4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Putative
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4OK0A 4O8SA
chains in the Genus database with same CATH superfamily
2CXDA 3E08A 3HKDE 2RSXA 3HIIA 3P4PA 3RX6A 1MWTA 3DGNA 1V9DA 4Z8XA 4UR9A 2BDEA 5GONE 1N8QA 4EC6A 4H63V 1WFDA 1OHOA 3H37A 1OWAA 2FJBA 2JDIH 3JUPA 5F3JA 1JB4A 3G6E3 3ETVA 2CM0A 4DR6T 4HZBB 2XUEA 2YDQA 3O1HA 1N32T 2JJ9A 3VU7H 4HM7B 4BL2A 3LT9A 2HMNB 2FUPA 3T8OA 3RRWA 3O1JA 5G2GA 2M6IA 2CG1A 3RDEA 2WWVA 1NO3A 2K54A 2CXLA 2DL1A 3F7SA 1LVFA 4QXBB 3AMOA 4EXTA 3PUYF 4R4KA 1IK3A 3EABA 3KIIA 2XQAA 2X68A 3MHEA 2K3WA 3ONLC 4MMXB 3HIGA 1KFYA 5BIRA 9RNTA 1UK5A 4UEMA 3N2OA 2CX0A 5FKYA 5AEUB 3AE5A 4MEIA 4EB6E 1YIT3 1I2EA 1O7HB 4XDVA 5LGNB 2VKOA 1M7KA 2UXXB 2BKPA 5CA0E 1CYVA 1YD8G 5FNVE 2KLQA 1T2IA 4LSOA 3PV0F 4YJ2E 2MAWA 5HCMA 1EG9B 4LMJA 1JBRA 1VQQA 2XQ6A 2CK3H 3CXC2 3A5XA 3LMLA 4WYKB 2IC6A 3K7CA 5J1GA 4DR1T 1E1HB 4G1MB 4X64T 2UUBT 2FJEA 4HM0B 3JAEA 3EN8A 3C4XA 1EKMA 5D81A 2YEVC 3WMDA 3PZWA 2P38A 4XM4A 3ZSTA 4DO0A 1N9JA 2CHOA 2XQ3A 1NB5I 4DBQA 3UTKA 5HAXA 1YIJ3 3MKDA 3SX1A 3LTBA 4ILUA 1EQKA 1HZ1A 1VQM3 2PJQA 4Z90A 4CI3B 5JR9A 4DV3T 4LF7T 5FY0A 4XAXB 3AAAB 2A72A 1KEYA 2XY8B 3RIUA 1W6CA 5AQOB 3F7XA 5JPUA 2HN1A 1CQSA 2V5CA 3MSOA 2BG9B 3HKBE 4M1PA 1AVKA 4YFSA 5LXTE 1MIWA 3UU3A 1Q824 1G8XA 1FJGT 2RPAA 2XR8B 2IIUA 2PFVA 2YDRA 5IG0A 4GKJT 3LBXA 2X9XA 2V5DA 5FYMA 1OXZA 5KXJA 1GOUA 1TUHA 3OWSA 2CHNA 2LM2A 1N5HA 2KINB 1D6ZA 1X79A 2MC8A 3LFMA 2YFJB 3ZT6A 2EHOA 3BB9A 4TV8E 1GSPA 4K1VA 2BG9E 4EV5A 3ESLA 4JI5T 4KFEA 1N34T 1IQ8A 1T5YA 1QJGA 2VL8A 2I6HA 5HXHA 2R41A 3CCS3 1YQ3A 1WMNA 3N5LA 2RP4A 2H0IA 3LTDA 4U33A 3LBXB 4LF8T 4C90A 2Z77A 3A5EA 1HFAA 1S723 4X5TA 1RMSA 3IHRA 2WAUA 4ZI2D 4JI4T 1W01A 3MPHA 3AGNA 1BR4A 3VKGA 1I2GA 1ZS7A 5IERA 2KF6A 1XWMA 1SUMB 4KX6A 4B3RT 2CXFA 5TGNA 2E9XB 2DCFA 3CPZA 4KFDA 4BTWA 3F2EA 2HOHA 2LRLA 1RGLA 2B1XB 3KSPA 2KCDA 2ZA4A 1O7NB 3B4OA 2EHOC 4FI5A 4RBNA 2UUCT 5CK6A 2NP9A 5AEWB 3ZMVB 2MF7A 1U4QA 3V5UA 2XRXB 2XQ5A 3VF1A 3AA0B 4MHCA 2VKJA 3EUHA 3OX9A 2DNXA 1YHQ3 1ZO2A 3QC9A 5AIGA 5AQUB 1A2VA 5CA1E 1K8A4 2W56A 3RQUA 2JMKA 4CDLA 1J1JA 3GZBA 3FZMB 4QXCB 3KFWX 3O8YA 4AKRB 3QNUA 3F8HA 3N9PA 3URPA 4HKVB 5G1KA 1HU9A 4L0RA 2DWKA 2Y48B 4JBWF 5J2TE 4NXMT 1YJ93 3N2GE 1DETA 2BO9B 3KZTA 4HFEA 5L3FB 1UDII 4B3MT 4CPKA 1LVNA 3D5GA 2W63A 3MXZA 4QX7B 3H51A 4OUQA 1RNTA 2V7MA 4E7ZA 1GOYA 5DRVA 5LC7A 4N6MA 1X1XA 3HZPA 4IE6A 1S5AA 2OTL3 2CH9A 1B2UA 4ZI2C 4U7IA 2WDQA 3S29A 3EX9A 3G16A 4G2AA 1ASKA 1S35A 3ECFA 3ZSSA 2C0SA 3OV4A 4X2HA 3VSYA 3PUQA 4EXRA 1E3VA 1RN1A 2LEHA 1IT8A 1WMOA 2C5JA 4R80A 4ZHQE 1GYBA 3FZHB 3PUSA 3QK6A 4HFVA 1RCKA 3L09A 5DJQC 1KC84 4QWNB 2XM1A 1SPUA 2C5KT 3MA9A 3EDVA 3IMAB 2CRBA 3SRZA 3ZMSB 3BIRA 5HEJA 1DVCA 4X62T 4HFIA 1VCSA 4YHHT 2KF4A 4MBQA 1E2AA 4I0UA 5A0OB 2D0UA 4K0KT 4J9AA 3M3ZB 3C51A 1W02A 4YTPA 4HFBA 3K8PC 2N9DA 4XBFB 3P50A 4TX5A 2LKGA 3EN1B 4HTEA 3B4PA 4DMVA 3VHLA 2H7OA 4OVMA 4PEJA 3V5SA 1SHZC 3N8BA 3ZYMA 4J5GA 2XQ8A 3UUBA 2ZL8A 4CN4A 3EF8A 1G96A 5AQVB 3FZLB 3NBBA 3MK7C 2XAQB 3NZPA 5TAOA 1MIYA 2EHOD 2WU5A 3UU5A 1T72A 5ADXL 2W04A 1OEDB 2WCAA 5AIHA 2XAFB 1UX4A 2Y6XA 1CH0A 1FUSA 4MMZB 4HM5B 2D0TA 4ERRA 5BR8T 3ZT5A 1OEDC 1STFI 4U13A 1WNHA 1RKYA 2UXCT 1E3RA 2D42A 1BR0A 2CLYB 4ILBA 1K41A 1W0AA 3PURA 1V58A 2BZBA 5ETWA 2VK9A 3ZLIA 3I0YA 2IC9A 4X1KE 3CCV3 2BU4A 4WFOA 5LMUT 4TV9E 5AIFA 4EV2A 4HM4B 1Q7Y4 1RGFA 4GIWA 3GN5B 5JDQA 4BIRA 3CD63 2XZEA 1Z1SA 2X0HA 3JC6D 1BAOA 2ACXA 2XM2A 2OOVA 2C4BA 3ZN1B 5IG4A 5LC6A 4DV0T 5FMNA 3L8RA 3PXMA 1MNEA 4WW0A 5ELUA 4HM3B 2NR4A 2Y8DA 4Z91A 3CCU3 3WA2X 5IEOA 1J5ET 3FXEB 5JDNA 3WOEB 1M904 2GSPA 4PJLA 2QA43 4OX9T 4X20E 1G0TA 4OK0A 2UU9T 3WAJA 3T8UA 3FH1A 2CIUA 3OW22 1SJWA 3GN5A 4P1NA 1RDSA 3QOFA 1KNRA 2BMRB 4YTMA 3AHSA 5FXWA 2BHMA 4TX4A 4ZI7E 3SOAA 2XQ9A 1OEDE 1YJN3 2DWGA 3N2KE 3D79A 1AVLA 3CKDA 3RIUC 5ABEA 1JNZA 1U5OA 3TLVA 4ZEYA 5EK2A 4BJMA 3BNBA 3CNXA 3CQCB 3VGNA 4P0AA 1NAFA 3ZEFB 1NB3I 4WZXA 2KF3A 1HG5A 2QGUA 3OWUA 1AQZA 2LT3A 2XAHB 1T8BA 2C5IT 3MACA 1I0VA 1G02A 4U72A 1YVBI 3DJBA 3AVRA 2RFRA 1MMAA 2LSGA 1BRGA 5AQTB 3MJXA 1A67A 4QXHB 2H7VC 1YGEA 4N6NB 2GBWB 1XNQT 3ZYKA 3RGLA 5STDA 3X3YA 1XDOA 3PDYA 1JBSA 2H3RA 4EEBA 3RLFF 1XZYA 1UGIA 4ORLA 3RQWA 2N1GA 1VQN3 3P4RA 2HHHT 2R4IA 3CMLA 4HM8B 4YTNA 5KMGP 3DH2A 4K0UA 5JR9B 1FMWA 1BSEA 2I59A 2WGOA 2KAAA 3S27A 4B6XA 4OYKA 1JNRA 3D5IA 2F5MA 2LSYA 4X65T 2KXPB 5EK4A 3KKGA 2DI4A 2HPLA 1IBLT 3KBTA 3I553 2XAGB 4N6LA 4CI2B 2N2NA 4DV5T 2CWOA 1ROAA 4I4KA 5J0ZA 5AYRB 4DV4T 3JUMA 1IYYA 4OYJA 1GMQA 3Q5XA 4ZZCA 1Y4KA 2YDSA 1GY6A 4LFCT 3F57A 1RN4A 2GK9A 2CMRA 4TWHA 3DUKA 3KCHA 3G8ZA 3FBZA 1FGOA 3EE1A 5LHHB 4IDPA 2A2FX 3EQQB 1U8CB 4TUYE 1HNXT 5AQQB 5HEGA 2XAJB 1W6GA 3I1AA 3D9RA 5IYZE 3LYGA 2Y73A 3PUAA 5HXEA 4ZZBA 4ADZA 3PU8A 3J7Yq 5EK3A 5AQSB 4ISSA 2VKDA 3C98B 4IPBA 3HX8A 1FW7A 3FKAA 2D1WA 4LF4T 1VQO3 3ZMUB 1KNPA 4AEQA 4N3VA 5AQJB 1VOMA 1YGWA 4LGQA 4KMCA 1ROVA 4O2AE 3SFEA 2NW7A 1VQP3 4BTYA 3FG3A 3AE2A 3LK2B 5C8YE 3WODG 2F5WA 3NWIA 3PU3A 5HXSA 4X1YE 3STDA 1FGRA 1XMOT 3NX0A 1LXEA 4P0BA 2IMLA 1TIJA 5IG3A 4DUZT 4QH1A 3ALAA 3NRYA 3GA8A 2NW9A 2QRXA 4KFFA 1IZNB 1WYBA 4EYUA 4JYAT 1ZEEA 4AI6A 4JRFA 5CF2A 3C4WA 3CCL3 2GEXA 3BQKA 2CWYA 3SVAA 3RF1A 5HYAA 5KDMC 4H3UA 1HCIA 3AMOB 1UI8A 2K3DA 2K5BB 1IVUA 4TNVA 3B5MA 1GMPA 1FUWA 1D0YA 2KZ7B 4AKYA 1Q42A 4MMYB 2E5VA 2V6YB 5CXOA 1HNWT 2W9QA 3CC23 5L3EB 4KT3B 3PJAJ 3IJEB 1RHLA 2VQFT 3IBPA 3KV5A 3GMIA 2EHOB 3KDSE 1I8VA 4JI7T 2UXDT 2CG0A 2K24A 2Q9QA 4CXWA 3CCE3 3MG1A 3SS1A 4KVHA 1BUQA 2XF3A 2E8IA 3OVUA 4XBYA 3CPW2 3DXOA 3F40A 1N33T 5LOVE 2K0MA 3RGRA 3LT8A 3IA3A 4R9LA 2HN2A 1B2ZA 1JKGB 2RA1A 2IUBA 1W0BA 2WMNA 4JLEA 2OCTA 3NM7A 3UQ7A 2WMOA 4KUMB 3I563 3UQ4A 1YKHB 2GBXB 4AKGA 2L9QA 3M8CA 2Z6EA 2MBGA 5AI1A 4N6UA 3OKQA 1UCJA 1LOVA 2Z7AA 3DMCA 4DV7T 1DU2A 5JDGA 4B3ST 3BU4A 1W09A 3K3QC 3SLUA 3V92A 1OEDA 2VKHA 3Q3FA 2H88A 2BS3A 5L3BB 3CVRA 1RTUA 7GSPA 4E7SA 4PJMA 1IV7A 2QGSA 4EBGA 2NTYA 2W4XA 4LMKA 1YVSA 5IG5A 5JQGE 4O4LE 5AQGB 3UFGA 2PTFA 4IDQA 4HBRA 4QKNA 1GD4A 1M1K4 1Q9EA 3VR9A 3AA6B 2BG9A 1ZHCA 5LJNA 1MGRA 2XGNA 2BVLA 5HWYA 4LFAT 3QB5A 4HWFA 2KXGA 3EB8A 3AE7A 1ISKA 1US1A 1JB5A 2CE7A 1AR0A 2C10A 5DQWA 3AGOA 1YNVX 2WZHA 1JKGA 3AXJB 5HXRA 3D0TA 2B1EA 4IDOA 4AQGA 5CJ5A 3L0RA 4FR9A 3WOFB 3LH4A 2RGQA 1NEKA 1SIHA 4JI3T 2OQEC 4YSZA 2GXFA 2BNGA 4WYVA 5LHIB 1A2KA 4HWHA 3PCRA 3ETUA 3RI5A 3SOYA 1B20A 1JN5A 4DIDB 1OGXA 2ZM6T 4KHPT 1OCVA 1ZP0A 2W00A 2XASB 2JQQA 2IHR1 3ZC0A 1S94A 4QH5A 2V6YA 4LYLB 4JI1T 4HAAA 4HVNA 3Q2PA 5IF6A 3CME3 5FL1A 5DQVA 2D9DA 2RBIA 4DV2T 2DLRA 5L2LA 1HNZT 2Z6BA 2YU2A 3P4QA 4EYYR 2AAEA 2W66A 4H9SE 4ZI3C 3FBLA 5DREA 1OF5B 4U31A 3DZLA 1Q7HA 1NWWA 1X1WA 2OOVC 3JAFA 5FVKA 5LA6E 3JC6C 3RNTA 2WB5A 4LF5T 4COFA 1W2B2 1MMGA 4K61A 1MMDA 3TDGA 5AQNB 3UU4A 2KT9A 3FB2A 3OBVE 4AKIA 3UFEA 4IREA 1BNIA 4GKKT 3QB5K 4NREA 1LKXA 5L3DB 1C54A 1K734 1KD14 3KSED 5DABA 4P09A 4IIAA 3RYIE 2E5LT 1FZUA 3OWYA 2XFSA 5JDHA 3OYZA 1SQWA 1Z8UA 2YN6A 5JVDE 1KK7A 2LE8A 3WDGB 1X9BA 4F8HA 5AFUL 2HPJA 1JBTA 1WR0A 1G73A 4YXDA 1OACA 4Q25A 2PNCA 3LXUX 2A9UA 3DY5A 