 A;  3QDK A;  4DV5 K;  1VSK A;  2F8T A;  4J2E A;  1NGE A;  4CEO A;  4FWO A;  4JKA A;  3QER A;  2F9W A;  3DLH A;  2KLA A;  4DV4 K;  4HUG A;  3OYN A;  4GVE A;  3L4Q A;  1OVQ A;  3OYE A;  2CH6 A;  4DSK A;  2D1K A;  3CET A;  1XMO K;  3DM2 A;  3EN9 A;  4CBU A;  4MFB A;  3UIQ A;  1EET A;  2B4J A;  3FFK B;  3RTV A;  2D0P A;  5GAG P;  3C6H A;  1RT4 A;  5LMU K;  5AQV A;  2VG6 A;  4WCE L;  2W6L A;  4J8F A;  1VQ9 N;  1NU0 A;  2WOM A;  5LL6 Z;  4CZJ A;  3OYF A;  4B3S K;  4YDU C;  3CQ8 A;  4CW7 B;  1KFD A;  4GV9 A;  4ILH A;  4A2B A;  2UUA K;  5JLF A;  3CFP A;  3TTD A;  3L4I A;  4ILG B;  4IJN A;  4FZY A;  1K6Y A;  2YNH A;  1CXQ A;  4FOE A;  1VAZ A;  2VGN A;  1NBW A;  2RPI A;  3ASM A;  1C1C A;  5AQF A;  1R59 O;  1RT2 A;  5EXW A;  4JKB A;  4LF5 K;  2A42 A;  5IT9 O;  1IJJ A;  3BZK A;  3ZX3 A;  4AHT A;  2OTJ N;  4JRP A;  2CH5 A;  2ZJQ L;  1BQM A;  5AR0 A;  3KTQ A;  4H03 B;  2O8F B;  4DF4 A;  4RW8 A;  3P38 A;  3HPG A;  4RCH A;  5C12 A;  1J9A A;  4K42 A;  5JIC A;  1XHX A;  5MLC Q;  3PIO L;  2UUB K;  1EQY A;  3HSC A;  5M1N A;  3BDP A;  2OPR A;  1RTH A;  1RT3 A;  2D4W A;  1UOC A;  5C2D A;  2QEX N;  3NF8 A;  4WQ4 A;  1A5V A;  1F21 A;  4BG9 A;  4CGD A;  4BRN A;  3SUP A;  4XH4 A;  4Y1D A;  2HMP A;  4HUF A;  4B1Z A;  1X9S A;  4BVP A;  1C0M A;  3WT0 A;  5JS1 A;  5GIP A;  2WC9 A;  3CJA A;  3VN5 A;  4JK9 A;  3KWI A;  5EVZ A;  3AA3 A;  3V4I A;  4WE1 A;  3B8A X;  2A5X A;  4FSV A;  4IG3 A;  3G4S N;  4CEQ A;  1WB9 A;  1D5A A;  1JCF A;  3GG4 A;  1ATR A;  3UKR B;  1I3A A;  1BIS A;  1TKD A;  4ELU A;  3HP6 A;  3LDL A;  1TKZ A;  1X1P A;  1YJN N;  1IBK K;  2BGG A;  2KTQ A;  4YOV A;  1RDU A;  3C0B A;  2O8F A;  3LDP A;  2V7Z A;  4F3T A;  5H1S Q;  4JI6 K;  4GVM A;  2EHG A;  4LH5 A;  3VQ9 A;  3MN6 A;  4FK4 A;  1GOB A;  3CFO A;  4AHC A;  1Z26 A;  4CEZ A;  3L2W A;  3K5O A;  4DR5 K;  3KD1 E;  3U8X A;  3PSF A;  5SZT A;  1HNW K;  4NCB A;  3K5L A;  3MCP A;  1NK0 A;  2I7N A;  1N5Y A;  3ATU A;  4IEE A;  3PLA A;  4M3R A;  3R6M A;  3AVM A;  3NMU A;  2ITM A;  4IFY A;  1TUU A;  4PKG A;  2HF3 A;  3TAN A;  1YIT N;  2HND A;  4FJJ A;  4LF9 K;  3H45 C;  3OYA A;  5TKW A;  1BO5 O;  3F73 A;  1S72 N;  1ILY A;  3H3N O;  1B92 A;  4IO9 L;  4GKJ K;  1Y64 A;  3UKR A;  1NG9 A;  4CES A;  4FLZ A;  3C6A A;  