4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
b'SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
molecule keywords Putative
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4OK0A 4O8SA
chains in the Genus database with same CATH superfamily
2WBLA 4LF6T 1UCUA 2JQ9A 3CD63 3V99A 3UU3A 4MEIA 4DV6T 2E8IA 3FXDB 5JRCA 2LJLA 2N2NA 4R80A 4ISTA 4UF0B 3RC8A 5CF1A 3H3AA 2W0GA 1BU4A 2QGSA 4WBOA 4PJLA 4DV7T 2SARA 4ZI3D 2KCDA 1G0TA 5J1GA 3NBJA 3EI0A 1NENA 1BGSA 3P8CD 1LNIA 1EQKA 4LFAT 2C10A 1XDOA 5LCYA 1RGCA 4QH4A 2P9BA 1O7MB 1YGEA 1IK3A 4CCVA 2BHMA 1L0VA 4GKJT 1QUUA 4IIAA 2X51A 2CKFB 4AKYA 3T0UA 2QA43 1YHQ3 5GSPA 2BT3A 4DBQA 2KF6A 1JN5B 1UI7A 5AQJB 1WR6A 4FCZA 2E9XD 4NPBA 3ESLA 3C64A 3RYIE 3PUQA 4MALA 5AQRB 1SIIA 2XTLA 4HAAA 2QEX3 4KP3C 4N6TA 3AE6A 1BAOA 5GONE 3RIUC 1UUVB 3RGLA 4PK4A 2I9WA 4O4JE 1BNFA 2MF7A 4O4IE 4FMAA 1OF5A 4QXCB 3U78A 4XDVA 2E5VA 2UGIA 4QWTA 3WA3A 5JH7E 1FIOA 3NBBA 1JRQA 3OWYA 2WDVA 3AE5A 2YEVC 2LRLA 3ZMUB 1ZX2A 1BRGA 4QXBB 1RCLA 1LKXA 2ZM2A 1K8A4 3JAEA 2HMLB 3CC43 1HG2A 3PTRB 3EABA 4ZI2C 2YFLB 5EEOA 5AQLB 4PK6A 2YDQA 1BNSA 1A90A 3LMLA 3N9QA 4HN9A 2WO0A 3IA3A 3GMIA 3CWZB 2OA5A 2JQ5A 4FCJA 4ERRA 1JNRA 3FZWA 1FMVA 3LK2B 1VQN3 1R8IA 4EZHA 1FJGT 3MZKB 5ABFA 2WMNA 3U1WA 2YU2A 1GD4A 2BS2A 1YGWA 4L8OA 1RN1A 3A5EA 4B6XA 4B3TT 1RMSA 1BUJA 2UXBT 5IHYA 2W9PA 2W9QA 3X3YA 5FYMA 1NAFA 3H37A 1TU5A 1YD8G 4B3MT 4AQYT 3AHWA 3JCFA 2WOFA 4JI5T 5LOVE 3FSDA 4BTWA 3CPW2 1B2MA 4ZS3A 1FUWA 2A9UA 4XAXB 2C5IT 2D0UA 4N6LA 1OEDA 4J8TA 3VR8A 1GY5A 1O3XA 2V7JA 2X0LB 3NM7A 3ZKRA 5KP3A 1MGRA 4LF5T 1UCLA 3MG2A 4U74A 4HWCA 5HAXA 5LB7B 1KK7A 3N2GE 2X0YA 4UEMA 1LXEA 3S28A 2R41A 3Q5XA 5AQSB 3C98B 4L5GA 2KT9A 4AKHA 4PJNA 3K0ZA 2BG9C 4A97A 3AECA 1QALA 3GA8A 4P09A 4HFEA 4QH5A 5G1KA 3UB1A 9RNTA 5IENA 2WWVA 3N9PA 5HCJA 2DLRA 4H9QC 3ZSSA 3ZT6A 1UCKA 2RCDA 3AHSA 3W15B 5G2GA 3GZRA 3MKDA 3MYTA 3RX6A 1JBSA 4LMKA 2CFKA 3WOEB 4MFRA 2G0UA 2H89A 1IYYA 4JUYA 1RLSA 2GU1A 1IBKT 1T7SA 2FJDA 3CXC2 2V5DA 1RNBA 1MMNA 3N2KE 1ZS7A 4DR2T 1DMMA 5G1LA 1OPYA 1I3IA 3P4WA 1XWMA 1MWUA 2Q9QC 4I55E 1RRHA 4K0KT 2R6GF 2XZEA 2VVNA 2BMRB 4QH1A 2W63A 3DZLA 3PGBA 5KP4A 2CWUA 3L39A 2UUCT 3WR2A 3CCE3 4YHHT 5D82A 7STDA 1DMQA 4DV3T 1PFPA 1UCIA 4BU4A 3FG3A 4BTXA 5FMNA 1UGOA 2D1WA 4N3VA 4WYVA 2PFVA 2QIYA 1KD14 2VB6A 2KNDA 3SRZA 4I4KA 2MC8A 4PFOA 5ADXL 4XM4A 4X1YE 2GK9A 5BU4A 1WMOA 1N9JA 3ZG5A 1EEJA 4AQGA 1G8XA 4XBFB 5AIGA 3PUWF 3RHWA 6RNTA 3EDVA 3GZXB 5AEUB 3LSVA 2XRXB 3CQXC 3A5XA 3C50A 2HMOB 2A15A 4IPBA 3G8ZA 3FZFB 1RTUA 2EHOB 3M3ZB 1XNRT 4GSPA 1BSCA 3DJBA 1I0VA 1ZO2A 3KIIA 4DV1T 1T3BA 4ZS2A 1RGKA 5JTGA 5EK3A 1YW0A 1N5PA 1TFKA 3OWUA 2Z6BA 1N36T 2CX0A 3U3IA 2RBIA 3D3LA 2XY8B 5C8YE 4NPPA 4UF0A 5IG0A 2HPLA 1WYCA 5HXCA 1UGHI 1I0XA 4KMCA 2XGLA 2BG9E 1GS3A 2W56B 1YIT3 4DV2T 1U4QA 3E0ZA 1W0BA 4ZI3C 5LJMA 2ZM6T 2OOVA 3KSED 2NW9A 3ZMTB 2JPFA 1I2EA 2W67A 2CMRA 1UUWB 2ZDJA 3AA1B 5L3FB 1J2BA 3AA0B 3MSOA 2R4IA 1EZ3A 2X9XA 5LJNA 2ZLYA 1LRZA 3F7SA 4U13A 5L3EB 2OLTA 5ABHA 1YNVX 2LKHA 2JQQA 1SPUA 3I9WA 3CMLA 2D2SA 4JYAT 2VK9A 2OQEA 2YFIB 5CB4E 4H9RC 2O9UX 4C90A 3E99A 1JN5A 4HFCA 3ZJ1A 1BR2A 3SX1A 2XSOB 2CG0A 2Z76A 4HWDA 1BUQA 1WRDA 3KFQC 3FHNA 1HU9A 1HKXA 3U97A 2YN6A 2KLQA 4H9OC 4TNWA 4AQFA 1JB4A 2JMKA 5CF2A 1MNDA 1IVXA 1K28A 1UURA 3OV4A 2D9DA 2F99A 5JVDE 1V57A 3HK4A 4HGAA 4EB6E 3EUHA 3LOYA 2GBXB 1I94T 2HMJB 2ODUA 1ZGXA 3CKDA 2H7VC 1S5AA 1QLBA 3PS8A 2XQ8A 1C54A 1YQ3A 2BKPA 2K24A 3M65A 4ANJA 4ZXLA 4DV5T 4CI3B 2IMLA 1CEWI 4IHJE 2BO9B 3FF2A 5ELUA 3EN1B 1STDA 4DV4T 3PE0A 1M9GA 2F5WA 2HN1A 3VGNA 4MMXB 3AGOA 1UUGB 3CCM3 2A3DA 5LGNB 3MKIA 3TLSA 2DL1A 1VZZA 1VCTA 3PJAJ 3NRXA 1BSAA 3ZLIA 4BIRA 5AEWB 2HMNB 4X20E 3X3XA 3EB8A 4TZ4C 4QKNA 2IIUA 5LC7A 2VKOA 1B21A 5AYSC 1XMOT 4O3VA 4FMCA 4O8SA 1ZP0A 1LOXA 1X1YA 3IBPA 3TLWA 3MXZA 1FW7A 4HKVB 5J2UE 4JI3T 4O2HA 4HZBB 2V7LA 4IDPA 1RGEA 3NKZA 4OHFA 4JI8T 4RZMA 3MJXA 4O4HE 3UUBA 2WOHA 3STDA 2DHRA 1L5GB 4X2OA 2BBJA 4K1VA 3EN8A 1B27A 2JRKA 5HYAA 1I2GA 4TWFA 2K0MA 3GAXA 1BSBA 1HG5A 1TIJA 1NWWA 4YTNA 3HI7A 1IT7A 5C2TA 2KRTA 4R9LA 1VQ93 2W62A 3N8BA 1GMRA 4DUYT 2DI4A 1PY3A 1SA0E 2UUBT 4YY3T 5J2TE 1A2KA 1HNWT 3LBXB 1JNZA 5AQTB 1OXZA 1V58A 2PTFA 2BVMA 2C5JA 5DABA 1XMQT 2AE9A 4PJMA 3DGNA 5LBQB 3ZFZA 4MBQA 2H0HA 5AQUB 5LP6E 4EYYR 3I553 3WMDA 4YT0A 3PUZF 4KVHA 1CHUA 2UXDT 1ZEEA 3TLTA 1US7B 3F9SA 3BLZA 4KHPT 4R9KA 1KF6A 4F6RC 1I8VA 4ZM8A 8CHOA 3HKBE 3EC9A 1IJ5A 4UVAB 3CU3A 3BNBA 4IDQA 2W03A 3A7MA 3I0QA 2ZA4A 2VKDA 3S5CA 2BMOB 1QVF2 5LHHB 4YHJA 1JZOA 5L3BB 1KSIA 3FBZA 3EAMA 1CQSA 4N78D 2HMMB 2CWOA 3TLVA 2UU9T 3AE4A 2E2UA 2UXCT 3K1SA 1S723 1HTJF 2E2VA 2I0MA 2QVAA 3FCSB 5BVBA 3AA6B 7GSPA 5DRVA 4NREA 4NXMT 3NQYA 3N9NA 3NV0B 2WSSV 3SFDA 1W6YA 1YVBI 3CMA3 5EQLA 1W2B2 3SYUA 3JC6D 5JDFA 4UXNB 1BRSA 3AE8A 3NBRA 2RPAA 1IQXA 1YKEB 1JNQA 2N9DA 4G63A 2WU5A 5IUXA 8RNTA 3AE2A 4IL9A 2V1LA 1N8QA 2MAWA 3SFEA 2INXA 3FH1A 2NW8A 4LF7T 4HFVA 4E7ZA 3B4PA 4I43B 4Z91A 1YJW3 3JVCA 4Q53A 3Q2PA 5TAOA 3HL6A 3AVRA 3UL6A 2GEYA 4U33A 2F56A 3KZTA 3QNUA 2RFRA 3D5IA 5LMUT 3IF8B 3UUMA 2LHRA 3SS1A 1W02A 3PUXF 4N6V0 3CQCB 1LOWA 1LNHA 4B3RT 2YOEA 1BNRA 2EHOA 5HXHA 4ILFA 3LTBA 3CCU3 1HR0T 2WQYA 2X9YA 5FXVA 1FZUA 4IGUA 1OACA 5CLKA 4H61A 2XF3A 1R4CA 1T98A 4EEDA 5F3JA 4YLHA 2P0XA 1O7WB 4JBWF 4ILBA 3HKDE 2XFTA 5JDLA 2BG9B 4X66T 4WWUC 4X1IE 4DR1T 3RH3A 2FNQA 1SIHA 1K734 5FW5A 1IQYA 1VQL3 4HM4B 4UV9B 2W56A 4RNTA 1FYSA 3FZKB 5FL1A 2CC3A 3CCS3 2ACXA 5JDGA 1XNQT 3G0KA 1MMAA 2GU3A 3Q2MA 5LMNT 4JV5T 3P50A 1AY7A 2VL0A 4L0RA 4DMVA 1OEDC 4CXWA 3AEAA 4YSYA 4DR5T 1OGXA 3RIFA 3PYJA 4IDNA 3LFMA 2D0TA 3DTOA 3K8PC 5C3JA 4B3ST 3BIRA 4HEAA 2Y74A 3PURA 1B2SA 4IT4A 2C0SA 4IIJE 1W01A 4AKLA 3G713 2O3OA 4HJLB 3CK6A 3K3NA 3O1JA 1LRAA 1YJN3 1I6ZA 1RJOA 1TP6A 2V7MA 1A2PA 4O4LE 3DGLA 2YDSA 5CA1E 2FGTA 2ML5A 2LM2A 3WODG 4EBGA 3MWZA 1YJ93 3OJAA 1Y64B 2V7KA 3ZMSB 1PYLA 1EG9B 1M1XB 5CK6A 4EEBA 3LJCA 1W09A 4X1KE 1W6GA 5CFBA 1E97A 4CJNA 2V8SV 3LZAA 2E5LT 1EKMA 1IVVA 3KDSE 3N9MA 2LSJA 1RGHA 4CXXA 5I97A 3P4SA 4HTEA 2B76A 2CRBA 3OTOT 1HZ1A 4YJ2E 5HOHA 1RKYA 4JEHB 5LA6E 5LGTB 2CX1A 4IREA 3SEDA 5JBSA 3K3QC 1W5ZA 3CCQ3 1IJ6A 2J1DG 2N1GA 2HN2A 3GZYB 4I4TE 2LSKA 2KF3A 5M18A 1U5PA 5LHIB 4UIGA 4EXTA 3UJMA 3H51A 3FB2A 4J5GA 2XSHB 4HM2B 1GOVA 4JI6T 3IEEA 3DGOA 3KN4A 3SXXA 2LOSA 3RF1A 4HOHA 2XQ5A 4UVCB 1RN4A 3JUNA 1A67A 3RNTA 1GOYA 6STDA 4BL2A 1EA2A 1JKGA 3ALAA 5FKYA 2H3RA 3EHCA 2XUEA 4TWHA 3NRYA 2LE8A 3SOYA 2BNGA 3NXJA 5F5WA 4H9NC 3AAEB 4O2AE 5IF6A 5A1LA 3UU5A 2CXLA 2XAHB 4KFEA 3KE7A 4TN7B 2EHOD 1VQ43 4TUYE 1BR4A 3HI2A 5AQNB 1IVWA 4HM7B 2JDIH 3PU3A 3QB5K 4TV8E 2UUGC 3CPOA 1MOLA 4DIDB 3BNCA 3X3ZA 3PZWA 2M6IA 3MG1A 2X9WA 5FY1A 2XSBA 1MMGA 4XDWA 5AIFA 1MIWA 3LBXA 3OXAA 3O1HA 1MWSA 4OUQA 1AR0A 4HZ9B 4XB5A 4EZ4A 3JAFA 5IW9A 2NTYA 4EC6A 2KWIB 5FXWA 3F40A 1WLXA 3DGYA 1HNZT 2B1XB 1E1HB 3X41A 3S67A 1RGLA 5FVLA 5M4YA 3DXOA 1E3RA 2IY2A 5A0OB 3RIUA 1BR1A 2UXNB 2F86B 4IE7A 2BZBA 5H6RB 1A2VA 3UTKA 4ZEYA 4DO0A 2ZM8A 2OWPA 1U5OA 2X0HA 4I5QA 1IAPA 3M8CA 3QK9A 2BS4A 1AVKA 4IE4A 4EYCA 2PJQA 3D5GA 4KUMB 3UL5A 2WCAA 3PUGA 3UUNA 1WTHA 5HEHA 2XQAA 3NM2A 3P4PA 3EHZA 4HKAA 1IT8A 5IG4A 2H0GA 4H63H 3AEDA 2KF5A 3J7Yd 3VRBA 2IHR1 4WFOA 2WWUA 2CHNA 4AQFC 2H88A 2XHEB 3I563 3NV0A 5LG3A 1I70A 2CWTA 4HYZA 2KAAA 3I1AA 4KHZF 4TNVA 4N6NB 4H3UA 1IZNB 2VQFT 4FMDA 1YVSA 1BNGA 2CIUA 3LTAA 1RHLA 2DNXA 3RDEA 2XAJB 5LYJE 5HXEA 2CWVA 1KFYA 3GSPA 3VSYA 3ZYLA 3KVBA 4PW8A 1SQWA 4QX7B 3DMCA 2CLYB 2F98A 2XH9A 3PCRA 1JV2B 1YQ4A 2K5BB 1OWAA 3RKOA 1HX8A 2XPKA 4L7KA 4EYUA 1D1AA 2V7IA 4A56A 5CGMA 2IA7A 2ACZA 3QC9A 4JI2T 3NHXA 1D0XA 2GBWB 4Z8XA 1X79A 2K3WA 4MMZB 3LXUX 4CZZB 2SBLA 1UDII 4DKIA 1LVKA 1YI23 3RRWA 1G73A 1QMAA 4ZHQE 4L9IA 2XSAA 1X1UA 2OTJ3 3C4WA 2STDA 5JR9B 3DY5A 1D0YA 1HCIA 2XQ9A 1D6ZA 5FGOA 