1WTHA 1KWIA 4JI8T 4IE5A 5JRCB 3J9X1 4WYKA 4PK6A 5L4HA 2X0YA 4O4JE 4H61A 5FW5A 2CWTA 3T8NA 1O7GB 3AAIA 3H3AA 3EBYA 3IEEA 3RGAA 3GRDA 1VQ93 2WSSV 2F99A 1BANA 3I0OA 4U2YA 2L1SA 4I50E 3LOYA 3T1HT 1RLSA 2CPTA 2FJDA 4YJ3E 1XMQT 4H9RC 4GYRA 2LHNA 3ZMZB 1NENA 4IGUA 3LSVA 2FXTA 2WBLA 2FBWA 3H3MA 5JRCA 1W9RA 4WHAA 2HMOB 1M9GA 4U2ZA 2WOHA 5L4EA 3MG3A 4I55E 1PFPA 4XDWA 5IEPA 3ZCIA 1UUVB 2IA7A 3K1SA 1HYFA 3TLTA 2BVMA 1R4YA 4LF9T 3U1WA 2QVAA 3K0ZA 4DUYT 5IUXA 1MIVA 3ZYLA 3ZJ1A 2L3LA 2MTQA 4L5GA 4X66T 4XB5A 1KNZA 4GOUA 2Q9QD 5LGTB 4RNYA 3LDQB 2UGIA 3X41A 3Q2MA 4X1IE 2W03A 4UIGA 1TTOA 4JI6T 3RYCE 4PK4A 4EAHA 3AE9A 2O3OA 1IJ5A 2Z76A 3EVYA 2WO0A 2O9UX 5LB7B 4A56A 1UUWB 4XBXA 4CJNA 2M67A 1ZV4X 4KZ1A 2YU1A 4RNZA 1X1UA 2NOXA 1LRZA 5GSPA 2XSHB 3X1DA 1RRHA 1D1AA 1IV9A 4UVCB 3PTRB 3FF2A 2A3DA 3Q9DA 3QUJA 4N6OB 2VVSA 3AEGA 4C91A 3TLSA 4BA9A 4HEAA 2W0QA 4GHOA 1WYCA 2XSBA 4ZM8A 3V99A 2CBIA 5BVBA 3RHWA 1ZX2A 3GWHA 3J7Yd 1NJI4 3HI7A 1XNRT 1QVG2 4WWUC 1FYSA 3ZN0B 1BNFA 2SPCA 2BG9C 1LOWA 4G63A 3S28A 2ZMAA 3N9MA 3AECA 1MNDA 3FZWA 3DGOA 2HMJB 1IVWA 4ZS2A 1RRLA 4WBOA 1T7SA 3CU3A 4GB5A 2NW8A 4FMAA 3ANWB 1QLBA 2BKNA 3UU6A 3GSPA 4AQFC 2HMMB 4ZI3D 5LBMA 2IDOB 4ISTA 2UXNB 3AE8A 5EVHA 4IT7A 3AVSA 4BU4A 2V7JA 4X2OA 2V7LA 3ONXA 2P0XA 1I6ZA 2WWUA 4JEHB 4H9PC 1LQGC 4JI2T 4CXYA 1R4CA 2ES0A 5M19A 3NXJA 3Q1CA 4NHFA 2LSJA 1IQXA 1OH0A 4ILFA 5LCYA 4UVAB 3CCR3 1TRQA 2UX0A 3O4XE 5HCJA 1OUNA 2P05A 3BNCA 4H9NC 4FMDA 3B13A 2XQ4A 1MWUA 4R1KA 4BJNA 4AKLA 3X42A 2J8XB 4ZS3A 2CWVA 1IT7A 1OGZA 2LSKA 4HWIB 3Q5DA 5JR9C 3E0ZA 4TZ4C 1V74A 1D0XA 2CHCA 1R8IA 4GL6A 4HE8A 4LMLA 2CFGA 2KNDA 3WI3A 3DGLA 5KP1A 3AEFA 4O8SA 2LLYA 1YW0A 1O7WB 3CC43 4UF0B 1HR0T 2D5UA 2W67A 5AQRB 4CQIA 3F31A 5CFBA 5M18A 3RYFE 2W62A 3Q90A 2QEX3 3PUXF 4I4TE 3CQXC 4PNIA 2CFKA 3O9XA 1YQ4A 5F5WA 1DMNA 2KMFA 4PAGA 2M7OA 2XEPA 2J47A 2V7IA 1O7MB 4KP3C 2IUKA 3NV0A 3WHOA 4EOZB 5AQHB 3ZG0A 1Q864 1M1XB 3GZRA 4TWFA 2ZHXB 4HM2B 3CX8B 2W6JH 1VQ83 3I0QA 1ULJB 2YKSA 1A90A 4CN6A 3C50A 3FG4A 3UT5E 3TLWA 3CX6B 7RNTA 1BNJA 1O7PB 2W56B 3KE7A 2BBHA 2LOSA 1GS3A 3AXJA 4QH4A 4K90B 1VQ63 1B2SA 3DM8A 4BL3A 4N78D 2XFTA 5KP4A 2HH7A 4LF6T 4GYSA 1HTJF 2VL0A 2CWUA 4LZIA 2VB6A 4NPPA 3HKEE 5KP3A 4QHOA 4AIUA 1HF8A 3SYUA 2WQYA 2XPKA 3E99A 2E9XA 1US7B 2B76A 2XTLA 3E22E 4FMCA 4DKIA 5LMNT 3LTCA 3K3OA 1MOLA 3FHNA 1ZKEA 3K3NA 2STDA 1UUSA 2BT3A 3K63A 1Z0PA 4I43B 3N9OA 2YX9A 5D82A 2RNTA 3X3XA 1KSIA 3HI2A 5LHGB 3BLZA 5JBSA 1BRHA 1AV4A 2UUAT 3ZMTB 1VQ43 3AE3A 4TWDA 1YKEB 2XQ7A 4H63H 4WNKA 5C2TA 4GSPA 3F8XA 3P4SA 5D83A 1B27A 4QWTA 1DMQA 3JVCA 3UL6A 3W15B 3HK4A 3AE6A 1DVDA 3T0UA 4PJJA 2GU1A 4J8TA 4EV6A 2W0GA 1BRKA 2OWPA 3WAKA 5AQFB 3U97A 2X66A 2ZM8A 3KN4A 3V98A 4F6RC 8RNTA 4ZOLE 5M1AA 4A5XA 4Q53A 4ILCA 2XSOB 4HJLB 1I2FA 3KVAA 3TLUA 4AQYT 1LOYA 2MPKA 4K1UA 3ZPOA 5AQKB 2JQ5A 3N54B 1QSDA 5JH7E 1FGTA 2K48A 3L3PA 3LZAA 1JZOA 3G713 5AQMB 7STDA 2LHRA 4FCMA 2ML5A 2CFDA 2HMLB 4N6TA 1V57A 1Q40B 3PUWF 2F98A 3VR8A 1LVKA 2WY2A 1Y01A 3UUXB 1GD3A 2WP9A 2HMKB 1BGSA 3VRAA 3MYTA 4HWDA 3ZKRA 3KV6A 1E7PA 2WDRA 4IT4A 1QAFA 4EYCA 4IIJE 1IQYA 2WDVA 2X51A 2LSIA 4IE4A 1LNHA 3D4AA 4H9QC 4HZ9B 3OPCA 3PUVF 3CQGB 3AA1B 4IL4A 4PFPA 1KQS2 4OFZA 4IL9A 4O3VA 2JQHA 4UV8B 4MJDA 1BSDA 5IWAT 1A2PA 3KFQC 5EZYE 3BQLA 2OV9A 3T1YT 4FMBA 1TU5A 3K9MC 1N5PA 4A97A 1BR2A 5LP6E 2PBIA 3N9QA 3AEDA 5FP3A 5FXXA 4JEUB 2AE9A 1ULIB 1YI23 2V7KA 3CWZB 4DMWA 2WS3A 1NNVA 2L4VA 3G0KA 1BRNL 2I0MA 1GOVA 2YOEA 5C3JA 4HOHA 2KWHA 2KSRA 2YINA 4XBTA 4HM1B 4AKHA 1W6YA 1FMVA 2UXBT 2PG8A 2OTJ3 4ILAA 2WU2A 5IW9A 1EA2A 3R84B 1WQLB 1QALA 1JRQA 2CFLA 2BS2A 2XH9A 1OF5A 4J5KA 2IAKA 5AYSC 2E2VA 4IDNA 4MLKA 4AQFA 3HKCE 1KF6A 5ABGA 2V6XA 1N36T 1BSCA 3FLJA 2CKFB 1HG2A 1UUGB 3CCQ3 5AQIB 2WZIA 3WR2A 3PS8A 4DR7T 3G4S3 1HX1B 1TRPA 4STDA 2CCQA 1UCLA 4YHJA 2X67A 4YY3T 2DHRA 4CN1A 1U5PA 3AE1A 2CEAA 2ODVA 1QAKA 1UW1A 5HEUA 1OHPA 2OQEA 1BNGA 3QK9A 3NQYA 2E2TA 4QX8B 3CIRA 1W2ZA 1IU7A 3K5TA 3X3ZA 4O2HA 3TKLB 1EZ3A 3QRDA 5JDFA 2X9WA 1VCTA 1I0XA 2Q9QC 3EJVA 1I3IA 3C4ZA 2QA7A 1IDPA 3JUQA 3AB3B 3HL6A 2Q9QB 1OHSA 2IY2A 5G1LA 5CGMA 3D3LA 3CNMA 3AE4A 1RGCA 1C7HA 1J5WA 1L0VA 3AA7B 2VVNA 1T98A 4KBMB 3ZC1A 5FY1A 1RCLA 2WGQA 2J1DG 1JZDA 1FEWA 1JNQA 4FCJA 5BXQA 1UCKA 1J2BA 1FGQA 4LFBT 1BNEA 4EZ4A 4NUVA 2CLYC 1IBKT 5F8PA 2I9WA 4FCZA 4EEDA 1JN5B 3PUGA 3HA4A 3O1IA 1BRJA 2KWIB 1RJOA 1X1YA 4LEHA 1BUJA 1D1BA 2RCDA 5CB4E 4HKAA 4WP5A 2F4YA 4AKZA 5LNKA 3SWHA 3FSDA 3FZKB 2W2UA 5FXVA 1L5GB 3CC73 1QVF2 3MKIA 4EGWA 4HM6B 2CC3A 1MNLA 1STDA 2H89A 6RNTA 4O02B 2VASA 3KV9A 4GK5E 2BIRA 3S4UA 3NKZA 4ZXLA 4U74A 4AISA 1BRIA 4A98A 3X40A 2V1DB 1E97A 1NDOB 1K9M4 2IMJA 2V1LA 2JPFA 3ROBA 4YSXA 2W9PA 4O4IE 1SA0E 2FJAA 4OHFA 2P0MA 5ABFA 3C64A 1WMPA 3SEDA 2IW5B 3FXDB 2W2CA 2UUGC 1DMMA 5LBQB 3U78A 5L47A 4YT0A 3SOLA 3N9NA 3M65A 4DV6T 3BNEA 1DE3A 2P09A 1TFKA 1I3FA 2L8KA 2BMOB 3B7CA 1UCIA 1JV2B 3CX7B 2GEYA 2KF5A 4GK0E 1GMRA 2AXDS 2ZLYA 3RKGA 4MFRA 2W61A 4UVBB 2K9AA 4CXXA 3I9WA 1SE7A 4MALA 1TFOA 2X9HA 2VURA 3LK3B 3GZXB 2YFIB 2ZDJA 2CX1A 4BTXA 2Y74A 3RH3A 5LGUB 1Q40A 1UGOA 1BSBA 3UU8A 5ABFB 1UCUA 1LNIA 1XDPA 1PYLA 2FGTA 1ZGXA 3NHXA 5EQLA 3A76A 2ZM2A 2OA5A 2P9BA 2Q07A 5AQLB 3ABVA 4YSYA 1N8R4 3EAMA 4J2CA 4EW5A 3H3HA 1LOXA 4BAYB 3ONJA 1FGMA 5IHYA 3UB1A 1D0ZA 4XZCA 1GQEA 2XQYA 1OPYA 1W5ZA 1JJ22 3BNDA 3FG1A 1QUUA 3JUOA 1JB2A 3KBUA 2SARA 1Y64B 1MGWA 2V8SV 4O4HE 1UI7A 2E2AA 3VKHA 1T3BA 4DR2T 1VQ73 3PE0A 1VQL3 3UUNA 3HOHA 1MMNA 4IHJE 4I5QA 3NUVA 3JADA 3NVOA 3B8LA 1CUNA 2ZM0A 1D6UA 3RRCA 2QYWA 3AAEB 3LTAA 2IUJA 4PFOA 3CK6A 3AEBA 3DGMA 1TJDA 4EZHA 3A7MA 3WA3A 1RGGA 5L3CB 4UV9B 3GWRA 3U3IA 2BS4A 5A1LA 4ASKA 5LG4A 4O2BE 1SIIA 2X9YA 3SFDA 2H0GA 2LKHA 1K28A 1BVIA 5LYJE 5EEOA 5E0OA 1FUTA 2FNQA 3MZKB 5JPPA 3IF8B 3NQZA 1I94T 2J4GA 3OTOT 1RNBA 1DYUA 1BOXA 1QMAA 5H6QB 2BKOA 3S67A 5KX5E 1IVVA 3PGBA 3F9SA 2G0UA 3NBRA 1CYUA 5FXZA 3DP7A 3CMA3 4R9KA 5M4YA 1F8NA 1D1CA 3Q5EA 3ZT7A 5BMVE 1VZZA 3NV0B 1AJ3A 1RGHA 2JRKA 1YJW3 2V26A 1TP6A 3MWZA 3LJCA 2E2UA 4UELA 5FGOA 1GY7A 1HKXA 4IE0A 1PY3A 2PZVA 2AADA 4L9IA 4HYZA 3MG2A 1WRDA 2VWAA 4NXNT 3ZG5A 2CBJA 2LM9A 5HEOA 4H9OC 3NRXA 3EC9A 3VRBA 3GAXA 5JDLA 2CA5A 4JV5T 2E9XD 1RGKA 2LYXA 4YLHA 2NWBA 4UXNB 1AY7A 6STDA 4DR5T 2LOPA 3RIFA 4CZZB 1BRSA 3N9HA 1M62A 4PK5A 4TN7B 4UF0A 1H7CA 1B21A 2XJ7A 4HFDA 1WLXA 4TNWA 1LQMB 3GZYB 1WR6A 3G06A 4HN9A 2E9XC 1BR1A 3Q5WA 5L3GB 1D6YA 2KRTA 3PYJA 5HXCA 3JCFA 1I70A 3NBJA 2MOZA 2WOFA 3UUMA 1IAPA 1W7CA 1RGAA 3RPUA 5HGRA 3RC3A 3UJMA 2XGLA 5BU4A 3RIAA 1B3SA 1LRAA 3FGYA 4N6V0 4NUUA 3OYXA 4DR3T 3CPOA 2YK0A 4V1Av 3DTOA 2JQ9A 1YXRA 4KHZF 1Q814 3EI0A 3ZCJA 3R6NA 2LJLA 1EEJA 5ABHA 2INXA 3UULA 3BQIA 3SXXA 4U7YA 2WM9A 1IBMT 4NPBA 4JI0T 1RN7A 4FJOA 3I9YA 2H0HA 3PUZF 4WBNE 5LG3A 2OLTA 4L8OA 1BNSA 3FCSB 1NU3A 1PU4A 3AHWA 3ANWA 1BNRA 2F4VT 1CHUA 1VQK3 1GY5A 5JREA 2ML6A 1CEWI 2A15A 3EDUA 3AEAA 2IYJA 4HFCA 1UURA 4EIWA 5AIIA 5CLKA 3AEEA 3FF0A 3RYHE 3BK9A 2BMQB 4NIQA 2D2SA 4JF8A 5J2UE 1RGEA 1W00A 5HEHA 1VRBA 3RKOA 1FA3A 1HS7A 3HR0A 3KVBA 5CF1A 5AQPB 1MWSA 4HGAA 1IJ6A 2J62A 4DVDA 2F86B 5FY7A 2QIYA 4AXPA 2JQKA 3N9LA 3UNLA 2JIWA 3P8CD 1IVXA 5JDMA 2ACZA 5ELJA 1ZOYA 3DGYA 5FVLA 1B7TA 3B57A 4DBRA 2GU3A 3CCJ3 1HX8A 3NM2A 3EHCA 2JMHA 2BBJA 4IE7A 3PCSA 5HOHA 5LJMA 2XHEB 4CCVA 2M6BA 4DR4T 3PJAA 3NBXX 2R6GF 1T2HA 3ZJ2A 6GSPA 1NWMX 2MYSA 3S5CA 4PW8A 3F14A 3JUNA 2XSAA 4LMIA 3P4WA 3EHZA 4B3TT 1UX5A 3OXAA 4PJNA 1UGHI 1MWRA 3ER7A 2VQET 4DNDA 1BSAA 2NTXA 3KV4A 3OJAA 4RZMA 1B2MA 1SARA 2C11A 3IPTA 3LK42 2ODUA 5HWXA 3CCM3 4ANJA 4KI0F 4L7KA 5JTGA 4IDZA 1FIOA 2B24B 8CHOA 1BIRA 4DV1T 3UL5A 3ZFZA 1RSNA 2F56A 4RNTA 4JUYA 2SBLA 4U3CA 4HFHA 4L8PA 5I97A 3EBTA 3RC8A 1W4NA 5RNTA 5H6RB 1EUIC 5IENA 1N9EA 4HWCA 1B2XA 3L39A 3A8YC 1WCRA 3FZFB 3KINB 4CI1B 1O3XA 3LG7A 2LRKA 2X0LB 1BU4A 2CFWA 2LQVA 2YFLB 3P7IA 5FL0A 1VQ53 2CW9A 3NZQA