3LDS A;  1FXX A;  3MXI A;  3JSM A;  4CZM A;  2HHS A;  1VRT A;  4HCB A;  2E2Q A;  1C0T A;  1ZBL A;  3FZK A;  4B1U B;  3BY5 A;  4JKG B;  3NF6 A;  3FR0 A;  4Q0B A;  1HRH A;  1NK4 A;  4DMN A;  2PFU A;  4JD2 B;  3ZCM A;  2VWK A;  1RDC A;  3CG7 A;  4LSL A;  4UY8 O;  3FZH A;  4CJW A;  3KIO A;  4CI6 A;  4N76 A;  4FWN A;  3THX B;  3NCI A;  5HP1 A;  3DLK A;  1J6Z A;  2F9T A;  1VSF A;  4AIL C;  2KW4 A;  2CGL A;  4DU3 A;  1HJR A;  3O5B A;  1RDA A;  4AHR A;  4AM7 A;  3H46 O;  4F8R A;  1RT5 A;  1ZBF A;  4JKE A;  2RHK A;  3A5M C;  2V51 B;  2QWN A;  4OKK A;  1HNZ K;  4C8L A;  1M1K O;  1OH8 A;  5SWM A;  3VET A;  2VWB A;  1SAZ A;  4CJF A;  4KTZ A;  3THY B;  4R5P A;  3E01 A;  3SAG A;  4QCL A;  4JKG A;  1W2B M;  4N41 A;  4FJX A;  2IC3 A;  5C25 A;  2O8E B;  1OKJ A;  1HYZ A;  3DMJ A;  1GLC G;  5JLH A;  1EKE A;  1KAX A;  3AVI A;  4JD2 A;  4CBX A;  4DR1 K;  3DRR A;  1HNI A;  1JCE A;  3NHG A;  2YHA A;  1BIU A;  1KTQ A;  3VQP A;  1X9J A;  2NRR A;  1RNH A;  1YUW A;  3LZI A;  2VYP A;  3THX A;  1U2V B;  4FLV A;  5GIO A;  4OPK A;  3PIP L;  3MWT A;  5KQD A;  3U4L A;  4EZ6 A;  3ZET B;  4MDB A;  3BF1 A;  3CME N;  2G8I A;  1J54 A;  3MX5 A;  4W5N A;  1LOT B;  5BR9 A;  4OPH A;  3VTH A;  3N4Q A;  4EAH D;  5BN8 A;  3E1Y A;  3VPZ A;  1OH6 A;  3TTC A;  3K5N A;  3U9Z A;  4M42 A;  2V7Y A;  1ZYQ A;  3QML A;  5BRF A;  2RE2 A;  3PX6 A;  3DXM B;  1S1V A;  4CVN E;  3THY A;  2KFZ A;  5I42 A;  2KKZ A;  5FPM A;  3SJH A;  4H4M A;  2E1Z A;  4RW7 A;  1SL2 A;  4J2B A;  3ENH A;  2E88 A;  5KPZ A;  1YF5 L;  4CZI A;  3U3G A;  3DOL A;  5AQI A;  1KSP A;  1SV5 A;  1J5E K;  2OZM A;  2O8E A;  1BDG A;  3QIN A;  4F2R A;  4DV2 K;  4F3O A;  1DT9 A;  3JAM O;  1K8K B;  4BRO A;  3V9W A;  5AQX A;  4CFB A;  3TAQ A;  2HBL A;  5F1X A;  1CZ9 A;  3OTO K;  5BR8 K;  1VQM N;  3AV9 A;  1U2V A;  1U47 A;  3CM5 A;  3S3M A;  3IS9 A;  3ZET A;  3O3F A;  4H0Y B;  2NZT A;  4DSL A;  4HHT A;  4JI1 K;  3QNO A;  1SL1 A;  3SBG A;  4BRC A;  3KK1 A;  3V9S A;  5ADX A;  4A5A A;  2BTF A;  2X74 A;  4OPJ A;  1BI4 B;  3I56 N;  1L5U A;  4DV0 K;  2WBN A;  4BQL A;  1NGG A;  3T1Y K;  4MDA A;  5DM7 L;  1YVN A;  4CJK A;  3NH1 A;  1WBB A; 
#chains in the Genus database with same CATH homology
