4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Putative
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
3Q5WA 3NUVA 4IDQA 3LOYA 1QVF2 1PFPA 1UUGB 3QK6A 4X64T 1NB5I 4JI2T 2BU4A 5IYZE 5ABFB 2UXBT 1LVNA 5KP4A 1K28A 3O4XE 2EHOD 3FB2A 3TLTA 3WAKA 5JDMA 5EZYE 3BNCA 4J8TA 2BG9E 3QB5K 1RSNA 1NAFA 2BG9B 3JC6D 1GOUA 3BQLA 5EK4A 2KZ7B 1BR1A 2NTXA 1SA0E 3M65A 2MAWA 5KDMC 2HMOB 2XEPA 3KVBA 2OOVC 4X66T 1E7PA 4QH5A 4I50E 4X20E 1HFAA 3AEDA 2PZVA 1JJ22 4LF8T 2VWAA 1HR0T 1WNHA 2XAHB 4TUYE 2BT3A 2CFLA 2W56A 3QB5A 4EB6E 3F9SA 3MKDA 4OFZA 2MPKA 1R4CA 3HKEE 5L4HA 3EHCA 1SIIA 3G06A 2YEVC 1BUQA 5ELJA 2WDVA 2FBWA 3EDUA 3PJAJ 4YTNA 1BNEA 1GOVA 4KFFA 3E08A 1YIJ3 2C10A 4WYKB 4ZXLA 2E2VA 2Q9QC 2P0MA 4UXNB 2F5MA 3EN8A 3PUGA 3PUXF 1TTOA 4AKLA 5FGOA 2W0GA 1BU4A 3G8ZA 1BNJA 5HWYA 4L9IA 1D6YA 4V1Av 2KF4A 4HWCA 1V9DA 3MACA 1GD4A 2CE7A 2P09A 4MHCA 1T2IA 1LRAA 2MF7A 2Y6XA 3CX7B 3AXJB 2H7OA 1N33T 4B3TT 4Z91A 2K9AA 4QHOA 2SPCA 4PEJA 3LSVA 1BRSA 3ZC1A 2I6HA 2PJQA 1JZDA 4HM4B 1UCUA 3E22E 3P7IA 4BTXA 2BMOB 5RNTA 1GS3A 3UU4A 3ZT5A 4HFHA 1Y64B 3I1AA 4JI4T 3JVCA 3U78A 3OBVE 3TKLB 2WSSV 1BRGA 3RKOA 1A90A 2E9XC 1TFOA 3KBTA 4CXYA 3RPUA 4R9LA 3FSDA 4ISSA 3PUZF 5GONE 2LT3A 5L3EB 1BR2A 2XQAA 5KMGP 3GN5B 4BL2A 3HZPA 1KEYA 2V26A 2ODVA 1H7CA 2M67A 3VGNA 4KBMB 1O7PB 4I43B 4AKYA 1FEWA 3EN1B 3DGNA 4TNVA 2W56B 4STDA 3KVAA 5L3CB 3RGRA 5FVKA 4AXPA 2LEHA 1EG9B 3VU7H 3AB3B 4H9PC 4DIDB 4HM3B 2HMNB 1Q9EA 1F8NA 5IW9A 2L3LA 3L39A 4HM6B 4Z90A 5AQVB 3UL5A 3HX8A 3O1IA 4XB5A 2KWHA 2CW9A 3CKDA 4CPKA 3KKGA 3B8LA 2DHRA 4U3CA 3FZKB 4AEQA 2WS3A 1HX1B 3DMCA 3NXJA 2LSJA 3FHNA 1IBKT 3RIUC 5H6RB 4C91A 4XDVA 5LOVE 3SOLA 1HKXA 4UF0B 3ZYKA 5L3BB 2V8SV 3CXC2 2CHNA 1ZGXA 2DNXA 3L0RA 1YNVX 3BB9A 1G96A 4ZS3A 3JAEA 3C4XA 4KZ1A 4WHAA 3ETUA 4TN7B 1X1WA 4IT7A 3V99A 3UTKA 4YSZA 4HBRA 3CCV3 2ZL8A 3EBYA 2DI4A 2N1GA 3EB8A 1N9EA 2VL0A 4TV8E 2N9DA 2FNQA 2C5KT 3PYJA 3HKCE 4DV6T 3X40A 2Y73A 2ZM0A 5LG4A 4BAYB 3Q5DA 3BU4A 4PK4A 5EVHA 3ROBA 1YIT3 2JQHA 2X66A 3SWHA 3DGLA 4TV9E 3EF8A 5LC7A 1JNRA 2A2FX 3C4WA 2DWGA 4L8OA 4HWIB 4P1NA 5JDFA 5AQPB 2L9QA 4HGAA 5AEUB 2OTL3 2OTJ3 4F6RC 3PUYF 4GK0E 1W0BA 2XQ7A 3SFEA 4ADZA 4HE8A 4A5XA 1EEJA 2CM0A 2LKGA 1ROAA 4GK5E 8RNTA 2ZHXB 4LGQA 4LMIA 3L09A 3UU8A 2KAAA 1GMRA 3CCU3 3B4PA 1N5HA 1JRQA 2XQ9A 4MMXB 5LGNB 4ILUA 2V6YA 1RTUA 3VSYA 3ZT6A 1UGIA 3BQKA 4JI8T 2BNGA 3J7Yq 3C98B 4JBWF 1I0VA 3Q5XA 4DMWA 1U8CB 1T72A 4KUMB 1I3IA 1YJN3 2DCFA 1Q824 5IWAT 1R8IA 3MXZA 5J2TE 2K0MA 1MOLA 4CXXA 1W5ZA 4O3VA 2XQ5A 1T8BA 1K41A 2K3WA 3CME3 3AE7A 1RDSA 3HR0A 4O4HE 5LYJE 3L3PA 4HWDA 2RSXA 5AQQB 1W0AA 3EHZA 1FMVA 1HF8A 4DV4T 1NEKA 3H37A 3X1DA 5DQVA 2LM2A 2D0TA 3P8CD 4TWHA 3S5CA 3KE7A 5FXXA 2XF3A 4OVMA 2ACXA 1MWUA 2R4IA 5FKYA 5A0OB 2H0IA 4LMKA 2Q9QA 3FKAA 2R41A 3JUQA 3T8UA 4BL3A 4PNIA 3FXDB 3FZMB 4U7YA 1RN1A 2A15A 2VQET 2Q9QB 2W00A 3CCQ3 4MLKA 3SYUA 3I0OA 2SARA 1OEDE 2B24B 4UELA 3B4OA 4IDZA 5CJ5A 1CQSA 1SHZC 4CN1A 2K54A 2W9PA 2M6IA 2UXCT 2RBIA 4I55E 2E5LT 2NW7A 5JDQA 1BIRA 3F57A 1QMAA 1AJ3A 3EABA 3OPCA 3UNLA 2G0UA 4X65T 3QRDA 1EQKA 2XUEA 3M3ZB 3JUPA 3ZSTA 1MWSA 3DY5A 3ECFA 4QH1A 4DV5T 2BDEA 2RPAA 5BIRA 3ZMTB 5FP3A 3K0ZA 2V6XA 2QA7A 5A1LA 1BNSA 4HM7B 5IG5A 4K0KT 4ZOLE 3SOAA 3PZWA 5HEHA 3L8RA 2JQ5A 1Z8UA 1UGHI 2H7VC 2CHOA 2W61A 1TUHA 3NQZA 4MJDA 2XSOB 2HMMB 1BRHA 2LHNA 3B13A 4P0AA 1LKXA 3ZMUB 4QWTA 2IUBA 4HJLB 4ZI2D 3MJXA 3WA3A 1I2GA 3AEAA 3VF1A 4MFRA 1KF6A 4H9RC 1O7MB 3RLFF 4UVBB 5CFBA 3IEEA 2X9WA 5M19A 1S94A 2C11A 3I553 3HKBE 2X0LB 2JQ9A 4X2OA 5AQJB 3PV0F 2VKHA 3I9WA 1OHOA 2RGQA 1UX4A 5IENA 2WQYA 5HXCA 4Z8XA 4FMBA 1Y4KA 4ZM8A 3JUOA 2QGUA 4FR9A 2K48A 3LJCA 3G16A 3RYCE 1T98A 1QAFA 2CXLA 3FLJA 2HMJB 5AQOB 2W6JH 2NW9A 4ILAA 4K61A 2FJBA 3PE0A 2W62A 3VR9A 2LHRA 1OF5A 4I4KA 5CXOA 2BKNA 4JEUB 2LSKA 2KWIB 4ZEYA 2BVLA 4O2BE 1EA2A 1OACA 3D79A 1HU9A 1V57A 4NUVA 5L2LA 2WMNA 2QIYA 3FZHB 2VL8A 5AIGA 4HKVB 1XDPA 2X9HA 2I59A 2QRXA 3ZFZA 5AYRB 1CH0A 1CHUA 5AIHA 4QH4A 3U3IA 4UV8B 1RJOA 1RCLA 3NV0A 4TX5A 2CKFB 4CI1B 1BVIA 2RFRA 1E3RA 3E0ZA 4JI3T 2V7KA 2XHEB 2XRXB 3BLZA 1LOVA 1XWMA 4EXRA 2VVNA 1QALA 3CMA3 4DMVA 1RGAA 2HN2A 3CPZA 3N9LA 1X1XA 1MWTA 2ZA4A 3SRZA 3GA8A 1JV2B 1U5PA 3GMIA 1K734 3RRWA 2LM9A 3T8OA 3CCL3 5FL0A 5HEUA 2BKPA 2Z76A 1IBMT 3EE1A 5LBMA 4OHFA 3WMDA 1I70A 4JI0T 1WMNA 5IHYA 3GRDA 4EV5A 3SEDA 4NIQA 1S5AA 4AI6A 4BIRA 4N6NB 2J8XB 1RCKA 2NTYA 4XBFB 2ZM8A 1HS7A 3NKZA 1LRZA 3G713 5AQUB 4DBRA 3VR8A 1W09A 3ZCJA 3KIIA 4UVAB 4ISTA 4QWNB 3AEBA 1MNDA 3AE5A 3QC9A 3FG4A 1OEDC 3EJVA 2QVAA 2HPLA 2C5IT 4NUUA 3AECA 1V74A 4YTMA 1YXRA 1W6GA 1A67A 1WYBA 3BIRA 2IMJA 5M1AA 3RGLA 3IBPA 5F3JA 1V58A 3AMOA 3D0TA 4AIUA 4PFOA 3RC3A 5ABEA 2CMRA 5ADXL 2A72A 5J2UE 2A3DA 5M18A 2RP4A 1SUMB 3V98A 1RGCA 3MK7C 5C3JA 3RIFA 2YDSA 2MOZA 3ZN1B 5ABHA 4ILFA 1W2ZA 4NHFA 3PUAA 1W4NA 2WOHA 1YJ93 4K0UA 3UU5A 4K1UA 3WR2A 2UUGC 5AQNB 4OYJA 2KLQA 2I0MA 3EX9A 5STDA 2F99A 1JNZA 4ILCA 3IHRA 1ZV4X 3F7SA 2A9UA 1E97A 5M4YA 2WDRA 1AY7A 5AIFA 2XQYA 3EDVA 3LXUX 4CDLA 1UGOA 3TLWA 5BXQA 1X79A 3N2KE 2W9QA 1JBRA 4OK0A 1UCKA 1T2HA 3RNTA 4K1VA 2XAJB 3K3OA 1CEWI 3FF2A 5AQFB 2NP9A 1AVKA 1DETA 2HOHA 4LFAT 3H3HA 4O8SA 2GEYA 1MGWA 3OTOT 2XPKA 4NPPA 4B3MT 1RRHA 2E9XA 4HFBA 3RX6A 4PJNA 3OWSA 1GY6A 1Q814 3HKDE 2XGNA 1I6ZA 2IAKA 4G2AA 3NRXA 5KXJA 2BS4A 3K3NA 1B2ZA 1NU3A 4GYSA 5L3DB 3ZG5A 2I9WA 4ANJA 3F7XA 2CWTA 3AGNA 5CA0E 1LQMB 1VQL3 1J1JA 2KINB 3RGAA 1RHLA 4GYRA 2RA1A 2PNCA 2J1DG 3UUXB 2VKJA 4DVDA 1RN4A 1E2AA 4WYVA 2CPTA 1T7SA 2FGTA 5BVBA 4N6OB 3CQGB 1TU5A 1VQN3 4NXNT 1IJ6A 4UIGA 2EHOA 5JTGA 1GY5A 1OHSA 2LJLA 1VQO3 1MMDA 3CQXC 2OLTA 3WAJA 3N2GE 4LF5T 4C90A 1L5GB 3H3MA 3CU3A 2X9XA 1N5PA 4JEHB 1EZ3A 2Z6BA 1TRPA 1W6CA 2P0XA 2XM2A 2HPJA 3P4QA 1PU4A 5BMVE 1AV4A 4AKIA 3QK9A 1LXEA 5JBSA 2WZIA 1M1XB 4CCVA 3NBJA 2AAEA 3PUVF 4RNZA 4WBNE 3D5IA 1B2UA 3OJAA 2P9BA 1UUSA 1K8A4 4RNTA 1SIHA 2M6BA 3RKGA 2RNTA 3HOHA 2CWVA 3PGBA 1WMPA 1E1HB 2YX9A 2YDQA 3ONJA 5C8YE 1J5WA 3JAFA 1RGHA 2WWUA 1QLBA 3K63A 1A2VA 2FXTA 5D83A 3FZFB 1BAOA 4LF4T 3AA6B 2VB6A 3AEEA 1FGRA 2SBLA 5EK2A 1I2EA 1M62A 4IIAA 2WCAA 1X9BA 4BTWA 3LFMA 3CQCB 3N54B 5JVDE 5JDHA 5G1KA 3X3XA 1HYFA 1QJGA 4EZ4A 2BO9B 1VQ73 4TZ4C 2CCQA 5AQGB 1FUTA 1DMNA 2DLRA 1IU7A 2CIUA 5JPUA 3DM8A 2NR4A 4KFEA 4B3RT 1YW0A 3W15B 1I94T 3U1WA 3NZQA 1FYSA 1ULIB 3VKHA 1XNRT 3R84B 3N8BA 2H89A 3CX6B 4XAXB 2FJAA 3CPOA 4ORLA 5DREA 5FL1A 3OKQA 1YQ3A 4WP5A 3KZTA 4U33A 2D0UA 2JPFA 5LMNT 4UR9A 3ZYMA 4LYLB 1YQ4A 2YU2A 1BSDA 1GYBA 2VKOA 2KT9A 3KDSE 2F56A 5BU4A 1HZ1A 1S35A 1UUVB 3WODG 3CD63 1UX5A 5EEOA 3Q90A 1WMOA 2BHMA 3KV4A 1FZUA 5IERA 2MC8A 1BSCA 1BR0A 2IA7A 3K3QC 3ANWB 4B6XA 4AKHA 4EGWA 3AHWA 1XMQT 3LK2B 2D1WA 2ZMAA 5LBQB 5BR8T 1IYYA 3N9NA 1US7B 2CLYB 2IW5B 3GAXA 3MWZA 4LSOA 1FGQA 1RGKA 2ML6A 1KNZA 3X3YA 3AAEB 3NHXA 5J1GA 1N36T 1U5OA 1ULJB 2X0HA 1VQQA 4WBOA 3UT5E 2YKSA 3RH3A 1NNVA 2CWUA 2E2UA 2X0YA 1OUNA 3NZPA 1LVKA 1IV9A 2KCDA 3A76A 3LTDA 3SOYA 4HN9A 3TLVA 1OF5B 3H3AA 4OYKA 2WMOA 5FYMA 1GMQA 4FCZA 5LMUT 1KSIA 3V5SA 2H88A 3LT9A 2LYXA 1RN7A 1UURA 4JI6T 2UUAT 2AE9A 4KVHA 2BG9A 3ZC0A 3NV0B 5JR9A 3VHLA 1W00A 2OV9A 3LT8A 1K9M4 2L1SA 4BJNA 5KP1A 2QYWA 1C54A 4EBGA 4KMCA 1GY7A 4WFOA 5LHIB 3UUNA 4MALA 2O9UX 3HA4A 3TLUA 1FA3A 3LDQB 2UUCT 3AE6A 4ILBA 1E3VA 4ZHQE 4EXTA 1IVUA 1UDII 3P50A 5HEGA 2W04A 1D1BA 4HTEA 4N6LA 4CZZB 3JC6C 5AYSC 3HI7A 5IUXA 2IC9A 2KMFA 2NW8A 2WDQA 2H0HA 3UQ7A 2V6YB 2GBXB 4N78D 2LSYA 3ONXA 4DR5T 3DGOA 4CN6A 5GSPA 3N2OA 2XTLA 2XZEA 4IHJE 3SXXA 4YLHA 1BSEA 4FI5A 1UK5A 2IHR1 2NWBA 2WZHA 4ERRA 2XJ7A 1C7HA 3GZYB 1U4QA 3J7Yd 2XFSA 3P4WA 1G0TA 3UU3A 5LG3A 2P38A 4CXWA 1B2XA 3D4AA 4UEMA 2LSIA 2GU3A 2F98A 4LZIA 3Q1CA 4YHJA 4HOHA 4R1KA 4O2AE 3EI0A 4KT3B 3K1SA 2FJEA 3P4RA 3PUSA 1BSAA 2D42A 4LF7T 3ZKRA 1OGXA 5HEJA 4X2HA 3LZAA 4DR6T 1WRDA 1RGGA 