3SOAA 2CCQA 4CN1A 3FF0A 4KZ1A 2BG9A 3CX6B 1W4NA 3K7CA 3T8NA 4WZXA 3UFEA 2CXFA 3E22E 1LOVA 4R1KA 3ONJA 2L3LA 3FBLA 3MA9A 1NB3I 5JPPA 2H7OA 2IMJA 2MOZA 2W04A 3ETUA 2LLYA 3L8RA 3SVAA 4ISSA 1VQ53 1RNTA 1OCVA 2NWBA 2LYXA 2A72A 4IE6A 4LEHA 4O02B 1BRHA 4PJJA 2V6YB 1R4YA 4KX6A 2OTL3 1SE7A 1KEYA 1VQ83 1Q42A 2E9XC 5L3DB 1MWRA 2LHNA 3ZN0B 4HM6B 4NXNT 4YJ3E 2DWKA 4COFA 3NVOA 4KI0F 3ZEFB 3PV0F 4HWFA 4NIQA 3ANWB 2Q07A 4KBMB 4F8HA 1G02A 4ZZBA 4DR4T 4CPKA 5IG5A 4QWNB 2ZHXB 3AXJB 1WFDA 3EDUA 3FG1A 2KXPB 1FGQA 2J47A 5FNVE 3O9XA 1H7CA 4MMYB 3FLJA 3G4S3 3JUQA 3AA7B 1SARA 1E3VA 3VR9A 5DQWA 4M1PA 3Q1CA 4HM8B 3V92A 2HOHA 1Q864 2Z6EA 5ABEA 1F8NA 5JDMA 2GSPA 4HM1B 3DUKA 5DQVA 4ZI7E 4A5XA 3TKLB 2RGQA 5CJ5A 4AI6A 1DU2A 3EBTA 3P4RA 2WP9A 3F57A 3NUVA 3C4ZA 3HZPA 3B57A 3Q9DA 1JKGB 2P0MA 4Z90A 3SLUA 1Z1SA 2MBGA 3DGMA 4K1UA 2I59A 3CNMA 4DBRA 2W00A 1DETA 3KV6A 2WU2A 3WHOA 4RNYA 2YU1A 3R6NA 3D0TA 2XR8B 2W0QA 2BMQB 2J8XB 1AV4A 3LK42 5LNKA 4KFDA 2JMHA 4LMLA 1BANA 2W66A 1E2AA 2VWAA 4DR3T 3F8XA 1XZYA 2OV9A 1JBTA 4IDZA 3WA2X 1X1XA 4EOZB 5ABGA 3IJEB 5HEGA 3GWHA 4H9PC 4YSZA 1B7TA 5LBMA 3C51A 3LG7A 2VASA 3RGRA 1J5WA 3CIRA 4GYRA 2XQYA 5JQGE 4FMBA 1OHPA 2AADA 4V1Av 4YSXA 3B5MA 5AQMB 3BQLA 2NOXA 3BK9A 5IEPA 2JQKA 3RIAA 3Q3FA 5KMGP 2P09A 2D42A 1ISKA 4HVNA 1B2XA 4KT3B 1MNEA 4WYKB 1YIJ3 3F31A 2VQET 4JEUB 1UX5A 5EK2A 5RNTA 1T5YA 3F8HA 5AI1A 1N9EA 2WGQA 3NZQA 1N5HA 2XASB 5L47A 3L3PA 3PUSA 5FXZA 3RYCE 4LF4T 3JUOA 3UT5E 1K41A 3ZG0A 1KC84 4NUVA 1Q824 5L4HA 1GMPA 2J4GA 2KWHA 5EK4A 1BR0A 1TJDA 3CNXA 3EJVA 1JB2A 3VU7H 1LQGC 1STFI 4ZZCA 1NO3A 2FBWA 1EUIC 1BIRA 3G16A 5IERA 4ORLA 3QB5A 5AQIB 3K5TA 3BNDA 3ZC0A 1W0AA 5E0OA 3AMOB 3CPZA 1RGGA 4GB5A 5BMVE 5L3CB 2Q9QD 4HWIB 4TX5A 4HFIA 1B3SA 3Q5EA 2J62A 3RRCA 3MK7C 3FZHB 3I9YA 3O1IA 3SOLA 1QAFA 4MHCA 2C5KT 2MTQA 4LZIA 4AKIA 4YFSA 3UULA 5AQKB 5CA0E 1CYVA 3T8UA 2RNTA 1J1JA 3JADA 2MYSA 2WS3A 2LSIA 4DMWA 4EV2A 3L0RA 4EGWA 3EQQB 3WOFB 3ER7A 5L3GB 2CG1A 1YXRA 2MPKA 2W2CA 3Q90A 2CFLA 4U2YA 1D1CA 4QX8B 4X5TA 2ML6A 1ULJB 4K0UA 3L09A 3N9HA 5HGRA 2LEHA 2XGNA 2LM9A 5IWAT 3WDGB 5JDHA 2WZIA 2NP9A 3EF8A 3CQGB 1VOMA 5AQOB 3MACA 3FG4A 2CEAA 1D6YA 5HCMA 3UNLA 2CPTA 4CN4A 2W61A 1ROVA 3LDQB 4HBRA 4GKKT 4HE8A 1HX1B 1TFOA 3ZN1B 1JJ22 4G2AA 4AXPA 3LTDA 3R84B 4A98A 3RYFE 3WI3A 2LRKA 1S35A 5HXRA 4OFZA 1WNHA 2BS3A 1LVFA 2CFGA 3B8LA 5AQVB 2BU4A 1YKHB 1UW1A 1IVUA 1V9DA 2HPJA 1Q9EA 1OUNA 3IHRA 3GN5A 5JR9A 2PNCA 1HS7A 2K54A 4UR9A 2IUBA 4BJMA 3PUVF 3KKGA 1OHOA 3PU8A 4EV6A 1CYUA 4J9AA 3AE7A 2XM2A 2LQVA 4XBXA 3G6E3 4YTPA 3ZMVB 4FJOA 1RSNA 3FZLB 1X1WA 2XAFB 4IE5A 1LOYA 2GEXA 3D4AA 1DVCA 5JPUA 2E2TA 4OVMA 4AIUA 4EIWA 5J0ZA 2YK0A 1ZV4X 2BIRA 4O2BE 3ZYMA 3QRDA 1NU3A 3BQIA 3CME3 1D0ZA 2Q9QB 4CXYA 4U3CA 4FCMA 4JRFA 1US1A 4AKGA 3CC73 2V6YA 1MNLA 2WAUA 2BBHA 3OYXA 2CM0A 1W9RA 1BRIA 2BKOA 2XQ7A 4P0BA 4LF8T 2V1DB 3AAAB 4JI0T 3ZT5A 1GOUA 3AVSA 4GK0E 1OGZA 2HMKB 3P4QA 2M6BA 3ANWA 1W2ZA 3UQ4A 4I0UA 1QAKA 4C91A 2LSGA 1S94A 2UUAT 2IYJA 1GYBA 1QJGA 3AXJA 5M1AA 3NWIA 1NB5I 3BB9A 1BRNL 3S27A 5HXSA 3KCHA 1W7CA 2H0IA 4H9SE 1HYFA 1Q40A 3P7IA 3F7XA 3V98A 4LFCT 4HFBA 4TWDA 4JI1T 1O7NB 2XAGB 1B20A 2K48A 2CFDA 3N54B 1NDOB 2XJ7A 2M7OA 1V74A 4U7IA 1WMNA 4P0AA 5AQFB 1MWTA 4E7SA 3CCL3 1VCSA 5H6QB 1QSDA 4R4KA 3LH4A 3EVYA 4WNKA 2AAEA 2JQHA 4HFHA 4N6UA 4DR7T 4HWHA 3G06A 5FP3A 4X65T 2YINA 2Y8DA 4I50E 1RGAA 2L8KA 3T1HT 4MJDA 3ZT7A 4XZCA 3RC3A 3EBYA 2IUJA 3WAJA 3MG3A 2CWYA 3KSPA 2XFSA 5HEOA 1BNIA 3PJAA 3IMAB 4GOUA 1BSEA 1NEKA 3AEBA 1FMWA 1FUTA 3CC23 2RSXA 4N6OB 3OYZA 3ZSTA 5EVHA 2FJBA 1BRKA 2QA7A 1IU7A 3NQZA 3K3OA 3PUYF 1Q814 1AVLA 2DWGA 2XAQB 4H63V 2VURA 2Z7AA 3H3MA 2IW5B 5D81A 4J2CA 1U8CB 3CCR3 3B13A 1UUSA 1B2ZA 1BSDA 3GZBA 2WB5A 4AEQA 1OEDE 5ETWA 1FGRA 4QXHB 2RP4A 2CFWA 3JUPA 3PDYA 1AQZA 3OW22 4JI4T 1W6CA 2FJAA 4BTYA 3HKEE 1CUNA 3B4OA 4PK5A 4BJNA 3RQWA 1T2HA 2E9XB 2FJEA 3A76A 4QHOA 3KFWX 1VQP3 3ONXA 2RA1A 1IDPA 2VVSA 1W00A 1C7HA 4WYKA 2OOVC 3N2OA 1N34T 1IBMT 3AB3B 3UU6A 1TRQA 2B24B 3ONLC 1NWMX 5JDNA 1T8BA 4X64T 4UVBB 4EXRA 4XBYA 2CH9A 5HEUA 4FI5A 1Y4KA 5AYRB 2X9HA 5AQPB 2WGOA 5BXQA 1B2UA 2CBIA 1WQLB 4OX9T 1M904 1UX4A 2F5MA 2OQEC 4U72A 3ROBA 1NNVA 2DCFA 1N8R4 1RDSA 1VRBA 4HFDA 2WY2A 2CHCA 6GSPA 5JREA 4PEJA 3AMOA 1FUSA 2L4VA 1FGMA 4LSOA 1WMPA 4LMJA 5M19A 4ILAA 3T1YT 2KZ7B 2YKSA 3SWHA 2KXGA 2Z77A 2F4YA 2XQ3A 2P05A 1VQO3 1Y01A 5TGNA 1N33T 1E7PA 5BR8T 4U2ZA 3FGYA 4ILCA 3LYGA 2K9AA 2WDRA 2BKNA 5HWXA 3N9OA 3RPUA 2KF4A 1DYUA 5KX5E 3UQ7A 3JC6C 4PFPA 1BRJA 2WDQA 4IT7A 3JUMA 3F2EA 2WMOA 1O7PB 1ZHCA 2YX9A 1T2IA 1SUMB 4UV8B 2KMFA 2ODVA 3A8YC 3OKQA 4ILUA 3LK3B 1TRPA 4EW5A 1SHZC 2NR4A 3AEGA 2PG8A 3AE1A 3PCSA 2IC9A 1ROAA 3RYHE 2L1SA 3VHLA 5IG3A 5AIHA 1NJI4 3HR0A 5HWYA 3OWSA 1FEWA 4ADZA 3CVRA 3Q5WA 2QRXA 2W6JH 3FXEB 4MLKA 3AEFA 3DH2A 5AQGB 3VKGA 4U7YA 3ZPOA 1G96A 2PBIA 5JRCB 1LVNA 1ASKA 5DJQC 4JF8A 1UI8A 2WM9A 3GN5B 1IV9A 1TTOA 4L8PA 2D5UA 3D9RA 2KINB 3CCV3 1Z8UA 1AJ3A 4RNZA 3X42A 1GY7A 5FY0A 4P1NA 3ECFA 2L9QA 3BU4A 4N6MA 2K3DA 1IV7A 4LMIA 3ZCIA 2AXDS 2PZVA 1JZDA 3LTCA 4AKRB 4DNDA 4GK5E 4GIWA 3AEEA 1VQM3 3I0OA 4DV0T 1ULIB 2IAKA 3NBXX 3O4XE 1VQ63 3KINB 2UX0A 4K90B 3TDGA 4Q25A 1GY6A 4WBNE 1D6UA 5ELJA 1BNEA 3V5SA 3ZMZB 1D1BA 1VQ73 1UGIA 2CHOA 2P38A 5L2LA 2LT3A 2LOPA 5KDMC 2YFJB 5KP1A 3KV5A 1FA3A 4RBNA 3PXMA 4CN6A 3URPA 2HHHT 2Q9QA 4FR9A 1WCRA 3ZYKA 1DVDA 1GSPA 2M67A 4HM3B 4CI1B 4DUZT 1HFAA 2IDOB 1M62A 1OF5B 7RNTA 3WAKA 2CXDA 1Q40B 3C4XA 3MHEA 1KNRA 1MIVA 4OYJA 2CW9A 3X1DA 3LT8A 1BOXA 5EZYE 1Z0PA 2XEPA 3BNEA 3K9MC 1FGOA 4LYLB 4HM0B 2XQ6A 1ZKEA 3X40A 1GMQA 2WZHA 2ZMAA 3BQKA 4ZI2D 1IQ8A 1WYBA 5IEOA 2ES0A 3VRAA 1J5ET 1DE3A 2CE7A 5IYZE 1M1K4 5AFUL 3RKGA 5AQHB 5HEJA 1FGTA 4X2HA 1Q7HA 3H3HA 2ZM0A 5LC6A 5FXXA 2E2AA 2QGUA 3E08A 1PU4A 3AGNA 2FXTA 3S4UA 3LT9A 5ABFB 4KFFA 4OYKA 4WHAA 3B7CA 2JJ9A 3O8YA 3T8OA 2SPCA 1BVIA 4PNIA 3AE3A 4JLEA 2C4BA 3GWRA 2W2UA 3OVUA 2V6XA 4TX4A 5L4EA 4EAHA 5D83A 3D79A 3ZJ2A 4AKZA 3KBUA 3N5LA 1T72A 1X9BA 2CK3H 2KSRA 2CLYC 2IC6A 2X67A 2IUKA 1BNJA 3HX8A 2JIWA 3UUXB 1O7HB 2EHOC 1OEDB 4AISA 1MIYA 2OCTA 3J7Yq 5FL0A 3DM8A 1RRLA 4GHOA 3QK6A 3K63A 3QOFA 4K61A 3EE1A 1JB5A 2XQ4A 3UFGA 1WR0A 5KXJA 3HIGA 5LG4A 3DP7A 5STDA 2NW7A 4WW0A 2XM1A 4JI7T 3ABVA 1OH0A 4YTMA 3V5UA 1N32T 3KV4A 1RCKA 3VKHA 2E9XA 1CH0A 4G1MB 1M7KA 5LXTE 1KNZA 4NHFA 5JDQA 3HKCE 4HM5B 4IL4A 5JR9C 2ZL8A 5LGUB 5BIRA 2F4VT 3I0YA 2VKJA 3CCJ3 4TV9E 5FY7A 3AAIA 5DREA 4WP5A 2QYWA 4UELA 3OPCA 4BA9A 4STDA 2YDRA 3UU8A 4XBTA 3RGAA 1VQQA 4J5KA 1MMDA 3KBTA 3ZCJA 1IBLT 5F8PA 3UU4A 1KNPA 1HNXT 1ZOYA 2X66A 3NX0A 3OBVE 4BL3A 2W4XA 3VF1A 2V5CA 3Q5DA 5CXOA 4CI2B 4U31A 1KWIA 1LQMB 4LGQA 2UXXB 1I2FA 3IPTA 3RLFF 2HH7A 4PAGA 4LFBT 2LSYA 2LKGA 2Y48B 1DMNA 3RQUA 3ZC1A 4OK0A 2CA5A 2X68A 3EX9A 5LHGB 2B1EA 3GRDA 3NZPA 2CBJA 4EV5A 3CX7B 4X62T 4LF9T 1GD3A 3FKAA 1QVG2 1Q7Y4 1JBRA 4YXDA 1VQK3 2FUPA 2VL8A 4ASKA 2C11A 1I3FA 1TUHA 1RN7A 3ETVA 1RGFA 4NUUA 5FVKA 2A2FX 1MGWA 3N9LA 2Y73A 4CQIA 4GYSA 3MPHA 1KQS2 4IE0A 3TLUA 1UK5A 4ZOLE 3HOHA 1GQEA 3PUAA 4DR6T 5AIIA 2NTXA 3KV9A 1HF8A 3CX8B 3KVAA 3RI5A 1O7GB 3OX9A 1XDPA 3F14A 3QUJA 3J9X1 4DVDA 3AE9A 3S29A 4BAYB 3HA4A 2BVLA 3FZMB 2I6HA 3HIIA 1K9M4 2V26A 2VKHA 2Y6XA 2GXFA 2BDEA 4GL6A 4IDOA 1UCJA 1OHSA 5AQQB 4CDLA 1SJWA
chains in the Genus database with same CATH topology