chains in the Genus database with same CATH topology
2CXDA 3E08A 3HKDE 2RSXA 3HIIA 3RX6A 3DGNA 1V9DA 4Z8XA 2BDEA 5GONE 1N8QA 4EC6A 4H63V 1OHOA 3H37A 1OWAA 2JDIH 3JUPA 5F3JA 1JB4A 3G6E3 3ETVA 2CM0A 4HZBB 2XUEA 3O1HA 2JJ9A 3VU7H 4HM7B 3LT9A 2HMNB 3T8OA 3RRWA 3O1JA 5G2GA 2CG1A 3RDEA 1NO3A 2K54A 2CXLA 3F7SA 1LVFA 4QXBB 3AMOA 4EXTA 4R4KA 1IK3A 3KIIA 2X68A 3MHEA 4MMXB 3HIGA 4UEMA 3N2OA 5AEUB 4MEIA 4EB6E 1YIT3 1O7HB 4XDVA 5LGNB 2VKOA 2UXXB 5CA0E 1CYVA 1YD8G 5FNVE 2KLQA 4LSOA 4YJ2E 1EG9B 2CK3H 3CXC2 3A5XA 3LMLA 4WYKB 2IC6A 3K7CA 5J1GA 1E1HB 4G1MB 4HM0B 3EN8A 3C4XA 1EKMA 5D81A 2YEVC 3WMDA 3PZWA 2P38A 4XM4A 4DO0A 1N9JA 1NB5I 4DBQA 3UTKA 5HAXA 1YIJ3 3MKDA 3SX1A 3LTBA 4ILUA 1EQKA 1VQM3 2PJQA 4CI3B 5JR9A 5FY0A 4XAXB 3AAAB 2A72A 1W6CA 3F7XA 5JPUA 1CQSA 3MSOA 3HKBE 4M1PA 1AVKA 4YFSA 5LXTE 1MIWA 1Q824 1G8XA 2XR8B 2PFVA 5IG0A 3LBXA 2X9XA 5FYMA 1OXZA 1TUHA 3OWSA 1N5HA 2KINB 1D6ZA 1X79A 2MC8A 3LFMA 2YFJB 2EHOA 3BB9A 4TV8E 4K1VA 4EV5A 3ESLA 4KFEA 1IQ8A 1T5YA 1QJGA 2VL8A 5HXHA 3CCS3 1WMNA 3N5LA 2RP4A 3LTDA 3LBXB 1S723 4C90A 2Z77A 1HFAA 3IHRA 2WAUA 4ZI2D 1W01A 3MPHA 1BR4A 3VKGA 5IERA 2CXFA 5TGNA 2E9XB 2DCFA 3CPZA 4KFDA 4BTWA 3F2EA 2B1XB 3KSPA 2KCDA 1O7NB 3B4OA 2EHOC 4FI5A 4RBNA 5CK6A 2NP9A 5AEWB 3ZMVB 2MF7A 1U4QA 3V5UA 2XRXB 3VF1A 3AA0B 4MHCA 2VKJA 3EUHA 3OX9A 2DNXA 1YHQ3 1ZO2A 3QC9A 5AIGA 1A2VA 5CA1E 1K8A4 2W56A 2JMKA 4CDLA 3GZBA 4QXCB 3KFWX 3O8YA 4AKRB 3F8HA 3N9PA 4HKVB 1HU9A 4L0RA 2DWKA 2Y48B 5J2TE 1YJ93 3N2GE 2BO9B 3KZTA 5L3FB 1LVNA 2W63A 3MXZA 4QX7B 3H51A 4OUQA 2V7MA 4E7ZA 5DRVA 5LC7A 4N6MA 3HZPA 4IE6A 1S5AA 2OTL3 2CH9A 4ZI2C 3S29A 3EX9A 3G16A 4G2AA 1ASKA 1S35A 3ECFA 2C0SA 3OV4A 4X2HA 3VSYA 3PUQA 4EXRA 1E3VA 2LEHA 1IT8A 1WMOA 2C5JA 4R80A 4ZHQE 1GYBA 3PUSA 3QK6A 4HFVA 3L09A 5DJQC 1KC84 4QWNB 1SPUA 2C5KT 3MA9A 3EDVA 3IMAB 3SRZA 3ZMSB 1DVCA 4MBQA 5A0OB 2D0UA 4J9AA 3C51A 1W02A 3K8PC 2N9DA 4XBFB 4TX5A 3EN1B 4HTEA 3B4PA 4DMVA 3VHLA 4PEJA 4OVMA 2H7OA 3V5SA 1SHZC 3N8BA 3ZYMA 2ZL8A 3EF8A 1G96A 3NBBA 3MK7C 2XAQB 3NZPA 5TAOA 1MIYA 2EHOD 5ADXL 2W04A 5AIHA 2XAFB 1UX4A 2Y6XA 4MMZB 4HM5B 2D0TA 4ERRA 1STFI 4U13A 1WNHA 1RKYA 1E3RA 2D42A 1BR0A 2CLYB 1K41A 3PURA 2BZBA 5ETWA 2VK9A 3ZLIA 3I0YA 2IC9A 4X1KE 3CCV3 4WFOA 4TV9E 5AIFA 4EV2A 4HM4B 1Q7Y4 4GIWA 3GN5B 5JDQA 3CD63 1Z1SA 3JC6D 2ACXA 2OOVA 3ZN1B 5IG4A 5LC6A 5FMNA 3PXMA 1MNEA 4WW0A 5ELUA 4HM3B 2Y8DA 3CCU3 3WA2X 5IEOA 3FXEB 5JDNA 3WOEB 1M904 4PJLA 2QA43 4X20E 4OK0A 3WAJA 3T8UA 3FH1A 2CIUA 3OW22 1SJWA 3GN5A 2BMRB 5FXWA 2BHMA 4TX4A 4ZI7E 3SOAA 1YJN3 2DWGA 3N2KE 1AVLA 3CKDA 1U5OA 5EK2A 4BJMA 3BNBA 3CNXA 3CQCB 3VGNA 4P0AA 1NAFA 3ZEFB 1NB3I 1HG5A 2QGUA 3OWUA 2LT3A 2XAHB 2C5IT 3MACA 4U72A 1YVBI 3DJBA 3AVRA 2RFRA 1MMAA 2LSGA 3MJXA 1A67A 4QXHB 2H7VC 1YGEA 4N6NB 2GBWB 3ZYKA 5STDA 3X3YA 3PDYA 2H3RA 4ORLA 2N1GA 1VQN3 2R4IA 3CMLA 4HM8B 5KMGP 4K0UA 5JR9B 1FMWA 2I59A 2WGOA 3S27A 4B6XA 4OYKA 2LSYA 2KXPB 5EK4A 3KKGA 2DI4A 2HPLA 3KBTA 3I553 2XAGB 4N6LA 4CI2B 2N2NA 2CWOA 1ROAA 4I4KA 5AYRB 3JUMA 4OYJA 3Q5XA 1Y4KA 1GY6A 3F57A 2GK9A 2CMRA 3DUKA 3G8ZA 3FBZA 1FGOA 3EE1A 5LHHB 2A2FX 3EQQB 1U8CB 4TUYE 2XAJB 1W6GA 3I1AA 3D9RA 5IYZE 3LYGA 2Y73A 3PUAA 5HXEA 4ADZA 3PU8A 3J7Yq 5EK3A 4ISSA 2VKDA 3C98B 4IPBA 3HX8A 3FKAA 2D1WA 1VQO3 3ZMUB 4AEQA 4N3VA 1VOMA 4LGQA 4KMCA 1ROVA 4O2AE 2NW7A 1VQP3 4BTYA 3FG3A 3LK2B 5C8YE 3WODG 3PU3A 5HXSA 4X1YE 3STDA 1FGRA 3NX0A 1LXEA 4P0BA 1TIJA 5IG3A 3ALAA 3NRYA 3GA8A 2NW9A 4KFFA 1WYBA 1IZNB 4EYUA 1ZEEA 4AI6A 4JRFA 5CF2A 3C4WA 3CCL3 2GEXA 3BQKA 2CWYA 3SVAA 5HYAA 5KDMC 4H3UA 1HCIA 3AMOB 1UI8A 2K5BB 1IVUA 1FUWA 1D0YA 2KZ7B 4AKYA 1Q42A 4MMYB 5CXOA 2W9QA 3CC23 5L3EB 3IJEB 3IBPA 3KV5A 3GMIA 2EHOB 3KDSE 2CG0A 2K24A 2Q9QA 4CXWA 3CCE3 3MG1A 3SS1A 4KVHA 1BUQA 2XF3A 2E8IA 4XBYA 3CPW2 3DXOA 3F40A 5LOVE 2K0MA 3RGRA 3LT8A 4R9LA 1JKGB 2RA1A 2WMNA 4JLEA 2OCTA 3NM7A 2WMOA 4KUMB 3I563 1YKHB 2GBXB 4AKGA 2L9QA 3M8CA 2Z6EA 2MBGA 5AI1A 4N6UA 3OKQA 2Z7AA 3DMCA 5JDGA 3K3QC 3SLUA 3V92A 2VKHA 5L3BB 3CVRA 4E7SA 4PJMA 1IV7A 2QGSA 4EBGA 2NTYA 5IG5A 5JQGE 4O4LE 4HBRA 4QKNA 1GD4A 1M1K4 3AA6B 1ZHCA 5LJNA 2XGNA 2BVLA 5HWYA 2KXGA 3EB8A 1ISKA 1US1A 1JB5A 2CE7A 1AR0A 2C10A 5DQWA 1JKGA 5HXRA 3D0TA 2B1EA 4AQGA 3L0RA 4FR9A 3WOFB 3LH4A 2RGQA 1SIHA 2OQEC 2GXFA 2BNGA 5LHIB 1A2KA 3PCRA 3ETUA 3SOYA 1JN5A 1OGXA 1OCVA 2W00A 2XASB 2JQQA 3ZC0A 1S94A 4HVNA 3CME3 5IF6A 3Q2PA 5DQVA 2DLRA 5L2LA 2Z6BA 2YU2A 4EYYR 4H9SE 4ZI3C 3FBLA 5DREA 1OF5B 3DZLA 1NWWA 2OOVC 5LA6E 3JC6C 1W2B2 1MMGA 4K61A 1MMDA 3TDGA 2KT9A 3FB2A 3OBVE 4AKIA 3UFEA 4NREA 1LKXA 5L3DB 1K734 1KD14 3KSED 5DABA 4P09A 4IIAA 3RYIE 3OWYA 2XFSA 5JDHA 3OYZA 1SQWA 5JVDE 1KK7A 2LE8A 3WDGB 5AFUL 2HPJA 1G73A 1OACA 2PNCA 3LXUX 3DY5A 1WTHA 1KWIA 4IE5A 5JRCB 3J9X1 4WYKA 4PK6A 4O4JE 4H61A 5FW5A 2CWTA 3T8NA 1O7GB 3AAIA 3H3AA 3EBYA 3IEEA 3RGAA 3GRDA 1VQ93 2WSSV 2F99A 3I0OA 4I50E 3LOYA 4YJ3E 4H9RC 4GYRA 2LHNA 3ZMZB 4IGUA 2FXTA 2WBLA 5JRCA 4WHAA 2HMOB 1M9GA 2WOHA 3MG3A 4I55E 1PFPA 4XDWA 5IEPA 3ZCIA 1UUVB 2IA7A 2BVMA 3U1WA 3K0ZA 1MIVA 3ZYLA 3ZJ1A 2L3LA 2MTQA 4L5GA 4XB5A 1KNZA 4GOUA 2Q9QD 5LGTB 4RNYA 3X41A 3Q2MA 4X1IE 2W03A 4UIGA 3RYCE 4PK4A 4EAHA 2O3OA 1IJ5A 2Z76A 3EVYA 2WO0A 2O9UX 4A56A 1UUWB 4XBXA 2M67A 1ZV4X 4KZ1A 2YU1A 4RNZA 2NOXA 1LRZA 2XSHB 1RRHA 1D1AA 1IV9A 4UVCB 3PTRB 3FF2A 2A3DA 3Q9DA 3QUJA 4N6OB 4C91A 4BA9A 4HEAA 2W0QA 1WYCA 4ZM8A 3V99A 5BVBA 1ZX2A 3GWHA 3J7Yd 1NJI4 3HI7A 1QVG2 4WWUC 3ZN0B 2SPCA 4G63A 3S28A 2ZMAA 3N9MA 1MNDA 3FZWA 3DGOA 2HMJB 1IVWA 4ZS2A 1RRLA 4WBOA 3CU3A 4GB5A 2NW8A 4FMAA 3ANWB 4AQFC 2HMMB 4ZI3D 5LBMA 4ISTA 2UXNB 5EVHA 4IT7A 3AVSA 2V7JA 4X2OA 2V7LA 3ONXA 2P0XA 2WWUA 4JEHB 4H9PC 4CXYA 1R4CA 2ES0A 3NXJA 3Q1CA 4NHFA 2LSJA 1IQXA 1OH0A 5LCYA 4UVAB 3CCR3 2UX0A 3O4XE 1OUNA 2P05A 3BNCA 4H9NC 4FMDA 3B13A 4R1KA 4BJNA 4AKLA 3X42A 4ZS3A 2CWVA 1IT7A 1OGZA 2LSKA 5JR9C 3E0ZA 4TZ4C 1V74A 1D0XA 2CHCA 4GL6A 4HE8A 2CFGA 2KNDA 3WI3A 3DGLA 5KP1A 4O8SA 1YW0A 1O7WB 3CC43 4UF0B 2D5UA 4CQIA 3F31A 3RYFE 2W62A 3Q90A 2QEX3 4I4TE 3CQXC 4PNIA 2CFKA 3O9XA 1DMNA 2KMFA 4PAGA 2M7OA 2XEPA 2V7IA 1O7MB 4KP3C 2IUKA 3NV0A 4EOZB 1Q864 1M1XB 3GZRA 4HM2B 3CX8B 2W6JH 1VQ83 3I0QA 1ULJB 1A90A 3C50A 3FG4A 3UT5E 3CX6B 1O7PB 2W56B 3KE7A 2LOSA 1GS3A 1VQ63 4K90B 3DM8A 4N78D 2XFTA 5KP4A 2HH7A 4GYSA 1HTJF 2CWUA 4LZIA 2VB6A 3HKEE 5KP3A 4QHOA 1HF8A 3E99A 2E9XA 1US7B 2XTLA 3E22E 4FMCA 3LTCA 3K3OA 1MOLA 3FHNA 1ZKEA 3K3NA 2STDA 2BT3A 3K63A 