3KFQC 1RGEA 4OUQA 5JR9C 2B1XB 3KSED 1VQ53 2Q07A 1N9JA 4NPBA 5IF6A 2CA5A 2MYSA 2N2NA 2XSAA 4X1YE 1MWRA 4YJ2E 1UCIA 3GZXB 4HM5B 1FUWA 4TX4A 3ANWA 2E9XB 1LOXA 3ZN0B 3T0UA 3N9MA 3ZCIA 4AKRB 3KN4A 4HYZA 3NBXX 3AA1B 2W63A 3KCHA 3EUHA 1WCRA 1B2MA 4H9NC 5EK3A 4ZI2C 1WQLB 4Q25A 4UF0A 5LJNA 1Q7HA 2KXGA 1STFI 4F8HA 2DL1A 1G8XA 3A7MA 1BGSA 2D2SA 5LXTE 3LG7A 4LMLA 4XZCA 4H9OC 4AQFC 4HWHA 5KP3A 5TGNA 2W0QA 9RNTA 3C51A 1HNXT 2WU2A 3RDEA 4I0UA 4DR3T 3G4S3 1BUJA 1WR0A 5HXRA 5AEWB 4G63A 3S27A 1HG5A 1ZP0A 2P05A 2CFWA 3NWIA 3CC23 2B1EA 5FXVA 1FUSA 1NB3I 1T5YA 4HM8B 4U13A 2JJ9A 4PW8A 5D81A 2QEX3 2F4VT 5F8PA 3EBTA 3T8NA 2XQ4A 4WNKA 3CCJ3 2BG9C 3FBLA 2V1LA 3OWUA 2HMLB 4EYUA 2HMKB 2XSBA 4JF8A 1YGWA 1T3BA 2V7MA 3S29A 5HGRA 1RMSA 3R6NA 4O02B 2ML5A 1J5ET 4CN4A 4KHPT 1KNRA 1XMOT 2PFVA 3GN5A 4H61A 1JBSA 3OW22 1Q42A 5DJQC 1EKMA 5L4EA 3ZMVB 2QGSA 1VQK3 4IT4A 1IQ8A 1LVFA 4H9SE 2CFGA 3ZSSA 4GOUA 4X1IE 1LOYA 3MKIA 3ZMZB 1BNFA 4K90B 3RYIE 2KSRA 2VASA 3K5TA 1VQ43 4ZS2A 2CXDA 5ELUA 1D6ZA 3WI3A 2WGOA 2LQVA 2W03A 2VVSA 3BNBA 1I0XA 5CF1A 4IDNA 2BMRB 3V92A 5JREA 2HN1A 4Q53A 4TWDA 3DP7A 3D9RA 2ZM2A 5FW5A 2BKOA 3RIAA 3AXJA 5FXWA 1ZEEA 3PURA 5HCJA 3AA0B 3FZWA 2W2UA 1KC84 4DV3T 4X1KE 3DZLA 1TRQA 1W6YA 3O9XA 1RNTA 1IV7A 3ZEFB 2CBJA 5JDNA 1MMAA 5AQIB 4L8PA 1DVDA 2V1DB 3CC43 2YFLB 4YHHT 3UL6A 1CYVA 2L8KA 3KSPA 3OV4A 2IYJA 2E5VA 4HZBB 1DE3A 2XR8B 4DO0A 2E2AA 5E0OA 1EUIC 4NREA 2K5BB 3OVUA 5LP6E 2CFDA 2XQ6A 3HL6A 1RRLA 3U97A 1B7TA 2CG0A 3EQQB 1BRJA 4IDPA 4BU4A 1HX8A 2W4XA 1VQP3 2XGLA 2JQQA 3GZBA 2J62A 1QAKA 1ISKA 1FJGT 2CG1A 3FZLB 3N9OA 2GU1A 2UXNB 3GZRA 3F31A 4X62T 4HWFA 2XAFB 3LH4A 3HI2A 4UV9B 4KX6A 1JB4A 4P0BA 2K3DA 2B76A 4XM4A 3DH2A 3UB1A 2MTQA 1HG2A 3URPA 4CQIA 2BMQB 4YXDA 1YVBI 1B20A 3NX0A 3UFEA 2X67A 2YN6A 4HFDA 1PY3A 4FMDA 2AXDS 3LBXA 5L3FB 1FGMA 5AFUL 3QUJA 4GSPA 4AQYT 4E7SA 2PTFA 3A5EA 3C50A 1VRBA 1OEDA 2XSHB 1N34T 3BNEA 2F86B 2C5JA 1VQ63 7STDA 1ZHCA 2LOPA 7RNTA 4E7ZA 2F4YA 3KV6A 1JZOA 2LRKA 2YK0A 1R4YA 4H63V 1YVSA 4RZMA 2XQ3A 2F5WA 1DVCA 3DUKA 4EEDA 4DUZT 4N3VA 3IF8B 1MNLA 4YSYA 5JDLA 4ZZBA 1NO3A 1KQS2 3ABVA 4J2CA 2CWYA 2DWKA 1TFKA 2JDIH 1LNHA 1Y01A 1FMWA 3N9QA 3MZKB 3NBBA 3PXMA 3S67A 2HH7A 1IQYA 1BRNL 3CCM3 5JRCB 2BS3A 3PJAA 2L4VA 3UULA 1DYUA 1LNIA 4HVNA 4KP3C 4O4JE 1RNBA 5AQTB 5FNVE 2C4BA 4ASKA 5TAOA 3LK42 2CFKA 3OYXA 4YSXA 3AMOB 1BNRA 2IDOB 4HAAA 3ZMSB 5AQSB 1D1CA 1GD3A 3RYHE 4AQFA 1NWMX 2C0SA 2UUBT 4L7KA 3AE9A 3F2EA 2KF3A 1I2FA 2CWOA 3PUWF 1NENA 2CC3A 3ER7A 3PDYA 4A56A 1D0XA 4JUYA 5LNKA 1WR6A 3AA7B 1BNIA 4XBXA 2V5DA 3ZJ1A 3RQWA 1ASKA 3CPW2 3D3LA 3BK9A 3PU3A 4YTPA 1CYUA 4HZ9B 3MYTA 4DUYT 5HXHA 3P4SA 2LLYA 3CCS3 2JQKA 3KINB 2ZM6T 2WBLA 1IZNB 1O7NB 1LQGC 1JB5A 4HM0B 5ABFA 2BIRA 3AEFA 1Q864 1I8VA 3ZJ2A 3SFDA 1W01A 3WOEB 4NXMT 2YU1A 4U72A 2IUJA 1ZKEA 4HEAA 3JCFA 4DV1T 2WB5A 1B21A 4BTYA 3AE8A 1Q40B 1GMPA 1RKYA 3CMLA 1RLSA 5HAXA 3CWZB 3DJBA 4O4LE 3Q3FA 8CHOA 3J9X1 1O7WB 3HK4A 4I4TE 2W66A 4FMCA 2XY8B 1YHQ3 1QSDA 3A8YC 2PG8A 5HXSA 4GL6A 2UX0A 3FH1A 1JN5A 3CVRA 2JRKA 2CXFA 2LRLA 1Q7Y4 4JI5T 1UW1A 3LMLA 1I3FA 4EZHA 1CUNA 2CRBA 4N6TA 1UUWB 2KF5A 4GKKT 3RF1A 3PUQA 3Q9DA 1ZO2A 3KV5A 4IDOA 3DGYA 3K9MC 1YKHB 2BVMA 3LTCA 4MMYB 3F40A 5CB4E 4O4IE 2M7OA 1MMGA 1IT7A 4DR1T 2V7IA 1XDOA 5DQWA 2CLYC 1NDOB 2IY2A 4IREA 4JRFA 3UUBA 5JR9B 1FGTA 1A2KA 1OGZA 1IVVA 1OWAA 3B57A 2Z77A 2YOEA 4IE6A 3T1HT 1A2PA 3STDA 2E2TA 2H0GA 4U74A 2STDA 2VURA 5LHGB 3GWRA 1O7HB 3ZG0A 3CX8B 3ZYLA 1N32T 1B27A 2ODUA 3RQUA 5AQHB 1SJWA 3CK6A 3O1HA 4HFEA 4JYAT 5FY1A 3NM7A 1OCVA 1UI7A 3AVRA 1DMQA 3LBXB 2GXFA 3JUMA 4RNYA 5HWXA 1JN5B 2WGQA 3C4ZA 4PK6A 2WP9A 2YFJB 1HTJF 1HNZT 1G73A 5FVLA 3S4UA 1RGFA 3BNDA 1ZS7A 3RC8A 2D9DA 4YT0A 4KHZF 5JPPA 2Y8DA 4AQGA 4FCMA 1OPYA 2IMLA 4U7IA 2OA5A 3D5GA 1N8R4 5FXZA 3ETVA 1VZZA 4WZXA 2WY2A 3LTAA 4PJLA 2J47A 3MG1A 5C2TA 4XBTA 4J5GA 1UI8A 5HEOA 1L0VA 3UFGA 3GSPA 2XAGB 5IG4A 1OXZA 4COFA 4JLEA 5L3GB 4FMAA 5JQGE 4J5KA 3C64A 1BRIA 6RNTA 2LSGA 1YKEB 4PFPA 2XFTA 4M1PA 4P09A 4DKIA 1X1UA 4O2HA 5HXEA 4EV2A 5LA6E 1SARA 2KNDA 2WAUA 1LOWA 1FW7A 2PBIA 1O7GB 1MIYA 1MIVA 1D0YA 3N5LA 3ZPOA 3EC9A 5EQLA 2LE8A 4ZI3D 3S28A 3I0QA 3TDGA 3RHWA 2CX1A 2XAQB 1GOYA 3WDGB 3I563 4I5QA 4QX8B 2J4GA 3UQ4A 2Y48B 4L5GA 5LB7B 5AQRB 5IG0A 1VCSA 3F8HA 5CA1E 4HFVA 3JUNA 4GHOA 3N9HA 4BJMA 3IA3A 1B2SA 2WO0A 4DR7T 2D5UA 2IIUA 1IVXA 3VKGA 4TWFA 1VQ93 1Z0PA 3HIGA 4L0RA 3CCE3 4OX9T 4WW0A 2UXDT 4LF6T 1SE7A 4IE0A 4DNDA 4PK5A 2IC6A 1JB2A 2QA43 4WYKA 2JMHA 3K8PC 4IL9A 3SLUA 4ZZCA 3AHSA 3PTRB 2ZLYA 1PYLA 3FG1A 3EAMA 2R6GF 1W02A 3IJEB 3MG3A 1TIJA 5IG3A 5LC6A 3CIRA 2BBHA 2FUPA 4EW5A 1UCJA 3FCSB 1GSPA 4JI7T 2W67A 1JBTA 3ZLIA 2V7LA 3WOFB 4GB5A 1M1K4 3IPTA 1X1YA 2OWPA 3UUMA 1BANA 3SS1A 5ABGA 3ONLC 3NQYA 3PU8A 3V5UA 1NWWA 5AQMB 1MIWA 4EIWA 2OQEA 2X68A 1US1A 3Q5EA 1KK7A 3LK3B 3X42A 3IMAB 4YJ3E 4LEHA 2XH9A 3NBRA 6STDA 2BS2A 5FY0A 2CHCA 3MPHA 2WU5A 3ALAA 4N6MA 2O3OA 3OYZA 1BNGA 4DV2T 4QKNA 5LCYA 3BQIA 1IQXA 1FIOA 3P4PA 5J0ZA 3MA9A 2EHOB 4CJNA 5AI1A 5IEPA 5LHHB 2YFIB 5G1LA 3FXEB 3CNMA 3LYGA 4TNWA 4KI0F 1TJDA 1BOXA 1W9RA 2E8IA 3AGOA 3OX9A 4IIJE 4G1MB 3I9YA 3Q2MA 4IGUA 4GKJT 4H9QC 3QOFA 1M9GA 3KV9A 2UXXB 2GSPA 2NOXA 5AQKB 1KWIA 3MHEA 3AE2A 3NVOA 5KX5E 5I97A 2OOVA 2MBGA 4MEIA 6GSPA 1KNPA 3ESLA 4LFCT 4ZI3C 3FGYA 3CCR3 3O1JA 4PAGA 1O3XA 4QXHB 1W2B2 3DXOA 2JMKA 4PJJA 5CK6A 3FF0A 4EOZB 2KF6A 4LFBT 2UGIA 1IAPA 3LTBA 4EC6A 4R4KA 5CLKA 4IE4A 1YJW3 4H63H 4IE5A 5LGUB 1IT8A 4J9AA 4AKGA 3N9PA 4N6UA 1B3SA 4IL4A 1WYCA 4HFCA 5LGTB 4R9KA 3WA2X 2LOSA 3UJMA 1HCIA 2ES0A 5D82A 1Q40A 1MMNA 3AAAB 2X9YA 4HM1B 1ZX2A 3RRCA 1SPUA 4AKZA 1IDPA 2XM1A 3SX1A 3HIIA 3DTOA 3PS8A 4U2ZA 1TP6A 1AR0A 4ZI7E 1WLXA 3DGMA 2ZDJA 4PJMA 3AE3A 1WFDA 1D6UA 3OXAA 5H6QB 1QVG2 2K24A 1QUUA 3Q2PA 5CGMA 5LJMA 4QXCB 4AISA 1BRKA 4EEBA 4EV6A 5CF2A 3VRBA 2KRTA 4EYYR 3KFWX 4WWUC 1XNQT 3FG3A 1AQZA 2GBWB 4XBYA 4DR2T 1M904 5DRVA 1GQEA 5DABA 1YGEA 4XDWA 4RBNA 1IK3A 2EHOC 2V5CA 5ETWA 2WM9A 5L47A 4KFDA 5HCMA 4QXBB 1OH0A 4GIWA 2ACZA 4DV0T 1NJI4 4HM2B 2YINA 1OHPA 2VK9A 1J2BA 3KBUA 3NRYA 2BBJA 1MGRA 1MNEA 3H51A 3PCRA 1KFYA 4X5TA 1Z1SA 1JNQA 1D0ZA 4A97A 1SQWA 5HYAA 3B5MA 1N8QA 1W7CA 2HHHT 3AAIA 4IPBA 4YY3T 2GEXA 2Y74A 2X51A 1UCLA 3NM2A 3SVAA 3OWYA 2H3RA 1IJ5A 5F5WA 3QNUA 2XQ8A 3E99A 3A5XA 2VQFT 1RGLA 2CH9A 1ROVA 5FY7A 4DBQA 4HKAA 1KD14 1YI23 2Q9QD 1VOMA 3X41A 3RIUA 2BZBA 3RYFE 3AE4A 3ZT7A 5AQLB 4BA9A 4FJOA 3PCSA 1VQM3 1HNWT 1XZYA 1STDA 3FBZA 4FCJA 2AADA 3WHOA 2UU9T 1S723 4MBQA 1FGOA 4H3UA 3O8YA 4IE7A 1JKGA 3G0KA 1ZOYA 3GWHA 4N6V0 2CBIA 1VCTA 4CI3B 2V7JA 2CX0A 1D1AA 2LKHA 4YFSA 3B7CA 3F14A 1YD8G 2Z7AA 1G02A 4DV7T 4MMZB 2GK9A 3K7CA 2KXPB 5JRCA 4U31A 4EAHA 5AIIA 2INXA 3X3ZA 1IBLT 2CEAA 1VQ83 3VRAA 4LF9T 3F8XA 2CK3H 4JI1T 2XASB 4UVCB 1WTHA 1AVLA 3CC73 4HFIA 3MG2A 2YDRA 4A98A 1DMMA 2W2CA 2E9XD 2RCDA 3MSOA 5IEOA 4CI2B 3RI5A 2OCTA 5FMNA 3TLSA 5HOHA 1JKGB 3AE1A 2OQEC 7GSPA 4R80A 3G6E3 3CNXA 4EYCA 2JIWA 2WWVA 4B3ST 2FJDA 2Z6EA 3AVSA 1IVWA 3I0YA 1BR4A 2WOFA 4U2YA 3UU6A 4JV5T 5JDGA 4DR4T 3T1YT 1OEDB 3AEGA 5JH7E 1DU2A 3JADA 4QX7B 3M8CA 2VKDA 5G2GA 4LMJA 1BSBA 1M7KA 3EVYA 2IUKA
chains in the Genus database with same CATH topology