2WBLA 1UCUA 3CD63 3V99A 4MEIA 2E8IA 3FXDB 5JRCA 2LJLA 2N2NA 4R80A 4ISTA 4UF0B 3RC8A 5CF1A 3H3AA 2W0GA 2QGSA 4WBOA 4PJLA 4ZI3D 2KCDA 5J1GA 3NBJA 3P8CD 1EQKA 2C10A 5LCYA 2P9BA 1O7MB 1YGEA 1IK3A 4CCVA 2BHMA 1QUUA 4IIAA 2X51A 2CKFB 4AKYA 3T0UA 2QA43 1YHQ3 2BT3A 4DBQA 1JN5B 1UI7A 1WR6A 4FCZA 2E9XD 3ESLA 3C64A 3RYIE 3PUQA 4MALA 1SIIA 2XTLA 2QEX3 4KP3C 4N6TA 5GONE 1UUVB 4PK4A 2I9WA 4O4JE 2MF7A 4O4IE 4FMAA 1OF5A 4QXCB 3U78A 4XDVA 4QWTA 3WA3A 5JH7E 1FIOA 3NBBA 1JRQA 3OWYA 2YEVC 3ZMUB 1ZX2A 4QXBB 1LKXA 2ZM2A 1K8A4 2HMLB 3CC43 1HG2A 3PTRB 4ZI2C 2YFLB 5EEOA 4PK6A 1A90A 3LMLA 3N9QA 4HN9A 2WO0A 3GMIA 3CWZB 2OA5A 2JQ5A 4FCJA 4ERRA 3FZWA 1FMVA 3LK2B 1VQN3 4EZHA 3MZKB 2WMNA 3U1WA 2YU2A 1GD4A 4L8OA 4B6XA 5IHYA 2W9PA 2W9QA 3X3YA 5FYMA 1NAFA 3H37A 1TU5A 1YD8G 2WOFA 3FSDA 5LOVE 4BTWA 3CPW2 4ZS3A 1FUWA 4XAXB 2C5IT 2D0UA 4N6LA 4J8TA 1GY5A 1O3XA 2V7JA 2X0LB 3NM7A 5KP3A 3MG2A 4U74A 5HAXA 1KK7A 3N2GE 4UEMA 1LXEA 3S28A 3Q5XA 3C98B 4L5GA 2KT9A 4AKHA 4PJNA 3K0ZA 1QALA 3GA8A 4P09A 3UB1A 5IENA 3N9PA 2DLRA 4H9QC 2RCDA 3W15B 5G2GA 3GZRA 3MKDA 3MYTA 3RX6A 2CFKA 3WOEB 4MFRA 2G0UA 4JUYA 2GU1A 3CXC2 1MMNA 3N2KE 1DMMA 1OPYA 2Q9QC 4I55E 1RRHA 2BMRB 2W63A 3DZLA 3PGBA 5KP4A 2CWUA 3CCE3 5D82A 7STDA 1DMQA 1PFPA 3FG3A 4BTXA 5FMNA 2D1WA 4N3VA 2PFVA 2QIYA 1KD14 2VB6A 2KNDA 3SRZA 4I4KA 2MC8A 4PFOA 5ADXL 4XM4A 4X1YE 2GK9A 1WMOA 1N9JA 4AQGA 1G8XA 4XBFB 5AIGA 3EDVA 3GZXB 5AEUB 2XRXB 3CQXC 3A5XA 3C50A 2HMOB 2A15A 4IPBA 3G8ZA 2EHOB 3DJBA 1ZO2A 3KIIA 4ZS2A 5EK3A 1YW0A 1N5PA 1TFKA 3OWUA 2Z6BA 3U3IA 3D3LA 5C8YE 4UF0A 5IG0A 2HPLA 1WYCA 5HXCA 4KMCA 2XGLA 1GS3A 2W56B 1YIT3 1U4QA 3E0ZA 4ZI3C 5LJMA 2OOVA 3KSED 2NW9A 3ZMTB 2JPFA 2CMRA 1UUWB 2ZDJA 3AA1B 5L3FB 1J2BA 3AA0B 3MSOA 2R4IA 1EZ3A 2X9XA 5LJNA 2ZLYA 1LRZA 3F7SA 4U13A 5L3EB 2JQQA 1SPUA 3I9WA 3CMLA 2D2SA 2VK9A 2OQEA 2YFIB 5CB4E 4H9RC 2O9UX 4C90A 3E99A 1JN5A 3ZJ1A 1BR2A 3SX1A 2XSOB 2CG0A 2Z76A 1BUQA 1WRDA 3KFQC 3FHNA 1HU9A 1HKXA 3U97A 2KLQA 4H9OC 1JB4A 4AQFA 2JMKA 5CF2A 1MNDA 1IVXA 1K28A 3OV4A 2F99A 5JVDE 3HK4A 4HGAA 4EB6E 3EUHA 3LOYA 2GBXB 2HMJB 2ODUA 3CKDA 2H7VC 1S5AA 3PS8A 2K24A 3M65A 4ANJA 4CI3B 1CEWI 4IHJE 2BO9B 3FF2A 5ELUA 3EN1B 1STDA 3PE0A 1M9GA 3VGNA 4MMXB 3CCM3 2A3DA 5LGNB 3MKIA 1VZZA 3NRXA 3ZLIA 5AEWB 2HMNB 4X20E 3X3XA 3EB8A 4TZ4C 4QKNA 5LC7A 2VKOA 5AYSC 4O3VA 4FMCA 4O8SA 1LOXA 3IBPA 3MXZA 4HKVB 5J2UE 4O2HA 4HZBB 2V7LA 4OHFA 4RZMA 3MJXA 4O4HE 2WOHA 3STDA 2DHRA 1L5GB 4X2OA 4K1VA 3EN8A 2JRKA 5HYAA 3GAXA 2K0MA 1HG5A 1TIJA 1NWWA 3HI7A 1IT7A 2KRTA 4R9LA 1VQ93 2W62A 3N8BA 2DI4A 1SA0E 5J2TE 1A2KA 3LBXB 1OXZA 2BVMA 2C5JA 5DABA 4PJMA 3DGNA 5LBQB 4MBQA 5LP6E 4EYYR 3I553 3WMDA 4KVHA 1ZEEA 1US7B 3F9SA 3BLZA 4R9KA 4F6RC 4ZM8A 8CHOA 3HKBE 3EC9A 1IJ5A 4UVAB 3CU3A 3BNBA 2W03A 3I0QA 2VKDA 3S5CA 2BMOB 1QVF2 5LHHB 4YHJA 5L3BB 1KSIA 3FBZA 1CQSA 4N78D 2HMMB 2CWOA 2E2UA 1S723 1HTJF 2E2VA 3FCSB 5BVBA 3AA6B 5DRVA 4NREA 3NQYA 3N9NA 3NV0B 2WSSV 1W6YA 1YVBI 3CMA3 5EQLA 1W2B2 3JC6D 5JDFA 4UXNB 3NBRA 1IQXA 1YKEB 1JNQA 2N9DA 4G63A 2V1LA 1N8QA 2INXA 3FH1A 2NW8A 4HFVA 4E7ZA 3B4PA 4I43B 1YJW3 3JVCA 4Q53A 3Q2PA 5TAOA 3HL6A 3AVRA 3UL6A 2GEYA 3KZTA 2RFRA 3IF8B 3UUMA 2LHRA 3SS1A 1W02A 4N6V0 3CQCB 1LNHA 2EHOA 5HXHA 3LTBA 3CCU3 5FXVA 2X9YA 4IGUA 1OACA 5CLKA 4H61A 2XF3A 1R4CA 1T98A 5F3JA 4YLHA 2P0XA 1O7WB 3HKDE 2XFTA 5JDLA 4WWUC 4X1IE 3RH3A 2FNQA 1SIHA 1K734 5FW5A 1IQYA 1VQL3 4HM4B 4UV9B 2W56A 2CC3A 3CCS3 2ACXA 5JDGA 3G0KA 1MMAA 2GU3A 3Q2MA 4L0RA 4DMVA 4CXWA 1OGXA 3PYJA 3LFMA 2D0TA 3DTOA 3K8PC 4HEAA 2Y74A 3PURA 2C0SA 4IIJE 1W01A 4AKLA 3G713 2O3OA 4HJLB 3O1JA 3K3NA 1YJN3 1RJOA 1TP6A 2V7MA 4O4LE 3DGLA 5CA1E 2FGTA 2ML5A 3WODG 4EBGA 3MWZA 1YJ93 3OJAA 1Y64B 2V7KA 3ZMSB 1EG9B 1M1XB 5CK6A 3LJCA 4X1KE 1W6GA 1E97A 3LZAA 1EKMA 1IVVA 3KDSE 3N9MA 2LSJA 4CXXA 5I97A 4HTEA 1RKYA 4YJ2E 4JEHB 5LA6E 5LGTB 3SEDA 5JBSA 3K3QC 1W5ZA 3CCQ3 1IJ6A 2J1DG 2N1GA 3GZYB 4I4TE 2LSKA 1U5PA 5LHIB 4UIGA 4EXTA 3UJMA 3H51A 3FB2A 2XSHB 4HM2B 3IEEA 3DGOA 3KN4A 3SXXA 2LOSA 4UVCB 3JUNA 1A67A 6STDA 1EA2A 1JKGA 3ALAA 2H3RA 3EHCA 2XUEA 3NRYA 2LE8A 3SOYA 2BNGA 3NXJA 4H9NC 3AAEB 4O2AE 5IF6A 5A1LA 2CXLA 2XAHB 4KFEA 3KE7A 4TN7B 2EHOD 1VQ43 4TUYE 1BR4A 3HI2A 1IVWA 4HM7B 2JDIH 3PU3A 4TV8E 3CPOA 1MOLA 3BNCA 3X3ZA 3PZWA 3MG1A 2X9WA 5FY1A 1MMGA 4XDWA 5AIFA 1MIWA 3LBXA 3OXAA 3O1HA 4OUQA 1AR0A 4HZ9B 4XB5A 4EZ4A 5IW9A 2NTYA 4EC6A 2KWIB 5FXWA 3F40A 1WLXA 2B1XB 1E1HB 3X41A 3S67A 3DXOA 5M4YA 1E3RA 5A0OB 1BR1A 2UXNB 2F86B 4IE7A 2BZBA 5H6RB 1A2VA 3UTKA 4DO0A 2ZM8A 2OWPA 1U5OA 1IAPA 3M8CA 3QK9A 1AVKA 4IE4A 4EYCA 2PJQA 4KUMB 3UL5A 3PUGA 3UUNA 1WTHA 3NM2A 4HKAA 1IT8A 5IG4A 4H63H 3J7Yd 4WFOA 2WWUA 4AQFC 2XHEB 3I563 3NV0A 2CWTA 4HYZA 3I1AA 4N6NB 4H3UA 1IZNB 4FMDA 2CIUA 3LTAA 2DNXA 3RDEA 2XAJB 5LYJE 5HXEA 2CWVA 3VSYA 3KVBA 4PW8A 3ZYLA 1SQWA 4QX7B 3DMCA 2CLYB 2F98A 2XH9A 3PCRA 1JV2B 2K5BB 1OWAA 3RKOA 1HX8A 4L7KA 4EYUA 1D1AA 2V7IA 4A56A 2IA7A 3QC9A 3NHXA 1D0XA 2GBWB 4Z8XA 1X79A 4MMZB 3LXUX 4CZZB 2SBLA 1LVKA 1YI23 3RRWA 1G73A 1QMAA 4ZHQE 4L9IA 2OTJ3 3C4WA 2STDA 5JR9B 3DY5A 1D0YA 1HCIA 1D6ZA 5FGOA 3SOAA 2CCQA 3FF0A 4KZ1A 3CX6B 1W4NA 3K7CA 3T8NA 3UFEA 2CXFA 3E22E 4R1KA 2L3LA 3FBLA 3MA9A 1NB3I 5JPPA 2H7OA 2IMJA 2MOZA 2W04A 3ETUA 3SVAA 4ISSA 1VQ53 1OCVA 2NWBA 2LYXA 2A72A 4IE6A 4LEHA 4O02B 4PJJA 2OTL3 1VQ83 1Q42A 2E9XC 5L3DB 2LHNA 3ZN0B 4HM6B 4YJ3E 2DWKA 3ZEFB 3ANWB 2Q07A 4KBMB 5IG5A 4QWNB 3EDUA 3FG1A 2KXPB 1FGQA 5FNVE 3O9XA 1H7CA 4MMYB 3FLJA 3G4S3 3JUQA 3AA7B 1E3VA 5DQWA 4M1PA 3Q1CA 4HM8B 3V92A 1Q864 2Z6EA 1F8NA 5JDMA 4HM1B 3DUKA 5DQVA 4ZI7E 3TKLB 2RGQA 4AI6A 3EBTA 3F57A 3NUVA 3C4ZA 3HZPA 3B57A 3Q9DA 1JKGB 2P0MA 3SLUA 1Z1SA 2MBGA 3DGMA 4K1UA 2I59A 3CNMA 4DBRA 2W00A 3KV6A 4RNYA 2YU1A 3R6NA 3D0TA 2XR8B 2W0QA 2BMQB 1AV4A 3LK42 5LNKA 4KFDA 2JMHA 2VWAA 3F8XA 4IDZA 3WA2X 4EOZB 3IJEB 3GWHA 4H9PC 1B7TA 5LBMA 3C51A 3LG7A 2VASA 3RGRA 4GYRA 2XQYA 5JQGE 4FMBA 1OHPA 4V1Av 3BQLA 2NOXA 3BK9A 5IEPA 5KMGP 2P09A 2D42A 1ISKA 4HVNA 1MNEA 4WYKB 1YIJ3 3F31A 4JEUB 1UX5A 5EK2A 1T5YA 3F8HA 5AI1A 1N9EA 2WGQA 3NZQA 1N5HA 2XASB 3L3PA 3PUSA 5FXZA 3RYCE 3JUOA 3UT5E 1K41A 1KC84 4NUVA 1Q824 2KWHA 5EK4A 1BR0A 3CNXA 3EJVA 1JB2A 3VU7H 1STFI 1NO3A 3G16A 5IERA 4ORLA 3K5TA 3BNDA 3ZC0A 5E0OA 3AMOB 3CPZA 4GB5A 5BMVE 5L3CB 2Q9QD 4TX5A 3RRCA 3MK7C 3I9YA 3O1IA 3SOLA 1QAFA 4MHCA 2C5KT 2MTQA 4LZIA 4AKIA 4YFSA 3UULA 5CA0E 1CYVA 3T8UA 2MYSA 2LSIA 4DMWA 4EV2A 3L0RA 3EQQB 3WOFB 3ER7A 5L3GB 2CG1A 3Q90A 2W2CA 2CFLA 1D1CA 4QX8B 2ML6A 1ULJB 4K0UA 3L09A 3N9HA 5HGRA 2LEHA 2XGNA 2LM9A 3WDGB 5JDHA 2NP9A 3EF8A 3CQGB 1VOMA 3MACA 3FG4A 2CEAA 1D6YA 3UNLA 2W61A 1ROVA 4HBRA 4HE8A 1TFOA 3ZN1B 1JJ22 4G2AA 4AXPA 3LTDA 3R84B 3RYFE 3WI3A 1S35A 5HXRA 4OFZA 1WNHA 1LVFA 2CFGA 3B8LA 1YKHB 1UW1A 1IVUA 1V9DA 2HPJA 1OUNA 3IHRA 3GN5A 5JR9A 2PNCA 1HS7A 2K54A 4BJMA 3KKGA 1OHOA 3PU8A 1CYUA 4J9AA 2LQVA 4XBXA 3G6E3 3ZMVB 4FJOA 2GEXA 2XAFB 4IE5A 1DVCA 5JPUA 2E2TA 4OVMA 4EIWA 2YK0A 1ZV4X 4O2BE 3ZYMA 3QRDA 1NU3A 3BQIA 3CME3 1D0ZA 2Q9QB 4CXYA 4FCMA 4JRFA 1US1A 4AKGA 3CC73 1MNLA 2WAUA 3OYXA 2CM0A 4P0BA 2V1DB 3AAAB 3AVSA 4GK0E 1OGZA 2HMKB 3ANWA 1W2ZA 1QAKA 4C91A 2LSGA 1S94A 1GYBA 1QJGA 1NB5I 3BB9A 3S27A 5HXSA 1W7CA 4H9SE 1Q40A 3P7IA 3F7XA 3V98A 1O7NB 2XAGB 2K48A 2CFDA 3N54B 1NDOB 2M7OA 1V74A 1WMNA 4P0AA 3CCL3 4E7SA 5H6QB 1QSDA 4R4KA 3LH4A 3EVYA 4WNKA 4N6UA 5FP3A 2YINA 2Y8DA 4I50E 2L8KA 4MJDA 4XZCA 3RC3A 3EBYA 2IUJA 3WAJA 3MG3A 2CWYA 3KSPA 2XFSA 3IMAB 4GOUA 1FMWA 3CC23 2RSXA 4N6OB 3OYZA 5EVHA 2QA7A 1IU7A 3NQZA 3K3OA 1Q814 1AVLA 2DWGA 2XAQB 4H63V 2Z7AA 2IW5B 5D81A 4J2CA 1U8CB 3CCR3 3B13A 3GZBA 4AEQA 5ETWA 1FGRA 4QXHB 2RP4A 2CFWA 3JUPA 3PDYA 3OW22 1W6CA 4BTYA 3HKEE 1CUNA 3B4OA 4PK5A 4BJNA 2E9XB 3A76A 4QHOA 3KFWX 1VQP3 3ONXA 2RA1A 1IDPA 1W00A 1C7HA 4WYKA 2OOVC 3N2OA 3AB3B 2B24B 1NWMX 5JDNA 4UVBB 4EXRA 4XBYA 2CH9A 4FI5A 1Y4KA 5AYRB 2X9HA 5BXQA 2WGOA 1WQLB 1M904 1UX4A 2OQEC 4U72A 3ROBA 1N8R4 2DCFA 1VRBA 2CHCA 5JREA 4PEJA 3AMOA 2L4VA 1FGMA 4LSOA 1WMPA 2KZ7B 3SWHA 2KXGA 2Z77A 1VQO3 2P05A 5TGNA 3FGYA 3LYGA 2K9AA 5HWXA 3N9OA 3RPUA 1DYUA 5KX5E 3JC6C 4PFPA 4IT7A 3JUMA 3F2EA 2WMOA 1O7PB 1ZHCA 2YX9A 4UV8B 2KMFA 2ODVA 3OKQA 4ILUA 3LK3B 1SHZC 2PG8A 3PCSA 2IC9A 1ROAA 3RYHE 3VHLA 5IG3A 5AIHA 1NJI4 3HR0A 5HWYA 3OWSA 1FEWA 4ADZA 3CVRA 3Q5WA 2W6JH 3FXEB 4MLKA 3VKGA 3ZPOA 1G96A 2PBIA 