1Z0PA 4I43B 3N9OA 2YX9A 5D82A 3X3XA 1KSIA 3HI2A 5LHGB 3BLZA 5JBSA 1AV4A 3ZMTB 1VQ43 1YKEB 4H63H 4WNKA 3F8XA 5D83A 4QWTA 1DMQA 3JVCA 3UL6A 3W15B 3HK4A 1DVDA 3T0UA 4PJJA 2GU1A 4J8TA 2W0GA 2OWPA 3WAKA 3U97A 2X66A 2ZM8A 3KN4A 3V98A 4F6RC 4ZOLE 4Q53A 2XSOB 4HJLB 3KVAA 4K1UA 3ZPOA 2JQ5A 3N54B 1QSDA 3LZAA 5JH7E 2K48A 3L3PA 1FGTA 3G713 7STDA 2LHRA 4FCMA 2ML5A 2CFDA 2HMLB 4N6TA 1Q40B 2F98A 1LVKA 3UUXB 1GD3A 2HMKB 3MYTA 3KV6A 1QAFA 4EYCA 4IIJE 1IQYA 2X51A 2LSIA 4IE4A 1LNHA 4H9QC 4HZ9B 3CQGB 3AA1B 4PFPA 1KQS2 4OFZA 4O3VA 4UV8B 4MJDA 3KFQC 5EZYE 3BQLA 4FMBA 1TU5A 3K9MC 1N5PA 1BR2A 5LP6E 2PBIA 3N9QA 5FP3A 5FXXA 4JEUB 1ULIB 1YI23 2V7KA 3CWZB 4DMWA 2L4VA 3G0KA 2KWHA 2YINA 4XBTA 4HM1B 4AKHA 1W6YA 1FMVA 2PG8A 2OTJ3 5IW9A 1EA2A 3R84B 1WQLB 1QALA 1JRQA 2CFLA 2XH9A 1OF5A 2IAKA 5AYSC 2E2VA 4MLKA 4AQFA 3HKCE 3FLJA 2CKFB 1HG2A 3CCQ3 3PS8A 3G4S3 4STDA 2CCQA 4YHJA 2X67A 2DHRA 1U5PA 2CEAA 2ODVA 1QAKA 1UW1A 1OHPA 2OQEA 3QK9A 3NQYA 2E2TA 4QX8B 1W2ZA 1IU7A 3K5TA 3X3ZA 4O2HA 3TKLB 1EZ3A 3QRDA 5JDFA 2X9WA 2Q9QC 3EJVA 3C4ZA 2QA7A 1IDPA 3JUQA 3AB3B 3HL6A 2Q9QB 1OHSA 3D3LA 3CNMA 1C7HA 3AA7B 1T98A 4KBMB 3ZC1A 5FY1A 2WGQA 2J1DG 1FEWA 1JNQA 4FCJA 5BXQA 1J2BA 1FGQA 4EZ4A 4NUVA 2CLYC 5F8PA 2I9WA 4FCZA 1JN5B 3PUGA 3HA4A 3O1IA 2KWIB 1RJOA 4LEHA 1D1BA 2RCDA 5CB4E 4HKAA 4WP5A 4AKZA 5LNKA 3SWHA 3FSDA 5FXVA 1L5GB 3CC73 1QVF2 3MKIA 4HM6B 2CC3A 1MNLA 1STDA 4O02B 2VASA 3KV9A 4GK5E 3S4UA 4U74A 3X40A 2V1DB 1E97A 1NDOB 1K9M4 2IMJA 2V1LA 2JPFA 3ROBA 2W9PA 4O4IE 1SA0E 4OHFA 2P0MA 3C64A 1WMPA 3SEDA 2IW5B 3FXDB 2W2CA 1DMMA 5LBQB 3U78A 3SOLA 3N9NA 3M65A 3BNEA 2P09A 1TFKA 2BMOB 2L8KA 3B7CA 1JV2B 3CX7B 2GEYA 4GK0E 2ZLYA 4MFRA 2W61A 4UVBB 2K9AA 4CXXA 3I9WA 4MALA 1TFOA 2X9HA 3LK3B 3GZXB 2YFIB 2ZDJA 4BTXA 2Y74A 3RH3A 5LGUB 1Q40A 1UCUA 2FGTA 3NHXA 5EQLA 3A76A 2ZM2A 2OA5A 2P9BA 2Q07A 1N8R4 4J2CA 3H3HA 1LOXA 4BAYB 1FGMA 3UB1A 5IHYA 1D0ZA 4XZCA 2XQYA 1OPYA 1W5ZA 1JJ22 3BNDA 3FG1A 1QUUA 3JUOA 1JB2A 3KBUA 1Y64B 4O4HE 1UI7A 3VKHA 1VQ73 3PE0A 1VQL3 3UUNA 1MMNA 4IHJE 3NUVA 3B8LA 1CUNA 2ZM0A 1D6UA 3RRCA 3AAEB 3LTAA 2IUJA 4PFOA 3DGMA 4EZHA 3WA3A 5L3CB 4UV9B 3GWRA 3U3IA 5A1LA 4ASKA 5LG4A 4O2BE 1SIIA 2X9YA 1K28A 5LYJE 5EEOA 5E0OA 2FNQA 3MZKB 5JPPA 3IF8B 3NQZA 1DYUA 1QMAA 5H6QB 3S67A 5KX5E 1IVVA 3PGBA 3F9SA 2G0UA 3NBRA 1CYUA 5FXZA 3DP7A 3CMA3 4R9KA 5M4YA 1F8NA 1D1CA 5BMVE 3NV0B 1VZZA 1AJ3A 2JRKA 1YJW3 2V26A 1TP6A 3MWZA 3LJCA 2E2UA 4UELA 5FGOA 1GY7A 1HKXA 4IE0A 2PZVA 4L9IA 4HYZA 3MG2A 1WRDA 2VWAA 2LM9A 4H9OC 3NRXA 3EC9A 3GAXA 5JDLA 2CA5A 2E9XD 2LYXA 4YLHA 2NWBA 4UXNB 6STDA 2LOPA 4CZZB 3N9HA 4PK5A 4TN7B 4UF0A 1H7CA 1WLXA 3GZYB 1WR6A 4HN9A 2E9XC 1BR1A 3Q5WA 5L3GB 1D6YA 2KRTA 3PYJA 5HXCA 3NBJA 2MOZA 2WOFA 3UUMA 1IAPA 1W7CA 3RPUA 5HGRA 3RC3A 3UJMA 2XGLA 3FGYA 4N6V0 4NUUA 3OYXA 3CPOA 2YK0A 4V1Av 3DTOA 1Q814 3ZCJA 3R6NA 2LJLA 2INXA 3UULA 3BQIA 3SXXA 2WM9A 1RN7A 4FJOA 3I9YA 4WBNE 4L8OA 3FCSB 1NU3A 1PU4A 3ANWA 1VQK3 1GY5A 5JREA 2ML6A 1CEWI 2A15A 3EDUA 4EIWA 5AIIA 5CLKA 3FF0A 3RYHE 3BK9A 2BMQB 2D2SA 4JF8A 5J2UE 1W00A 1VRBA 3RKOA 1FA3A 1HS7A 3HR0A 3KVBA 5CF1A 4HGAA 1IJ6A 4DVDA 2F86B 5FY7A 2QIYA 4AXPA 3N9LA 3UNLA 3P8CD 1IVXA 5JDMA 5ELJA 4DBRA 1B7TA 3B57A 2GU3A 3CCJ3 1HX8A 3NM2A 3EHCA 2JMHA 4IE7A 3PCSA 5LJMA 2XHEB 4CCVA 3NBXX 3ZJ2A 1NWMX 2MYSA 3S5CA 4PW8A 3F14A 3JUNA 4LMIA 1UX5A 3OXAA 4PJNA 3ER7A 4DNDA 2NTXA 3KV4A 3OJAA 4RZMA 2C11A 3IPTA 3LK42 2ODUA 5HWXA 3CCM3 4ANJA 4L7KA 4IDZA 1FIOA 2B24B 8CHOA 3UL5A 4JUYA 2SBLA 4L8PA 5I97A 3EBTA 3RC8A 1W4NA 5H6RB 5IENA 1N9EA 3KINB 4CI1B 1O3XA 3LG7A 2X0LB 2CFWA 2LQVA 2YFLB 3P7IA 1VQ53 2CW9A 3NZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OK0 A;  4O8S A; 
#chains in the Genus database with same CATH topology
 2CXD A;  3E08 A;  3HKD E;  2RSX A;  3HII A;  3P4P A;  3RX6 A;  1MWT A;  3DGN A;  1V9D A;  4Z8X A;  4UR9 A;  2BDE A;  5GON E;  1N8Q A;  4EC6 A;  4H63 V;  1WFD A;  1OHO A;  3H37 A;  1OWA A;  2FJB A;  2JDI H;  3JUP A;  5F3J A;  1JB4 A;  3G6E 3;  3ETV A;  2CM0 A;  4DR6 T;  4HZB B;  2XUE A;  2YDQ A;  3O1H A;  1N32 T;  2JJ9 A;  3VU7 H;  4HM7 B;  4BL2 A;  3LT9 A;  2HMN B;  2FUP A;  3T8O A;  3RRW A;  3O1J A;  5G2G A;  2M6I A;  2CG1 A;  3RDE A;  2WWV A;  1NO3 A;  2K54 A;  2CXL A;  2DL1 A;  3F7S A;  1LVF A;  4QXB B;  3AMO A;  4EXT A;  3PUY F;  4R4K A;  1IK3 A;  3EAB A;  3KII A;  2XQA A;  2X68 A;  3MHE A;  2K3W A;  3ONL C;  4MMX B;  3HIG A;  1KFY A;  5BIR A;  9RNT A;  1UK5 A;  4UEM A;  3N2O A;  2CX0 A;  5FKY A;  5AEU B;  3AE5 A;  4MEI A;  4EB6 E;  1YIT 3;  1I2E A;  1O7H B;  4XDV A;  5LGN B;  2VKO A;  1M7K A;  2UXX B;  2BKP A;  5CA0 E;  1CYV A;  1YD8 G;  5FNV E;  2KLQ A;  1T2I A;  4LSO A;  3PV0 F;  4YJ2 E;  2MAW A;  5HCM A;  1EG9 B;  4LMJ A;  1JBR A;  1VQQ A;  2XQ6 A;  2CK3 H;  3CXC 2;  3A5X A;  3LML A;  4WYK B;  2IC6 A;  3K7C A;  5J1G A;  4DR1 T;  1E1H B;  4G1M B;  4X64 T;  2UUB T;  2FJE A;  4HM0 B;  3JAE A;  3EN8 A;  3C4X A;  1EKM A;  5D81 A;  2YEV C;  3WMD A;  3PZW A;  2P38 A;  4XM4 A;  3ZST A;  4DO0 A;  1N9J A;  2CHO A;  2XQ3 A;  1NB5 I;  4DBQ A;  3UTK A;  5HAX A;  1YIJ 3;  3MKD A;  3SX1 A;  3LTB A;  4ILU A;  1EQK A;  1HZ1 A;  1VQM 3;  2PJQ A;  4Z90 A;  4CI3 B;  5JR9 A;  4DV3 T;  4LF7 T;  5FY0 A;  4XAX B;  3AAA B;  2A72 A;  1KEY A;  2XY8 B;  3RIU A;  1W6C A;  5AQO B;  3F7X A;  5JPU A;  2HN1 A;  1CQS A;  2V5C A;  3MSO A;  2BG9 B;  3HKB E;  4M1P A;  1AVK A;  4YFS A;  5LXT E;  1MIW A;  3UU3 A;  1Q82 4;  1G8X A;  1FJG T;  2RPA A;  2XR8 B;  2IIU A;  2PFV A;  2YDR A;  5IG0 A;  4GKJ T;  3LBX A;  2X9X A;  2V5D A;  5FYM A;  1OXZ A;  5KXJ A;  1GOU A;  1TUH A;  3OWS A;  2CHN A;  2LM2 A;  1N5H A;  2KIN B;  1D6Z A;  1X79 A;  2MC8 A;  3LFM A;  2YFJ B;  3ZT6 A;  2EHO A;  3BB9 A;  4TV8 E;  1GSP A;  4K1V A;  2BG9 E;  4EV5 A;  3ESL A;  4JI5 T;  4KFE A;  1N34 T;  1IQ8 A;  1T5Y A;  1QJG A;  2VL8 A;  2I6H A;  5HXH A;  2R41 A;  3CCS 3;  1YQ3 A;  1WMN A;  3N5L A;  2RP4 A;  2H0I A;  3LTD A;  4U33 A;  3LBX B;  4LF8 T;  4C90 A;  2Z77 A;  3A5E A;  1HFA A;  1S72 3;  4X5T A;  1RMS A;  3IHR A;  2WAU A;  4ZI2 D;  4JI4 T;  1W01 A;  3MPH A;  3AGN A;  1BR4 A;  3VKG A;  1I2G A;  1ZS7 A;  5IER A;  2KF6 A;  1XWM A;  1SUM B;  4KX6 A;  4B3R T;  2CXF A;  5TGN A;  2E9X B;  2DCF A;  3CPZ A;  4KFD A;  4BTW A;  3F2E A;  2HOH A;  2LRL A;  1RGL A;  2B1X B;  3KSP A;  2KCD A;  2ZA4 A;  1O7N B;  3B4O A;  2EHO C;  4FI5 A;  4RBN A;  2UUC T;  5CK6 A;  2NP9 A;  5AEW B;  3ZMV B;  2MF7 A;  1U4Q A;  3V5U A;  2XRX B;  2XQ5 A;  3VF1 A;  3AA0 B;  4MHC A;  2VKJ A;  3EUH A;  3OX9 A;  2DNX A;  1YHQ 3;  1ZO2 A;  3QC9 A;  5AIG A;  5AQU B;  1A2V A;  5CA1 E;  1K8A 4;  2W56 A;  3RQU A;  2JMK A;  4CDL A;  1J1J A;  3GZB A;  3FZM B;  4QXC B;  3KFW X;  3O8Y A;  4AKR B;  3QNU A;  3F8H A;  3N9P A;  3URP A;  4HKV B;  5G1K A;  1HU9 A;  4L0R A;  2DWK A;  2Y48 B;  4JBW F;  5J2T E;  4NXM T;  1YJ9 3;  3N2G E;  1DET A;  2BO9 B;  3KZT A;  4HFE A;  5L3F B;  1UDI I;  4B3M T;  4CPK A;  1LVN A;  3D5G A;  2W63 A;  3MXZ A;  4QX7 B;  3H51 A;  4OUQ A;  1RNT A;  2V7M A;  4E7Z A;  1GOY A;  5DRV A;  5LC7 A;  4N6M A;  1X1X