3Q5WA 3NUVA 3LOYA 1QVF2 1PFPA 3QK6A 1NB5I 5IYZE 1LVNA 5KP4A 1K28A 3O4XE 2EHOD 3FB2A 3WAKA 5JDMA 5EZYE 3BNCA 4J8TA 1NAFA 3JC6D 3BQLA 5EK4A 2KZ7B 1BR1A 2NTXA 1SA0E 3M65A 5KDMC 2HMOB 2XEPA 3KVBA 2OOVC 4I50E 4X20E 1HFAA 2PZVA 1JJ22 1WNHA 2VWAA 2XAHB 4TUYE 2BT3A 2CFLA 2W56A 4EB6E 3F9SA 3MKDA 4OFZA 1R4CA 3HKEE 3EHCA 1SIIA 2YEVC 1BUQA 5ELJA 3EDUA 4KFFA 3E08A 1YIJ3 2C10A 4WYKB 2E2VA 2Q9QC 2P0MA 4UXNB 3EN8A 3PUGA 4AKLA 5FGOA 2W0GA 3G8ZA 5HWYA 4L9IA 1D6YA 4V1Av 1V9DA 3MACA 1GD4A 2CE7A 2P09A 4MHCA 2MF7A 2Y6XA 3CX7B 2H7OA 2K9AA 4QHOA 2SPCA 4PEJA 3ZC1A 2PJQA 4HM4B 1UCUA 3E22E 3P7IA 4BTXA 2BMOB 1GS3A 1Y64B 3I1AA 3JVCA 3U78A 3OBVE 3TKLB 2WSSV 3RKOA 1A90A 2E9XC 1TFOA 3KBTA 4CXYA 3RPUA 4R9LA 3FSDA 4ISSA 5GONE 2LT3A 5L3EB 1BR2A 5KMGP 3GN5B 3HZPA 2V26A 2ODVA 1H7CA 2M67A 3VGNA 4KBMB 1O7PB 4I43B 4AKYA 1FEWA 3EN1B 3DGNA 2W56B 4STDA 3KVAA 5L3CB 3RGRA 4AXPA 2LEHA 1EG9B 3VU7H 3AB3B 4H9PC 4HM3B 2HMNB 1F8NA 5IW9A 2L3LA 4HM6B 3UL5A 3HX8A 3O1IA 4XB5A 2KWHA 2CW9A 3CKDA 3KKGA 3B8LA 2DHRA 4AEQA 3DMCA 3NXJA 2LSJA 3FHNA 5H6RB 4C91A 4XDVA 5LOVE 3SOLA 1HKXA 4UF0B 3ZYKA 5L3BB 3CXC2 2DNXA 3L0RA 3BB9A 1G96A 4ZS3A 4KZ1A 3C4XA 4WHAA 3ETUA 4TN7B 4IT7A 3V99A 3UTKA 4HBRA 3CCV3 2ZL8A 3EBYA 2DI4A 2N1GA 3EB8A 1N9EA 4TV8E 2N9DA 2FNQA 2C5KT 3PYJA 3HKCE 3X40A 2Y73A 2ZM0A 5LG4A 4BAYB 4PK4A 5EVHA 3ROBA 1YIT3 2X66A 3SWHA 3DGLA 4TV9E 3EF8A 5LC7A 2A2FX 3C4WA 2DWGA 4L8OA 5JDFA 2L9QA 4HGAA 5AEUB 2OTL3 2OTJ3 4F6RC 4GK0E 4ADZA 4HE8A 2CM0A 1ROAA 4GK5E 4LGQA 4LMIA 3L09A 3CCU3 3B4PA 1N5HA 1JRQA 4MMXB 5LGNB 4ILUA 3VSYA 3BQKA 2BNGA 3J7Yq 3C98B 3Q5XA 4DMWA 1U8CB 4KUMB 1YJN3 2DCFA 1Q824 5J2TE 3MXZA 2K0MA 1MOLA 4CXXA 1W5ZA 4O3VA 1K41A 3CME3 3HR0A 4O4HE 5LYJE 3L3PA 2RSXA 1FMVA 1HF8A 3H37A 5DQVA 2D0TA 3P8CD 3S5CA 3KE7A 5FXXA 2XF3A 4OVMA 2ACXA 2R4IA 5A0OB 2Q9QA 3FKAA 3JUQA 3T8UA 4PNIA 3FXDB 2A15A 2Q9QB 2W00A 3CCQ3 4MLKA 3I0OA 2B24B 4UELA 3B4OA 4IDZA 1CQSA 1SHZC 2K54A 2W9PA 4I55E 2NW7A 5JDQA 3F57A 1QMAA 1AJ3A 3UNLA 2G0UA 3QRDA 1EQKA 2XUEA 3JUPA 3DY5A 3ECFA 2BDEA 3ZMTB 5FP3A 3K0ZA 2QA7A 5A1LA 4HM7B 5IG5A 4ZOLE 3SOAA 3PZWA 2JQ5A 2H7VC 2W61A 1TUHA 3NQZA 4MJDA 2XSOB 2HMMB 4QWTA 2LHNA 3B13A 1LKXA 3ZMUB 4P0AA 4HJLB 4ZI2D 3MJXA 3WA3A 3VF1A 4MFRA 4H9RC 1O7MB 4UVBB 3IEEA 2X9WA 1S94A 2C11A 3I553 3HKBE 2X0LB 4X2OA 2VKHA 3I9WA 1OHOA 2RGQA 1UX4A 5IENA 5HXCA 4Z8XA 4FMBA 1Y4KA 4ZM8A 3JUOA 2QGUA 4FR9A 2K48A 3LJCA 3G16A 3RYCE 1T98A 1QAFA 2CXLA 3FLJA 2HMJB 2W6JH 2NW9A 4K61A 3PE0A 2W62A 5CXOA 2LHRA 4I4KA 1OF5A 4JEUB 2LSKA 2KWIB 2BVLA 4O2BE 1EA2A 1OACA 1HU9A 4NUVA 5L2LA 2WMNA 2QIYA 2VL8A 5AIGA 4HKVB 2X9HA 2I59A 5AYRB 5AIHA 3U3IA 4UV8B 1RJOA 3NV0A 4TX5A 2CKFB 4CI1B 2RFRA 1E3RA 3E0ZA 2V7KA 2XHEB 2XRXB 3BLZA 4EXRA 1QALA 3CMA3 4DMVA 3CPZA 3N9LA 3SRZA 3GA8A 1JV2B 1U5PA 3GMIA 1K734 3RRWA 2LM9A 3T8OA 3CCL3 2Z76A 3EE1A 5LBMA 4OHFA 3WMDA 1WMNA 5IHYA 3GRDA 4EV5A 3SEDA 1S5AA 4AI6A 4N6NB 2NTYA 4XBFB 2ZM8A 1HS7A 1LRZA 3G713 4DBRA 3KIIA 3ZCJA 4QWNB 4ISTA 4UVAB 1MNDA 3QC9A 3FG4A 3EJVA 2HPLA 2C5IT 4NUUA 1V74A 1W6GA 1A67A 1WYBA 2IMJA 3IBPA 5F3JA 3AMOA 3D0TA 4PFOA 3RC3A 2CMRA 5ADXL 2A72A 5J2UE 2A3DA 2RP4A 3V98A 3MK7C 2MOZA 3ZN1B 1W2ZA 4NHFA 3PUAA 1W4NA 2WOHA 1YJ93 4K0UA 4K1UA 4OYJA 2KLQA 3EX9A 5STDA 2F99A 3IHRA 1ZV4X 3F7SA 1E97A 5M4YA 5AIFA 2XQYA 3EDVA 3LXUX 4CDLA 5BXQA 1X79A 3N2KE 2W9QA 4OK0A 4K1VA 2XAJB 3K3OA 1CEWI 3FF2A 2NP9A 1AVKA 3H3HA 4O8SA 2GEYA 1RRHA 2E9XA 3RX6A 4PJNA 3OWSA 1GY6A 1Q814 3HKDE 2XGNA 2IAKA 4G2AA 3NRXA 3K3NA 1NU3A 4GYSA 5L3DB 2I9WA 4ANJA 3F7XA 2CWTA 5CA0E 1VQL3 2KINB 3RGAA 4GYRA 2RA1A 2PNCA 2J1DG 3UUXB 2VKJA 4DVDA 2FGTA 5BVBA 4N6OB 3CQGB 1TU5A 1VQN3 1IJ6A 4UIGA 2EHOA 1GY5A 1OHSA 2LJLA 1VQO3 1MMDA 3CQXC 3WAJA 3N2GE 4C90A 1L5GB 3CU3A 2X9XA 1N5PA 4JEHB 1EZ3A 2Z6BA 1W6CA 2P0XA 2HPJA 1PU4A 5BMVE 1AV4A 4AKIA 3QK9A 1LXEA 5JBSA 1M1XB 4CCVA 3NBJA 4RNZA 4WBNE 3OJAA 2P9BA 1K8A4 1SIHA 2CWVA 3PGBA 1WMPA 1E1HB 2YX9A 5C8YE 2WWUA 3K63A 1A2VA 2FXTA 5D83A 3AA6B 2VB6A 1FGRA 2SBLA 5EK2A 4IIAA 4BTWA 3LFMA 3CQCB 3N54B 5JVDE 5JDHA 3X3XA 1QJGA 4EZ4A 2BO9B 1VQ73 4TZ4C 2CCQA 1DMNA 2DLRA 1IU7A 2CIUA 5JPUA 3DM8A 4KFEA 1YW0A 3W15B 3U1WA 3NZQA 1ULIB 3VKHA 3R84B 3N8BA 3CX6B 4XAXB 3CPOA 4ORLA 5DREA 3OKQA 4WP5A 3KZTA 2D0UA 2JPFA 3ZYMA 2YU2A 1GYBA 2VKOA 2KT9A 3KDSE 1S35A 1UUVB 3WODG 3CD63 1UX5A 5EEOA 3Q90A 1WMOA 2BHMA 3KV4A 5IERA 2MC8A 1BR0A 2IA7A 3K3QC 3ANWB 4B6XA 4AKHA 3LK2B 2D1WA 2ZMAA 5LBQB 3N9NA 1US7B 2CLYB 2IW5B 3GAXA 3MWZA 4LSOA 1FGQA 2ML6A 1KNZA 3X3YA 3AAEB 3NHXA 5J1GA 1U5OA 1ULJB 4WBOA 3UT5E 3RH3A 2CWUA 2E2UA 1OUNA 3NZPA 1LVKA 1IV9A 2KCDA 3A76A 3LTDA 3SOYA 4HN9A 1OF5B 3H3AA 4OYKA 2WMOA 5FYMA 4FCZA 1KSIA 3V5SA 3LT9A 2LYXA 1RN7A 4KVHA 3NV0B 3ZC0A 5JR9A 3VHLA 1W00A 3LT8A 1K9M4 4BJNA 5KP1A 4EBGA 4KMCA 1GY7A 4WFOA 5LHIB 3UUNA 4MALA 2O9UX 3HA4A 1FA3A 1E3VA 4ZHQE 4EXTA 1IVUA 2W04A 1D1BA 4HTEA 4N6LA 4CZZB 3JC6C 5AYSC 3HI7A 2IC9A 2KMFA 2NW8A 2GBXB 4N78D 2LSYA 3ONXA 3DGOA 3N2OA 2XTLA 4IHJE 3SXXA 4YLHA 4FI5A 2NWBA 4ERRA 1C7HA 3GZYB 1U4QA 3J7Yd 2XFSA 2P38A 4CXWA 4UEMA 2LSIA 2GU3A 2F98A 4LZIA 3Q1CA 4YHJA 4R1KA 4O2AE 3PUSA 2D42A 1OGXA 4X2HA 3LZAA 1WRDA 3KFQC 4OUQA 5JR9C 2B1XB 3KSED 1VQ53 2Q07A 1N9JA 5IF6A 2CA5A 2MYSA 2N2NA 4X1YE 4YJ2E 3GZXB 4HM5B 1FUWA 4TX4A 3ANWA 2E9XB 1LOXA 3ZN0B 3T0UA 3N9MA 3ZCIA 4AKRB 3KN4A 4HYZA 3NBXX 3AA1B 2W63A 3EUHA 4H9NC 5EK3A 2KXGA 4ZI2C 1WQLB 4UF0A 5LJNA 1STFI 1G8XA 2D2SA 5LXTE 3LG7A 4XZCA 4H9OC 4AQFC 5KP3A 5TGNA 2W0QA 3C51A 3RDEA 3G4S3 5HXRA 5AEWB 4G63A 3S27A 1HG5A 2P05A 2CFWA 3CC23 2B1EA 5FXVA 1NB3I 1T5YA 4HM8B 4U13A 2JJ9A 4PW8A 5D81A 2QEX3 5F8PA 3EBTA 3T8NA 4WNKA 3CCJ3 3FBLA 2V1LA 3OWUA 2HMLB 4EYUA 2HMKB 4JF8A 2V7MA 3S29A 5HGRA 3R6NA 4O02B 2ML5A 2PFVA 3GN5A 4H61A 3OW22 1Q42A 5DJQC 1EKMA 1VQK3 3ZMVB 2QGSA 1IQ8A 1LVFA 4H9SE 2CFGA 4GOUA 4X1IE 3MKIA 3ZMZB 4K90B 3RYIE 3K5TA 2VASA 1VQ43 4ZS2A 2CXDA 5ELUA 1D6ZA 3WI3A 2WGOA 2LQVA 2W03A 3BNBA 5CF1A 2BMRB 3V92A 5JREA 4Q53A 3DP7A 3D9RA 2ZM2A 5FW5A 5FXWA 1ZEEA 3PURA 3FZWA 3AA0B 1KC84 4X1KE 3DZLA 1W6YA 3O9XA 1IV7A 3ZEFB 5JDNA 1MMAA 4L8PA 1DVDA 2V1DB 3CC43 2YFLB 3UL6A 1CYVA 2L8KA 3KSPA 3OV4A 4HZBB 2XR8B 4DO0A 5E0OA 4NREA 2K5BB 5LP6E 2CFDA 3HL6A 1RRLA 3U97A 1B7TA 2CG0A 3EQQB 1HX8A 1VQP3 2XGLA 2JQQA 3GZBA 1QAKA 1ISKA 2CG1A 3N9OA 2GU1A 2UXNB 3GZRA 3F31A 2XAFB 3LH4A 3HI2A 4UV9B 1JB4A 4P0BA 4XM4A 3UB1A 2MTQA 1HG2A 4CQIA 2BMQB 1YVBI 3NX0A 3UFEA 2X67A 4FMDA 3LBXA 5L3FB 1FGMA 5AFUL 3QUJA 4E7SA 3C50A 1VRBA 2XSHB 3BNEA 2F86B 2C5JA 1VQ63 7STDA 1ZHCA 2LOPA 4E7ZA 3KV6A 2YK0A 4H63V 4RZMA 1DVCA 3DUKA 4N3VA 3IF8B 1MNLA 5JDLA 1NO3A 1KQS2 4J2CA 2CWYA 2DWKA 1TFKA 2JDIH 1LNHA 1FMWA 3N9QA 3MZKB 3NBBA 3PXMA 3S67A 2HH7A 1IQYA 3CCM3 5JRCB 2L4VA 3UULA 1DYUA 4HVNA 4KP3C 4O4JE 5FNVE 4ASKA 5TAOA 3LK42 2CFKA 3OYXA 3AMOB 3ZMSB 1D1CA 1GD3A 3RYHE 4AQFA 1NWMX 2C0SA 4L7KA 3F2EA 2CWOA 2CC3A 3ER7A 3PDYA 4A56A 1D0XA 4JUYA 5LNKA 1WR6A 3AA7B 4XBXA 3ZJ1A 1ASKA 3CPW2 3D3LA 3BK9A 3PU3A 1CYUA 4HZ9B 3MYTA 5HXHA 3CCS3 3KINB 2WBLA 1IZNB 1O7NB 1JB5A 4HM0B 1Q864 3ZJ2A 1W01A 3WOEB 2YU1A 4U72A 2IUJA 1ZKEA 4HEAA 4BTYA 1Q40B 1RKYA 3CMLA 5HAXA 3CWZB 3DJBA 4O4LE 8CHOA 3J9X1 1O7WB 3HK4A 4FMCA 4I4TE 1YHQ3 1QSDA 2PG8A 5HXSA 4GL6A 2UX0A 3FH1A 1JN5A 3CVRA 2JRKA 2CXFA 1Q7Y4 1UW1A 3LMLA 4EZHA 1CUNA 4N6TA 1UUWB 3PUQA 3Q9DA 1ZO2A 3KV5A 3K9MC 1YKHB 2BVMA 3LTCA 4MMYB 3F40A 5CB4E 4O4IE 2M7OA 1MMGA 1IT7A 2V7IA 5DQWA 2CLYC 1NDOB 4JRFA 5JR9B 1FGTA 1A2KA 1OGZA 1OWAA 1IVVA 3B57A 2Z77A 4IE6A 3STDA 2E2TA 4U74A 2STDA 5LHGB 3GWRA 1O7HB 3CX8B 3ZYLA 2ODUA 1SJWA 3O1HA 5FY1A 3NM7A 1OCVA 1UI7A 3AVRA 1DMQA 3LBXB 2GXFA 3JUMA 4RNYA 5HWXA 1JN5B 2WGQA 3C4ZA 4PK6A 2YFJB 1HTJF 1G73A 3S4UA 3BNDA 3RC8A 5JPPA 2Y8DA 4AQGA 4FCMA 1OPYA 2OA5A 1N8R4 5FXZA 3ETVA 1VZZA 3LTAA 4PJLA 3MG1A 4XBTA 1UI8A 2XAGB 5IG4A 1OXZA 4JLEA 5L3GB 4FMAA 5JQGE 3C64A 2LSGA 1YKEB 4PFPA 2XFTA 4M1PA 4P09A 4O2HA 5HXEA 4EV2A 5LA6E 2KNDA 2WAUA 2PBIA 1O7GB 1MIYA 1MIVA 1D0YA 3N5LA 3ZPOA 3EC9A 5EQLA 2LE8A 4ZI3D 3S28A 3I0QA 3TDGA 2XAQB 3WDGB 3I563 4QX8B 2Y48B 4L5GA 5IG0A 3F8HA 4HFVA 5CA1E 3JUNA 3N9HA 4BJMA 2WO0A 2D5UA 1IVXA 3VKGA 1VQ93 1Z0PA 3HIGA 4L0RA 3CCE3 4WW0A 4IE0A 4DNDA 4PK5A 2IC6A 1JB2A 2QA43 4WYKA 2JMHA 3K8PC 3SLUA 3PTRB 2ZLYA 3FG1A 1W02A 3IJEB 3MG3A 1TIJA 5IG3A 5LC6A 3FCSB 3ZLIA 2V7LA 3WOFB 4GB5A 1M1K4 3IPTA 2OWPA 3UUMA 3SS1A 3NQYA 3PU8A 3V5UA 1NWWA 1MIWA 4EIWA 2OQEA 2X68A 1US1A 1KK7A 3LK3B 3X42A 3IMAB 4YJ3E 4LEHA 2XH9A 