5JRCB 1LVNA 1ASKA 5DJQC 4JF8A 1UI8A 2WM9A 3GN5B 1IV9A 4L8PA 2D5UA 3D9RA 2KINB 3CCV3 1AJ3A 4RNZA 3X42A 1GY7A 5FY0A 3ECFA 2L9QA 4N6MA 1IV7A 4LMIA 3ZCIA 2PZVA 3LTCA 4AKRB 4DNDA 4GK5E 4GIWA 1VQM3 3I0OA 1ULIB 2IAKA 3NBXX 3O4XE 1VQ63 3KINB 2UX0A 4K90B 3TDGA 1GY6A 4WBNE 1D6UA 5ELJA 3V5SA 3ZMZB 1D1BA 1VQ73 2P38A 5L2LA 2LT3A 2LOPA 5KDMC 2YFJB 5KP1A 3KV5A 1FA3A 4RBNA 3PXMA 4FR9A 2Q9QA 3ZYKA 1DVDA 2M67A 4HM3B 4CI1B 1HFAA 1OF5B 3WAKA 2CXDA 1Q40B 3C4XA 3MHEA 1MIVA 4OYJA 2CW9A 3LT8A 5EZYE 1Z0PA 2XEPA 3BNEA 3K9MC 1FGOA 4HM0B 1ZKEA 3X40A 2ZMAA 3BQKA 4ZI2D 1IQ8A 1WYBA 5IEOA 2ES0A 2CE7A 5IYZE 1M1K4 5AFUL 1FGTA 4X2HA 3H3HA 2ZM0A 5LC6A 5FXXA 2QGUA 3E08A 1PU4A 2FXTA 3S4UA 3LT9A 4KFFA 4OYKA 4WHAA 3B7CA 2JJ9A 3O8YA 3T8OA 2SPCA 4PNIA 4JLEA 3GWRA 4TX4A 4EAHA 5D83A 3ZJ2A 4AKZA 3KBUA 3N5LA 2CK3H 2CLYC 2IC6A 2X67A 2IUKA 3HX8A 3UUXB 1O7HB 2EHOC 1MIYA 2OCTA 3J7Yq 3DM8A 1RRLA 3QK6A 3K63A 4K61A 3EE1A 1JB5A 3HIGA 5LG4A 3DP7A 5STDA 2NW7A 4WW0A 1OH0A 3V5UA 3KV4A 3VKHA 2E9XA 4G1MB 5LXTE 4NHFA 1KNZA 5JDQA 3HKCE 4HM5B 5JR9C 2ZL8A 5LGUB 3I0YA 2VKJA 3CCJ3 4TV9E 5FY7A 3AAIA 5DREA 4WP5A 4UELA 4BA9A 4STDA 4XBTA 3RGAA 1MMDA 3KBTA 3ZCJA 5F8PA 2X66A 3NX0A 3OBVE 3VF1A 5CXOA 4CI2B 1KWIA 4LGQA 2UXXB 3IPTA 2HH7A 4PAGA 2LSYA 2Y48B 1DMNA 3ZC1A 4OK0A 2CA5A 2X68A 3EX9A 5LHGB 2B1EA 3GRDA 3NZPA 4EV5A 3CX7B 1GD3A 3FKAA 1QVG2 1Q7Y4 1VQK3 2VL8A 4ASKA 2C11A 1TUHA 1RN7A 3ETVA 4NUUA 2A2FX 3N9LA 2Y73A 4CQIA 4GYSA 3MPHA 1KQS2 4IE0A 4ZOLE 3PUAA 5AIIA 2NTXA 3KV9A 1HF8A 3CX8B 3KVAA 1O7GB 3OX9A 3F14A 3QUJA 3J9X1 4DVDA 3S29A 4BAYB 3HA4A 2BVLA 3HIIA 1K9M4 2V26A 2VKHA 2Y6XA 2GXFA 2BDEA 4GL6A 1OHSA 4CDLA 1SJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OK0 A;  4O8S A; 
#chains in the Genus database with same CATH topology
 2WBL A;  4LF6 T;  1UCU A;  2JQ9 A;  3CD6 3;  3V99 A;  3UU3 A;  4MEI A;  4DV6 T;  2E8I A;  3FXD B;  5JRC A;  2LJL A;  2N2N A;  4R80 A;  4IST A;  4UF0 B;  3RC8 A;  5CF1 A;  3H3A A;  2W0G A;  1BU4 A;  2QGS A;  4WBO A;  4PJL A;  4DV7 T;  2SAR A;  4ZI3 D;  2KCD A;  1G0T A;  5J1G A;  3NBJ A;  3EI0 A;  1NEN A;  1BGS A;  3P8C D;  1LNI A;  1EQK A;  4LFA T;  2C10 A;  1XDO A;  5LCY A;  1RGC A;  4QH4 A;  2P9B A;  1O7M B;  1YGE A;  1IK3 A;  4CCV A;  2BHM A;  1L0V A;  4GKJ T;  1QUU A;  4IIA A;  2X51 A;  2CKF B;  4AKY A;  3T0U A;  2QA4 3;  1YHQ 3;  5GSP A;  2BT3 A;  4DBQ A;  2KF6 A;  1JN5 B;  1UI7 A;  5AQJ B;  1WR6 A;  4FCZ A;  2E9X D;  4NPB A;  3ESL A;  3C64 A;  3RYI E;  3PUQ A;  4MAL A;  5AQR B;  1SII A;  2XTL A;  4HAA A;  2QEX 3;  4KP3 C;  4N6T A;  3AE6 A;  1BAO A;  5GON E;  3RIU C;  1UUV B;  3RGL A;  4PK4 A;  2I9W A;  4O4J E;  1BNF A;  2MF7 A;  4O4I E;  4FMA A;  1OF5 A;  4QXC B;  3U78 A;  4XDV A;  2E5V A;  2UGI A;  4QWT A;  3WA3 A;  5JH7 E;  1FIO A;  3NBB A;  1JRQ A;  3OWY A;  2WDV A;  3AE5 A;  2YEV C;  2LRL A;  3ZMU B;  1ZX2 A;  1BRG A;  4QXB B;  1RCL A;  1LKX A;  2ZM2 A;  1K8A 4;  3JAE A;  2HML B;  3CC4 3;  1HG2 A;  3PTR B;  3EAB A;  4ZI2 C;  2YFL B;  5EEO A;  5AQL B;  4PK6 A;  2YDQ A;  1BNS A;  1A90 A;  3LML A;  3N9Q A;  4HN9 A;  2WO0 A;  3IA3 A;  3GMI A;  3CWZ B;  2OA5 A;  2JQ5 A;  4FCJ A;  4ERR A;  1JNR A;  3FZW A;  1FMV A;  3LK2 B;  1VQN 3;  1R8I A;  4EZH A;  1FJG T;  3MZK B;  5ABF A;  2WMN A;  3U1W A;  2YU2 A;  1GD4 A;  2BS2 A;  1YGW A;  4L8O A;  1RN1 A;  3A5E A;  4B6X A;  4B3T T;  1RMS A;  1BUJ A;  2UXB T;  5IHY A;  2W9P A;  2W9Q A;  3X3Y A;  5FYM A;  1NAF A;  3H37 A;  1TU5 A;  1YD8 G;  4B3M T;  4AQY T;  3AHW A;  3JCF A;  2WOF A;  4JI5 T;  5LOV E;  3FSD A;  4BTW A;  3CPW 2;  1B2M A;  4ZS3 A;  1FUW A;  2A9U A;  4XAX B;  2C5I T;  2D0U A;  4N6L A;  1OED A;  4J8T A;  3VR8 A;  1GY5 A;  1O3X A;  2V7J A;  2X0L B;  3NM7 A;  3ZKR A;  5KP3 A;  1MGR A;  4LF5 T;  1UCL A;  3MG2 A;  4U74 A;  4HWC A;  5HAX A;  5LB7 B;  1KK7 A;  3N2G E;  2X0Y A;  4UEM A;  1LXE A;  3S28 A;  2R41 A;  3Q5X A;  5AQS B;  3C98 B;  4L5G A;  2KT9 A;  4AKH A;  4PJN A;  3K0Z A;  2BG9 C;  4A97 A;  3AEC A;  1QAL A;  3GA8 A;  4P09 A;  4HFE A;  4QH5 A;  5G1K A;  3UB1 A;  9RNT A;  5IEN A;  2WWV A;  3N9P A;  5HCJ A;  2DLR A;  4H9Q C;  3ZSS A;  3ZT6 A;  1UCK A;  2RCD A;  3AHS A;  3W15 B;  5G2G A;  3GZR A;  3MKD A;  3MYT A;  3RX6 A;  1JBS A;  4LMK A;  2CFK A;  3WOE B;  4MFR A;  2G0U A;  2H89 A;  1IYY A;  4JUY A;  1RLS A;  2GU1 A;  1IBK T;  1T7S A;  2FJD A;  3CXC 2;  2V5D A;  1RNB A;  1MMN A;  3N2K E;  1ZS7 A;  4DR2 T;  1DMM A;  5G1L A;  1OPY A;  1I3I A;  3P4W A;  1XWM A;  1MWU A;  2Q9Q C;  4I55 E;  1RRH A;  4K0K T;  2R6G F;  2XZE A;  2VVN A;  2BMR B;  4QH1 A;  2W63 A;  3DZL A;  3PGB A;  5KP4 A;  2CWU A;  3L39 A;  2UUC T;  3WR2 A;  3CCE 3;  4YHH T;  5D82 A;  7STD A;  1DMQ A;  4DV3 T;  1PFP A;  1UCI A;  4BU4 A;  3FG3 A;  4BTX A;  5FMN A;  1UGO A;  2D1W A;  4N3V A;  4WYV A;  2PFV A;  2QIY A;  1KD1 4;  2VB6 A;  2KND A;  3SRZ A;  4I4K A;  2MC8 A;  4PFO A;  5ADX L;  4XM4 A;  4X1Y E;  2GK9 A;  5BU4 A;  1WMO A;  1N9J A;  3ZG5 A;  1EEJ A;  4AQG A;  1G8X A;  4XBF B;  5AIG A;  3PUW F;  3RHW A;  6RNT A;  3EDV A;  3GZX B;  5AEU B;  3LSV A;  2XRX B;  3CQX C;  3A5X A;  3C50 A;  2HMO B;  2A15 A;  4IPB A;  3G8Z A;  3FZF B;  1RTU A;  2EHO B;  3M3Z B;  1XNR T;  4GSP A;  1BSC A;  3DJB A;  1I0V A;  1ZO2 A;  3KII A;  4DV1 T;  1T3B A;  4ZS2 A;  1RGK A;  5JTG A;  5EK3 A;  1YW0 A;  1N5P A;  1TFK A;  3OWU A;  2Z6B A;  1N36 T;  2CX0 A;  3U3I A;  2RBI A;  3D3L A;  2XY8 B;  5C8Y E;  4NPP A;  4UF0 A;  5IG0 A;  2HPL A;  1WYC A;  5HXC A;  1UGH I;  1I0X A;  4KMC A;  2XGL A;  2BG9 E;  1GS3 A;  2W56 B;  1YIT 3;  4DV2 T;  1U4Q A;  3E0Z A;  1W0B A;  4ZI3 C;  5LJM A;  2ZM6 T;  2OOV A;  3KSE D;  2NW9 A;  3ZMT B;  2JPF A;  1I2E A;  2W67 A;  2CMR A;  1UUW B;  2ZDJ A;  3AA1 B;  5L3F B;  1J2B A;  3AA0 B;  3MSO A;  2R4I A;  1EZ3 A;  2X9X A;  5LJN A;  2ZLY A;  1LRZ A;  3F7S A;  4U13 A;  5L3E B;  2OLT A;  5ABH A;  1YNV X;  2LKH A;  2JQQ A;  1SPU A;  3I9W A;  3CML A;  2D2S A;  4JYA T;  2VK9 A;  2OQE A;  2YFI B;  5CB4 E;  4H9R C;  2O9U X;  4C90 A;  3E99 A;  1JN5 A;  4HFC A;  3ZJ1 A;  1BR2 A;  3SX1 A;  2XSO B;  2CG0 A;  2Z76 A;  4HWD A;  1BUQ A;  1WRD A;  3KFQ C;  3FHN A;  1HU9 A;  1HKX A;  3U97 A;  2YN6 A;  2KLQ A;  4H9O C;  4TNW A;  4AQF A;  1JB4 A;  2JMK A;  5CF2 A;  1MND A;  1IVX A;  1K28 A;  1UUR A;  3OV4 A;  2D9D A;  2F99 A;  5JVD E;  1V57 A;  3HK4 A;  4HGA A;  4EB6 E;  3EUH A;  3LOY A;  2GBX B;  1I94 T;  2HMJ B;  2ODU A;  1ZGX A;  3CKD A;  2H7V C;  1S5A A;  1QLB A;  3PS8 A;  2XQ8 A;  1C54 A;  1YQ3 A;  2BKP A;  2K24 A;  3M65 A;  4ANJ A;  4ZXL A;  4DV5 T;  4CI3 B;  2IML A;  1CEW I;  4IHJ E;  2BO9 B;  3FF2 A;  5ELU A;  3EN1 B;  1STD A;  4DV4 T;  3PE0 A;  1M9G A;  2F5W A;  2HN1 A;  3VGN A;  4MMX B;  3AGO A;  1UUG B;  3CCM 3;  2A3D A;  5LGN B;  3MKI A;  3TLS A;  2DL1 A;  1VZZ A;  1VCT A;  3PJA J;  3NRX A;  1BSA A;  3ZLI A;  4BIR A;  5AEW B;  2HMN B;  4X20 E;  3X3X A;  3EB8 A;  4TZ4 C;  4QKN A;  2IIU A;  5LC7 A;  2VKO A;  1B21 A;  5AYS C;  1XMO T;  4O3V A;  4FMC A;  4O8S A;  1ZP0 A;  1LOX A;  1X1Y A;  3IBP A;  3TLW A;  3MXZ A;  1FW7 A;  4HKV B;  5J2U E;  4JI3 T;  4O2H A;  4HZB B;  2V7L A;  4IDP A;  1RGE A;  3NKZ A;  4OHF A;  4JI8 T;  4RZM A;  3MJX A;  4O4H E;  3UUB A;  2WOH A;  3STD A;  2DHR A;  1L5G B;  4X2O A;  2BBJ A;  4K1V A;  3EN8 A;  1B27 A;  2JRK A;  5HYA A;  1I2G A;  4TWF A;  2K0M A;  3GAX A;  1BSB A;  1HG5 A;  1TIJ A;  1NWW A;  4YTN A;  3HI7 A;  1IT7 A;  5C2T A;  2KRT A;  4R9L A;  1VQ9 3;  2W62 A;  3N8B A;  1GMR A;  4DUY T;  2DI4 A;  1PY3 A;  1SA0 E;  2UUB T;  4YY3 T;  5J2T E;  1A2K A;  1HNW T;  3LBX B;  1JNZ A;  5AQT B;  1OXZ A;  1V58 A;  2PTF A;  2BVM A;  2C5J A;  5DAB A;  1XMQ T;  2AE9 A;  4PJM A;  3DGN A;  5LBQ B;  3ZFZ A;  4MBQ A;  2H0H A;  