A;  3HZP A;  4IE6 A;  1S5A A;  2OTL 3;  2CH9 A;  1B2U A;  4ZI2 C;  4U7I A;  2WDQ A;  3S29 A;  3EX9 A;  3G16 A;  4G2A A;  1ASK A;  1S35 A;  3ECF A;  3ZSS A;  2C0S A;  3OV4 A;  4X2H A;  3VSY A;  3PUQ A;  4EXR A;  1E3V A;  1RN1 A;  2LEH A;  1IT8 A;  1WMO A;  2C5J A;  4R80 A;  4ZHQ E;  1GYB A;  3FZH B;  3PUS A;  3QK6 A;  4HFV A;  1RCK A;  3L09 A;  5DJQ C;  1KC8 4;  4QWN B;  2XM1 A;  1SPU A;  2C5K T;  3MA9 A;  3EDV A;  3IMA B;  2CRB A;  3SRZ A;  3ZMS B;  3BIR A;  5HEJ A;  1DVC A;  4X62 T;  4HFI A;  1VCS A;  4YHH T;  2KF4 A;  4MBQ A;  1E2A A;  4I0U A;  5A0O B;  2D0U A;  4K0K T;  4J9A A;  3M3Z B;  3C51 A;  1W02 A;  4YTP A;  4HFB A;  3K8P C;  2N9D A;  4XBF B;  3P50 A;  4TX5 A;  2LKG A;  3EN1 B;  4HTE A;  3B4P A;  4DMV A;  3VHL A;  2H7O A;  4OVM A;  4PEJ A;  3V5S A;  1SHZ C;  3N8B A;  3ZYM A;  4J5G A;  2XQ8 A;  3UUB A;  2ZL8 A;  4CN4 A;  3EF8 A;  1G96 A;  5AQV B;  3FZL B;  3NBB A;  3MK7 C;  2XAQ B;  3NZP A;  5TAO A;  1MIY A;  2EHO D;  2WU5 A;  3UU5 A;  1T72 A;  5ADX L;  2W04 A;  1OED B;  2WCA A;  5AIH A;  2XAF B;  1UX4 A;  2Y6X A;  1CH0 A;  1FUS A;  4MMZ B;  4HM5 B;  2D0T A;  4ERR A;  5BR8 T;  3ZT5 A;  1OED C;  1STF I;  4U13 A;  1WNH A;  1RKY A;  2UXC T;  1E3R A;  2D42 A;  1BR0 A;  2CLY B;  4ILB A;  1K41 A;  1W0A A;  3PUR A;  1V58 A;  2BZB A;  5ETW A;  2VK9 A;  3ZLI A;  3I0Y A;  2IC9 A;  4X1K E;  3CCV 3;  2BU4 A;  4WFO A;  5LMU T;  4TV9 E;  5AIF A;  4EV2 A;  4HM4 B;  1Q7Y 4;  1RGF A;  4GIW A;  3GN5 B;  5JDQ A;  4BIR A;  3CD6 3;  2XZE A;  1Z1S A;  2X0H A;  3JC6 D;  1BAO A;  2ACX A;  2XM2 A;  2OOV A;  2C4B A;  3ZN1 B;  5IG4 A;  5LC6 A;  4DV0 T;  5FMN A;  3L8R A;  3PXM A;  1MNE A;  4WW0 A;  5ELU A;  4HM3 B;  2NR4 A;  2Y8D A;  4Z91 A;  3CCU 3;  3WA2 X;  5IEO A;  1J5E T;  3FXE B;  5JDN A;  3WOE B;  1M90 4;  2GSP A;  4PJL A;  2QA4 3;  4OX9 T;  4X20 E;  1G0T A;  4OK0 A;  2UU9 T;  3WAJ A;  3T8U A;  3FH1 A;  2CIU A;  3OW2 2;  1SJW A;  3GN5 A;  4P1N A;  1RDS A;  3QOF A;  1KNR A;  2BMR B;  4YTM A;  3AHS A;  5FXW A;  2BHM A;  4TX4 A;  4ZI7 E;  3SOA A;  2XQ9 A;  1OED E;  1YJN 3;  2DWG A;  3N2K E;  3D79 A;  1AVL A;  3CKD A;  3RIU C;  5ABE A;  1JNZ A;  1U5O A;  3TLV A;  4ZEY A;  5EK2 A;  4BJM A;  3BNB A;  3CNX A;  3CQC B;  3VGN A;  4P0A A;  1NAF A;  3ZEF B;  1NB3 I;  4WZX A;  2KF3 A;  1HG5 A;  2QGU A;  3OWU A;  1AQZ A;  2LT3 A;  2XAH B;  1T8B A;  2C5I T;  3MAC A;  1I0V A;  1G02 A;  4U72 A;  1YVB I;  3DJB A;  3AVR A;  2RFR A;  1MMA A;  2LSG A;  1BRG A;  5AQT B;  3MJX A;  1A67 A;  4QXH B;  2H7V C;  1YGE A;  4N6N B;  2GBW B;  1XNQ T;  3ZYK A;  3RGL A;  5STD A;  3X3Y A;  1XDO A;  3PDY A;  1JBS A;  2H3R A;  4EEB A;  3RLF F;  1XZY A;  1UGI A;  4ORL A;  3RQW A;  2N1G A;  1VQN 3;  3P4R A;  2HHH T;  2R4I A;  3CML A;  4HM8 B;  4YTN A;  5KMG P;  3DH2 A;  4K0U A;  5JR9 B;  1FMW A;  1BSE A;  2I59 A;  2WGO A;  2KAA A;  3S27 A;  4B6X A;  4OYK A;  1JNR A;  3D5I A;  2F5M A;  2LSY A;  4X65 T;  2KXP B;  5EK4 A;  3KKG A;  2DI4 A;  2HPL A;  1IBL T;  3KBT A;  3I55 3;  2XAG B;  4N6L A;  4CI2 B;  2N2N A;  4DV5 T;  2CWO A;  1ROA A;  4I4K A;  5J0Z A;  5AYR B;  4DV4 T;  3JUM A;  1IYY A;  4OYJ A;  1GMQ A;  3Q5X A;  4ZZC A;  1Y4K A;  2YDS A;  1GY6 A;  4LFC T;  3F57 A;  1RN4 A;  2GK9 A;  2CMR A;  4TWH A;  3DUK A;  3KCH A;  3G8Z A;  3FBZ A;  1FGO A;  3EE1 A;  5LHH B;  4IDP A;  2A2F X;  3EQQ B;  1U8C B;  4TUY E;  1HNX T;  5AQQ B;  5HEG A;  2XAJ B;  1W6G A;  3I1A A;  3D9R A;  5IYZ E;  3LYG A;  2Y73 A;  3PUA A;  5HXE A;  4ZZB A;  4ADZ A;  3PU8 A;  3J7Y q;  5EK3 A;  5AQS B;  4ISS A;  2VKD A;  3C98 B;  4IPB A;  3HX8 A;  1FW7 A;  3FKA A;  2D1W A;  4LF4 T;  1VQO 3;  3ZMU B;  1KNP A;  4AEQ A;  4N3V A;  5AQJ B;  1VOM A;  1YGW A;  4LGQ A;  4KMC A;  1ROV A;  4O2A E;  3SFE A;  2NW7 A;  1VQP 3;  4BTY A;  3FG3 A;  3AE2 A;  3LK2 B;  5C8Y E;  3WOD G;  2F5W A;  3NWI A;  3PU3 A;  5HXS A;  4X1Y E;  3STD A;  1FGR A;  1XMO T;  3NX0 A;  1LXE A;  4P0B A;  2IML A;  1TIJ A;  5IG3 A;  4DUZ T;  4QH1 A;  3ALA A;  3NRY A;  3GA8 A;  2NW9 A;  2QRX A;  4KFF A;  1IZN B;  1WYB A;  4EYU A;  4JYA T;  1ZEE A;  4AI6 A;  4JRF A;  5CF2 A;  3C4W A;  3CCL 3;  2GEX A;  3BQK A;  2CWY A;  3SVA A;  3RF1 A;  5HYA A;  5KDM C;  4H3U A;  1HCI A;  3AMO B;  1UI8 A;  2K3D A;  2K5B B;  1IVU A;  4TNV A;  3B5M A;  1GMP A;  1FUW A;  1D0Y A;  2KZ7 B;  4AKY A;  1Q42 A;  4MMY B;  2E5V A;  2V6Y B;  5CXO A;  1HNW T;  2W9Q A;  3CC2 3;  5L3E B;  4KT3 B;  3PJA J;  3IJE B;  1RHL A;  2VQF T;  3IBP A;  3KV5 A;  3GMI A;  2EHO B;  3KDS E;  1I8V A;  4JI7 T;  2UXD T;  2CG0 A;  2K24 A;  2Q9Q A;  4CXW A;  3CCE 3;  3MG1 A;  3SS1 A;  4KVH A;  1BUQ A;  2XF3 A;  2E8I A;  3OVU A;  4XBY A;  3CPW 2;  3DXO A;  3F40 A;  1N33 T;  5LOV E;  2K0M A;  3RGR A;  3LT8 A;  3IA3 A;  4R9L A;  2HN2 A;  1B2Z A;  1JKG B;  2RA1 A;  2IUB A;  1W0B A;  2WMN A;  4JLE A;  2OCT A;  3NM7 A;  3UQ7 A;  2WMO A;  4KUM B;  3I56 3;  3UQ4 A;  1YKH B;  2GBX B;  4AKG A;  2L9Q A;  3M8C A;  2Z6E A;  2MBG A;  5AI1 A;  4N6U A;  3OKQ A;  1UCJ A;  1LOV A;  2Z7A A;  3DMC A;  4DV7 T;  1DU2 A;  5JDG A;  4B3S T;  3BU4 A;  1W09 A;  3K3Q C;  3SLU A;  3V92 A;  1OED A;  2VKH A;  3Q3F A;  2H88 A;  2BS3 A;  5L3B B;  3CVR A;  1RTU A;  7GSP A;  4E7S A;  4PJM A;  1IV7 A;  2QGS A;  4EBG A;  2NTY A;  2W4X A;  4LMK A;  1YVS A;  5IG5 A;  5JQG E;  4O4L E;  5AQG B;  3UFG A;  2PTF A;  4IDQ A;  4HBR A;  4QKN A;  1GD4 A;  1M1K 4;  1Q9E A;  3VR9 A;  3AA6 B;  2BG9 A;  1ZHC A;  5LJN A;  1MGR A;  2XGN A;  2BVL A;  5HWY A;  4LFA T;  3QB5 A;  4HWF A;  2KXG A;  3EB8 A;  3AE7 A;  1ISK A;  1US1 A;  1JB5 A;  2CE7 A;  1AR0 A;  2C10 A;  5DQW A;  3AGO A;  1YNV X;  2WZH A;  1JKG A;  3AXJ B;  5HXR A;  3D0T A;  2B1E A;  4IDO A;  4AQG A;  5CJ5 A;  3L0R A;  4FR9 A;  3WOF B;  3LH4 A;  2RGQ A;  1NEK A;  1SIH A;  4JI3 T;  2OQE C;  4YSZ A;  2GXF A;  2BNG A;  4WYV A;  5LHI B;  1A2K A;  4HWH A;  3PCR A;  3ETU A;  3RI5 A;  3SOY A;  1B20 A;  1JN5 A;  4DID B;  1OGX A;  2ZM6 T;  4KHP T;  1OCV A;  1ZP0 A;  2W00 A;  2XAS B;  2JQQ A;  2IHR 1;  3ZC0 A;  1S94 A;  4QH5 A;  2V6Y A;  4LYL B;  4JI1 T;  4HAA A;  4HVN A;  3Q2P A;  5IF6 A;  3CME 3;  5FL1 A;  5DQV A;  2D9D A;  2RBI A;  4DV2 T;  2DLR A;  5L2L A;  1HNZ T;  2Z6B A;  2YU2 A;  3P4Q A;  4EYY R;  2AAE A;  2W66 A;  4H9S E;  4ZI3 C;  3FBL A;  5DRE A;  1OF5 B;  4U31 A;  3DZL A;  1Q7H A;  1NWW A;  1X1W A;  2OOV C;  3JAF A;  5FVK A;  5LA6 E;  3JC6 C;  3RNT A;  2WB5 A;  4LF5 T;  4COF A;  1W2B 2;  1MMG A;  4K61 A;  1MMD A;  3TDG A;  5AQN B;  3UU4 A;  2KT9 A;  3FB2 A;  3OBV E;  4AKI A;  3UFE A;  4IRE A;  1BNI A;  4GKK T;  3QB5 K;  4NRE A;  1LKX A;  5L3D B;  1C54 A;  1K73 4;  1KD1 4;  3KSE D;  5DAB A;  4P09 A;  4IIA A;  3RYI E;  2E5L T;  1FZU A;  3OWY A;  2XFS A;  5JDH A;  3OYZ A;  1SQW A;  1Z8U A;  2YN6 A;  5JVD E;  1KK7 A;  2LE8 A;  3WDG B;  1X9B A;  4F8H A;  5AFU L;  2HPJ A;  1JBT A;  1WR0 A;  1G73 A;  4YXD A;  1OAC A;  4Q25 A;  2PNC A;  3LXU X;  2A9U A;  3DY5 A;  1WTH A;  1KWI A;  4JI8 T;  4IE5 A;  5JRC B;  3J9X 1;  4WYK A;  4PK6 A;  5L4H A;  2X0Y A;  4O4J E;  