3NBRA 6STDA 5FY0A 2CHCA 3MPHA 3ALAA 4N6MA 2O3OA 3OYZA 4QKNA 5LCYA 3BQIA 1IQXA 1FIOA 3MA9A 2EHOB 5AI1A 5IEPA 5LHHB 2YFIB 3FXEB 3CNMA 3LYGA 2E8IA 3OX9A 4IIJE 4G1MB 3I9YA 3Q2MA 4IGUA 4H9QC 1M9GA 3KV9A 2UXXB 2NOXA 3MHEA 1KWIA 5KX5E 5I97A 2OOVA 2MBGA 4MEIA 3ESLA 4ZI3C 3FGYA 3CCR3 3O1JA 4PAGA 1O3XA 4QXHB 1W2B2 3DXOA 2JMKA 4PJJA 5CK6A 3FF0A 4EOZB 3LTBA 1IAPA 4EC6A 4R4KA 5CLKA 4IE4A 1YJW3 4H63H 4IE5A 5LGUB 1IT8A 4J9AA 4AKGA 3N9PA 4N6UA 1WYCA 5LGTB 4R9KA 3WA2X 2LOSA 3UJMA 1HCIA 2ES0A 5D82A 1Q40A 1MMNA 3AAAB 2X9YA 4HM1B 1ZX2A 3RRCA 1SPUA 4AKZA 1IDPA 3SX1A 3HIIA 3DTOA 3PS8A 1TP6A 1AR0A 4ZI7E 1WLXA 3DGMA 2ZDJA 4PJMA 3OXAA 1D6UA 5H6QB 1QVG2 2K24A 1QUUA 3Q2PA 5LJMA 4QXCB 5CF2A 2KRTA 4EYYR 3KFWX 4WWUC 3FG3A 2GBWB 4XBYA 1M904 5DRVA 5DABA 1YGEA 4XDWA 4RBNA 1IK3A 2EHOC 5ETWA 2WM9A 4KFDA 4QXBB 1OH0A 4GIWA 1NJI4 4HM2B 2YINA 1OHPA 2VK9A 1J2BA 3KBUA 3NRYA 1MNEA 3H51A 3PCRA 1Z1SA 1JNQA 1D0ZA 1SQWA 5HYAA 1N8QA 1W7CA 3AAIA 4IPBA 2GEXA 2Y74A 2X51A 3SVAA 3NM2A 3OWYA 2H3RA 1IJ5A 3E99A 3A5XA 2CH9A 1ROVA 5FY7A 4DBQA 4HKAA 1KD14 1YI23 2Q9QD 1VOMA 3X41A 2BZBA 3RYFE 4BA9A 4FJOA 3PCSA 1VQM3 1STDA 3FBZA 4FCJA 1S723 4MBQA 1FGOA 4H3UA 3O8YA 4IE7A 1JKGA 3G0KA 3GWHA 4N6V0 4CI3B 2V7JA 1D1AA 4YFSA 3B7CA 3F14A 1YD8G 2Z7AA 4MMZB 2GK9A 3K7CA 2KXPB 5JRCA 4EAHA 5AIIA 2INXA 3X3ZA 2CEAA 1VQ83 3F8XA 2CK3H 2XASB 4UVCB 1WTHA 1AVLA 3CC73 3MG2A 1DMMA 2W2CA 2E9XD 3MSOA 2RCDA 5IEOA 4CI2B 2OCTA 5FMNA 1JKGB 2OQEC 4R80A 3G6E3 3CNXA 4EYCA 2Z6EA 3AVSA 1IVWA 3I0YA 1BR4A 2WOFA 5JDGA 5JH7E 4QX7B 3M8CA 2VKDA 5G2GA 3EVYA 2IUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 3Q5W A;  3NUV A;  4IDQ A;  3LOY A;  1QVF 2;  1PFP A;  1UUG B;  3QK6 A;  4X64 T;  1NB5 I;  4JI2 T;  2BU4 A;  5IYZ E;  5ABF B;  2UXB T;  1LVN A;  5KP4 A;  1K28 A;  3O4X E;  2EHO D;  3FB2 A;  3TLT A;  3WAK A;  5JDM A;  5EZY E;  3BNC A;  4J8T A;  2BG9 E;  3QB5 K;  1RSN A;  1NAF A;  2BG9 B;  3JC6 D;  1GOU A;  3BQL A;  5EK4 A;  2KZ7 B;  1BR1 A;  2NTX A;  1SA0 E;  3M65 A;  2MAW A;  5KDM C;  2HMO B;  2XEP A;  3KVB A;  2OOV C;  4X66 T;  1E7P A;  4QH5 A;  4I50 E;  4X20 E;  1HFA A;  3AED A;  2PZV A;  1JJ2 2;  4LF8 T;  2VWA A;  1HR0 T;  1WNH A;  2XAH B;  4TUY E;  2BT3 A;  2CFL A;  2W56 A;  3QB5 A;  4EB6 E;  3F9S A;  3MKD A;  4OFZ A;  2MPK A;  1R4C A;  3HKE E;  5L4H A;  3EHC A;  1SII A;  3G06 A;  2YEV C;  1BUQ A;  5ELJ A;  2WDV A;  2FBW A;  3EDU A;  3PJA J;  4YTN A;  1BNE A;  1GOV A;  4KFF A;  3E08 A;  1YIJ 3;  2C10 A;  4WYK B;  4ZXL A;  2E2V A;  2Q9Q C;  2P0M A;  4UXN B;  2F5M A;  3EN8 A;  3PUG A;  3PUX F;  1TTO A;  4AKL A;  5FGO A;  2W0G A;  1BU4 A;  3G8Z A;  1BNJ A;  5HWY A;  4L9I A;  1D6Y A;  4V1A v;  2KF4 A;  4HWC A;  1V9D A;  3MAC A;  1GD4 A;  2CE7 A;  2P09 A;  4MHC A;  1T2I A;  1LRA A;  2MF7 A;  2Y6X A;  3CX7 B;  3AXJ B;  2H7O A;  1N33 T;  4B3T T;  4Z91 A;  2K9A A;  4QHO A;  2SPC A;  4PEJ A;  3LSV A;  1BRS A;  3ZC1 A;  2I6H A;  2PJQ A;  1JZD A;  4HM4 B;  1UCU A;  3E22 E;  3P7I A;  4BTX A;  2BMO B;  5RNT A;  1GS3 A;  3UU4 A;  3ZT5 A;  4HFH A;  1Y64 B;  3I1A A;  4JI4 T;  3JVC A;  3U78 A;  3OBV E;  3TKL B;  2WSS V;  1BRG A;  3RKO A;  1A90 A;  2E9X C;  1TFO A;  3KBT A;  4CXY A;  3RPU A;  4R9L A;  3FSD A;  4ISS A;  3PUZ F;  5GON E;  2LT3 A;  5L3E B;  1BR2 A;  2XQA A;  5KMG P;  3GN5 B;  4BL2 A;  3HZP A;  1KEY A;  2V26 A;  2ODV A;  1H7C A;  2M67 A;  3VGN A;  4KBM B;  1O7P B;  4I43 B;  4AKY A;  1FEW A;  3EN1 B;  3DGN A;  4TNV A;  2W56 B;  4STD A;  3KVA A;  5L3C B;  3RGR A;  5FVK A;  4AXP A;  2LEH A;  1EG9 B;  3VU7 H;  3AB3 B;  4H9P C;  4DID B;  4HM3 B;  2HMN B;  1Q9E A;  1F8N A;  5IW9 A;  2L3L A;  3L39 A;  4HM6 B;  4Z90 A;  5AQV B;  3UL5 A;  3HX8 A;  3O1I A;  4XB5 A;  2KWH A;  2CW9 A;  3CKD A;  4CPK A;  3KKG A;  3B8L A;  2DHR A;  4U3C A;  3FZK B;  4AEQ A;  2WS3 A;  1HX1 B;  3DMC A;  3NXJ A;  2LSJ A;  3FHN A;  1IBK T;  3RIU C;  5H6R B;  4C91 A;  4XDV A;  5LOV E;  3SOL A;  1HKX A;  4UF0 B;  3ZYK A;  5L3B B;  2V8S V;  3CXC 2;  2CHN A;  1ZGX A;  2DNX A;  3L0R A;  1YNV X;  3BB9 A;  1G96 A;  4ZS3 A;  3JAE A;  3C4X A;  4KZ1 A;  4WHA A;  3ETU A;  4TN7 B;  1X1W A;  4IT7 A;  3V99 A;  3UTK A;  4YSZ A;  4HBR A;  3CCV 3;  2ZL8 A;  3EBY A;  2DI4 A;  2N1G A;  3EB8 A;  1N9E A;  2VL0 A;  4TV8 E;  2N9D A;  2FNQ A;  2C5K T;  3PYJ A;  3HKC E;  4DV6 T;  3X40 A;  2Y73 A;  2ZM0 A;  5LG4 A;  4BAY B;  3Q5D A;  3BU4 A;  4PK4 A;  5EVH A;  3ROB A;  1YIT 3;  2JQH A;  2X66 A;  3SWH A;  3DGL A;  4TV9 E;  3EF8 A;  5LC7 A;  1JNR A;  2A2F X;  3C4W A;  2DWG A;  4L8O A;  4HWI B;  4P1N A;  5JDF A;  5AQP B;  2L9Q A;  4HGA A;  5AEU B;  2OTL 3;  2OTJ 3;  4F6R C;  3PUY F;  4GK0 E;  1W0B A;  2XQ7 A;  3SFE A;  4ADZ A;  4HE8 A;  4A5X A;  1EEJ A;  2CM0 A;  2LKG A;  1ROA A;  4GK5 E;  8RNT A;  2ZHX B;  4LGQ A;  4LMI A;  3L09 A;  3UU8 A;  2KAA A;  1GMR A;  3CCU 3;  3B4P A;  1N5H A;  1JRQ A;  2XQ9 A;  4MMX B;  5LGN B;  4ILU A;  2V6Y A;  1RTU A;  3VSY A;  3ZT6 A;  1UGI A;  3BQK A;  4JI8 T;  2BNG A;  3J7Y q;  3C98 B;  4JBW F;  1I0V A;  3Q5X A;  4DMW A;  1U8C B;  1T72 A;  4KUM B;  1I3I A;  1YJN 3;  2DCF A;  1Q82 4;  5IWA T;  1R8I A;  3MXZ A;  5J2T E;  2K0M A;  1MOL A;  4CXX A;  1W5Z A;  4O3V A;  2XQ5 A;  1T8B A;  1K41 A;  2K3W A;  3CME 3;  3AE7 A;  1RDS A;  3HR0 A;  4O4H E;  5LYJ E;  3L3P A;  4HWD A;  2RSX A;  5AQQ B;  1W0A A;  3EHZ A;  1FMV A;  1HF8 A;  4DV4 T;  1NEK A;  3H37 A;  3X1D A;  5DQV A;  2LM2 A;  2D0T A;  3P8C D;  4TWH A;  3S5C A;  3KE7 A;  5FXX A;  2XF3 A;  4OVM A;  2ACX A;  1MWU A;  2R4I A;  5FKY A;  5A0O B;  2H0I A;  4LMK A;  2Q9Q A;  3FKA A;  2R41 A;  3JUQ A;  3T8U A;  4BL3 A;  4PNI A;  3FXD B;  3FZM B;  4U7Y A;  1RN1 A;  2A15 A;  2VQE T;  2Q9Q B;  2W00 A;  3CCQ 3;  4MLK A;  3SYU A;  3I0O A;  2SAR A;  1OED E;  2B24 B;  4UEL A;  3B4O A;  4IDZ A;  5CJ5 A;  1CQS A;  1SHZ C;  4CN1 A;  2K54 A;  2W9P A;  2M6I A;  2UXC T;  2RBI A;  4I55 E;  2E5L T;  2NW7 A;  5JDQ A;  1BIR A;  3F57 A;  1QMA A;  1AJ3 A;  3EAB A;  3OPC A;  3UNL A;  2G0U A;  4X65 T;  3QRD A;  1EQK A;  2XUE A;  3M3Z B;  3JUP A;  3ZST A;  1MWS A;  3DY5 A;  3ECF A;  4QH1 A;  4DV5 T;  2BDE A;  2RPA A;  5BIR A;  3ZMT B;  5FP3 A;  3K0Z A;  2V6X A;  2QA7 A;  5A1L A;  1BNS A;  4HM7 B;  5IG5 A;  4K0K T;  4ZOL E;  3SOA A;  3PZW A;  5HEH A;  3L8R A;  2JQ5 A;  1Z8U A;  1UGH I;  2H7V C;  2CHO A;  2W61 A;  1TUH A;  3NQZ A;  4MJD A;  2XSO B;  2HMM B;  1BRH A;  2LHN A;  3B13 A;  4P0A A;  1LKX A;  3ZMU B;  4QWT A;  2IUB A;  4HJL B;  4ZI2 D;  3MJX A;  3WA3 A;  1I2G A;  3AEA A;  3VF1 A;  4MFR A;  1KF6 A;  4H9R C;  1O7M B;  3RLF F;  4UVB B;  5CFB A;  3IEE A;  2X9W A;  5M19 A;  1S94 A;  2C11 A;  3I55 3;  3HKB E;  2X0L B;  2JQ9 A;  4X2O A;  5AQJ B;  3PV0 F;  2VKH A;  3I9W A;  1OHO A;  2RGQ A;  1UX4 A;  5IEN A;  2WQY A;  5HXC A;  4Z8X A;  4FMB A;  1Y4K A;  4ZM8 A;  3JUO A;  2QGU A;  4FR9 A;  2K48 A;  3LJC A;  3G16 A;  3RYC E;  1T98 A;  1QAF A;  2CXL A;  3FLJ A;  2HMJ B;  5AQO B;  2W6J H;  2NW9 A;  4ILA A;  4K61 A;  2FJB A;  3PE0 A;  2W62 A;  3VR9 A;  2LHR A;  1OF5 A;  4I4K A;  5CXO A;  2BKN A;  4JEU B;  2LSK A;  2KWI B;  4ZEY A;  2BVL A;  4O2B E;  1EA2 A;  1OAC A;  3D79 A;  1HU9 A;  1V57 A;  4NUV A;  5L2L A;  2WMN A;  2QIY A;  3FZH B;  2VL8 A;  5AIG A;  4HKV B;  1XDP A;  2X9H A;  2I59 A;  2QRX A;  3ZFZ A;  5AYR B;  1CH0 A;  1CHU A;  5AIH A;  4QH4 A;  3U3I A;  4UV8 B;  1RJO A;  1RCL A;  3NV0 A;  4TX5 A;  2CKF B;  4CI1 B;  1BVI A;  2RFR A;  1E3R A;  3E0Z A;  4JI3 T;  2V7K A;  2XHE B;  2XRX B;  3BLZ A;  1LOV A;  1XWM A;  4EXR A;  2VVN A;  1QAL A;  3CMA 3;  4DMV A;  1RGA A;  2HN2 A;  3CPZ A;  3N9L A;  1X1X A;  1MWT A;  2ZA4 A;  3SRZ A;  3GA8 A;  1JV2 B;  1U5P A;  3GMI A;  1K73 4;  3RRW A;  2LM9 A;  3T8O