5AQU B;  5LP6 E;  4EYY R;  3I55 3;  3WMD A;  4YT0 A;  3PUZ F;  4KVH A;  1CHU A;  2UXD T;  1ZEE A;  3TLT A;  1US7 B;  3F9S A;  3BLZ A;  4KHP T;  4R9K A;  1KF6 A;  4F6R C;  1I8V A;  4ZM8 A;  8CHO A;  3HKB E;  3EC9 A;  1IJ5 A;  4UVA B;  3CU3 A;  3BNB A;  4IDQ A;  2W03 A;  3A7M A;  3I0Q A;  2ZA4 A;  2VKD A;  3S5C A;  2BMO B;  1QVF 2;  5LHH B;  4YHJ A;  1JZO A;  5L3B B;  1KSI A;  3FBZ A;  3EAM A;  1CQS A;  4N78 D;  2HMM B;  2CWO A;  3TLV A;  2UU9 T;  3AE4 A;  2E2U A;  2UXC T;  3K1S A;  1S72 3;  1HTJ F;  2E2V A;  2I0M A;  2QVA A;  3FCS B;  5BVB A;  3AA6 B;  7GSP A;  5DRV A;  4NRE A;  4NXM T;  3NQY A;  3N9N A;  3NV0 B;  2WSS V;  3SFD A;  1W6Y A;  1YVB I;  3CMA 3;  5EQL A;  1W2B 2;  3SYU A;  3JC6 D;  5JDF A;  4UXN B;  1BRS A;  3AE8 A;  3NBR A;  2RPA A;  1IQX A;  1YKE B;  1JNQ A;  2N9D A;  4G63 A;  2WU5 A;  5IUX A;  8RNT A;  3AE2 A;  4IL9 A;  2V1L A;  1N8Q A;  2MAW A;  3SFE A;  2INX A;  3FH1 A;  2NW8 A;  4LF7 T;  4HFV A;  4E7Z A;  3B4P A;  4I43 B;  4Z91 A;  1YJW 3;  3JVC A;  4Q53 A;  3Q2P A;  5TAO A;  3HL6 A;  3AVR A;  3UL6 A;  2GEY A;  4U33 A;  2F56 A;  3KZT A;  3QNU A;  2RFR A;  3D5I A;  5LMU T;  3IF8 B;  3UUM A;  2LHR A;  3SS1 A;  1W02 A;  3PUX F;  4N6V 0;  3CQC B;  1LOW A;  1LNH A;  4B3R T;  2YOE A;  1BNR A;  2EHO A;  5HXH A;  4ILF A;  3LTB A;  3CCU 3;  1HR0 T;  2WQY A;  2X9Y A;  5FXV A;  1FZU A;  4IGU A;  1OAC A;  5CLK A;  4H61 A;  2XF3 A;  1R4C A;  1T98 A;  4EED A;  5F3J A;  4YLH A;  2P0X A;  1O7W B;  4JBW F;  4ILB A;  3HKD E;  2XFT A;  5JDL A;  2BG9 B;  4X66 T;  4WWU C;  4X1I E;  4DR1 T;  3RH3 A;  2FNQ A;  1SIH A;  1K73 4;  5FW5 A;  1IQY A;  1VQL 3;  4HM4 B;  4UV9 B;  2W56 A;  4RNT A;  1FYS A;  3FZK B;  5FL1 A;  2CC3 A;  3CCS 3;  2ACX A;  5JDG A;  1XNQ T;  3G0K A;  1MMA A;  2GU3 A;  3Q2M A;  5LMN T;  4JV5 T;  3P50 A;  1AY7 A;  2VL0 A;  4L0R A;  4DMV A;  1OED C;  4CXW A;  3AEA A;  4YSY A;  4DR5 T;  1OGX A;  3RIF A;  3PYJ A;  4IDN A;  3LFM A;  2D0T A;  3DTO A;  3K8P C;  5C3J A;  4B3S T;  3BIR A;  4HEA A;  2Y74 A;  3PUR A;  1B2S A;  4IT4 A;  2C0S A;  4IIJ E;  1W01 A;  4AKL A;  3G71 3;  2O3O A;  4HJL B;  3CK6 A;  3K3N A;  3O1J A;  1LRA A;  1YJN 3;  1I6Z A;  1RJO A;  1TP6 A;  2V7M A;  1A2P A;  4O4L E;  3DGL A;  2YDS A;  5CA1 E;  2FGT A;  2ML5 A;  2LM2 A;  3WOD G;  4EBG A;  3MWZ A;  1YJ9 3;  3OJA A;  1Y64 B;  2V7K A;  3ZMS B;  1PYL A;  1EG9 B;  1M1X B;  5CK6 A;  4EEB A;  3LJC A;  1W09 A;  4X1K E;  1W6G A;  5CFB A;  1E97 A;  4CJN A;  2V8S V;  3LZA A;  2E5L T;  1EKM A;  1IVV A;  3KDS E;  3N9M A;  2LSJ A;  1RGH A;  4CXX A;  5I97 A;  3P4S A;  4HTE A;  2B76 A;  2CRB A;  3OTO T;  1HZ1 A;  4YJ2 E;  5HOH A;  1RKY A;  4JEH B;  5LA6 E;  5LGT B;  2CX1 A;  4IRE A;  3SED A;  5JBS A;  3K3Q C;  1W5Z A;  3CCQ 3;  1IJ6 A;  2J1D G;  2N1G A;  2HN2 A;  3GZY B;  4I4T E;  2LSK A;  2KF3 A;  5M18 A;  1U5P A;  5LHI B;  4UIG A;  4EXT A;  3UJM A;  3H51 A;  3FB2 A;  4J5G A;  2XSH B;  4HM2 B;  1GOV A;  4JI6 T;  3IEE A;  3DGO A;  3KN4 A;  3SXX A;  2LOS A;  3RF1 A;  4HOH A;  2XQ5 A;  4UVC B;  1RN4 A;  3JUN A;  1A67 A;  3RNT A;  1GOY A;  6STD A;  4BL2 A;  1EA2 A;  1JKG A;  3ALA A;  5FKY A;  2H3R A;  3EHC A;  2XUE A;  4TWH A;  3NRY A;  2LE8 A;  3SOY A;  2BNG A;  3NXJ A;  5F5W A;  4H9N C;  3AAE B;  4O2A E;  5IF6 A;  5A1L A;  3UU5 A;  2CXL A;  2XAH B;  4KFE A;  3KE7 A;  4TN7 B;  2EHO D;  1VQ4 3;  4TUY E;  1BR4 A;  3HI2 A;  5AQN B;  1IVW A;  4HM7 B;  2JDI H;  3PU3 A;  3QB5 K;  4TV8 E;  2UUG C;  3CPO A;  1MOL A;  4DID B;  3BNC A;  3X3Z A;  3PZW A;  2M6I A;  3MG1 A;  2X9W A;  5FY1 A;  2XSB A;  1MMG A;  4XDW A;  5AIF A;  1MIW A;  3LBX A;  3OXA A;  3O1H A;  1MWS A;  4OUQ A;  1AR0 A;  4HZ9 B;  4XB5 A;  4EZ4 A;  3JAF A;  5IW9 A;  2NTY A;  4EC6 A;  2KWI B;  5FXW A;  3F40 A;  1WLX A;  3DGY A;  1HNZ T;  2B1X B;  1E1H B;  3X41 A;  3S67 A;  1RGL A;  5FVL A;  5M4Y A;  3DXO A;  1E3R A;  2IY2 A;  5A0O B;  3RIU A;  1BR1 A;  2UXN B;  2F86 B;  4IE7 A;  2BZB A;  5H6R B;  1A2V A;  3UTK A;  4ZEY A;  4DO0 A;  2ZM8 A;  2OWP A;  1U5O A;  2X0H A;  4I5Q A;  1IAP A;  3M8C A;  3QK9 A;  2BS4 A;  1AVK A;  4IE4 A;  4EYC A;  2PJQ A;  3D5G A;  4KUM B;  3UL5 A;  2WCA A;  3PUG A;  3UUN A;  1WTH A;  5HEH A;  2XQA A;  3NM2 A;  3P4P A;  3EHZ A;  4HKA A;  1IT8 A;  5IG4 A;  2H0G A;  4H63 H;  3AED A;  2KF5 A;  3J7Y d;  3VRB A;  2IHR 1;  4WFO A;  2WWU A;  2CHN A;  4AQF C;  2H88 A;  2XHE B;  3I56 3;  3NV0 A;  5LG3 A;  1I70 A;  2CWT A;  4HYZ A;  2KAA A;  3I1A A;  4KHZ F;  4TNV A;  4N6N B;  4H3U A;  1IZN B;  2VQF T;  4FMD A;  1YVS A;  1BNG A;  2CIU A;  3LTA A;  1RHL A;  2DNX A;  3RDE A;  2XAJ B;  5LYJ E;  5HXE A;  2CWV A;  1KFY A;  3GSP A;  3VSY A;  3ZYL A;  3KVB A;  4PW8 A;  1SQW A;  4QX7 B;  3DMC A;  2CLY B;  2F98 A;  2XH9 A;  3PCR A;  1JV2 B;  1YQ4 A;  2K5B B;  1OWA A;  3RKO A;  1HX8 A;  2XPK A;  4L7K A;  4EYU A;  1D1A A;  2V7I A;  4A56 A;  5CGM A;  2IA7 A;  2ACZ A;  3QC9 A;  4JI2 T;  3NHX A;  1D0X A;  2GBW B;  4Z8X A;  1X79 A;  2K3W A;  4MMZ B;  3LXU X;  4CZZ B;  2SBL A;  1UDI I;  4DKI A;  1LVK A;  1YI2 3;  3RRW A;  1G73 A;  1QMA A;  4ZHQ E;  4L9I A;  2XSA A;  1X1U A;  2OTJ 3;  3C4W A;  2STD A;  5JR9 B;  3DY5 A;  1D0Y A;  1HCI A;  2XQ9 A;  1D6Z A;  5FGO A;  3SOA A;  2CCQ A;  4CN1 A;  3FF0 A;  4KZ1 A;  2BG9 A;  3CX6 B;  1W4N A;  3K7C A;  3T8N A;  4WZX A;  3UFE A;  2CXF A;  3E22 E;  1LOV A;  4R1K A;  3ONJ A;  2L3L A;  3FBL A;  3MA9 A;  1NB3 I;  5JPP A;  2H7O A;  2IMJ A;  2MOZ A;  2W04 A;  3ETU A;  2LLY A;  3L8R A;  3SVA A;  4ISS A;  1VQ5 3;  1RNT A;  1OCV A;  2NWB A;  2LYX A;  2A72 A;  4IE6 A;  4LEH A;  4O02 B;  1BRH A;  4PJJ A;  2V6Y B;  1R4Y A;  4KX6 A;  2OTL 3;  1SE7 A;  1KEY A;  1VQ8 3;  1Q42 A;  2E9X C;  5L3D B;  1MWR A;  2LHN A;  3ZN0 B;  4HM6 B;  4NXN T;  4YJ3 E;  2DWK A;  4COF A;  3NVO A;  4KI0 F;  3ZEF B;  3PV0 F;  4HWF A;  4NIQ A;  3ANW B;  2Q07 A;  4KBM B;  4F8H A;  1G02 A;  4ZZB A;  4DR4 T;  4CPK A;  5IG5 A;  4QWN B;  2ZHX B;  3AXJ B;  1WFD A;  3EDU A;  3FG1 A;  2KXP B;  1FGQ A;  2J47 A;  5FNV E;  3O9X A;  1H7C A;  4MMY B;  3FLJ A;  3G4S 3;  3JUQ A;  3AA7 B;  1SAR A;  1E3V A;  3VR9 A;  5DQW A;  4M1P A;  3Q1C A;  4HM8 B;  3V92 A;  2HOH A;  1Q86 4;  2Z6E A;  5ABE A;  1F8N A;  5JDM A;  2GSP A;  4HM1 B;  3DUK A;  5DQV A;  4ZI7 E;  4A5X A;  3TKL B;  2RGQ A;  5CJ5 A;  4AI6 A;  1DU2 A;  3EBT A;  3P4R A;  2WP9 A;  3F57 A;  3NUV A;  3C4Z A;  3HZP A;  3B57 A;  3Q9D A;  1JKG B;  2P0M A;  4Z90 A;  3SLU A;  1Z1S A;  2MBG A;  3DGM A;  4K1U A;  2I59 A;  3CNM A;  4DBR A;  2W00 A;  1DET A;  3KV6 A;  2WU2 A;  3WHO A;  4RNY A;  2YU1 A;  3R6N A;  3D0T A;  2XR8 B;  2W0Q A;  2BMQ B;  2J8X B;  1AV4 A;  3LK4 2;  5LNK A;  4KFD A;  2JMH A;  4LML A;  1BAN A;  2W66 A;  1E2A A;  2VWA A;  4DR3 T;  3F8X A;  1XZY A;  2OV9 A;  1JBT A;  4IDZ A;  3WA2 X;  1X1X A;  4EOZ B;  5ABG A;  3IJE B;  5HEG A;  3GWH A;  4H9P C;  4YSZ A;  1B7T A;  5LBM A;  3C51 A;  3LG7 A;  2VAS A;  3RGR A;  1J5W A;  3CIR A;  4GYR A;  2XQY A;  5JQG E;  4FMB A;  1OHP A;  2AAD A;  4V1A v;  4YSX A;  3B5M A;  5AQM B;  3BQL A;  2NOX A;  3BK9 A;  5IEP A;  2JQK A;  3RIA A;  3Q3F A;  5KMG P;  2P09 A;  2D42 A;  1ISK A;  4HVN A;  1B2X A;  4KT3 B;  1MNE A;  4WYK B;  1YIJ 3;  3F31 A;  2VQE T;  4JEU B;  1UX5 A;  5EK2 A;  5RNT A;  1T5Y A;  3F8H A;  5AI1 A;  1N9E A;  2WGQ A;  3NZQ A;  1N5H A;  2XAS B;  5L47 A;  3L3P A;  3PUS A;  5FXZ A;  3RYC E;  4LF4 T;  3JUO A;  3UT5 E;  1K41 A;  3ZG0 A;  1KC8 4;  4NUV A;  1Q82 4;  5L4H A;  1GMP A;  2J4G A;  2KWH A;  5EK4 A;  1BR0 A;  1TJD A;  3CNX A;  3EJV A;  1JB2 A;  3VU7 H;  1LQG C;  1STF I;  4ZZC A;  1NO3 A;  2FBW A;  1EUI C;  1BIR A;  3G16 A;  5IER A;  4ORL A;  3QB5 A;  5AQI B;  3K5T A;  3BND A;  3ZC0 A;  1W0A A;  5E0O