4H61 A;  5FW5 A;  2CWT A;  3T8N A;  1O7G B;  3AAI A;  3H3A A;  3EBY A;  3IEE A;  3RGA A;  3GRD A;  1VQ9 3;  2WSS V;  2F99 A;  1BAN A;  3I0O A;  4U2Y A;  2L1S A;  4I50 E;  3LOY A;  3T1H T;  1RLS A;  2CPT A;  2FJD A;  4YJ3 E;  1XMQ T;  4H9R C;  4GYR A;  2LHN A;  3ZMZ B;  1NEN A;  4IGU A;  3LSV A;  2FXT A;  2WBL A;  2FBW A;  3H3M A;  5JRC A;  1W9R A;  4WHA A;  2HMO B;  1M9G A;  4U2Z A;  2WOH A;  5L4E A;  3MG3 A;  4I55 E;  1PFP A;  4XDW A;  5IEP A;  3ZCI A;  1UUV B;  2IA7 A;  3K1S A;  1HYF A;  3TLT A;  2BVM A;  1R4Y A;  4LF9 T;  3U1W A;  2QVA A;  3K0Z A;  4DUY T;  5IUX A;  1MIV A;  3ZYL A;  3ZJ1 A;  2L3L A;  2MTQ A;  4L5G A;  4X66 T;  4XB5 A;  1KNZ A;  4GOU A;  2Q9Q D;  5LGT B;  4RNY A;  3LDQ B;  2UGI A;  3X41 A;  3Q2M A;  4X1I E;  2W03 A;  4UIG A;  1TTO A;  4JI6 T;  3RYC E;  4PK4 A;  4EAH A;  3AE9 A;  2O3O A;  1IJ5 A;  2Z76 A;  3EVY A;  2WO0 A;  2O9U X;  5LB7 B;  4A56 A;  1UUW B;  4XBX A;  4CJN A;  2M67 A;  1ZV4 X;  4KZ1 A;  2YU1 A;  4RNZ A;  1X1U A;  2NOX A;  1LRZ A;  5GSP A;  2XSH B;  3X1D A;  1RRH A;  1D1A A;  1IV9 A;  4UVC B;  3PTR B;  3FF2 A;  2A3D A;  3Q9D A;  3QUJ A;  4N6O B;  2VVS A;  3AEG A;  4C91 A;  3TLS A;  4BA9 A;  4HEA A;  2W0Q A;  4GHO A;  1WYC A;  2XSB A;  4ZM8 A;  3V99 A;  2CBI A;  5BVB A;  3RHW A;  1ZX2 A;  3GWH A;  3J7Y d;  1NJI 4;  3HI7 A;  1XNR T;  1QVG 2;  4WWU C;  1FYS A;  3ZN0 B;  1BNF A;  2SPC A;  2BG9 C;  1LOW A;  4G63 A;  3S28 A;  2ZMA A;  3N9M A;  3AEC A;  1MND A;  3FZW A;  3DGO A;  2HMJ B;  1IVW A;  4ZS2 A;  1RRL A;  4WBO A;  1T7S A;  3CU3 A;  4GB5 A;  2NW8 A;  4FMA A;  3ANW B;  1QLB A;  2BKN A;  3UU6 A;  3GSP A;  4AQF C;  2HMM B;  4ZI3 D;  5LBM A;  2IDO B;  4IST A;  2UXN B;  3AE8 A;  5EVH A;  4IT7 A;  3AVS A;  4BU4 A;  2V7J A;  4X2O A;  2V7L A;  3ONX A;  2P0X A;  1I6Z A;  2WWU A;  4JEH B;  4H9P C;  1LQG C;  4JI2 T;  4CXY A;  1R4C A;  2ES0 A;  5M19 A;  3NXJ A;  3Q1C A;  4NHF A;  2LSJ A;  1IQX A;  1OH0 A;  4ILF A;  5LCY A;  4UVA B;  3CCR 3;  1TRQ A;  2UX0 A;  3O4X E;  5HCJ A;  1OUN A;  2P05 A;  3BNC A;  4H9N C;  4FMD A;  3B13 A;  2XQ4 A;  1MWU A;  4R1K A;  4BJN A;  4AKL A;  3X42 A;  2J8X B;  4ZS3 A;  2CWV A;  1IT7 A;  1OGZ A;  2LSK A;  4HWI B;  3Q5D A;  5JR9 C;  3E0Z A;  4TZ4 C;  1V74 A;  1D0X A;  2CHC A;  1R8I A;  4GL6 A;  4HE8 A;  4LML A;  2CFG A;  2KND A;  3WI3 A;  3DGL A;  5KP1 A;  3AEF A;  4O8S A;  2LLY A;  1YW0 A;  1O7W B;  3CC4 3;  4UF0 B;  1HR0 T;  2D5U A;  2W67 A;  5AQR B;  4CQI A;  3F31 A;  5CFB A;  5M18 A;  3RYF E;  2W62 A;  3Q90 A;  2QEX 3;  3PUX F;  4I4T E;  3CQX C;  4PNI A;  2CFK A;  3O9X A;  1YQ4 A;  5F5W A;  1DMN A;  2KMF A;  4PAG A;  2M7O A;  2XEP A;  2J47 A;  2V7I A;  1O7M B;  4KP3 C;  2IUK A;  3NV0 A;  3WHO A;  4EOZ B;  5AQH B;  3ZG0 A;  1Q86 4;  1M1X B;  3GZR A;  4TWF A;  2ZHX B;  4HM2 B;  3CX8 B;  2W6J H;  1VQ8 3;  3I0Q A;  1ULJ B;  2YKS A;  1A90 A;  4CN6 A;  3C50 A;  3FG4 A;  3UT5 E;  3TLW A;  3CX6 B;  7RNT A;  1BNJ A;  1O7P B;  2W56 B;  3KE7 A;  2BBH A;  2LOS A;  1GS3 A;  3AXJ A;  4QH4 A;  4K90 B;  1VQ6 3;  1B2S A;  3DM8 A;  4BL3 A;  4N78 D;  2XFT A;  5KP4 A;  2HH7 A;  4LF6 T;  4GYS A;  1HTJ F;  2VL0 A;  2CWU A;  4LZI A;  2VB6 A;  4NPP A;  3HKE E;  5KP3 A;  4QHO A;  4AIU A;  1HF8 A;  3SYU A;  2WQY A;  2XPK A;  3E99 A;  2E9X A;  1US7 B;  2B76 A;  2XTL A;  3E22 E;  4FMC A;  4DKI A;  5LMN T;  3LTC A;  3K3O A;  1MOL A;  3FHN A;  1ZKE A;  3K3N A;  2STD A;  1UUS A;  2BT3 A;  3K63 A;  1Z0P A;  4I43 B;  3N9O A;  2YX9 A;  5D82 A;  2RNT A;  3X3X A;  1KSI A;  3HI2 A;  5LHG B;  3BLZ A;  5JBS A;  1BRH A;  1AV4 A;  2UUA T;  3ZMT B;  1VQ4 3;  3AE3 A;  4TWD A;  1YKE B;  2XQ7 A;  4H63 H;  4WNK A;  5C2T A;  4GSP A;  3F8X A;  3P4S A;  5D83 A;  1B27 A;  4QWT A;  1DMQ A;  3JVC A;  3UL6 A;  3W15 B;  3HK4 A;  3AE6 A;  1DVD A;  3T0U A;  4PJJ A;  2GU1 A;  4J8T A;  4EV6 A;  2W0G A;  1BRK A;  2OWP A;  3WAK A;  5AQF B;  3U97 A;  2X66 A;  2ZM8 A;  3KN4 A;  3V98 A;  4F6R C;  8RNT A;  4ZOL E;  5M1A A;  4A5X A;  4Q53 A;  4ILC A;  2XSO B;  4HJL B;  1I2F A;  3KVA A;  3TLU A;  4AQY T;  1LOY A;  2MPK A;  4K1U A;  3ZPO A;  5AQK B;  2JQ5 A;  3N54 B;  1QSD A;  5JH7 E;  1FGT A;  2K48 A;  3L3P A;  3LZA A;  1JZO A;  3G71 3;  5AQM B;  7STD A;  2LHR A;  4FCM A;  2ML5 A;  2CFD A;  2HML B;  4N6T A;  1V57 A;  1Q40 B;  3PUW F;  2F98 A;  3VR8 A;  1LVK A;  2WY2 A;  1Y01 A;  3UUX B;  1GD3 A;  2WP9 A;  2HMK B;  1BGS A;  3VRA A;  3MYT A;  4HWD A;  3ZKR A;  3KV6 A;  1E7P A;  2WDR A;  4IT4 A;  1QAF A;  4EYC A;  4IIJ E;  1IQY A;  2WDV A;  2X51 A;  2LSI A;  4IE4 A;  1LNH A;  3D4A A;  4H9Q C;  4HZ9 B;  3OPC A;  3PUV F;  3CQG B;  3AA1 B;  4IL4 A;  4PFP A;  1KQS 2;  4OFZ A;  4IL9 A;  4O3V A;  2JQH A;  4UV8 B;  4MJD A;  1BSD A;  5IWA T;  1A2P A;  3KFQ C;  5EZY E;  3BQL A;  2OV9 A;  3T1Y T;  4FMB A;  1TU5 A;  3K9M C;  1N5P A;  4A97 A;  1BR2 A;  5LP6 E;  2PBI A;  3N9Q A;  3AED A;  5FP3 A;  5FXX A;  4JEU B;  2AE9 A;  1ULI B;  1YI2 3;  2V7K A;  3CWZ B;  4DMW A;  2WS3 A;  1NNV A;  2L4V A;  3G0K A;  1BRN L;  2I0M A;  1GOV A;  2YOE A;  5C3J A;  4HOH A;  2KWH A;  2KSR A;  2YIN A;  4XBT A;  4HM1 B;  4AKH A;  1W6Y A;  1FMV A;  2UXB T;  2PG8 A;  2OTJ 3;  4ILA A;  2WU2 A;  5IW9 A;  1EA2 A;  3R84 B;  1WQL B;  1QAL A;  1JRQ A;  2CFL A;  2BS2 A;  2XH9 A;  1OF5 A;  4J5K A;  2IAK A;  5AYS C;  2E2V A;  4IDN A;  4MLK A;  4AQF A;  3HKC E;  1KF6 A;  5ABG A;  2V6X A;  1N36 T;  1BSC A;  3FLJ A;  2CKF B;  1HG2 A;  1UUG B;  3CCQ 3;  5AQI B;  2WZI A;  3WR2 A;  3PS8 A;  4DR7 T;  3G4S 3;  1HX1 B;  1TRP A;  4STD A;  2CCQ A;  1UCL A;  4YHJ A;  2X67 A;  4YY3 T;  2DHR A;  4CN1 A;  1U5P A;  3AE1 A;  2CEA A;  2ODV A;  1QAK A;  1UW1 A;  5HEU A;  1OHP A;  2OQE A;  1BNG A;  3QK9 A;  3NQY A;  2E2T A;  4QX8 B;  3CIR A;  1W2Z A;  1IU7 A;  3K5T A;  3X3Z A;  4O2H A;  3TKL B;  1EZ3 A;  3QRD A;  5JDF A;  2X9W A;  1VCT A;  1I0X A;  2Q9Q C;  3EJV A;  1I3I A;  3C4Z A;  2QA7 A;  1IDP A;  3JUQ A;  3AB3 B;  3HL6 A;  2Q9Q B;  1OHS A;  2IY2 A;  5G1L A;  5CGM A;  3D3L A;  3CNM A;  3AE4 A;  1RGC A;  1C7H A;  1J5W A;  1L0V A;  3AA7 B;  2VVN A;  1T98 A;  4KBM B;  3ZC1 A;  5FY1 A;  1RCL A;  2WGQ A;  2J1D G;  1JZD A;  1FEW A;  1JNQ A;  4FCJ A;  5BXQ A;  1UCK A;  1J2B A;  1FGQ A;  4LFB T;  1BNE A;  4EZ4 A;  4NUV A;  2CLY C;  1IBK T;  5F8P A;  2I9W A;  4FCZ A;  4EED A;  1JN5 B;  3PUG A;  3HA4 A;  3O1I A;  1BRJ A;  2KWI B;  1RJO A;  1X1Y A;  4LEH A;  1BUJ A;  1D1B A;  2RCD A;  5CB4 E;  4HKA A;  4WP5 A;  2F4Y A;  4AKZ A;  5LNK A;  3SWH A;  3FSD A;  3FZK B;  2W2U A;  5FXV A;  1L5G B;  3CC7 3;  1QVF 2;  3MKI A;  4EGW A;  4HM6 B;  2CC3 A;  1MNL A;  1STD A;  2H89 A;  6RNT A;  4O02 B;  2VAS A;  3KV9 A;  4GK5 E;  2BIR A;  3S4U A;  3NKZ A;  4ZXL A;  4U74 A;  4AIS A;  1BRI A;  4A98 A;  3X40 A;  2V1D B;  1E97 A;  1NDO B;  1K9M 4;  2IMJ A;  2V1L A;  2JPF A;  3ROB A;  4YSX A;  2W9P A;  4O4I E;  1SA0 E;  2FJA A;  4OHF A;  2P0M A;  5ABF A;  3C64 A;  1WMP A;  3SED A;  2IW5 B;  3FXD B;  2W2C A;  2UUG C;  1DMM A;  5LBQ B;  3U78 A;  5L47 A;  4YT0 A;  3SOL A;  3N9N A;  3M65 