 5TKY A;  1QVG M;  3GBT A;  3E9L A;  3DXM A;  5B8H A;  3CJ9 A;  5AQU A;  3SBT A;  1S22 A;  1NWK A;  5AZJ B;  3W3D A;  3ULE B;  3WXJ A;  4B9Q A;  2QWO A;  1Q18 A;  4K25 A;  3OBY A;  3CQY A;  3CCL N;  4L3Q A;  4IDH A;  2ASM A;  1QVF M;  2ZGY A;  5EY4 A;  1Q7Y O;  2ZJR L;  2KHO A;  3D2E B;  2W41 A;  4IO8 A;  4O8U A;  2A41 A;  2NRW A;  4QS9 A;  2ZJP L;  3TSP A;  3HTV A;  4M63 C;  3KHY A;  4KH6 A;  5AQH A;  3WXM B;  3RSE B;  2HBM A;  3EO3 A;  1MWM A;  2P9K B;  3I55 N;  4BRL A;  1E4F T;  3AY9 A;  3I8B A;  1SQK A;  5C10 A;  1HKG A;  2IIR A;  2YJF A;  3ATV A;  3R3L A;  3WQU A;  4BVO A;  3CJB A;  3CC4 N;  2QA4 N;  5LJV A;  1W97 L;  4Y0W A;  1U6Z A;  4DQ8 A;  3O6W A;  3CF5 L;  3JXU A;  4BRH A;  1DKG D;  2QWP A;  3IFR A;  3VGM A;  1IG8 A;  5HL7 L;  1VQ5 N;  4GY2 B;  1GLE G;  2V52 B;  4NO7 A;  4O8K A;  2GTD A;  1D4X A;  1WOQ A;  4B1X B;  1NGB A;  3E66 A;  4EIA A;  4HWI A;  5AQL A;  3O9U A;  2P9L B;  4BRP A;  3VES A;  2Q1N A;  3WUH A;  1ZXO A;  1BG3 A;  3CPE A;  2A40 A;  4BRD A;  3O1B A;  5ELZ A;  3CCV N;  1MWK A;  5AQZ A;  3QFU A;  4JK7 A;  4O5F A;  1H1V A;  2NRH A;  1VQO N;  3TPQ A;  2IVO A;  1BU6 O;  5JVH L;  4A2A A;  1GLB G;  3P39 A;  1K8A O;  4E1J A;  4XEI A;  2HBJ A;  4DKW A;  4U7B A;  1QQN A;  3AGK A;  1BWF O;  2GUP A;  3F2K A;  5AZJ A;  4JEP A;  3ULE A;  3MDQ A;  3WEE B;  4PL7 A;  4H5V A;  3A0I X;  4BRA A;  4BGA A;  3LM9 A;  4MO4 A;  4YOY A;  5KPT A;  3K9J A;  1BUP A;  3DXK B;  3D2E A;  2HST A;  4FWR A;  1HKC A;  5AZI B;  4B1V A;  3H1V X;  4IEI A;  3BF3 A;  3JS6 A;  1MA9 B;  2FSK A;  4BRM A;  1ZBS A;  4WQ4 C;  3RSE A;  1JJ2 M;  5M1P A;  1K73 O;  5BPM A;  3CCR N;  4A5B A;  3ENB A;  3I33 A;  2IVN A;  1X3M A;  3QDK A;  5C2F A;  3MWP A;  4BR9 A;  1QHA A;  1NGE A;  3O9S A;  4FWO A;  4JKA A;  4PKH A;  2F9W A;  2FSJ A;  2KLA A;  2YJE A;  3CER A;  1VQ6 N;  3DAW A;  3CIP A;  5F0X A;  4GVE A;  1V4T A;  5AQQ A;  3R9P A;  2VCP A;  5FPN A;  3L4Q A;  4ILJ A;  4PHT X;  5BPL A;  3C7N B;  2QTD A;  2H3G X;  2CH6 A;  2D1K A;  3CET A;  3LDQ A;  2OTL N;  2P9L A;  3EN9 A;  4CBU A;  1HJO A;  2FF6 A;  1M90 O;  4H0O A;  3HOT A;  2Q31 A;  1YIJ N;  3VEX A;  4JNE A;  3FFK B;  2D0P A;  4FWQ A;  5GAG P;  3SAH A;  3C6H A;  3F9M A;  5AQV A;  4WCE L;  1OVY A;  2W40 A;  3KWG A;  3OHR A;  4J8F A;  1KD1 O;  5BRE A;  1VQ9 N;  3AAR