A;  3CCL 3;  5FL0 A;  5HEU A;  2BKP A;  2Z76 A;  1IBM T;  3EE1 A;  5LBM A;  4OHF A;  3WMD A;  1I70 A;  4JI0 T;  1WMN A;  5IHY A;  3GRD A;  4EV5 A;  3SED A;  4NIQ A;  1S5A A;  4AI6 A;  4BIR A;  4N6N B;  2J8X B;  1RCK A;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  3NKZ A;  1LRZ A;  3G71 3;  5AQU B;  4DBR A;  3VR8 A;  1W09 A;  3ZCJ A;  3KII A;  4UVA B;  4IST A;  4QWN B;  3AEB A;  1MND A;  3AE5 A;  3QC9 A;  3FG4 A;  1OED C;  3EJV A;  2QVA A;  2HPL A;  2C5I T;  4NUU A;  3AEC A;  1V74 A;  4YTM A;  1YXR A;  1W6G A;  1A67 A;  1WYB A;  3BIR A;  2IMJ A;  5M1A A;  3RGL A;  3IBP A;  5F3J A;  1V58 A;  3AMO A;  3D0T A;  4AIU A;  4PFO A;  3RC3 A;  5ABE A;  2CMR A;  5ADX L;  2A72 A;  5J2U E;  2A3D A;  5M18 A;  2RP4 A;  1SUM B;  3V98 A;  1RGC A;  3MK7 C;  5C3J A;  3RIF A;  2YDS A;  2MOZ A;  3ZN1 B;  5ABH A;  4ILF A;  1W2Z A;  4NHF A;  3PUA A;  1W4N A;  2WOH A;  1YJ9 3;  4K0U A;  3UU5 A;  4K1U A;  3WR2 A;  2UUG C;  5AQN B;  4OYJ A;  2KLQ A;  2I0M A;  3EX9 A;  5STD A;  2F99 A;  1JNZ A;  4ILC A;  3IHR A;  1ZV4 X;  3F7S A;  2A9U A;  1E97 A;  5M4Y A;  2WDR A;  1AY7 A;  5AIF A;  2XQY A;  3EDV A;  3LXU X;  4CDL A;  1UGO A;  3TLW A;  5BXQ A;  1X79 A;  3N2K E;  2W9Q A;  1JBR A;  4OK0 A;  1UCK A;  1T2H A;  3RNT A;  4K1V A;  2XAJ B;  3K3O A;  1CEW I;  3FF2 A;  5AQF B;  2NP9 A;  1AVK A;  1DET A;  2HOH A;  4LFA T;  3H3H A;  4O8S A;  2GEY A;  1MGW A;  3OTO T;  2XPK A;  4NPP A;  4B3M T;  1RRH A;  2E9X A;  4HFB A;  3RX6 A;  4PJN A;  3OWS A;  1GY6 A;  1Q81 4;  3HKD E;  2XGN A;  1I6Z A;  2IAK A;  4G2A A;  3NRX A;  5KXJ A;  2BS4 A;  3K3N A;  1B2Z A;  1NU3 A;  4GYS A;  5L3D B;  3ZG5 A;  2I9W A;  4ANJ A;  3F7X A;  2CWT A;  3AGN A;  5CA0 E;  1LQM B;  1VQL 3;  1J1J A;  2KIN B;  3RGA A;  1RHL A;  4GYR A;  2RA1 A;  2PNC A;  2J1D G;  3UUX B;  2VKJ A;  4DVD A;  1RN4 A;  1E2A A;  4WYV A;  2CPT A;  1T7S A;  2FGT A;  5BVB A;  4N6O B;  3CQG B;  1TU5 A;  1VQN 3;  4NXN T;  1IJ6 A;  4UIG A;  2EHO A;  5JTG A;  1GY5 A;  1OHS A;  2LJL A;  1VQO 3;  1MMD A;  3CQX C;  2OLT A;  3WAJ A;  3N2G E;  4LF5 T;  4C90 A;  1L5G B;  3H3M A;  3CU3 A;  2X9X A;  1N5P A;  4JEH B;  1EZ3 A;  2Z6B A;  1TRP A;  1W6C A;  2P0X A;  2XM2 A;  2HPJ A;  3P4Q A;  1PU4 A;  5BMV E;  1AV4 A;  4AKI A;  3QK9 A;  1LXE A;  5JBS A;  2WZI A;  1M1X B;  4CCV A;  3NBJ A;  2AAE A;  3PUV F;  4RNZ A;  4WBN E;  3D5I A;  1B2U A;  3OJA A;  2P9B A;  1UUS A;  1K8A 4;  4RNT A;  1SIH A;  2M6B A;  3RKG A;  2RNT A;  3HOH A;  2CWV A;  3PGB A;  1WMP A;  1E1H B;  2YX9 A;  2YDQ A;  3ONJ A;  5C8Y E;  1J5W A;  3JAF A;  1RGH A;  2WWU A;  1QLB A;  3K63 A;  1A2V A;  2FXT A;  5D83 A;  3FZF B;  1BAO A;  4LF4 T;  3AA6 B;  2VB6 A;  3AEE A;  1FGR A;  2SBL A;  5EK2 A;  1I2E A;  1M62 A;  4IIA A;  2WCA A;  1X9B A;  4BTW A;  3LFM A;  3CQC B;  3N54 B;  5JVD E;  5JDH A;  5G1K A;  3X3X A;  1HYF A;  1QJG A;  4EZ4 A;  2BO9 B;  1VQ7 3;  4TZ4 C;  2CCQ A;  5AQG B;  1FUT A;  1DMN A;  2DLR A;  1IU7 A;  2CIU A;  5JPU A;  3DM8 A;  2NR4 A;  4KFE A;  4B3R T;  1YW0 A;  3W15 B;  1I94 T;  3U1W A;  3NZQ A;  1FYS A;  1ULI B;  3VKH A;  1XNR T;  3R84 B;  3N8B A;  2H89 A;  3CX6 B;  4XAX B;  2FJA A;  3CPO A;  4ORL A;  5DRE A;  5FL1 A;  3OKQ A;  1YQ3 A;  4WP5 A;  3KZT A;  4U33 A;  2D0U A;  2JPF A;  5LMN T;  4UR9 A;  3ZYM A;  4LYL B;  1YQ4 A;  2YU2 A;  1BSD A;  1GYB A;  2VKO A;  2KT9 A;  3KDS E;  2F56 A;  5BU4 A;  1HZ1 A;  1S35 A;  1UUV B;  3WOD G;  3CD6 3;  1UX5 A;  5EEO A;  3Q90 A;  1WMO A;  2BHM A;  3KV4 A;  1FZU A;  5IER A;  2MC8 A;  1BSC A;  1BR0 A;  2IA7 A;  3K3Q C;  3ANW B;  4B6X A;  4AKH A;  4EGW A;  3AHW A;  1XMQ T;  3LK2 B;  2D1W A;  2ZMA A;  5LBQ B;  5BR8 T;  1IYY A;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  3GAX A;  3MWZ A;  4LSO A;  1FGQ A;  1RGK A;  2ML6 A;  1KNZ A;  3X3Y A;  3AAE B;  3NHX A;  5J1G A;  1N36 T;  1U5O A;  1ULJ B;  2X0H A;  1VQQ A;  4WBO A;  3UT5 E;  2YKS A;  3RH3 A;  1NNV A;  2CWU A;  2E2U A;  2X0Y A;  1OUN A;  3NZP A;  1LVK A;  1IV9 A;  2KCD A;  3A76 A;  3LTD A;  3SOY A;  4HN9 A;  3TLV A;  1OF5 B;  3H3A A;  4OYK A;  2WMO A;  5FYM A;  1GMQ A;  4FCZ A;  5LMU T;  1KSI A;  3V5S A;  2H88 A;  3LT9 A;  2LYX A;  1RN7 A;  1UUR A;  4JI6 T;  2UUA T;  2AE9 A;  4KVH A;  2BG9 A;  3ZC0 A;  3NV0 B;  5JR9 A;  3VHL A;  1W00 A;  2OV9 A;  3LT8 A;  1K9M 4;  2L1S A;  4BJN A;  5KP1 A;  2QYW A;  1C54 A;  4EBG A;  4KMC A;  1GY7 A;  4WFO A;  5LHI B;  3UUN A;  4MAL A;  2O9U X;  3HA4 A;  3TLU A;  1FA3 A;  3LDQ B;  2UUC T;  3AE6 A;  4ILB A;  1E3V A;  4ZHQ E;  4EXT A;  1IVU A;  1UDI I;  3P50 A;  5HEG A;  2W04 A;  1D1B A;  4HTE A;  4N6L A;  4CZZ B;  3JC6 C;  5AYS C;  3HI7 A;  5IUX A;  2IC9 A;  2KMF A;  2NW8 A;  2WDQ A;  2H0H A;  3UQ7 A;  2V6Y B;  2GBX B;  4N78 D;  2LSY A;  3ONX A;  4DR5 T;  3DGO A;  4CN6 A;  5GSP A;  3N2O A;  2XTL A;  2XZE A;  4IHJ E;  3SXX A;  4YLH A;  1BSE A;  4FI5 A;  1UK5 A;  2IHR 1;  2NWB A;  2WZH A;  4ERR A;  2XJ7 A;  1C7H A;  3GZY B;  1U4Q A;  3J7Y d;  2XFS A;  3P4W A;  1G0T A;  3UU3 A;  5LG3 A;  2P38 A;  4CXW A;  1B2X A;  3D4A A;  4UEM A;  2LSI A;  2GU3 A;  2F98 A;  4LZI A;  3Q1C A;  4YHJ A;  4HOH A;  4R1K A;  4O2A E;  3EI0 A;  4KT3 B;  3K1S A;  2FJE A;  3P4R A;  3PUS A;  1BSA A;  2D42 A;  4LF7 T;  3ZKR A;  1OGX A;  5HEJ A;  4X2H A;  3LZA A;  4DR6 T;  1WRD A;  1RGG A;  3KFQ C;  1RGE A;  4OUQ A;  5JR9 C;  2B1X B;  3KSE D;  1VQ5 3;  2Q07 A;  1N9J A;  4NPB A;  5IF6 A;  2CA5 A;  2MYS A;  2N2N A;  2XSA A;  4X1Y E;  1MWR A;  4YJ2 E;  1UCI A;  3GZX B;  4HM5 B;  1FUW A;  4TX4 A;  3ANW A;  2E9X B;  1LOX A;  3ZN0 B;  3T0U A;  3N9M A;  3ZCI A;  4AKR B;  3KN4 A;  4HYZ A;  3NBX X;  3AA1 B;  2W63 A;  3KCH A;  3EUH A;  1WCR A;  1B2M A;  4H9N C;  5EK3 A;  4ZI2 C;  1WQL B;  4Q25 A;  4UF0 A;  5LJN A;  1Q7H A;  2KXG A;  1STF I;  4F8H A;  2DL1 A;  1G8X A;  3A7M A;  1BGS A;  2D2S A;  5LXT E;  3LG7 A;  4LML A;  4XZC A;  4H9O C;  4AQF C;  4HWH A;  5KP3 A;  5TGN A;  2W0Q A;  9RNT A;  3C51 A;  1HNX T;  2WU2 A;  3RDE A;  4I0U A;  4DR3 T;  3G4S 3;  1BUJ A;  1WR0 A;  5HXR A;  5AEW B;  4G63 A;  3S27 A;  1HG5 A;  1ZP0 A;  2P05 A;  2CFW A;  3NWI A;  3CC2 3;  2B1E A;  5FXV A;  1FUS A;  1NB3 I;  1T5Y A;  4HM8 B;  4U13 A;  2JJ9 A;  4PW8 A;  5D81 A;  2QEX 3;  2F4V T;  5F8P A;  3EBT A;  3T8N A;  2XQ4 A;  4WNK A;  3CCJ 3;  2BG9 C;  3FBL A;  2V1L A;  3OWU A;  2HML B;  4EYU A;  2HMK B;  2XSB A;  4JF8 A;  1YGW A;  1T3B A;  2V7M A;  3S29 A;  5HGR A;  1RMS A;  3R6N A;  4O02 B;  2ML5 A;  1J5E T;  4CN4 A;  4KHP T;  1KNR A;  1XMO T;  2PFV A;  3GN5 A;  4H61 A;  1JBS A;  3OW2 2;  1Q42 A;  5DJQ C;  1EKM A;  5L4E A;  3ZMV B;  2QGS A;  1VQK 3;  4IT4 A;  1IQ8 A;  1LVF A;  4H9S E;  2CFG A;  3ZSS A;  4GOU A;  4X1I E;  1LOY A;  3MKI A;  3ZMZ B;  1BNF A;  4K90 B;  3RYI E;  2KSR A;  2VAS A;  3K5T A;  1VQ4 3;  4ZS2 A;  2CXD A;  5ELU A;  1D6Z A;  3WI3 A;  2WGO A;  2LQV A;  2W03 A;  2VVS A;  3BNB A;  1I0X A;  5CF1 A;  4IDN A;  2BMR B;  3V92 A;  5JRE A;  2HN1 A;  4Q53 A;  4TWD A;  3DP7 A;  3D9R A;  2ZM2 A;  5FW5 A;  2BKO A;  3RIA A;  3AXJ A;  5FXW A;  1ZEE A;  3PUR A;  5HCJ A;  3AA0 B;  3FZW A;  2W2U A;  1KC8 4;  4DV3 T;  4X1K E;  3DZL A;  1TRQ A;  1W6Y A;  3O9X A;  1RNT A;  1IV7 A;  3ZEF B;  2CBJ A;  5JDN A;  1MMA A;  5AQI B;  4L8P A;  1DVD A;  2V1D B;  3CC4 3;  2YFL B;  4YHH T;  3UL6 A;  1CYV A;  2L8K A;  3KSP A;  3OV4 A;  2IYJ A;  2E5V A;  4HZB B;  1DE3 A;  2XR8 B;  4DO0 A;  2E2A A;  5E0O A;  1EUI C;  4NRE A;  2K5B B;  3OVU A;  5LP6 E;  2CFD A;  2XQ6 A;  3HL6 A;  1RRL A;  3U97 A;  1B7T A;  2CG0 A;  3EQQ B;  1BRJ A;  4IDP A;  4BU4 A;  1HX8 A;  2W4X A;  1VQP 3;  2XGL A;  2JQQ A;  3GZB A;  2J62 A;  1QAK A;  1ISK A;  1FJG T;  2CG1 A;  3FZL B;  3N9O A;  