A;  4DV6 T;  3BNE A;  1DE3 A;  2P09 A;  1TFK A;  1I3F A;  2L8K A;  2BMO B;  3B7C A;  1UCI A;  1JV2 B;  3CX7 B;  2GEY A;  2KF5 A;  4GK0 E;  1GMR A;  2AXD S;  2ZLY A;  3RKG A;  4MFR A;  2W61 A;  4UVB B;  2K9A A;  4CXX A;  3I9W A;  1SE7 A;  4MAL A;  1TFO A;  2X9H A;  2VUR A;  3LK3 B;  3GZX B;  2YFI B;  2ZDJ A;  2CX1 A;  4BTX A;  2Y74 A;  3RH3 A;  5LGU B;  1Q40 A;  1UGO A;  1BSB A;  3UU8 A;  5ABF B;  1UCU A;  1LNI A;  1XDP A;  1PYL A;  2FGT A;  1ZGX A;  3NHX A;  5EQL A;  3A76 A;  2ZM2 A;  2OA5 A;  2P9B A;  2Q07 A;  5AQL B;  3ABV A;  4YSY A;  1N8R 4;  3EAM A;  4J2C A;  4EW5 A;  3H3H A;  1LOX A;  4BAY B;  3ONJ A;  1FGM A;  5IHY A;  3UB1 A;  1D0Z A;  4XZC A;  1GQE A;  2XQY A;  1OPY A;  1W5Z A;  1JJ2 2;  3BND A;  3FG1 A;  1QUU A;  3JUO A;  1JB2 A;  3KBU A;  2SAR A;  1Y64 B;  1MGW A;  2V8S V;  4O4H E;  1UI7 A;  2E2A A;  3VKH A;  1T3B A;  4DR2 T;  1VQ7 3;  3PE0 A;  1VQL 3;  3UUN A;  3HOH A;  1MMN A;  4IHJ E;  4I5Q A;  3NUV A;  3JAD A;  3NVO A;  3B8L A;  1CUN A;  2ZM0 A;  1D6U A;  3RRC A;  2QYW A;  3AAE B;  3LTA A;  2IUJ A;  4PFO A;  3CK6 A;  3AEB A;  3DGM A;  1TJD A;  4EZH A;  3A7M A;  3WA3 A;  1RGG A;  5L3C B;  4UV9 B;  3GWR A;  3U3I A;  2BS4 A;  5A1L A;  4ASK A;  5LG4 A;  4O2B E;  1SII A;  2X9Y A;  3SFD A;  2H0G A;  2LKH A;  1K28 A;  1BVI A;  5LYJ E;  5EEO A;  5E0O A;  1FUT A;  2FNQ A;  3MZK B;  5JPP A;  3IF8 B;  3NQZ A;  1I94 T;  2J4G A;  3OTO T;  1RNB A;  1DYU A;  1BOX A;  1QMA A;  5H6Q B;  2BKO A;  3S67 A;  5KX5 E;  1IVV A;  3PGB A;  3F9S A;  2G0U A;  3NBR A;  1CYU A;  5FXZ A;  3DP7 A;  3CMA 3;  4R9K A;  5M4Y A;  1F8N A;  1D1C A;  3Q5E A;  3ZT7 A;  5BMV E;  1VZZ A;  3NV0 B;  1AJ3 A;  1RGH A;  2JRK A;  1YJW 3;  2V26 A;  1TP6 A;  3MWZ A;  3LJC A;  2E2U A;  4UEL A;  5FGO A;  1GY7 A;  1HKX A;  4IE0 A;  1PY3 A;  2PZV A;  2AAD A;  4L9I A;  4HYZ A;  3MG2 A;  1WRD A;  2VWA A;  4NXN T;  3ZG5 A;  2CBJ A;  2LM9 A;  5HEO A;  4H9O C;  3NRX A;  3EC9 A;  3VRB A;  3GAX A;  5JDL A;  2CA5 A;  4JV5 T;  2E9X D;  1RGK A;  2LYX A;  4YLH A;  2NWB A;  4UXN B;  1AY7 A;  6STD A;  4DR5 T;  2LOP A;  3RIF A;  4CZZ B;  1BRS A;  3N9H A;  1M62 A;  4PK5 A;  4TN7 B;  4UF0 A;  1H7C A;  1B21 A;  2XJ7 A;  4HFD A;  1WLX A;  4TNW A;  1LQM B;  3GZY B;  1WR6 A;  3G06 A;  4HN9 A;  2E9X C;  1BR1 A;  3Q5W A;  5L3G B;  1D6Y A;  2KRT A;  3PYJ A;  5HXC A;  3JCF A;  1I70 A;  3NBJ A;  2MOZ A;  2WOF A;  3UUM A;  1IAP A;  1W7C A;  1RGA A;  3RPU A;  5HGR A;  3RC3 A;  3UJM A;  2XGL A;  5BU4 A;  3RIA A;  1B3S A;  1LRA A;  3FGY A;  4N6V 0;  4NUU A;  3OYX A;  4DR3 T;  3CPO A;  2YK0 A;  4V1A v;  3DTO A;  2JQ9 A;  1YXR A;  4KHZ F;  1Q81 4;  3EI0 A;  3ZCJ A;  3R6N A;  2LJL A;  1EEJ A;  5ABH A;  2INX A;  3UUL A;  3BQI A;  3SXX A;  4U7Y A;  2WM9 A;  1IBM T;  4NPB A;  4JI0 T;  1RN7 A;  4FJO A;  3I9Y A;  2H0H A;  3PUZ F;  4WBN E;  5LG3 A;  2OLT A;  4L8O A;  1BNS A;  3FCS B;  1NU3 A;  1PU4 A;  3AHW A;  3ANW A;  1BNR A;  2F4V T;  1CHU A;  1VQK 3;  1GY5 A;  5JRE A;  2ML6 A;  1CEW I;  2A15 A;  3EDU A;  3AEA A;  2IYJ A;  4HFC A;  1UUR A;  4EIW A;  5AII A;  5CLK A;  3AEE A;  3FF0 A;  3RYH E;  3BK9 A;  2BMQ B;  4NIQ A;  2D2S A;  4JF8 A;  5J2U E;  1RGE A;  1W00 A;  5HEH A;  1VRB A;  3RKO A;  1FA3 A;  1HS7 A;  3HR0 A;  3KVB A;  5CF1 A;  5AQP B;  1MWS A;  4HGA A;  1IJ6 A;  2J62 A;  4DVD A;  2F86 B;  5FY7 A;  2QIY A;  4AXP A;  2JQK A;  3N9L A;  3UNL A;  2JIW A;  3P8C D;  1IVX A;  5JDM A;  2ACZ A;  5ELJ A;  1ZOY A;  3DGY A;  5FVL A;  1B7T A;  3B57 A;  4DBR A;  2GU3 A;  3CCJ 3;  1HX8 A;  3NM2 A;  3EHC A;  2JMH A;  2BBJ A;  4IE7 A;  3PCS A;  5HOH A;  5LJM A;  2XHE B;  4CCV A;  2M6B A;  4DR4 T;  3PJA A;  3NBX X;  2R6G F;  1T2H A;  3ZJ2 A;  6GSP A;  1NWM X;  2MYS A;  3S5C A;  4PW8 A;  3F14 A;  3JUN A;  2XSA A;  4LMI A;  3P4W A;  3EHZ A;  4B3T T;  1UX5 A;  3OXA A;  4PJN A;  1UGH I;  1MWR A;  3ER7 A;  2VQE T;  4DND A;  1BSA A;  2NTX A;  3KV4 A;  3OJA A;  4RZM A;  1B2M A;  1SAR A;  2C11 A;  3IPT A;  3LK4 2;  2ODU A;  5HWX A;  3CCM 3;  4ANJ A;  4KI0 F;  4L7K A;  5JTG A;  4IDZ A;  1FIO A;  2B24 B;  8CHO A;  1BIR A;  4DV1 T;  3UL5 A;  3ZFZ A;  1RSN A;  2F56 A;  4RNT A;  4JUY A;  2SBL A;  4U3C A;  4HFH A;  4L8P A;  5I97 A;  3EBT A;  3RC8 A;  1W4N A;  5RNT A;  5H6R B;  1EUI C;  5IEN A;  1N9E A;  4HWC A;  1B2X A;  3L39 A;  3A8Y C;  1WCR A;  3FZF B;  3KIN B;  4CI1 B;  1O3X A;  3LG7 A;  2LRK A;  2X0L B;  1BU4 A;  2CFW A;  2LQV A;  2YFL B;  3P7I A;  5FL0 A;  1VQ5 3;  2CW9 A;  3NZQ A; 
#chains in the Genus database with same CATH homology
 2CXD A;  3E08 A;  3HKD E;  2RSX A;  3HII A;  3RX6 A;  3DGN A;  1V9D A;  4Z8X A;  2BDE A;  5GON E;  1N8Q A;  4EC6 A;  4H63 V;  1OHO A;  3H37 A;  1OWA A;  2JDI H;  3JUP A;  5F3J A;  1JB4 A;  3G6E 3;  3ETV A;  2CM0 A;  4HZB B;  2XUE A;  3O1H A;  2JJ9 A;  3VU7 H;  4HM7 B;  3LT9 A;  2HMN B;  3T8O A;  3RRW A;  3O1J A;  5G2G A;  2CG1 A;  3RDE A;  1NO3 A;  2K54 A;  2CXL A;  3F7S A;  1LVF A;  4QXB B;  3AMO A;  4EXT A;  4R4K A;  1IK3 A;  3KII A;  2X68 A;  3MHE A;  4MMX B;  3HIG A;  4UEM A;  3N2O A;  5AEU B;  4MEI A;  4EB6 E;  1YIT 3;  1O7H B;  4XDV A;  5LGN B;  2VKO A;  2UXX B;  5CA0 E;  1CYV A;  1YD8 G;  5FNV E;  2KLQ A;  4LSO A;  4YJ2 E;  1EG9 B;  2CK3 H;  3CXC 2;  3A5X A;  3LML A;  4WYK B;  2IC6 A;  3K7C A;  5J1G A;  1E1H B;  4G1M B;  4HM0 B;  3EN8 A;  3C4X A;  1EKM A;  5D81 A;  2YEV C;  3WMD A;  3PZW A;  2P38 A;  4XM4 A;  4DO0 A;  1N9J A;  1NB5 I;  4DBQ A;  3UTK A;  5HAX A;  1YIJ 3;  3MKD A;  3SX1 A;  3LTB A;  4ILU A;  1EQK A;  1VQM 3;  2PJQ A;  4CI3 B;  5JR9 A;  5FY0 A;  4XAX B;  3AAA B;  2A72 A;  1W6C A;  3F7X A;  5JPU A;  1CQS A;  3MSO A;  3HKB E;  4M1P A;  1AVK A;  4YFS A;  5LXT E;  1MIW A;  1Q82 4;  1G8X A;  2XR8 B;  2PFV A;  5IG0 A;  3LBX A;  2X9X A;  5FYM A;  1OXZ A;  1TUH A;  3OWS A;  1N5H A;  2KIN B;  1D6Z A;  1X79 A;  2MC8 A;  3LFM A;  2YFJ B;  2EHO A;  3BB9 A;  4TV8 E;  4K1V A;  4EV5 A;  3ESL A;  4KFE A;  1IQ8 A;  1T5Y A;  1QJG A;  2VL8 A;  5HXH A;  3CCS 3;  1WMN A;  3N5L A;  2RP4 A;  3LTD A;  3LBX B;  1S72 3;  4C90 A;  2Z77 A;  1HFA A;  3IHR A;  2WAU A;  4ZI2 D;  1W01 A;  3MPH A;  1BR4 A;  3VKG A;  5IER A;  2CXF A;  5TGN A;  2E9X B;  2DCF A;  3CPZ A;  4KFD A;  4BTW A;  3F2E A;  2B1X B;  3KSP A;  2KCD A;  1O7N B;  3B4O A;  2EHO C;  4FI5 A;  4RBN A;  5CK6 A;  2NP9 A;  5AEW B;  3ZMV B;  2MF7 A;  1U4Q A;  3V5U A;  2XRX B;  3VF1 A;  3AA0 B;  4MHC A;  2VKJ A;  3EUH A;  3OX9 A;  2DNX A;  1YHQ 3;  1ZO2 A;  3QC9 A;  5AIG A;  1A2V A;  5CA1 E;  1K8A 4;  2W56 A;  2JMK A;  4CDL A;  3GZB A;  4QXC B;  3KFW X;  3O8Y A;  4AKR B;  3F8H A;  3N9P A;  4HKV B;  1HU9 A;  4L0R A;  2DWK A;  2Y48 B;  5J2T E;  1YJ9 3;  3N2G E;  2BO9 B;  3KZT A;  5L3F B;  1LVN A;  2W63 A;  3MXZ A;  4QX7 B;  3H51 A;  4OUQ A;  2V7M A;  4E7Z A;  5DRV A;  5LC7 A;  4N6M A;  3HZP A;  4IE6 A;  1S5A A;  2OTL 3;  2CH9 A;  4ZI2 C;  3S29 A;  3EX9 A;  3G16 A;  4G2A A;  1ASK A;  1S35 A;  3ECF A;  2C0S A;  3OV4 A;  4X2H A;  3VSY A;  3PUQ A;  4EXR A;  1E3V A;  2LEH A;  1IT8 A;  1WMO A;  2C5J A;  