A;  3AMO B;  3CPZ A;  1RGG A;  4GB5 A;  5BMV E;  5L3C B;  2Q9Q D;  4HWI B;  4TX5 A;  4HFI A;  1B3S A;  3Q5E A;  2J62 A;  3RRC A;  3MK7 C;  3FZH B;  3I9Y A;  3O1I A;  3SOL A;  1QAF A;  4MHC A;  2C5K T;  2MTQ A;  4LZI A;  4AKI A;  4YFS A;  3UUL A;  5AQK B;  5CA0 E;  1CYV A;  3T8U A;  2RNT A;  1J1J A;  3JAD A;  2MYS A;  2WS3 A;  2LSI A;  4DMW A;  4EV2 A;  3L0R A;  4EGW A;  3EQQ B;  3WOF B;  3ER7 A;  5L3G B;  2CG1 A;  1YXR A;  2MPK A;  2W2C A;  3Q90 A;  2CFL A;  4U2Y A;  1D1C A;  4QX8 B;  4X5T A;  2ML6 A;  1ULJ B;  4K0U A;  3L09 A;  3N9H A;  5HGR A;  2LEH A;  2XGN A;  2LM9 A;  5IWA T;  3WDG B;  5JDH A;  2WZI A;  2NP9 A;  3EF8 A;  3CQG B;  1VOM A;  5AQO B;  3MAC A;  3FG4 A;  2CEA A;  1D6Y A;  5HCM A;  3UNL A;  2CPT A;  4CN4 A;  2W61 A;  1ROV A;  3LDQ B;  4HBR A;  4GKK T;  4HE8 A;  1HX1 B;  1TFO A;  3ZN1 B;  1JJ2 2;  4G2A A;  4AXP A;  3LTD A;  3R84 B;  4A98 A;  3RYF E;  3WI3 A;  2LRK A;  1S35 A;  5HXR A;  4OFZ A;  1WNH A;  2BS3 A;  1LVF A;  2CFG A;  3B8L A;  5AQV B;  2BU4 A;  1YKH B;  1UW1 A;  1IVU A;  1V9D A;  2HPJ A;  1Q9E A;  1OUN A;  3IHR A;  3GN5 A;  5JR9 A;  2PNC A;  1HS7 A;  2K54 A;  4UR9 A;  2IUB A;  4BJM A;  3PUV F;  3KKG A;  1OHO A;  3PU8 A;  4EV6 A;  1CYU A;  4J9A A;  3AE7 A;  2XM2 A;  2LQV A;  4XBX A;  3G6E 3;  4YTP A;  3ZMV B;  4FJO A;  1RSN A;  3FZL B;  1X1W A;  2XAF B;  4IE5 A;  1LOY A;  2GEX A;  3D4A A;  1DVC A;  5JPU A;  2E2T A;  4OVM A;  4AIU A;  4EIW A;  5J0Z A;  2YK0 A;  1ZV4 X;  2BIR A;  4O2B E;  3ZYM A;  3QRD A;  1NU3 A;  3BQI A;  3CME 3;  1D0Z A;  2Q9Q B;  4CXY A;  4U3C A;  4FCM A;  4JRF A;  1US1 A;  4AKG A;  3CC7 3;  2V6Y A;  1MNL A;  2WAU A;  2BBH A;  3OYX A;  2CM0 A;  1W9R A;  1BRI A;  2BKO A;  2XQ7 A;  4P0B A;  4LF8 T;  2V1D B;  3AAA B;  4JI0 T;  3ZT5 A;  1GOU A;  3AVS A;  4GK0 E;  1OGZ A;  2HMK B;  3P4Q A;  2M6B A;  3ANW A;  1W2Z A;  3UQ4 A;  4I0U A;  1QAK A;  4C91 A;  2LSG A;  1S94 A;  2UUA T;  2IYJ A;  1GYB A;  1QJG A;  3AXJ A;  5M1A A;  3NWI A;  1NB5 I;  3BB9 A;  1BRN L;  3S27 A;  5HXS A;  3KCH A;  1W7C A;  2H0I A;  4H9S E;  1HYF A;  1Q40 A;  3P7I A;  3F7X A;  3V98 A;  4LFC T;  4HFB A;  4TWD A;  4JI1 T;  1O7N B;  2XAG B;  1B20 A;  2K48 A;  2CFD A;  3N54 B;  1NDO B;  2XJ7 A;  2M7O A;  1V74 A;  4U7I A;  1WMN A;  4P0A A;  5AQF B;  1MWT A;  4E7S A;  3CCL 3;  1VCS A;  5H6Q B;  1QSD A;  4R4K A;  3LH4 A;  3EVY A;  4WNK A;  2AAE A;  2JQH A;  4HFH A;  4N6U A;  4DR7 T;  4HWH A;  3G06 A;  5FP3 A;  4X65 T;  2YIN A;  2Y8D A;  4I50 E;  1RGA A;  2L8K A;  3T1H T;  4MJD A;  3ZT7 A;  4XZC A;  3RC3 A;  3EBY A;  2IUJ A;  3WAJ A;  3MG3 A;  2CWY A;  3KSP A;  2XFS A;  5HEO A;  1BNI A;  3PJA A;  3IMA B;  4GOU A;  1BSE A;  1NEK A;  3AEB A;  1FMW A;  1FUT A;  3CC2 3;  2RSX A;  4N6O B;  3OYZ A;  3ZST A;  5EVH A;  2FJB A;  1BRK A;  2QA7 A;  1IU7 A;  3NQZ A;  3K3O A;  3PUY F;  1Q81 4;  1AVL A;  2DWG A;  2XAQ B;  4H63 V;  2VUR A;  2Z7A A;  3H3M A;  2IW5 B;  5D81 A;  4J2C A;  1U8C B;  3CCR 3;  3B13 A;  1UUS A;  1B2Z A;  1BSD A;  3GZB A;  2WB5 A;  4AEQ A;  1OED E;  5ETW A;  1FGR A;  4QXH B;  2RP4 A;  2CFW A;  3JUP A;  3PDY A;  1AQZ A;  3OW2 2;  4JI4 T;  1W6C A;  2FJA A;  4BTY A;  3HKE E;  1CUN A;  3B4O A;  4PK5 A;  4BJN A;  3RQW A;  1T2H A;  2E9X B;  2FJE A;  3A76 A;  4QHO A;  3KFW X;  1VQP 3;  3ONX A;  2RA1 A;  1IDP A;  2VVS A;  1W00 A;  1C7H A;  4WYK A;  2OOV C;  3N2O A;  1N34 T;  1IBM T;  3AB3 B;  3UU6 A;  1TRQ A;  2B24 B;  3ONL C;  1NWM X;  5JDN A;  1T8B A;  4X64 T;  4UVB B;  4EXR A;  4XBY A;  2CH9 A;  5HEU A;  4FI5 A;  1Y4K A;  5AYR B;  2X9H A;  5AQP B;  2WGO A;  5BXQ A;  1B2U A;  2CBI A;  1WQL B;  4OX9 T;  1M90 4;  1UX4 A;  2F5M A;  2OQE C;  4U72 A;  3ROB A;  1NNV A;  2DCF A;  1N8R 4;  1RDS A;  1VRB A;  4HFD A;  2WY2 A;  2CHC A;  6GSP A;  5JRE A;  4PEJ A;  3AMO A;  1FUS A;  2L4V A;  1FGM A;  4LSO A;  1WMP A;  4LMJ A;  5M19 A;  4ILA A;  3T1Y T;  2KZ7 B;  2YKS A;  3SWH A;  2KXG A;  2Z77 A;  2F4Y A;  2XQ3 A;  2P05 A;  1VQO 3;  1Y01 A;  5TGN A;  1N33 T;  1E7P A;  5BR8 T;  4U2Z A;  3FGY A;  4ILC A;  3LYG A;  2K9A A;  2WDR A;  2BKN A;  5HWX A;  3N9O A;  3RPU A;  2KF4 A;  1DYU A;  5KX5 E;  3UQ7 A;  3JC6 C;  4PFP A;  1BRJ A;  2WDQ A;  4IT7 A;  3JUM A;  3F2E A;  2WMO A;  1O7P B;  1ZHC A;  2YX9 A;  1T2I A;  1SUM B;  4UV8 B;  2KMF A;  2ODV A;  3A8Y C;  3OKQ A;  4ILU A;  3LK3 B;  1TRP A;  4EW5 A;  1SHZ C;  2NR4 A;  3AEG A;  2PG8 A;  3AE1 A;  3PCS A;  2IC9 A;  1ROA A;  3RYH E;  2L1S A;  3VHL A;  5IG3 A;  5AIH A;  1NJI 4;  3HR0 A;  5HWY A;  3OWS A;  1FEW A;  4ADZ A;  3CVR A;  3Q5W A;  2QRX A;  2W6J H;  3FXE B;  4MLK A;  3AEF A;  3DH2 A;  5AQG B;  3VKG A;  4U7Y A;  3ZPO A;  1G96 A;  2PBI A;  5JRC B;  1LVN A;  1ASK A;  5DJQ C;  4JF8 A;  1UI8 A;  2WM9 A;  3GN5 B;  1IV9 A;  1TTO A;  4L8P A;  2D5U A;  3D9R A;  2KIN B;  3CCV 3;  1Z8U A;  1AJ3 A;  4RNZ A;  3X42 A;  1GY7 A;  5FY0 A;  4P1N A;  3ECF A;  2L9Q A;  3BU4 A;  4N6M A;  2K3D A;  1IV7 A;  4LMI A;  3ZCI A;  2AXD S;  2PZV A;  1JZD A;  3LTC A;  4AKR B;  4DND A;  4GK5 E;  4GIW A;  3AEE A;  1VQM 3;  3I0O A;  4DV0 T;  1ULI B;  2IAK A;  3NBX X;  3O4X E;  1VQ6 3;  3KIN B;  2UX0 A;  4K90 B;  3TDG A;  4Q25 A;  1GY6 A;  4WBN E;  1D6U A;  5ELJ A;  1BNE A;  3V5S A;  3ZMZ B;  1D1B A;  1VQ7 3;  1UGI A;  2CHO A;  2P38 A;  5L2L A;  2LT3 A;  2LOP A;  5KDM C;  2YFJ B;  5KP1 A;  3KV5 A;  1FA3 A;  4RBN A;  3PXM A;  4CN6 A;  3URP A;  2HHH T;  2Q9Q A;  4FR9 A;  1WCR A;  3ZYK A;  1DVD A;  1GSP A;  2M67 A;  4HM3 B;  4CI1 B;  4DUZ T;  1HFA A;  2IDO B;  1M62 A;  1OF5 B;  7RNT A;  3WAK A;  2CXD A;  1Q40 B;  3C4X A;  3MHE A;  1KNR A;  1MIV A;  4OYJ A;  2CW9 A;  3X1D A;  3LT8 A;  1BOX A;  5EZY E;  1Z0P A;  2XEP A;  3BNE A;  3K9M C;  1FGO A;  4LYL B;  4HM0 B;  2XQ6 A;  1ZKE A;  3X40 A;  1GMQ A;  2WZH A;  2ZMA A;  3BQK A;  4ZI2 D;  1IQ8 A;  1WYB A;  5IEO A;  2ES0 A;  3VRA A;  1J5E T;  1DE3 A;  2CE7 A;  5IYZ E;  1M1K 4;  5AFU L;  3RKG A;  5AQH B;  5HEJ A;  1FGT A;  4X2H A;  1Q7H A;  3H3H A;  2ZM0 A;  5LC6 A;  5FXX A;  2E2A A;  2QGU A;  3E08 A;  1PU4 A;  3AGN A;  2FXT A;  3S4U A;  3LT9 A;  5ABF B;  4KFF A;  4OYK A;  4WHA A;  3B7C A;  2JJ9 A;  3O8Y A;  3T8O A;  2SPC A;  1BVI A;  4PNI A;  3AE3 A;  4JLE A;  2C4B A;  3GWR A;  2W2U A;  3OVU A;  2V6X A;  4TX4 A;  5L4E A;  4EAH A;  5D83 A;  3D79 A;  3ZJ2 A;  4AKZ A;  3KBU A;  3N5L A;  1T72 A;  1X9B A;  2CK3 H;  2KSR A;  2CLY C;  2IC6 A;  2X67 A;  2IUK A;  1BNJ A;  3HX8 A;  2JIW A;  3UUX B;  1O7H B;  2EHO C;  1OED B;  4AIS A;  1MIY A;  2OCT A;  3J7Y q;  5FL0 A;  3DM8 A;  1RRL A;  4GHO A;  3QK6 A;  3K63 A;  3QOF A;  4K61 A;  3EE1 A;  1JB5 A;  2XQ4 A;  3UFG A;  1WR0 A;  5KXJ A;  3HIG A;  5LG4 A;  3DP7 A;  5STD A;  2NW7 A;  4WW0 A;  2XM1 A;  4JI7 T;  3ABV A;  1OH0 A;  4YTM A;  3V5U A;  1N32 T;  3KV4 A;  1RCK A;  3VKH A;  2E9X A;  1CH0 A;  4G1M B;  1M7K A;  5LXT E;  1KNZ A;  4NHF A;  5JDQ A;  3HKC E;  4HM5 B;  4IL4 A;  5JR9 C;  2ZL8 A;  5LGU B;  5BIR A;  2F4V T;  3I0Y A;  2VKJ A;  3CCJ 3;  4TV9 E;  5FY7 A;  3AAI A;  5DRE A;  4WP5 A;  2QYW A;  4UEL A;  3OPC A;  4BA9 A;  4STD A;  2YDR A;  3UU8 A;  4XBT A;  3RGA A;  1VQQ A;  4J5K A;  1MMD A;  3KBT A;  3ZCJ A;  1IBL T;  5F8P A;  3UU4 A;  1KNP A;  1HNX T;  1ZOY A;  2X66 A;  3NX0 A;  3OBV E;  4BL3 A;  2W4X A;  3VF1 A;  2V5C A;  3Q5D A;  5CXO A;  4CI2 B;  4U31 A;  1KWI A;  1LQM B;  4LGQ A;  2UXX B;  1I2F A;  3IPT A;  3RLF F;  2HH7 A;  4PAG A;  4LFB T;  2LSY A;  2LKG A;  2Y48 B;  1DMN A;  3RQU A;  3ZC1 A;  4OK0 A;  2CA5 A;  2X68 A;  3EX9 A;  5LHG B;  2B1E A;  3GRD A;  3NZP A;  2CBJ A;  4EV5 A;  3CX7 B;  4X62 T;  4LF9 T;  1GD3 A;  3FKA A;  1QVG 2;  1Q7Y 4;  1JBR A;  4YXD A;  1VQK 3;  2FUP A;  2VL8 A;  4ASK A;  2C11 A;  1I3F A;  1TUH A;  1RN7 A;  3ETV A;  1RGF A;  4NUU A;  5FVK A;  2A2F X;  1MGW A;  3N9L A;  2Y73 A;  4CQI A;  4GYS A;  3MPH A;  1KQS 2;  4IE0 A;  3TLU A;  1UK5 A;  4ZOL E;  3HOH A;  1GQE A;  3PUA A;  4DR6 T;  5AII A;  2NTX A;  3KV9 A;  1HF8 A;  3CX8 B;  3KVA A;  3RI5 A;  1O7G B;  3OX9 A;  1XDP A;  3F14 A;  3QUJ A;  3J9X 1;  4DVD A;  3AE9 A;  3S29 A;  4BAY B;  3HA4 A;  2BVL A;  3FZM B;  2I6H A;  3HII A;  1K9M 4;  2V26 A;  2VKH A;  2Y6X A;  2GXF A;  2BDE A;  4GL6 A;  4IDO A;  1UCJ A;  1OHS A;  5AQQ B;  4CDL A;  1SJW A; 