2GU1 A;  2UXN B;  3GZR A;  3F31 A;  4X62 T;  4HWF A;  2XAF B;  3LH4 A;  3HI2 A;  4UV9 B;  4KX6 A;  1JB4 A;  4P0B A;  2K3D A;  2B76 A;  4XM4 A;  3DH2 A;  3UB1 A;  2MTQ A;  1HG2 A;  3URP A;  4CQI A;  2BMQ B;  4YXD A;  1YVB I;  1B20 A;  3NX0 A;  3UFE A;  2X67 A;  2YN6 A;  4HFD A;  1PY3 A;  4FMD A;  2AXD S;  3LBX A;  5L3F B;  1FGM A;  5AFU L;  3QUJ A;  4GSP A;  4AQY T;  4E7S A;  2PTF A;  3A5E A;  3C50 A;  1VRB A;  1OED A;  2XSH B;  1N34 T;  3BNE A;  2F86 B;  2C5J A;  1VQ6 3;  7STD A;  1ZHC A;  2LOP A;  7RNT A;  4E7Z A;  2F4Y A;  3KV6 A;  1JZO A;  2LRK A;  2YK0 A;  1R4Y A;  4H63 V;  1YVS A;  4RZM A;  2XQ3 A;  2F5W A;  1DVC A;  3DUK A;  4EED A;  4DUZ T;  4N3V A;  3IF8 B;  1MNL A;  4YSY A;  5JDL A;  4ZZB A;  1NO3 A;  1KQS 2;  3ABV A;  4J2C A;  2CWY A;  2DWK A;  1TFK A;  2JDI H;  1LNH A;  1Y01 A;  1FMW A;  3N9Q A;  3MZK B;  3NBB A;  3PXM A;  3S67 A;  2HH7 A;  1IQY A;  1BRN L;  3CCM 3;  5JRC B;  2BS3 A;  3PJA A;  2L4V A;  3UUL A;  1DYU A;  1LNI A;  4HVN A;  4KP3 C;  4O4J E;  1RNB A;  5AQT B;  5FNV E;  2C4B A;  4ASK A;  5TAO A;  3LK4 2;  2CFK A;  3OYX A;  4YSX A;  3AMO B;  1BNR A;  2IDO B;  4HAA A;  3ZMS B;  5AQS B;  1D1C A;  1GD3 A;  3RYH E;  4AQF A;  1NWM X;  2C0S A;  2UUB T;  4L7K A;  3AE9 A;  3F2E A;  2KF3 A;  1I2F A;  2CWO A;  3PUW F;  1NEN A;  2CC3 A;  3ER7 A;  3PDY A;  4A56 A;  1D0X A;  4JUY A;  5LNK A;  1WR6 A;  3AA7 B;  1BNI A;  4XBX A;  2V5D A;  3ZJ1 A;  3RQW A;  1ASK A;  3CPW 2;  3D3L A;  3BK9 A;  3PU3 A;  4YTP A;  1CYU A;  4HZ9 B;  3MYT A;  4DUY T;  5HXH A;  3P4S A;  2LLY A;  3CCS 3;  2JQK A;  3KIN B;  2ZM6 T;  2WBL A;  1IZN B;  1O7N B;  1LQG C;  1JB5 A;  4HM0 B;  5ABF A;  2BIR A;  3AEF A;  1Q86 4;  1I8V A;  3ZJ2 A;  3SFD A;  1W01 A;  3WOE B;  4NXM T;  2YU1 A;  4U72 A;  2IUJ A;  1ZKE A;  4HEA A;  3JCF A;  4DV1 T;  2WB5 A;  1B21 A;  4BTY A;  3AE8 A;  1Q40 B;  1GMP A;  1RKY A;  3CML A;  1RLS A;  5HAX A;  3CWZ B;  3DJB A;  4O4L E;  3Q3F A;  8CHO A;  3J9X 1;  1O7W B;  3HK4 A;  4I4T E;  2W66 A;  4FMC A;  2XY8 B;  1YHQ 3;  1QSD A;  3A8Y C;  2PG8 A;  5HXS A;  4GL6 A;  2UX0 A;  3FH1 A;  1JN5 A;  3CVR A;  2JRK A;  2CXF A;  2LRL A;  1Q7Y 4;  4JI5 T;  1UW1 A;  3LML A;  1I3F A;  4EZH A;  1CUN A;  2CRB A;  4N6T A;  1UUW B;  2KF5 A;  4GKK T;  3RF1 A;  3PUQ A;  3Q9D A;  1ZO2 A;  3KV5 A;  4IDO A;  3DGY A;  3K9M C;  1YKH B;  2BVM A;  3LTC A;  4MMY B;  3F40 A;  5CB4 E;  4O4I E;  2M7O A;  1MMG A;  1IT7 A;  4DR1 T;  2V7I A;  1XDO A;  5DQW A;  2CLY C;  1NDO B;  2IY2 A;  4IRE A;  4JRF A;  3UUB A;  5JR9 B;  1FGT A;  1A2K A;  1OGZ A;  1IVV A;  1OWA A;  3B57 A;  2Z77 A;  2YOE A;  4IE6 A;  3T1H T;  1A2P A;  3STD A;  2E2T A;  2H0G A;  4U74 A;  2STD A;  2VUR A;  5LHG B;  3GWR A;  1O7H B;  3ZG0 A;  3CX8 B;  3ZYL A;  1N32 T;  1B27 A;  2ODU A;  3RQU A;  5AQH B;  1SJW A;  3CK6 A;  3O1H A;  4HFE A;  4JYA T;  5FY1 A;  3NM7 A;  1OCV A;  1UI7 A;  3AVR A;  1DMQ A;  3LBX B;  2GXF A;  3JUM A;  4RNY A;  5HWX A;  1JN5 B;  2WGQ A;  3C4Z A;  4PK6 A;  2WP9 A;  2YFJ B;  1HTJ F;  1HNZ T;  1G73 A;  5FVL A;  3S4U A;  1RGF A;  3BND A;  1ZS7 A;  3RC8 A;  2D9D A;  4YT0 A;  4KHZ F;  5JPP A;  2Y8D A;  4AQG A;  4FCM A;  1OPY A;  2IML A;  4U7I A;  2OA5 A;  3D5G A;  1N8R 4;  5FXZ A;  3ETV A;  1VZZ A;  4WZX A;  2WY2 A;  3LTA A;  4PJL A;  2J47 A;  3MG1 A;  5C2T A;  4XBT A;  4J5G A;  1UI8 A;  5HEO A;  1L0V A;  3UFG A;  3GSP A;  2XAG B;  5IG4 A;  1OXZ A;  4COF A;  4JLE A;  5L3G B;  4FMA A;  5JQG E;  4J5K A;  3C64 A;  1BRI A;  6RNT A;  2LSG A;  1YKE B;  4PFP A;  2XFT A;  4M1P A;  4P09 A;  4DKI A;  1X1U A;  4O2H A;  5HXE A;  4EV2 A;  5LA6 E;  1SAR A;  2KND A;  2WAU A;  1LOW A;  1FW7 A;  2PBI A;  1O7G B;  1MIY A;  1MIV A;  1D0Y A;  3N5L A;  3ZPO A;  3EC9 A;  5EQL A;  2LE8 A;  4ZI3 D;  3S28 A;  3I0Q A;  3TDG A;  3RHW A;  2CX1 A;  2XAQ B;  1GOY A;  3WDG B;  3I56 3;  4I5Q A;  4QX8 B;  2J4G A;  3UQ4 A;  2Y48 B;  4L5G A;  5LB7 B;  5AQR B;  5IG0 A;  1VCS A;  3F8H A;  5CA1 E;  4HFV A;  3JUN A;  4GHO A;  3N9H A;  4BJM A;  3IA3 A;  1B2S A;  2WO0 A;  4DR7 T;  2D5U A;  2IIU A;  1IVX A;  3VKG A;  4TWF A;  1VQ9 3;  1Z0P A;  3HIG A;  4L0R A;  3CCE 3;  4OX9 T;  4WW0 A;  2UXD T;  4LF6 T;  1SE7 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  1JB2 A;  2QA4 3;  4WYK A;  2JMH A;  3K8P C;  4IL9 A;  3SLU A;  4ZZC A;  3AHS A;  3PTR B;  2ZLY A;  1PYL A;  3FG1 A;  3EAM A;  2R6G F;  1W02 A;  3IJE B;  3MG3 A;  1TIJ A;  5IG3 A;  5LC6 A;  3CIR A;  2BBH A;  2FUP A;  4EW5 A;  1UCJ A;  3FCS B;  1GSP A;  4JI7 T;  2W67 A;  1JBT A;  3ZLI A;  2V7L A;  3WOF B;  4GB5 A;  1M1K 4;  3IPT A;  1X1Y A;  2OWP A;  3UUM A;  1BAN A;  3SS1 A;  5ABG A;  3ONL C;  3NQY A;  3PU8 A;  3V5U A;  1NWW A;  5AQM B;  1MIW A;  4EIW A;  2OQE A;  2X68 A;  1US1 A;  3Q5E A;  1KK7 A;  3LK3 B;  3X42 A;  3IMA B;  4YJ3 E;  4LEH A;  2XH9 A;  3NBR A;  6STD A;  2BS2 A;  5FY0 A;  2CHC A;  3MPH A;  2WU5 A;  3ALA A;  4N6M A;  2O3O A;  3OYZ A;  1BNG A;  4DV2 T;  4QKN A;  5LCY A;  3BQI A;  1IQX A;  1FIO A;  3P4P A;  5J0Z A;  3MA9 A;  2EHO B;  4CJN A;  5AI1 A;  5IEP A;  5LHH B;  2YFI B;  5G1L A;  3FXE B;  3CNM A;  3LYG A;  4TNW A;  4KI0 F;  1TJD A;  1BOX A;  1W9R A;  2E8I A;  3AGO A;  3OX9 A;  4IIJ E;  4G1M B;  3I9Y A;  3Q2M A;  4IGU A;  4GKJ T;  4H9Q C;  3QOF A;  1M9G A;  3KV9 A;  2UXX B;  2GSP A;  2NOX A;  5AQK B;  1KWI A;  3MHE A;  3AE2 A;  3NVO A;  5KX5 E;  5I97 A;  2OOV A;  2MBG A;  4MEI A;  6GSP A;  1KNP A;  3ESL A;  4LFC T;  4ZI3 C;  3FGY A;  3CCR 3;  3O1J A;  4PAG A;  1O3X A;  4QXH B;  1W2B 2;  3DXO A;  2JMK A;  4PJJ A;  5CK6 A;  3FF0 A;  4EOZ B;  2KF6 A;  4LFB T;  2UGI A;  1IAP A;  3LTB A;  4EC6 A;  4R4K A;  5CLK A;  4IE4 A;  1YJW 3;  4H63 H;  4IE5 A;  5LGU B;  1IT8 A;  4J9A A;  4AKG A;  3N9P A;  4N6U A;  1B3S A;  4IL4 A;  1WYC A;  4HFC A;  5LGT B;  4R9K A;  3WA2 X;  2LOS A;  3UJM A;  1HCI A;  2ES0 A;  5D82 A;  1Q40 A;  1MMN A;  3AAA B;  2X9Y A;  4HM1 B;  1ZX2 A;  3RRC A;  1SPU A;  4AKZ A;  1IDP A;  2XM1 A;  3SX1 A;  3HII A;  3DTO A;  3PS8 A;  4U2Z A;  1TP6 A;  1AR0 A;  4ZI7 E;  1WLX A;  3DGM A;  2ZDJ A;  4PJM A;  3AE3 A;  1WFD A;  1D6U A;  3OXA A;  5H6Q B;  1QVG 2;  2K24 A;  1QUU A;  3Q2P A;  5CGM A;  5LJM A;  4QXC B;  4AIS A;  1BRK A;  4EEB A;  4EV6 A;  5CF2 A;  3VRB A;  2KRT A;  4EYY R;  3KFW X;  4WWU C;  1XNQ T;  3FG3 A;  1AQZ A;  2GBW B;  4XBY A;  4DR2 T;  1M90 4;  5DRV A;  1GQE A;  5DAB A;  1YGE A;  4XDW A;  4RBN A;  1IK3 A;  2EHO C;  2V5C A;  5ETW A;  2WM9 A;  5L47 A;  4KFD A;  5HCM A;  4QXB B;  1OH0 A;  4GIW A;  2ACZ A;  4DV0 T;  1NJI 4;  4HM2 B;  2YIN A;  1OHP A;  2VK9 A;  1J2B A;  3KBU A;  3NRY A;  2BBJ A;  1MGR A;  1MNE A;  3H51 A;  3PCR A;  1KFY A;  4X5T A;  1Z1S A;  1JNQ A;  1D0Z A;  4A97 A;  1SQW A;  5HYA A;  3B5M A;  1N8Q A;  1W7C A;  2HHH T;  3AAI A;  4IPB A;  4YY3 T;  2GEX A;  2Y74 A;  2X51 A;  1UCL A;  3NM2 A;  3SVA A;  3OWY A;  2H3R A;  1IJ5 A;  5F5W A;  3QNU A;  2XQ8 A;  3E99 A;  3A5X A;  2VQF T;  1RGL A;  2CH9 A;  1ROV A;  5FY7 A;  4DBQ A;  4HKA A;  1KD1 4;  1YI2 3;  2Q9Q D;  1VOM A;  3X41 A;  3RIU A;  2BZB A;  3RYF E;  3AE4 A;  3ZT7 A;  5AQL B;  4BA9 A;  4FJO A;  3PCS A;  1VQM 3;  1HNW T;  1XZY A;  1STD A;  3FBZ A;  4FCJ A;  2AAD A;  3WHO A;  2UU9 T;  1S72 3;  4MBQ A;  1FGO A;  4H3U A;  3O8Y A;  4IE7 A;  1JKG A;  3G0K A;  1ZOY A;  3GWH A;  4N6V 0;  2CBI A;  1VCT A;  4CI3 B;  2V7J A;  2CX0 A;  1D1A A;  2LKH A;  4YFS A;  3B7C A;  3F14 A;  1YD8 G;  2Z7A A;  1G02 A;  4DV7 T;  4MMZ B;  2GK9 A;  3K7C A;  2KXP B;  5JRC A;  4U31 A;  4EAH A;  5AII A;  2INX A;  3X3Z A;  1IBL T;  2CEA A;  1VQ8 3;  3VRA A;  4LF9 T;  3F8X A;  2CK3 H;  4JI1 T;  2XAS B;  4UVC B;  1WTH A;  1AVL A;  3CC7 3;  4HFI A;  3MG2 A;  2YDR A;  4A98 A;  1DMM A;  2W2C A;  2E9X D;  2RCD A;  3MSO A;  5IEO A;  4CI2 B;  3RI5 A;  2OCT A;  5FMN A;  3TLS A;  5HOH A;  1JKG B;  3AE1 A;  2OQE C;  7GSP A;  4R80 A;  3G6E 3;  3CNX A;  4EYC A;  2JIW A;  2WWV A;  4B3S T;  2FJD A;  2Z6E A;  3AVS A;  1IVW A;  3I0Y A;  1BR4 A;  2WOF A;  4U2Y A;  3UU6 A;  4JV5 T;  5JDG A;  4DR4 T;  3T1Y T;  1OED B;  3AEG A;  5JH7 E;  1DU2 A;  3JAD A;  4QX7 B;  3M8C A;  2VKD A;  5G2G A;  4LMJ A;  1BSB A;  1M7K A;  3EVY A;  2IUK A; 