A;  4CZJ A;  4YDU C;  3UE5 A;  4BC2 A;  1HPM A;  2QW9 A;  4GV9 A;  2NRZ A;  3Q7C A;  2YHX A;  5HOO A;  3WEE A;  4ILH A;  3TTF A;  4A2B A;  4CZF A;  5JLF A;  3KK7 A;  1P8Z A;  4BR5 A;  3DXK A;  2E2N A;  3GDQ A;  4BR0 A;  5AZI A;  3TTD A;  3L4I A;  4ILG B;  1T6C A;  2A6A A;  1ATN A;  4IJN A;  3EZW A;  4ISG A;  4GNI A;  5LJW A;  1S3X A;  4OPA A;  4FOE A;  3ENO A;  2PBD A;  1VAZ A;  2VGN A;  5M1O A;  1NBW A;  2E20 A;  4A59 A;  5I9E B;  4BGB A;  3A5L C;  1RGI A;  5GAH P;  1Q82 O;  5AQF A;  5AQR A;  1HLU A;  1R59 O;  5EXW A;  4JKB A;  3EE9 A;  3LDN A;  2A42 A;  1IJJ A;  3QB0 A;  3ZX3 A;  3VEY A;  1Q86 O;  3DLL L;  2CH5 A;  3AAQ A;  2OTJ N;  2P9S B;  1BA1 A;  2ZJQ L;  3LL3 A;  3N4P A;  5AR0 A;  1XQS C;  1YJW N;  4MO5 A;  4H03 B;  1P90 A;  3C7N A;  2QWR A;  4FWK A;  3O08 A;  3TU5 A;  2FF3 B;  5CR4 A;  5GAD P;  3KZB A;  5EOY A;  3TSQ A;  3P38 A;  3U9D A;  4RCH A;  4LC9 B;  3VEN A;  4K42 A;  3R1X A;  5C12 A;  5JIC A;  5MLC Q;  3PIO L;  4IOA L;  1NGC A;  4FPB A;  3DWL A;  1EQY A;  3D7E O;  3HSC A;  5M1N A;  3O4W A;  3VEV A;  4RTF D;  3UB5 A;  2JWL A;  3VF2 A;  1KC8 O;  2D4W A;  1EO1 A;  1BOT O;  4CZH A;  5BRH A;  5C2D A;  2QEX N;  4CBW A;  4IJA A;  4WQ4 A;  4AF1 A;  2ZGZ A;  4JK8 A;  5CHI A;  3BUZ B;  3FZF A;  4BG9 A;  5C15 A;  4BRN A;  1NJI O;  4XH4 A;  3S41 A;  2YX6 A;  2HMP A;  3O9R A;  4B1Z A;  2A3Z A;  4BVP A;  5BN9 A;  3E9O A;  4HTL A;  3WT0 A;  4R79 A;  4BG8 A;  5GIP A;  1VQL N;  3D6R A;  3H6E A;  5DM6 L;  4YOX A;  2WC9 A;  3CJA A;  4BRI A;  3G6E N;  3GL1 A;  4JK9 A;  5M1K A;  3KWI A;  5EVZ A;  4EHT A;  1XC3 A;  2GWK A;  2P9U B;  2WFB A;  3B8A X;  1VQ7 N;  1NGA A;  4EFH A;  3IUC A;  2A5X A;  4FSV A;  1QQO A;  3SMP A;  3VGK A;  2Q0R A;  3BP8 A;  1X3N A;  3FE1 A;  3RVC A;  5BRD A;  4JKD A;  3G4S N;  3WXK A;  1JCF A;  1KXP A;  2FLO A;  3GG4 A;  3MMV A;  2QWM A;  2P9I A;  1ATR A;  2GWJ A;  2NRV A;  3FLC O;  3UKR B;  1VQN N;  4BRG A;  4CZK A;  1NGI A;  1O13 A;  5BPN A;  3VTI A;  2P9S A;  3LDL A;  4KH4 A;  4QS8 A;  1Z6R A;  1YJN N;  3GOI A;  4YOV A;  2ZF5 O;  1RDU A;  3C0B A;  4YDU A;  2BUP A;  3O8M A;  1NMD A;  3LDP A;  5GAE P;  2QWQ A;  2V7Z A;  5AQK A;  2E8A A;  3ZYY X;  5H1S Q;  2Q97 A;  2E1Y A;  2GX9 A;  4DB3 A;  3MN6 A;  1VQP N;  1KQS M;  