#chains in the Genus database with same CATH homology
 2WBL A;  1UCU A;  3CD6 3;  3V99 A;  4MEI A;  2E8I A;  3FXD B;  5JRC A;  2LJL A;  2N2N A;  4R80 A;  4IST A;  4UF0 B;  3RC8 A;  5CF1 A;  3H3A A;  2W0G A;  2QGS A;  4WBO A;  4PJL A;  4ZI3 D;  2KCD A;  5J1G A;  3NBJ A;  3P8C D;  1EQK A;  2C10 A;  5LCY A;  2P9B A;  1O7M B;  1YGE A;  1IK3 A;  4CCV A;  2BHM A;  1QUU A;  4IIA A;  2X51 A;  2CKF B;  4AKY A;  3T0U A;  2QA4 3;  1YHQ 3;  2BT3 A;  4DBQ A;  1JN5 B;  1UI7 A;  1WR6 A;  4FCZ A;  2E9X D;  3ESL A;  3C64 A;  3RYI E;  3PUQ A;  4MAL A;  1SII A;  2XTL A;  2QEX 3;  4KP3 C;  4N6T A;  5GON E;  1UUV B;  4PK4 A;  2I9W A;  4O4J E;  2MF7 A;  4O4I E;  4FMA A;  1OF5 A;  4QXC B;  3U78 A;  4XDV A;  4QWT A;  3WA3 A;  5JH7 E;  1FIO A;  3NBB A;  1JRQ A;  3OWY A;  2YEV C;  3ZMU B;  1ZX2 A;  4QXB B;  1LKX A;  2ZM2 A;  1K8A 4;  2HML B;  3CC4 3;  1HG2 A;  3PTR B;  4ZI2 C;  2YFL B;  5EEO A;  4PK6 A;  1A90 A;  3LML A;  3N9Q A;  4HN9 A;  2WO0 A;  3GMI A;  3CWZ B;  2OA5 A;  2JQ5 A;  4FCJ A;  4ERR A;  3FZW A;  1FMV A;  3LK2 B;  1VQN 3;  4EZH A;  3MZK B;  2WMN A;  3U1W A;  2YU2 A;  1GD4 A;  4L8O A;  4B6X A;  5IHY A;  2W9P A;  2W9Q A;  3X3Y A;  5FYM A;  1NAF A;  3H37 A;  1TU5 A;  1YD8 G;  2WOF A;  3FSD A;  5LOV E;  4BTW A;  3CPW 2;  4ZS3 A;  1FUW A;  4XAX B;  2C5I T;  2D0U A;  4N6L A;  4J8T A;  1GY5 A;  1O3X A;  2V7J A;  2X0L B;  3NM7 A;  5KP3 A;  3MG2 A;  4U74 A;  5HAX A;  1KK7 A;  3N2G E;  4UEM A;  1LXE A;  3S28 A;  3Q5X A;  3C98 B;  4L5G A;  2KT9 A;  4AKH A;  4PJN A;  3K0Z A;  1QAL A;  3GA8 A;  4P09 A;  3UB1 A;  5IEN A;  3N9P A;  2DLR A;  4H9Q C;  2RCD A;  3W15 B;  5G2G A;  3GZR A;  3MKD A;  3MYT A;  3RX6 A;  2CFK A;  3WOE B;  4MFR A;  2G0U A;  4JUY A;  2GU1 A;  3CXC 2;  1MMN A;  3N2K E;  1DMM A;  1OPY A;  2Q9Q C;  4I55 E;  1RRH A;  2BMR B;  2W63 A;  3DZL A;  3PGB A;  5KP4 A;  2CWU A;  3CCE 3;  5D82 A;  7STD A;  1DMQ A;  1PFP A;  3FG3 A;  4BTX A;  5FMN A;  2D1W A;  4N3V A;  2PFV A;  2QIY A;  1KD1 4;  2VB6 A;  2KND A;  3SRZ A;  4I4K A;  2MC8 A;  4PFO A;  5ADX L;  4XM4 A;  4X1Y E;  2GK9 A;  1WMO A;  1N9J A;  4AQG A;  1G8X A;  4XBF B;  5AIG A;  3EDV A;  3GZX B;  5AEU B;  2XRX B;  3CQX C;  3A5X A;  3C50 A;  2HMO B;  2A15 A;  4IPB A;  3G8Z A;  2EHO B;  3DJB A;  1ZO2 A;  3KII A;  4ZS2 A;  5EK3 A;  1YW0 A;  1N5P A;  1TFK A;  3OWU A;  2Z6B A;  3U3I A;  3D3L A;  5C8Y E;  4UF0 A;  5IG0 A;  2HPL A;  1WYC A;  5HXC A;  4KMC A;  2XGL A;  1GS3 A;  2W56 B;  1YIT 3;  1U4Q A;  3E0Z A;  4ZI3 C;  5LJM A;  2OOV A;  3KSE D;  2NW9 A;  3ZMT B;  2JPF A;  2CMR A;  1UUW B;  2ZDJ A;  3AA1 B;  5L3F B;  1J2B A;  3AA0 B;  3MSO A;  2R4I A;  1EZ3 A;  2X9X A;  5LJN A;  2ZLY A;  1LRZ A;  3F7S A;  4U13 A;  5L3E B;  2JQQ A;  1SPU A;  3I9W A;  3CML A;  2D2S A;  2VK9 A;  2OQE A;  2YFI B;  5CB4 E;  4H9R C;  2O9U X;  4C90 A;  3E99 A;  1JN5 A;  3ZJ1 A;  1BR2 A;  3SX1 A;  2XSO B;  2CG0 A;  2Z76 A;  1BUQ A;  1WRD A;  3KFQ C;  3FHN A;  1HU9 A;  1HKX A;  3U97 A;  2KLQ A;  4H9O C;  1JB4 A;  4AQF A;  2JMK A;  5CF2 A;  1MND A;  1IVX A;  1K28 A;  3OV4 A;  2F99 A;  5JVD E;  3HK4 A;  4HGA A;  4EB6 E;  3EUH A;  3LOY A;  2GBX B;  2HMJ B;  2ODU A;  3CKD A;  2H7V C;  1S5A A;  3PS8 A;  2K24 A;  3M65 A;  4ANJ A;  4CI3 B;  1CEW I;  4IHJ E;  2BO9 B;  3FF2 A;  5ELU A;  3EN1 B;  1STD A;  3PE0 A;  1M9G A;  3VGN A;  4MMX B;  3CCM 3;  2A3D A;  5LGN B;  3MKI A;  1VZZ A;  3NRX A;  3ZLI A;  5AEW B;  2HMN B;  4X20 E;  3X3X A;  3EB8 A;  4TZ4 C;  4QKN A;  5LC7 A;  2VKO A;  5AYS C;  4O3V A;  4FMC A;  4O8S A;  1LOX A;  3IBP A;  3MXZ A;  4HKV B;  5J2U E;  4O2H A;  4HZB B;  2V7L A;  4OHF A;  4RZM A;  3MJX A;  4O4H E;  2WOH A;  3STD A;  2DHR A;  1L5G B;  4X2O A;  4K1V A;  3EN8 A;  2JRK A;  5HYA A;  3GAX A;  2K0M A;  1HG5 A;  1TIJ A;  1NWW A;  3HI7 A;  1IT7 A;  2KRT A;  4R9L A;  1VQ9 3;  2W62 A;  3N8B A;  2DI4 A;  1SA0 E;  5J2T E;  1A2K A;  3LBX B;  1OXZ A;  2BVM A;  2C5J A;  5DAB A;  4PJM A;  3DGN A;  5LBQ B;  4MBQ A;  5LP6 E;  4EYY R;  3I55 3;  3WMD A;  4KVH A;  1ZEE A;  1US7 B;  3F9S A;  3BLZ A;  4R9K A;  4F6R C;  4ZM8 A;  8CHO A;  3HKB E;  3EC9 A;  1IJ5 A;  4UVA B;  3CU3 A;  3BNB A;  2W03 A;  3I0Q A;  2VKD A;  3S5C A;  2BMO B;  1QVF 2;  5LHH B;  4YHJ A;  5L3B B;  1KSI A;  3FBZ A;  1CQS A;  4N78 D;  2HMM B;  2CWO A;  2E2U A;  1S72 3;  1HTJ F;  2E2V A;  3FCS B;  5BVB A;  3AA6 B;  5DRV A;  4NRE A;  3NQY A;  3N9N A;  3NV0 B;  2WSS V;  1W6Y A;  1YVB I;  3CMA 3;  5EQL A;  1W2B 2;  3JC6 D;  5JDF A;  4UXN B;  3NBR A;  1IQX A;  1YKE B;  1JNQ A;  2N9D A;  4G63 A;  2V1L A;  1N8Q A;  2INX A;  3FH1 A;  2NW8 A;  4HFV A;  4E7Z A;  3B4P A;  4I43 B;  1YJW 3;  3JVC A;  4Q53 A;  3Q2P A;  5TAO A;  3HL6 A;  3AVR A;  3UL6 A;  2GEY A;  3KZT A;  2RFR A;  3IF8 B;  3UUM A;  2LHR A;  3SS1 A;  1W02 A;  4N6V 0;  3CQC B;  1LNH A;  2EHO A;  5HXH A;  3LTB A;  3CCU 3;  5FXV A;  2X9Y A;  4IGU A;  1OAC A;  5CLK A;  4H61 A;  2XF3 A;  1R4C A;  1T98 A;  5F3J A;  4YLH A;  2P0X A;  1O7W B;  3HKD E;  2XFT A;  5JDL A;  4WWU C;  4X1I E;  3RH3 A;  2FNQ A;  1SIH A;  1K73 4;  5FW5 A;  1IQY A;  1VQL 3;  4HM4 B;  4UV9 B;  2W56 A;  2CC3 A;  3CCS 3;  2ACX A;  5JDG A;  3G0K A;  1MMA A;  2GU3 A;  3Q2M A;  4L0R A;  4DMV A;  4CXW A;  1OGX A;  3PYJ A;  3LFM A;  2D0T A;  3DTO A;  3K8P C;  4HEA A;  2Y74 A;  3PUR A;  2C0S A;  4IIJ E;  1W01 A;  4AKL A;  3G71 3;  2O3O A;  4HJL B;  3O1J A;  3K3N A;  1YJN 3;  1RJO A;  1TP6 A;  2V7M A;  4O4L E;  3DGL A;  5CA1 E;  2FGT A;  2ML5 A;  3WOD G;  4EBG A;  3MWZ A;  1YJ9 3;  3OJA A;  1Y64 B;  2V7K A;  3ZMS B;  1EG9 B;  1M1X B;  5CK6 A;  3LJC A;  4X1K E;  1W6G A;  1E97 A;  3LZA A;  1EKM A;  1IVV A;  3KDS E;  3N9M A;  2LSJ A;  4CXX A;  5I97 A;  4HTE A;  1RKY A;  4YJ2 E;  4JEH B;  5LA6 E;  5LGT B;  3SED A;  5JBS A;  3K3Q C;  1W5Z A;  3CCQ 3;  1IJ6 A;  2J1D G;  2N1G A;  3GZY B;  4I4T E;  2LSK A;  1U5P A;  5LHI B;  4UIG A;  4EXT A;  3UJM A;  3H51 A;  3FB2 A;  2XSH B;  4HM2 B;  3IEE A;  3DGO A;  3KN4 A;  3SXX A;  2LOS A;  4UVC B;  3JUN A;  1A67 A;  6STD A;  1EA2 A;  1JKG A;  3ALA A;  2H3R A;  3EHC A;  2XUE A;  3NRY A;  2LE8 A;  3SOY A;  2BNG A;  3NXJ A;  4H9N C;  3AAE B;  4O2A E;  5IF6 A;  5A1L A;  2CXL A;  2XAH B;  4KFE A;  3KE7 A;  4TN7 B;  2EHO D;  1VQ4 3;  4TUY E;  1BR4 A;  3HI2 A;  1IVW A;  4HM7 B;  2JDI H;  3PU3 A;  4TV8 E;  3CPO A;  1MOL A;  3BNC A;  3X3Z A;  3PZW A;  3MG1 A;  2X9W A;  5FY1 A;  1MMG A;  4XDW A;  5AIF A;  1MIW A;  3LBX A;  3OXA A;  3O1H A;  4OUQ A;  1AR0 A;  4HZ9 B;  4XB5 A;  4EZ4 A;  5IW9 A;  2NTY A;  4EC6 A;  2KWI B;  5FXW A;  3F40 A;  1WLX A;  2B1X B;  1E1H B;  3X41 A;  3S67 A;  3DXO A;  5M4Y A;  1E3R A;  5A0O B;  1BR1 A;  2UXN B;  2F86 B;  4IE7 A;  2BZB A;  5H6R B;  1A2V A;  3UTK A;  4DO0 A;  2ZM8 A;  2OWP A;  1U5O A;  1IAP A;  3M8C A;  3QK9 A;  1AVK A;  4IE4 A;  4EYC A;  2PJQ A;  4KUM B;  3UL5 A;  3PUG A;  3UUN A;  1WTH A;  3NM2 A;  4HKA A;  1IT8 A;  5IG4 A;  4H63 H;  3J7Y d;  4WFO A;  2WWU A;  4AQF C;  2XHE B;  3I56 3;  3NV0 A;  2CWT A;  4HYZ A;  3I1A A;  4N6N B;  4H3U A;  1IZN B;  4FMD A;  2CIU A;  3LTA A;  2DNX A;  3RDE A;  2XAJ B;  5LYJ E;  5HXE A;  2CWV A;  3VSY A;  3KVB A;  4PW8 A;  3ZYL A;  