#chains in the Genus database with same CATH homology
 3Q5W A;  3NUV A;  3LOY A;  1QVF 2;  1PFP A;  3QK6 A;  1NB5 I;  5IYZ E;  1LVN A;  5KP4 A;  1K28 A;  3O4X E;  2EHO D;  3FB2 A;  3WAK A;  5JDM A;  5EZY E;  3BNC A;  4J8T A;  1NAF A;  3JC6 D;  3BQL A;  5EK4 A;  2KZ7 B;  1BR1 A;  2NTX A;  1SA0 E;  3M65 A;  5KDM C;  2HMO B;  2XEP A;  3KVB A;  2OOV C;  4I50 E;  4X20 E;  1HFA A;  2PZV A;  1JJ2 2;  1WNH A;  2VWA A;  2XAH B;  4TUY E;  2BT3 A;  2CFL A;  2W56 A;  4EB6 E;  3F9S A;  3MKD A;  4OFZ A;  1R4C A;  3HKE E;  3EHC A;  1SII A;  2YEV C;  1BUQ A;  5ELJ A;  3EDU A;  4KFF A;  3E08 A;  1YIJ 3;  2C10 A;  4WYK B;  2E2V A;  2Q9Q C;  2P0M A;  4UXN B;  3EN8 A;  3PUG A;  4AKL A;  5FGO A;  2W0G A;  3G8Z A;  5HWY A;  4L9I A;  1D6Y A;  4V1A v;  1V9D A;  3MAC A;  1GD4 A;  2CE7 A;  2P09 A;  4MHC A;  2MF7 A;  2Y6X A;  3CX7 B;  2H7O A;  2K9A A;  4QHO A;  2SPC A;  4PEJ A;  3ZC1 A;  2PJQ A;  4HM4 B;  1UCU A;  3E22 E;  3P7I A;  4BTX A;  2BMO B;  1GS3 A;  1Y64 B;  3I1A A;  3JVC A;  3U78 A;  3OBV E;  3TKL B;  2WSS V;  3RKO A;  1A90 A;  2E9X C;  1TFO A;  3KBT A;  4CXY A;  3RPU A;  4R9L A;  3FSD A;  4ISS A;  5GON E;  2LT3 A;  5L3E B;  1BR2 A;  5KMG P;  3GN5 B;  3HZP A;  2V26 A;  2ODV A;  1H7C A;  2M67 A;  3VGN A;  4KBM B;  1O7P B;  4I43 B;  4AKY A;  1FEW A;  3EN1 B;  3DGN A;  2W56 B;  4STD A;  3KVA A;  5L3C B;  3RGR A;  4AXP A;  2LEH A;  1EG9 B;  3VU7 H;  3AB3 B;  4H9P C;  4HM3 B;  2HMN B;  1F8N A;  5IW9 A;  2L3L A;  4HM6 B;  3UL5 A;  3HX8 A;  3O1I A;  4XB5 A;  2KWH A;  2CW9 A;  3CKD A;  3KKG A;  3B8L A;  2DHR A;  4AEQ A;  3DMC A;  3NXJ A;  2LSJ A;  3FHN A;  5H6R B;  4C91 A;  4XDV A;  5LOV E;  3SOL A;  1HKX A;  4UF0 B;  3ZYK A;  5L3B B;  3CXC 2;  2DNX A;  3L0R A;  3BB9 A;  1G96 A;  4ZS3 A;  4KZ1 A;  3C4X A;  4WHA A;  3ETU A;  4TN7 B;  4IT7 A;  3V99 A;  3UTK A;  4HBR A;  3CCV 3;  2ZL8 A;  3EBY A;  2DI4 A;  2N1G A;  3EB8 A;  1N9E A;  4TV8 E;  2N9D A;  2FNQ A;  2C5K T;  3PYJ A;  3HKC E;  3X40 A;  2Y73 A;  2ZM0 A;  5LG4 A;  4BAY B;  4PK4 A;  5EVH A;  3ROB A;  1YIT 3;  2X66 A;  3SWH A;  3DGL A;  4TV9 E;  3EF8 A;  5LC7 A;  2A2F X;  3C4W A;  2DWG A;  4L8O A;  5JDF A;  2L9Q A;  4HGA A;  5AEU B;  2OTL 3;  2OTJ 3;  4F6R C;  4GK0 E;  4ADZ A;  4HE8 A;  2CM0 A;  1ROA A;  4GK5 E;  4LGQ A;  4LMI A;  3L09 A;  3CCU 3;  3B4P A;  1N5H A;  1JRQ A;  4MMX B;  5LGN B;  4ILU A;  3VSY A;  3BQK A;  2BNG A;  3J7Y q;  3C98 B;  3Q5X A;  4DMW A;  1U8C B;  4KUM B;  1YJN 3;  2DCF A;  1Q82 4;  5J2T E;  3MXZ A;  2K0M A;  1MOL A;  4CXX A;  1W5Z A;  4O3V A;  1K41 A;  3CME 3;  3HR0 A;  4O4H E;  5LYJ E;  3L3P A;  2RSX A;  1FMV A;  1HF8 A;  3H37 A;  5DQV A;  2D0T A;  3P8C D;  3S5C A;  3KE7 A;  5FXX A;  2XF3 A;  4OVM A;  2ACX A;  2R4I A;  5A0O B;  2Q9Q A;  3FKA A;  3JUQ A;  3T8U A;  4PNI A;  3FXD B;  2A15 A;  2Q9Q B;  2W00 A;  3CCQ 3;  4MLK A;  3I0O A;  2B24 B;  4UEL A;  3B4O A;  4IDZ A;  1CQS A;  1SHZ C;  2K54 A;  2W9P A;  4I55 E;  2NW7 A;  5JDQ A;  3F57 A;  1QMA A;  1AJ3 A;  3UNL A;  2G0U A;  3QRD A;  1EQK A;  2XUE A;  3JUP A;  3DY5 A;  3ECF A;  2BDE A;  3ZMT B;  5FP3 A;  3K0Z A;  2QA7 A;  5A1L A;  4HM7 B;  5IG5 A;  4ZOL E;  3SOA A;  3PZW A;  2JQ5 A;  2H7V C;  2W61 A;  1TUH A;  3NQZ A;  4MJD A;  2XSO B;  2HMM B;  4QWT A;  2LHN A;  3B13 A;  1LKX A;  3ZMU B;  4P0A A;  4HJL B;  4ZI2 D;  3MJX A;  3WA3 A;  3VF1 A;  4MFR A;  4H9R C;  1O7M B;  4UVB B;  3IEE A;  2X9W A;  1S94 A;  2C11 A;  3I55 3;  3HKB E;  2X0L B;  4X2O A;  2VKH A;  3I9W A;  1OHO A;  2RGQ A;  1UX4 A;  5IEN A;  5HXC A;  4Z8X A;  4FMB A;  1Y4K A;  4ZM8 A;  3JUO A;  2QGU A;  4FR9 A;  2K48 A;  3LJC A;  3G16 A;  3RYC E;  1T98 A;  1QAF A;  2CXL A;  3FLJ A;  2HMJ B;  2W6J H;  2NW9 A;  4K61 A;  3PE0 A;  2W62 A;  5CXO A;  2LHR A;  4I4K A;  1OF5 A;  4JEU B;  2LSK A;  2KWI B;  2BVL A;  4O2B E;  1EA2 A;  1OAC A;  1HU9 A;  4NUV A;  5L2L A;  2WMN A;  2QIY A;  2VL8 A;  5AIG A;  4HKV B;  2X9H A;  2I59 A;  5AYR B;  5AIH A;  3U3I A;  4UV8 B;  1RJO A;  3NV0 A;  4TX5 A;  2CKF B;  4CI1 B;  2RFR A;  1E3R A;  3E0Z A;  2V7K A;  2XHE B;  2XRX B;  3BLZ A;  4EXR A;  1QAL A;  3CMA 3;  4DMV A;  3CPZ A;  3N9L A;  3SRZ A;  3GA8 A;  1JV2 B;  1U5P A;  3GMI A;  1K73 4;  3RRW A;  2LM9 A;  3T8O A;  3CCL 3;  2Z76 A;  3EE1 A;  5LBM A;  4OHF A;  3WMD A;  1WMN A;  5IHY A;  3GRD A;  4EV5 A;  3SED A;  1S5A A;  4AI6 A;  4N6N B;  2NTY A;  4XBF B;  2ZM8 A;  1HS7 A;  1LRZ A;  3G71 3;  4DBR A;  3KII A;  3ZCJ A;  4QWN B;  4IST A;  4UVA B;  1MND A;  3QC9 A;  3FG4 A;  3EJV A;  2HPL A;  2C5I T;  4NUU A;  1V74 A;  1W6G A;  1A67 A;  1WYB A;  2IMJ A;  3IBP A;  5F3J A;  3AMO A;  3D0T A;  4PFO A;  3RC3 A;  2CMR A;  5ADX L;  2A72 A;  5J2U E;  2A3D A;  2RP4 A;  3V98 A;  3MK7 C;  2MOZ A;  3ZN1 B;  1W2Z A;  4NHF A;  3PUA A;  1W4N A;  2WOH A;  1YJ9 3;  4K0U A;  4K1U A;  4OYJ A;  2KLQ A;  3EX9 A;  5STD A;  2F99 A;  3IHR A;  1ZV4 X;  3F7S A;  1E97 A;  5M4Y A;  5AIF A;  2XQY A;  3EDV A;  3LXU X;  4CDL A;  5BXQ A;  1X79 A;  3N2K E;  2W9Q A;  4OK0 A;  4K1V A;  2XAJ B;  3K3O A;  1CEW I;  3FF2 A;  2NP9 A;  1AVK A;  3H3H A;  4O8S A;  2GEY A;  1RRH A;  2E9X A;  3RX6 A;  4PJN A;  3OWS A;  1GY6 A;  1Q81 4;  3HKD E;  2XGN A;  2IAK A;  4G2A A;  3NRX A;  3K3N A;  1NU3 A;  4GYS A;  5L3D B;  2I9W A;  4ANJ A;  3F7X A;  2CWT A;  5CA0 E;  1VQL 3;  2KIN B;  3RGA A;  4GYR A;  2RA1 A;  2PNC A;  2J1D G;  3UUX B;  2VKJ A;  4DVD A;  2FGT A;  5BVB A;  4N6O B;  3CQG B;  1TU5 A;  1VQN 3;  1IJ6 A;  4UIG A;  2EHO A;  1GY5 A;  1OHS A;  2LJL A;  1VQO 3;  1MMD A;  3CQX C;  3WAJ A;  3N2G E;  4C90 A;  1L5G B;  3CU3 A;  2X9X A;  1N5P A;  4JEH B;  1EZ3 A;  2Z6B A;  1W6C A;  2P0X A;  2HPJ A;  1PU4 A;  5BMV E;  1AV4 A;  4AKI A;  3QK9 A;  1LXE A;  5JBS A;  1M1X B;  4CCV A;  3NBJ A;  4RNZ A;  4WBN E;  3OJA A;  2P9B A;  1K8A 4;  1SIH A;  2CWV A;  3PGB A;  1WMP A;  1E1H B;  2YX9 A;  5C8Y E;  2WWU A;  3K63 A;  1A2V A;  2FXT A;  5D83 A;  3AA6 B;  2VB6 A;  1FGR A;  2SBL A;  5EK2 A;  4IIA A;  4BTW A;  3LFM A;  3CQC B;  3N54 B;  5JVD E;  5JDH A;  3X3X A;  1QJG A;  4EZ4 A;  2BO9 B;  1VQ7 3;  4TZ4 C;  2CCQ A;  1DMN A;  2DLR A;  1IU7 A;  2CIU A;  5JPU A;  3DM8 A;  4KFE A;  1YW0 A;  3W15 B;  3U1W A;  3NZQ A;  1ULI B;  3VKH A;  3R84 B;  3N8B A;  3CX6 B;  4XAX B;  3CPO A;  4ORL A;  5DRE A;  3OKQ A;  4WP5 A;  3KZT A;  2D0U A;  2JPF A;  3ZYM A;  2YU2 A;  1GYB A;  2VKO A;  2KT9 A;  3KDS E;  1S35 A;  1UUV B;  3WOD G;  3CD6 3;  1UX5 A;  5EEO A;  3Q90 A;  1WMO A;  2BHM A;  3KV4 A;  5IER A;  2MC8 A;  1BR0 A;  2IA7 A;  3K3Q C;  3ANW B;  4B6X A;  4AKH A;  3LK2 B;  2D1W A;  2ZMA A;  5LBQ B;  3N9N A;  1US7 B;  2CLY B;  2IW5 B;  3GAX A;  3MWZ A;  4LSO A;  1FGQ A;  2ML6 A;  1KNZ A;  3X3Y A;  3AAE B;  3NHX A;  5J1G A;  1U5O A;  1ULJ B;  4WBO A;  3UT5 E;  3RH3 A;  2CWU A;  2E2U A;  1OUN A;  3NZP A;  1LVK A;  1IV9 A;  2KCD A;  3A76 A;  3LTD A;  3SOY A;  4HN9 A;  1OF5 B;  3H3A A;  4OYK A;  2WMO A;  5FYM A;  4FCZ A;  1KSI A;  3V5S A;  3LT9 A;  2LYX A;  1RN7 A;  4KVH A;  3NV0 B;  3ZC0 A;  5JR9 A;  3VHL A;  1W00 A;  3LT8 A;  1K9M 4;  4BJN A;  5KP1 A;  4EBG A;  4KMC A;  1GY7 A;  4WFO A;  5LHI B;  3UUN A;  4MAL A;  2O9U X;  3HA4 A;  1FA3 A;  1E3V A;  4ZHQ E;  4EXT