4GV3 A;  2P9P B;  5AQY A;  4CZG A;  4FOI A;  3U8X A;  2GEL A;  2I7P A;  4FVU A;  3NVM A;  4PL8 A;  4M7X A;  5FPE A;  4JHD A;  4JKH A;  3SAF A;  3MCP A;  3UKU B;  2I7N A;  4BC3 A;  1NGJ A;  3ATU A;  4IEE A;  3PLA A;  2Q0U A;  3R6M A;  2F7T A;  3FGU A;  2NRT A;  3EKU A;  3MK6 A;  1G99 A;  3WQT A;  3MN5 A;  3NMU A;  2ITM A;  1TUU A;  1HUX A;  3LDO A;  4PKG A;  3ZEU B;  2HF3 A;  4A62 A;  3KVG A;  1YIT N;  4A57 A;  4BR4 A;  1ATS A;  1GLL O;  2CGJ A;  5KQ8 A;  3H45 C;  3HM8 A;  5LY3 A;  3MX2 A;  3R8E A;  2Q2R A;  2NRX A;  5E84 A;  5TKW A;  1BO5 O;  2UYT A;  5AQS A;  2FSN A;  4YOT A;  3QBX A;  3VOV A;  2P9U A;  3D2F A;  1RDW X;  1S72 N;  1ILY A;  1NGF A;  2JWK A;  4WFA L;  1CZA N;  3F5T A;  3H3N O;  4BRQ A;  4BY9 C;  3CMA N;  4IO9 L;  5GIN A;  1GLD G;  3CCS N;  1Y64 A;  3MCA B;  3UKR A;  4C1N K;  4WF9 L;  3HI0 A;  3VGL A;  3CCE N;  3C6A A;  4JN4 A;  2WUS A;  3CJ7 A;  3M3Z A;  2E2P A;  3CXC M;  2AA4 A;  4CD3 A;  4CZM A;  2PAV A;  4JAX A;  4AM6 A;  4IFE A;  1DEJ A;  2E2Q A;  2QWL A;  2QXL A;  1QZ6 A;  3FZK A;  2YCH A;  4B1U B;  4JKG B;  1ESV A;  4KH5 A;  1WUA A;  3L6Q A;  5AQO A;  2J4R A;  5C0Y A;  3FR0 A;  2P9P A;  4CJ7 A;  2P9I B;  4YOR A;  3A8Y A;  3VER A;  5JVG L;  2PFU A;  3IDH A;  4BQZ A;  2QI2 A;  3UKU A;  4JD2 B;  3K9K A;  1KAZ A;  4OO1 J;  1SZ2 A;  4UY8 O;  1GLF O;  3FZH A;  4CZE A;  2P9N B;  2QM1 A;  3CJ1 A;  3ZEU A;  3HBT A;  4CI6 A;  1C0F A;  4I6M B;  3CCJ N;  3CD6 N;  2Q36 A;  2ASO A;  3AGR A;  4FWN A;  5AFU H;  4WYB A;  3GE1 A;  3C65 A;  1VQ4 N;  4IZ9 A;  3M1F A;  3J8A A;  4CZL A;  2EWS A;  1J6Z A;  2F9T A;  2ZWH A;  4G9Z A;  4WFN L;  1Z05 A;  5AQG A;  4JKF A;  4BC4 A;  3VEW A;  3QFP A;  3HRG A;  3CQX A;  4JHD B;  2CGL A;  3EE8 A;  4H5N A;  4QS7 A;  4WQ5 C;  3BEX A;  3O5B A;  4H5T A;  3HOS A;  3NVK A;  3H3O B;  5JMV A;  4AM7 A;  3H46 O;  2IVP A;  4BRE A;  2ASP A;  1YAG A;  5AQT A;  2HF4 A;  4JKE A;  1NGD A;  2RHK A;  3A5M C;  3VEO A;  1K8K A;  1V4S A;  2FXU A;  2V51 B;  3IKM A;  4FWL A;  2QWN A;  4GV6 A;  3VF6 A;  3WXI A;  3M5R A;  1M1K O;  3VET A;  2VWB A;  1TUY A;  1SAZ A;  3CCU N;  5AQW A;  5AQP A;  4BRF A;  3D2F B;  3SMS A;  4IOX A;  4C1N I;  1K9M O;  3SAG A;  4DCH A;  3CI5 A;  1Q81 O;  4YOU A;  3EKS A;  4JKG A;  1NGH A;  1W2B M;  