1SQW A;  4QX7 B;  3DMC A;  2CLY B;  2F98 A;  2XH9 A;  3PCR A;  1JV2 B;  2K5B B;  1OWA A;  3RKO A;  1HX8 A;  4L7K A;  4EYU A;  1D1A A;  2V7I A;  4A56 A;  2IA7 A;  3QC9 A;  3NHX A;  1D0X A;  2GBW B;  4Z8X A;  1X79 A;  4MMZ B;  3LXU X;  4CZZ B;  2SBL A;  1LVK A;  1YI2 3;  3RRW A;  1G73 A;  1QMA A;  4ZHQ E;  4L9I A;  2OTJ 3;  3C4W A;  2STD A;  5JR9 B;  3DY5 A;  1D0Y A;  1HCI A;  1D6Z A;  5FGO A;  3SOA A;  2CCQ A;  3FF0 A;  4KZ1 A;  3CX6 B;  1W4N A;  3K7C A;  3T8N A;  3UFE A;  2CXF A;  3E22 E;  4R1K A;  2L3L A;  3FBL A;  3MA9 A;  1NB3 I;  5JPP A;  2H7O A;  2IMJ A;  2MOZ A;  2W04 A;  3ETU A;  3SVA A;  4ISS A;  1VQ5 3;  1OCV A;  2NWB A;  2LYX A;  2A72 A;  4IE6 A;  4LEH A;  4O02 B;  4PJJ A;  2OTL 3;  1VQ8 3;  1Q42 A;  2E9X C;  5L3D B;  2LHN A;  3ZN0 B;  4HM6 B;  4YJ3 E;  2DWK A;  3ZEF B;  3ANW B;  2Q07 A;  4KBM B;  5IG5 A;  4QWN B;  3EDU A;  3FG1 A;  2KXP B;  1FGQ A;  5FNV E;  3O9X A;  1H7C A;  4MMY B;  3FLJ A;  3G4S 3;  3JUQ A;  3AA7 B;  1E3V A;  5DQW A;  4M1P A;  3Q1C A;  4HM8 B;  3V92 A;  1Q86 4;  2Z6E A;  1F8N A;  5JDM A;  4HM1 B;  3DUK A;  5DQV A;  4ZI7 E;  3TKL B;  2RGQ A;  4AI6 A;  3EBT A;  3F57 A;  3NUV A;  3C4Z A;  3HZP A;  3B57 A;  3Q9D A;  1JKG B;  2P0M A;  3SLU A;  1Z1S A;  2MBG A;  3DGM A;  4K1U A;  2I59 A;  3CNM A;  4DBR A;  2W00 A;  3KV6 A;  4RNY A;  2YU1 A;  3R6N A;  3D0T A;  2XR8 B;  2W0Q A;  2BMQ B;  1AV4 A;  3LK4 2;  5LNK A;  4KFD A;  2JMH A;  2VWA A;  3F8X A;  4IDZ A;  3WA2 X;  4EOZ B;  3IJE B;  3GWH A;  4H9P C;  1B7T A;  5LBM A;  3C51 A;  3LG7 A;  2VAS A;  3RGR A;  4GYR A;  2XQY A;  5JQG E;  4FMB A;  1OHP A;  4V1A v;  3BQL A;  2NOX A;  3BK9 A;  5IEP A;  5KMG P;  2P09 A;  2D42 A;  1ISK A;  4HVN A;  1MNE A;  4WYK B;  1YIJ 3;  3F31 A;  4JEU B;  1UX5 A;  5EK2 A;  1T5Y A;  3F8H A;  5AI1 A;  1N9E A;  2WGQ A;  3NZQ A;  1N5H A;  2XAS B;  3L3P A;  3PUS A;  5FXZ A;  3RYC E;  3JUO A;  3UT5 E;  1K41 A;  1KC8 4;  4NUV A;  1Q82 4;  2KWH A;  5EK4 A;  1BR0 A;  3CNX A;  3EJV A;  1JB2 A;  3VU7 H;  1STF I;  1NO3 A;  3G16 A;  5IER A;  4ORL A;  3K5T A;  3BND A;  3ZC0 A;  5E0O A;  3AMO B;  3CPZ A;  4GB5 A;  5BMV E;  5L3C B;  2Q9Q D;  4TX5 A;  3RRC A;  3MK7 C;  3I9Y A;  3O1I A;  3SOL A;  1QAF A;  4MHC A;  2C5K T;  2MTQ A;  4LZI A;  4AKI A;  4YFS A;  3UUL A;  5CA0 E;  1CYV A;  3T8U A;  2MYS A;  2LSI A;  4DMW A;  4EV2 A;  3L0R A;  3EQQ B;  3WOF B;  3ER7 A;  5L3G B;  2CG1 A;  3Q90 A;  2W2C A;  2CFL A;  1D1C A;  4QX8 B;  2ML6 A;  1ULJ B;  4K0U A;  3L09 A;  3N9H A;  5HGR A;  2LEH A;  2XGN A;  2LM9 A;  3WDG B;  5JDH A;  2NP9 A;  3EF8 A;  3CQG B;  1VOM A;  3MAC A;  3FG4 A;  2CEA A;  1D6Y A;  3UNL A;  2W61 A;  1ROV A;  4HBR A;  4HE8 A;  1TFO A;  3ZN1 B;  1JJ2 2;  4G2A A;  4AXP A;  3LTD A;  3R84 B;  3RYF E;  3WI3 A;  1S35 A;  5HXR A;  4OFZ A;  1WNH A;  1LVF A;  2CFG A;  3B8L A;  1YKH B;  1UW1 A;  1IVU A;  1V9D A;  2HPJ A;  1OUN A;  3IHR A;  3GN5 A;  5JR9 A;  2PNC A;  1HS7 A;  2K54 A;  4BJM A;  3KKG A;  1OHO A;  3PU8 A;  1CYU A;  4J9A A;  2LQV A;  4XBX A;  3G6E 3;  3ZMV B;  4FJO A;  2GEX A;  2XAF B;  4IE5 A;  1DVC A;  5JPU A;  2E2T A;  4OVM A;  4EIW A;  2YK0 A;  1ZV4 X;  4O2B E;  3ZYM A;  3QRD A;  1NU3 A;  3BQI A;  3CME 3;  1D0Z A;  2Q9Q B;  4CXY A;  4FCM A;  4JRF A;  1US1 A;  4AKG A;  3CC7 3;  1MNL A;  2WAU A;  3OYX A;  2CM0 A;  4P0B A;  2V1D B;  3AAA B;  3AVS A;  4GK0 E;  1OGZ A;  2HMK B;  3ANW A;  1W2Z A;  1QAK A;  4C91 A;  2LSG A;  1S94 A;  1GYB A;  1QJG A;  1NB5 I;  3BB9 A;  3S27 A;  5HXS A;  1W7C A;  4H9S E;  1Q40 A;  3P7I A;  3F7X A;  3V98 A;  1O7N B;  2XAG B;  2K48 A;  2CFD A;  3N54 B;  1NDO B;  2M7O A;  1V74 A;  1WMN A;  4P0A A;  3CCL 3;  4E7S A;  5H6Q B;  1QSD A;  4R4K A;  3LH4 A;  3EVY A;  4WNK A;  4N6U A;  5FP3 A;  2YIN A;  2Y8D A;  4I50 E;  2L8K A;  4MJD A;  4XZC A;  3RC3 A;  3EBY A;  2IUJ A;  3WAJ A;  3MG3 A;  2CWY A;  3KSP A;  2XFS A;  3IMA B;  4GOU A;  1FMW A;  3CC2 3;  2RSX A;  4N6O B;  3OYZ A;  5EVH A;  2QA7 A;  1IU7 A;  3NQZ A;  3K3O A;  1Q81 4;  1AVL A;  2DWG A;  2XAQ B;  4H63 V;  2Z7A A;  2IW5 B;  5D81 A;  4J2C A;  1U8C B;  3CCR 3;  3B13 A;  3GZB A;  4AEQ A;  5ETW A;  1FGR A;  4QXH B;  2RP4 A;  2CFW A;  3JUP A;  3PDY A;  3OW2 2;  1W6C A;  4BTY A;  3HKE E;  1CUN A;  3B4O A;  4PK5 A;  4BJN A;  2E9X B;  3A76 A;  4QHO A;  3KFW X;  1VQP 3;  3ONX A;  2RA1 A;  1IDP A;  1W00 A;  1C7H A;  4WYK A;  2OOV C;  3N2O A;  3AB3 B;  2B24 B;  1NWM X;  5JDN A;  4UVB B;  4EXR A;  4XBY A;  2CH9 A;  4FI5 A;  1Y4K A;  5AYR B;  2X9H A;  5BXQ A;  2WGO A;  1WQL B;  1M90 4;  1UX4 A;  2OQE C;  4U72 A;  3ROB A;  1N8R 4;  2DCF A;  1VRB A;  2CHC A;  5JRE A;  4PEJ A;  3AMO A;  2L4V A;  1FGM A;  4LSO A;  1WMP A;  2KZ7 B;  3SWH A;  2KXG A;  2Z77 A;  1VQO 3;  2P05 A;  5TGN A;  3FGY A;  3LYG A;  2K9A A;  5HWX A;  3N9O A;  3RPU A;  1DYU A;  5KX5 E;  3JC6 C;  4PFP A;  4IT7 A;  3JUM A;  3F2E A;  2WMO A;  1O7P B;  1ZHC A;  2YX9 A;  4UV8 B;  2KMF A;  2ODV A;  3OKQ A;  4ILU A;  3LK3 B;  1SHZ C;  2PG8 A;  3PCS A;  2IC9 A;  1ROA A;  3RYH E;  3VHL A;  5IG3 A;  5AIH A;  1NJI 4;  3HR0 A;  5HWY A;  3OWS A;  1FEW A;  4ADZ A;  3CVR A;  3Q5W A;  2W6J H;  3FXE B;  4MLK A;  3VKG A;  3ZPO A;  1G96 A;  2PBI A;  5JRC B;  1LVN A;  1ASK A;  5DJQ C;  4JF8 A;  1UI8 A;  2WM9 A;  3GN5 B;  1IV9 A;  4L8P A;  2D5U A;  3D9R A;  2KIN B;  3CCV 3;  1AJ3 A;  4RNZ A;  3X42 A;  1GY7 A;  5FY0 A;  3ECF A;  2L9Q A;  4N6M A;  1IV7 A;  4LMI A;  3ZCI A;  2PZV A;  3LTC A;  4AKR B;  4DND A;  4GK5 E;  4GIW A;  1VQM 3;  3I0O A;  1ULI B;  2IAK A;  3NBX X;  3O4X E;  1VQ6 3;  3KIN B;  2UX0 A;  4K90 B;  3TDG A;  1GY6 A;  4WBN E;  1D6U A;  5ELJ A;  3V5S A;  3ZMZ B;  1D1B A;  1VQ7 3;  2P38 A;  5L2L A;  2LT3 A;  2LOP A;  5KDM C;  2YFJ B;  5KP1 A;  3KV5 A;  1FA3 A;  4RBN A;  3PXM A;  4FR9 A;  2Q9Q A;  3ZYK A;  1DVD A;  2M67 A;  4HM3 B;  4CI1 B;  1HFA A;  1OF5 B;  3WAK A;  2CXD A;  1Q40 B;  3C4X A;  3MHE A;  1MIV A;  4OYJ A;  2CW9 A;  3LT8 A;  5EZY E;  1Z0P A;  2XEP A;  3BNE A;  3K9M C;  1FGO A;  4HM0 B;  1ZKE A;  3X40 A;  2ZMA A;  3BQK A;  4ZI2 D;  1IQ8 A;  1WYB A;  5IEO A;  2ES0 A;  2CE7 A;  5IYZ E;  1M1K 4;  5AFU L;  1FGT A;  4X2H A;  3H3H A;  2ZM0 A;  5LC6 A;  5FXX A;  2QGU A;  3E08 A;  1PU4 A;  2FXT A;  3S4U A;  3LT9 A;  4KFF A;  4OYK A;  4WHA A;  3B7C A;  2JJ9 A;  3O8Y A;  3T8O A;  2SPC A;  4PNI A;  4JLE A;  3GWR A;  4TX4 A;  4EAH A;  5D83 A;  3ZJ2 A;  4AKZ A;  3KBU A;  3N5L A;  2CK3 H;  2CLY C;  2IC6 A;  2X67 A;  2IUK A;  3HX8 A;  3UUX B;  1O7H B;  2EHO C;  1MIY A;  2OCT A;  3J7Y q;  3DM8 A;  1RRL A;  3QK6 A;  3K63 A;  4K61 A;  3EE1 A;  1JB5 A;  3HIG A;  5LG4 A;  3DP7 A;  5STD A;  2NW7 A;  4WW0 A;  1OH0 A;  3V5U A;  3KV4 A;  3VKH A;  2E9X A;  4G1M B;  5LXT E;  4NHF A;  1KNZ A;  5JDQ A;  3HKC E;  4HM5 B;  5JR9 C;  2ZL8 A;  5LGU B;  3I0Y A;  2VKJ A;  3CCJ 3;  4TV9 E;  5FY7 A;  3AAI A;  5DRE A;  4WP5 A;  4UEL A;  4BA9 A;  4STD A;  4XBT A;  3RGA A;  1MMD A;  3KBT A;  3ZCJ A;  5F8P A;  2X66 A;  3NX0 A;  3OBV E;  3VF1 A;  5CXO A;  4CI2 B;  1KWI A;  4LGQ A;  2UXX B;  3IPT A;  2HH7 A;  4PAG A;  2LSY A;  2Y48 B;  1DMN A;  3ZC1 A;  4OK0 A;  2CA5 A;  2X68 A;  3EX9 A;  5LHG B;  2B1E A;  3GRD A;  3NZP A;  4EV5 A;  3CX7 B;  1GD3 A;  3FKA A;  1QVG 2;  1Q7Y 4;  1VQK 3;  2VL8 A;  4ASK A;  2C11 A;  1TUH A;  1RN7 A;  3ETV A;  4NUU A;  2A2F X;  3N9L A;  2Y73 A;  4CQI A;  4GYS A;  3MPH A;  1KQS 2;  4IE0 A;  4ZOL E;  3PUA A;  5AII A;  2NTX A;  3KV9 A;  1HF8 A;  3CX8 B;  3KVA A;  1O7G B;  3OX9 A;  3F14 A;  3QUJ A;  3J9X 1;  4DVD A;  3S29 A;  4BAY B;  3HA4 A;  2BVL A;  3HII A;  1K9M 4;  2V26 A;  2VKH A;  2Y6X A;  2GXF A;  2BDE A;  4GL6 A;  1OHS A;  4CDL A;  1SJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...