A;  1IVU A;  2W04 A;  1D1B A;  4HTE A;  4N6L A;  4CZZ B;  3JC6 C;  5AYS C;  3HI7 A;  2IC9 A;  2KMF A;  2NW8 A;  2GBX B;  4N78 D;  2LSY A;  3ONX A;  3DGO A;  3N2O A;  2XTL A;  4IHJ E;  3SXX A;  4YLH A;  4FI5 A;  2NWB A;  4ERR A;  1C7H A;  3GZY B;  1U4Q A;  3J7Y d;  2XFS A;  2P38 A;  4CXW A;  4UEM A;  2LSI A;  2GU3 A;  2F98 A;  4LZI A;  3Q1C A;  4YHJ A;  4R1K A;  4O2A E;  3PUS A;  2D42 A;  1OGX A;  4X2H A;  3LZA A;  1WRD A;  3KFQ C;  4OUQ A;  5JR9 C;  2B1X B;  3KSE D;  1VQ5 3;  2Q07 A;  1N9J A;  5IF6 A;  2CA5 A;  2MYS A;  2N2N A;  4X1Y E;  4YJ2 E;  3GZX B;  4HM5 B;  1FUW A;  4TX4 A;  3ANW A;  2E9X B;  1LOX A;  3ZN0 B;  3T0U A;  3N9M A;  3ZCI A;  4AKR B;  3KN4 A;  4HYZ A;  3NBX X;  3AA1 B;  2W63 A;  3EUH A;  4H9N C;  5EK3 A;  2KXG A;  4ZI2 C;  1WQL B;  4UF0 A;  5LJN A;  1STF I;  1G8X A;  2D2S A;  5LXT E;  3LG7 A;  4XZC A;  4H9O C;  4AQF C;  5KP3 A;  5TGN A;  2W0Q A;  3C51 A;  3RDE A;  3G4S 3;  5HXR A;  5AEW B;  4G63 A;  3S27 A;  1HG5 A;  2P05 A;  2CFW A;  3CC2 3;  2B1E A;  5FXV A;  1NB3 I;  1T5Y A;  4HM8 B;  4U13 A;  2JJ9 A;  4PW8 A;  5D81 A;  2QEX 3;  5F8P A;  3EBT A;  3T8N A;  4WNK A;  3CCJ 3;  3FBL A;  2V1L A;  3OWU A;  2HML B;  4EYU A;  2HMK B;  4JF8 A;  2V7M A;  3S29 A;  5HGR A;  3R6N A;  4O02 B;  2ML5 A;  2PFV A;  3GN5 A;  4H61 A;  3OW2 2;  1Q42 A;  5DJQ C;  1EKM A;  1VQK 3;  3ZMV B;  2QGS A;  1IQ8 A;  1LVF A;  4H9S E;  2CFG A;  4GOU A;  4X1I E;  3MKI A;  3ZMZ B;  4K90 B;  3RYI E;  3K5T A;  2VAS A;  1VQ4 3;  4ZS2 A;  2CXD A;  5ELU A;  1D6Z A;  3WI3 A;  2WGO A;  2LQV A;  2W03 A;  3BNB A;  5CF1 A;  2BMR B;  3V92 A;  5JRE A;  4Q53 A;  3DP7 A;  3D9R A;  2ZM2 A;  5FW5 A;  5FXW A;  1ZEE A;  3PUR A;  3FZW A;  3AA0 B;  1KC8 4;  4X1K E;  3DZL A;  1W6Y A;  3O9X A;  1IV7 A;  3ZEF B;  5JDN A;  1MMA A;  4L8P A;  1DVD A;  2V1D B;  3CC4 3;  2YFL B;  3UL6 A;  1CYV A;  2L8K A;  3KSP A;  3OV4 A;  4HZB B;  2XR8 B;  4DO0 A;  5E0O A;  4NRE A;  2K5B B;  5LP6 E;  2CFD A;  3HL6 A;  1RRL A;  3U97 A;  1B7T A;  2CG0 A;  3EQQ B;  1HX8 A;  1VQP 3;  2XGL A;  2JQQ A;  3GZB A;  1QAK A;  1ISK A;  2CG1 A;  3N9O A;  2GU1 A;  2UXN B;  3GZR A;  3F31 A;  2XAF B;  3LH4 A;  3HI2 A;  4UV9 B;  1JB4 A;  4P0B A;  4XM4 A;  3UB1 A;  2MTQ A;  1HG2 A;  4CQI A;  2BMQ B;  1YVB I;  3NX0 A;  3UFE A;  2X67 A;  4FMD A;  3LBX A;  5L3F B;  1FGM A;  5AFU L;  3QUJ A;  4E7S A;  3C50 A;  1VRB A;  2XSH B;  3BNE A;  2F86 B;  2C5J A;  1VQ6 3;  7STD A;  1ZHC A;  2LOP A;  4E7Z A;  3KV6 A;  2YK0 A;  4H63 V;  4RZM A;  1DVC A;  3DUK A;  4N3V A;  3IF8 B;  1MNL A;  5JDL A;  1NO3 A;  1KQS 2;  4J2C A;  2CWY A;  2DWK A;  1TFK A;  2JDI H;  1LNH A;  1FMW A;  3N9Q A;  3MZK B;  3NBB A;  3PXM A;  3S67 A;  2HH7 A;  1IQY A;  3CCM 3;  5JRC B;  2L4V A;  3UUL A;  1DYU A;  4HVN A;  4KP3 C;  4O4J E;  5FNV E;  4ASK A;  5TAO A;  3LK4 2;  2CFK A;  3OYX A;  3AMO B;  3ZMS B;  1D1C A;  1GD3 A;  3RYH E;  4AQF A;  1NWM X;  2C0S A;  4L7K A;  3F2E A;  2CWO A;  2CC3 A;  3ER7 A;  3PDY A;  4A56 A;  1D0X A;  4JUY A;  5LNK A;  1WR6 A;  3AA7 B;  4XBX A;  3ZJ1 A;  1ASK A;  3CPW 2;  3D3L A;  3BK9 A;  3PU3 A;  1CYU A;  4HZ9 B;  3MYT A;  5HXH A;  3CCS 3;  3KIN B;  2WBL A;  1IZN B;  1O7N B;  1JB5 A;  4HM0 B;  1Q86 4;  3ZJ2 A;  1W01 A;  3WOE B;  2YU1 A;  4U72 A;  2IUJ A;  1ZKE A;  4HEA A;  4BTY A;  1Q40 B;  1RKY A;  3CML A;  5HAX A;  3CWZ B;  3DJB A;  4O4L E;  8CHO A;  3J9X 1;  1O7W B;  3HK4 A;  4FMC A;  4I4T E;  1YHQ 3;  1QSD A;  2PG8 A;  5HXS A;  4GL6 A;  2UX0 A;  3FH1 A;  1JN5 A;  3CVR A;  2JRK A;  2CXF A;  1Q7Y 4;  1UW1 A;  3LML A;  4EZH A;  1CUN A;  4N6T A;  1UUW B;  3PUQ A;  3Q9D A;  1ZO2 A;  3KV5 A;  3K9M C;  1YKH B;  2BVM A;  3LTC A;  4MMY B;  3F40 A;  5CB4 E;  4O4I E;  2M7O A;  1MMG A;  1IT7 A;  2V7I A;  5DQW A;  2CLY C;  1NDO B;  4JRF A;  5JR9 B;  1FGT A;  1A2K A;  1OGZ A;  1OWA A;  1IVV A;  3B57 A;  2Z77 A;  4IE6 A;  3STD A;  2E2T A;  4U74 A;  2STD A;  5LHG B;  3GWR A;  1O7H B;  3CX8 B;  3ZYL A;  2ODU A;  1SJW A;  3O1H A;  5FY1 A;  3NM7 A;  1OCV A;  1UI7 A;  3AVR A;  1DMQ A;  3LBX B;  2GXF A;  3JUM A;  4RNY A;  5HWX A;  1JN5 B;  2WGQ A;  3C4Z A;  4PK6 A;  2YFJ B;  1HTJ F;  1G73 A;  3S4U A;  3BND A;  3RC8 A;  5JPP A;  2Y8D A;  4AQG A;  4FCM A;  1OPY A;  2OA5 A;  1N8R 4;  5FXZ A;  3ETV A;  1VZZ A;  3LTA A;  4PJL A;  3MG1 A;  4XBT A;  1UI8 A;  2XAG B;  5IG4 A;  1OXZ A;  4JLE A;  5L3G B;  4FMA A;  5JQG E;  3C64 A;  2LSG A;  1YKE B;  4PFP A;  2XFT A;  4M1P A;  4P09 A;  4O2H A;  5HXE A;  4EV2 A;  5LA6 E;  2KND A;  2WAU A;  2PBI A;  1O7G B;  1MIY A;  1MIV A;  1D0Y A;  3N5L A;  3ZPO A;  3EC9 A;  5EQL A;  2LE8 A;  4ZI3 D;  3S28 A;  3I0Q A;  3TDG A;  2XAQ B;  3WDG B;  3I56 3;  4QX8 B;  2Y48 B;  4L5G A;  5IG0 A;  3F8H A;  4HFV A;  5CA1 E;  3JUN A;  3N9H A;  4BJM A;  2WO0 A;  2D5U A;  1IVX A;  3VKG A;  1VQ9 3;  1Z0P A;  3HIG A;  4L0R A;  3CCE 3;  4WW0 A;  4IE0 A;  4DND A;  4PK5 A;  2IC6 A;  1JB2 A;  2QA4 3;  4WYK A;  2JMH A;  3K8P C;  3SLU A;  3PTR B;  2ZLY A;  3FG1 A;  1W02 A;  3IJE B;  3MG3 A;  1TIJ A;  5IG3 A;  5LC6 A;  3FCS B;  3ZLI A;  2V7L A;  3WOF B;  4GB5 A;  1M1K 4;  3IPT A;  2OWP A;  3UUM A;  3SS1 A;  3NQY A;  3PU8 A;  3V5U A;  1NWW A;  1MIW A;  4EIW A;  2OQE A;  2X68 A;  1US1 A;  1KK7 A;  3LK3 B;  3X42 A;  3IMA B;  4YJ3 E;  4LEH A;  2XH9 A;  3NBR A;  6STD A;  5FY0 A;  2CHC A;  3MPH A;  3ALA A;  4N6M A;  2O3O A;  3OYZ A;  4QKN A;  5LCY A;  3BQI A;  1IQX A;  1FIO A;  3MA9 A;  2EHO B;  5AI1 A;  5IEP A;  5LHH B;  2YFI B;  3FXE B;  3CNM A;  3LYG A;  2E8I A;  3OX9 A;  4IIJ E;  4G1M B;  3I9Y A;  3Q2M A;  4IGU A;  4H9Q C;  1M9G A;  3KV9 A;  2UXX B;  2NOX A;  3MHE A;  1KWI A;  5KX5 E;  5I97 A;  2OOV A;  2MBG A;  4MEI A;  3ESL A;  4ZI3 C;  3FGY A;  3CCR 3;  3O1J A;  4PAG A;  1O3X A;  4QXH B;  1W2B 2;  3DXO A;  2JMK A;  4PJJ A;  5CK6 A;  3FF0 A;  4EOZ B;  3LTB A;  1IAP A;  4EC6 A;  4R4K A;  5CLK A;  4IE4 A;  1YJW 3;  4H63 H;  4IE5 A;  5LGU B;  1IT8 A;  4J9A A;  4AKG A;  3N9P A;  4N6U A;  1WYC A;  5LGT B;  4R9K A;  3WA2 X;  2LOS A;  3UJM A;  1HCI A;  2ES0 A;  5D82 A;  1Q40 A;  1MMN A;  3AAA B;  2X9Y A;  4HM1 B;  1ZX2 A;  3RRC A;  1SPU A;  4AKZ A;  1IDP A;  3SX1 A;  3HII A;  3DTO A;  3PS8 A;  1TP6 A;  1AR0 A;  4ZI7 E;  1WLX A;  3DGM A;  2ZDJ A;  4PJM A;  3OXA A;  1D6U A;  5H6Q B;  1QVG 2;  2K24 A;  1QUU A;  3Q2P A;  5LJM A;  4QXC B;  5CF2 A;  2KRT A;  4EYY R;  3KFW X;  4WWU C;  3FG3 A;  2GBW B;  4XBY A;  1M90 4;  5DRV A;  5DAB A;  1YGE A;  4XDW A;  4RBN A;  1IK3 A;  2EHO C;  5ETW A;  2WM9 A;  4KFD A;  4QXB B;  1OH0 A;  4GIW A;  1NJI 4;  4HM2 B;  2YIN A;  1OHP A;  2VK9 A;  1J2B A;  3KBU A;  3NRY A;  1MNE A;  3H51 A;  3PCR A;  1Z1S A;  1JNQ A;  1D0Z A;  1SQW A;  5HYA A;  1N8Q A;  1W7C A;  3AAI A;  4IPB A;  2GEX A;  2Y74 A;  2X51 A;  3SVA A;  3NM2 A;  3OWY A;  2H3R A;  1IJ5 A;  3E99 A;  3A5X A;  2CH9 A;  1ROV A;  5FY7 A;  4DBQ A;  4HKA A;  1KD1 4;  1YI2 3;  2Q9Q D;  1VOM A;  3X41 A;  2BZB A;  3RYF E;  4BA9 A;  4FJO A;  3PCS A;  1VQM 3;  1STD A;  3FBZ A;  4FCJ A;  1S72 3;  4MBQ A;  1FGO A;  4H3U A;  3O8Y A;  4IE7 A;  1JKG A;  3G0K A;  3GWH A;  4N6V 0;  4CI3 B;  2V7J A;  1D1A A;  4YFS A;  3B7C A;  3F14 A;  1YD8 G;  2Z7A A;  4MMZ B;  2GK9 A;  3K7C A;  2KXP B;  5JRC A;  4EAH A;  5AII A;  2INX A;  3X3Z A;  2CEA A;  1VQ8 3;  3F8X A;  2CK3 H;  2XAS B;  4UVC B;  1WTH A;  1AVL A;  3CC7 3;  3MG2 A;  1DMM A;  2W2C A;  2E9X D;  3MSO A;  2RCD A;  5IEO A;  4CI2 B;  2OCT A;  5FMN A;  1JKG B;  2OQE C;  4R80 A;  3G6E 3;  3CNX A;  4EYC A;  2Z6E A;  3AVS A;  1IVW A;  3I0Y A;  1BR4 A;  2WOF A;  5JDG A;  5JH7 E;  4QX7 B;  3M8C A;  2VKD A;  5G2G A;  3EVY A;  2IUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...