1JCG A;  2HBK A;  3OBW A;  3G25 A;  5M1Q A;  1OKJ A;  4K41 A;  4H0V B;  1T3V A;  3O9Q A;  1GLC G;  5JLH A;  1KAX A;  3HZ6 A;  4JD2 A;  4CBX A;  1YJ9 N;  1NM1 A;  4B1Y B;  4C23 A;  4K43 A;  1JCE A;  3ZX0 A;  5KPR A;  3P31 A;  3TSU A;  2P9N A;  1X9J A;  2NRR A;  2AP1 A;  3ID6 A;  4I6M A;  1GLJ O;  1YUW A;  3T7Z A;  4Z94 A;  4PKI A;  2VYP A;  1HX1 A;  3VMF B;  5ADX H;  2CGK A;  1YXQ A;  3LM2 A;  4FWM A;  1U2V B;  5GIO A;  4NLC A;  3PIP L;  3MWT A;  5KQD A;  3U4L A;  2HOE A;  3L0Q A;  4FL9 A;  4IOC L;  4CD1 A;  4B1W B;  3H1Q A;  3ZET B;  4H5W A;  4M7Y A;  4MDB A;  3P4I A;  3BF1 A;  3AAP A;  5EX5 A;  4BR2 A;  2VGM A;  3CME N;  1KAY A;  3EL2 A;  5AQJ A;  3MX5 A;  3VF4 A;  3ID8 A;  1LOT B;  4H0T B;  4IWV A;  5AQM A;  5AFU A;  4H5R A;  4OPH A;  5BR9 A;  1QZ5 A;  3N4Q A;  2YHY A;  3VTH A;  4EAH D;  1RFQ A;  4WFB L;  5BN8 A;  3E1Y A;  3VPZ A;  2OAN A;  3TTC A;  2P9K A;  1TYQ B;  4U67 L;  3U9Z A;  2V7Y A;  1YI2 N;  1SS6 A;  3QML A;  2BH1 A;  2RE2 A;  4NB4 A;  4BR7 A;  3DXM B;  4FPA A;  5BRF A;  1VQK N;  5E26 A;  4FO0 A;  1BA0 A;  1T6D A;  2YHW A;  1GLA G;  2KKZ A;  4IXC A;  5FPM A;  3SJH A;  2E1Z A;  3CCM N;  3ENH A;  2E88 A;  4NLB A;  1YF5 L;  3QIC A;  4CZI A;  5KPZ A;  4XH5 A;  4RWT A;  3E9P A;  4BC5 A;  5AQI A;  4H0P A;  3CCQ N;  1XUP O;  2NLX A;  4KBO A;  5F2R A;  3CHW A;  1BDG A;  2YI1 A;  1C0G A;  4FWP A;  5FPD A;  3CC7 N;  4H0X B;  5CE3 A;  1DT9 A;  4FWS A;  3DJC A;  2D0O A;  1K8K B;  5M1F A;  1E4G T;  4BRO A;  4DHY A;  4JKC A;  4ISF A;  4WQ5 A;  4YOW A;  3MN7 A;  1ZC6 A;  1LCU A;  3A5N C;  5AQX A;  1VQ8 N;  1MDU B;  3FZM A;  1DGK N;  1YHQ N;  3MN9 A;  3IMX A;  2HBL A;  5F1X A;  3Q7B A;  3O9T A;  3QBW A;  1T44 A;  3FZL A;  3SLC A;  3ZX2 A;  1VQM N;  4MLH A;  1U2V A;  3OW2 M;  3O80 A;  4MLE A;  4F9O A;  3SK3 A;  1QQM A;  2E2O A;  3ZET A;  3WXL A;  4H0Y B;  2NZT A;  3VEZ A;  4BRK A;  3M6G A;  4XH1 A;  3CC2 N;  3OA9 A;  3SBG A;  4BRC A;  1N8R O;  2GEM A;  1HKB A;  4EHU A;  5AQN A;  5ADX A;  4A5A A;  2BTF A;  3CJC A;  3I56 N;  3CPW M;  4ISE A;  3A5O C;  2WBN A;  4BQL A;  1NGG A;  4A61 A;  4MDA A;  5DM7 L;  1TYQ A;  1YVN A;  2NNW A;  3T69 A;  1NLV A;  3G71 N;  3O1W A;  3J7Z O;  3W0L A;  2DPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...