4R80 A;  4ZHQ E;  1GYB A;  3PUS A;  3QK6 A;  4HFV A;  3L09 A;  5DJQ C;  1KC8 4;  4QWN B;  1SPU A;  2C5K T;  3MA9 A;  3EDV A;  3IMA B;  3SRZ A;  3ZMS B;  1DVC A;  4MBQ A;  5A0O B;  2D0U A;  4J9A A;  3C51 A;  1W02 A;  3K8P C;  2N9D A;  4XBF B;  4TX5 A;  3EN1 B;  4HTE A;  3B4P A;  4DMV A;  3VHL A;  4PEJ A;  4OVM A;  2H7O A;  3V5S A;  1SHZ C;  3N8B A;  3ZYM A;  2ZL8 A;  3EF8 A;  1G96 A;  3NBB A;  3MK7 C;  2XAQ B;  3NZP A;  5TAO A;  1MIY A;  2EHO D;  5ADX L;  2W04 A;  5AIH A;  2XAF B;  1UX4 A;  2Y6X A;  4MMZ B;  4HM5 B;  2D0T A;  4ERR A;  1STF I;  4U13 A;  1WNH A;  1RKY A;  1E3R A;  2D42 A;  1BR0 A;  2CLY B;  1K41 A;  3PUR A;  2BZB A;  5ETW A;  2VK9 A;  3ZLI A;  3I0Y A;  2IC9 A;  4X1K E;  3CCV 3;  4WFO A;  4TV9 E;  5AIF A;  4EV2 A;  4HM4 B;  1Q7Y 4;  4GIW A;  3GN5 B;  5JDQ A;  3CD6 3;  1Z1S A;  3JC6 D;  2ACX A;  2OOV A;  3ZN1 B;  5IG4 A;  5LC6 A;  5FMN A;  3PXM A;  1MNE A;  4WW0 A;  5ELU A;  4HM3 B;  2Y8D A;  3CCU 3;  3WA2 X;  5IEO A;  3FXE B;  5JDN A;  3WOE B;  1M90 4;  4PJL A;  2QA4 3;  4X20 E;  4OK0 A;  3WAJ A;  3T8U A;  3FH1 A;  2CIU A;  3OW2 2;  1SJW A;  3GN5 A;  2BMR B;  5FXW A;  2BHM A;  4TX4 A;  4ZI7 E;  3SOA A;  1YJN 3;  2DWG A;  3N2K E;  1AVL A;  3CKD A;  1U5O A;  5EK2 A;  4BJM A;  3BNB A;  3CNX A;  3CQC B;  3VGN A;  4P0A A;  1NAF A;  3ZEF B;  1NB3 I;  1HG5 A;  2QGU A;  3OWU A;  2LT3 A;  2XAH B;  2C5I T;  3MAC A;  4U72 A;  1YVB I;  3DJB A;  3AVR A;  2RFR A;  1MMA A;  2LSG A;  3MJX A;  1A67 A;  4QXH B;  2H7V C;  1YGE A;  4N6N B;  2GBW B;  3ZYK A;  5STD A;  3X3Y A;  3PDY A;  2H3R A;  4ORL A;  2N1G A;  1VQN 3;  2R4I A;  3CML A;  4HM8 B;  5KMG P;  4K0U A;  5JR9 B;  1FMW A;  2I59 A;  2WGO A;  3S27 A;  4B6X A;  4OYK A;  2LSY A;  2KXP B;  5EK4 A;  3KKG A;  2DI4 A;  2HPL A;  3KBT A;  3I55 3;  2XAG B;  4N6L A;  4CI2 B;  2N2N A;  2CWO A;  1ROA A;  4I4K A;  5AYR B;  3JUM A;  4OYJ A;  3Q5X A;  1Y4K A;  1GY6 A;  3F57 A;  2GK9 A;  2CMR A;  3DUK A;  3G8Z A;  3FBZ A;  1FGO A;  3EE1 A;  5LHH B;  2A2F X;  3EQQ B;  1U8C B;  4TUY E;  2XAJ B;  1W6G A;  3I1A A;  3D9R A;  5IYZ E;  3LYG A;  2Y73 A;  3PUA A;  5HXE A;  4ADZ A;  3PU8 A;  3J7Y q;  5EK3 A;  4ISS A;  2VKD A;  3C98 B;  4IPB A;  3HX8 A;  3FKA A;  2D1W A;  1VQO 3;  3ZMU B;  4AEQ A;  4N3V A;  1VOM A;  4LGQ A;  4KMC A;  1ROV A;  4O2A E;  2NW7 A;  1VQP 3;  4BTY A;  3FG3 A;  3LK2 B;  5C8Y E;  3WOD G;  3PU3 A;  5HXS A;  4X1Y E;  3STD A;  1FGR A;  3NX0 A;  1LXE A;  4P0B A;  1TIJ A;  5IG3 A;  3ALA A;  3NRY A;  3GA8 A;  2NW9 A;  4KFF A;  1WYB A;  1IZN B;  4EYU A;  1ZEE A;  4AI6 A;  4JRF A;  5CF2 A;  3C4W A;  3CCL 3;  2GEX A;  3BQK A;  2CWY A;  3SVA A;  5HYA A;  5KDM C;  4H3U A;  1HCI A;  3AMO B;  1UI8 A;  2K5B B;  1IVU A;  1FUW A;  1D0Y A;  2KZ7 B;  4AKY A;  1Q42 A;  4MMY B;  5CXO A;  2W9Q A;  3CC2 3;  5L3E B;  3IJE B;  3IBP A;  3KV5 A;  3GMI A;  2EHO B;  3KDS E;  2CG0 A;  2K24 A;  2Q9Q A;  4CXW A;  3CCE 3;  3MG1 A;  3SS1 A;  4KVH A;  1BUQ A;  2XF3 A;  2E8I A;  4XBY A;  3CPW 2;  3DXO A;  3F40 A;  5LOV E;  2K0M A;  3RGR A;  3LT8 A;  4R9L A;  1JKG B;  2RA1 A;  2WMN A;  4JLE A;  2OCT A;  3NM7 A;  2WMO A;  4KUM B;  3I56 3;  1YKH B;  2GBX B;  4AKG A;  2L9Q A;  3M8C A;  2Z6E A;  2MBG A;  5AI1 A;  4N6U A;  3OKQ A;  2Z7A A;  3DMC A;  5JDG A;  3K3Q C;  3SLU A;  3V92 A;  2VKH A;  5L3B B;  3CVR A;  4E7S A;  4PJM A;  1IV7 A;  2QGS A;  4EBG A;  2NTY A;  5IG5 A;  5JQG E;  4O4L E;  4HBR A;  4QKN A;  1GD4 A;  1M1K 4;  3AA6 B;  1ZHC A;  5LJN A;  2XGN A;  2BVL A;  5HWY A;  2KXG A;  3EB8 A;  1ISK A;  1US1 A;  1JB5 A;  2CE7 A;  1AR0 A;  2C10 A;  5DQW A;  1JKG A;  5HXR A;  3D0T A;  2B1E A;  4AQG A;  3L0R A;  4FR9 A;  3WOF B;  3LH4 A;  2RGQ A;  1SIH A;  2OQE C;  2GXF A;  2BNG A;  5LHI B;  1A2K A;  3PCR A;  3ETU A;  3SOY A;  1JN5 A;  1OGX A;  1OCV A;  2W00 A;  2XAS B;  2JQQ A;  3ZC0 A;  1S94 A;  4HVN A;  3CME 3;  5IF6 A;  3Q2P A;  5DQV A;  2DLR A;  5L2L A;  2Z6B A;  2YU2 A;  4EYY R;  4H9S E;  4ZI3 C;  3FBL A;  5DRE A;  1OF5 B;  3DZL A;  1NWW A;  2OOV C;  5LA6 E;  3JC6 C;  1W2B 2;  1MMG A;  4K61 A;  1MMD A;  3TDG A;  2KT9 A;  3FB2 A;  3OBV E;  4AKI A;  3UFE A;  4NRE A;  1LKX A;  5L3D B;  1K73 4;  1KD1 4;  3KSE D;  5DAB A;  4P09 A;  4IIA A;  3RYI E;  3OWY A;  2XFS A;  5JDH A;  3OYZ A;  1SQW A;  5JVD E;  1KK7 A;  2LE8 A;  3WDG B;  5AFU L;  2HPJ A;  1G73 A;  1OAC A;  2PNC A;  3LXU X;  3DY5 A;  1WTH A;  1KWI A;  4IE5 A;  5JRC B;  3J9X 1;  4WYK A;  4PK6 A;  4O4J E;  4H61 A;  5FW5 A;  2CWT A;  3T8N A;  1O7G B;  3AAI A;  3H3A A;  3EBY A;  3IEE A;  3RGA A;  3GRD A;  1VQ9 3;  2WSS V;  2F99 A;  3I0O A;  4I50 E;  3LOY A;  4YJ3 E;  4H9R C;  4GYR A;  2LHN A;  3ZMZ B;  4IGU A;  2FXT A;  2WBL A;  5JRC A;  4WHA A;  2HMO B;  1M9G A;  2WOH A;  3MG3 A;  4I55 E;  1PFP A;  4XDW A;  5IEP A;  3ZCI A;  1UUV B;  2IA7 A;  2BVM A;  3U1W A;  3K0Z A;  1MIV A;  3ZYL A;  3ZJ1 A;  2L3L A;  2MTQ A;  4L5G A;  4XB5 A;  1KNZ A;  4GOU A;  2Q9Q D;  5LGT B;  4RNY A;  3X41 A;  3Q2M A;  4X1I E;  2W03 A;  4UIG A;  3RYC E;  4PK4 A;  4EAH A;  2O3O A;  1IJ5 A;  2Z76 A;  3EVY A;  2WO0 A;  2O9U X;  4A56 A;  1UUW B;  4XBX A;  2M67 A;  1ZV4 X;  4KZ1 A;  2YU1 A;  4RNZ A;  2NOX A;  1LRZ A;  2XSH B;  1RRH A;  1D1A A;  1IV9 A;  4UVC B;  3PTR B;  3FF2 A;  2A3D A;  3Q9D A;  3QUJ A;  4N6O B;  4C91 A;  4BA9 A;  4HEA A;  2W0Q A;  1WYC A;  4ZM8 A;  3V99 A;  5BVB A;  1ZX2 A;  3GWH A;  3J7Y d;  1NJI 4;  3HI7 A;  1QVG 2;  4WWU C;  3ZN0 B;  2SPC A;  4G63 A;  3S28 A;  2ZMA A;  3N9M A;  1MND A;  3FZW A;  3DGO A;  2HMJ B;  1IVW A;  4ZS2 A;  1RRL A;  4WBO A;  3CU3 A;  4GB5 A;  2NW8 A;  4FMA A;  3ANW B;  4AQF C;  2HMM B;  4ZI3 D;  5LBM A;  4IST A;  2UXN B;  5EVH A;  4IT7 A;  3AVS A;  2V7J A;  4X2O A;  2V7L A;  3ONX A;  2P0X A;  2WWU A;  4JEH B;  4H9P C;  4CXY A;  1R4C A;  2ES0 A;  3NXJ A;  3Q1C A;  4NHF A;  2LSJ A;  1IQX A;  1OH0 A;  5LCY A;  4UVA B;  3CCR 3;  2UX0 A;  3O4X E;  1OUN A;  2P05 A;  3BNC A;  4H9N C;  4FMD A;  3B13 A;  4R1K A;  4BJN A;  4AKL A;  3X42 A;  4ZS3 A;  2CWV A;  1IT7 A;  1OGZ A;  2LSK A;  5JR9 C;  3E0Z A;  4TZ4 C;  1V74 A;  1D0X A;  2CHC A;  4GL6 A;  4HE8 A;  2CFG A;  2KND A;  3WI3 A;  3DGL A;  5KP1 A;  4O8S A;  1YW0 A;  1O7W B;  3CC4 3;  4UF0 B;  2D5U A;  4CQI A;  3F31 A;  3RYF E;  2W62 A;  3Q90 A;  2QEX 3;  4I4T E;  3CQX C;  4PNI A;  2CFK A;  3O9X A;  1DMN A;  2KMF A;  4PAG A;  2M7O A;  2XEP A;  2V7I A;  1O7M B;  4KP3 C;  2IUK A;  3NV0 A;  4EOZ B;  1Q86 4;  1M1X B;  3GZR A;  4HM2 B;  3CX8 B;  2W6J H;  1VQ8 3;  3I0Q A;  1ULJ B;  1A90 A;  3C50 A;  3FG4 A;  3UT5 E;  3CX6 B;  1O7P B;  2W56 B;  3KE7 A;  2LOS A;  1GS3 A;  1VQ6 3;  4K90 B;  3DM8 A;  4N78 D;  2XFT A;  5KP4 A;  2HH7 A;  4GYS A;  1HTJ F;  2CWU A;  4LZI A;  2VB6 A;  3HKE E;  5KP3 A;  4QHO A;  1HF8 A;  3E99 A;  2E9X A;  1US7 B;  2XTL A;  3E22 E;  4FMC A;  3LTC A;  3K3O A;  1MOL A;  3FHN A;  1ZKE A;  3K3N A;  2STD A;  2BT3 A;  3K63 A;  1Z0P A;  4I43 B;  3N9O A;  2YX9 A;  5D82 A;  3X3X A;  1KSI A;  3HI2 A;  5LHG B;  3BLZ A;  5JBS A;  1AV4 A;  3ZMT B;  1VQ4 3;  1YKE B;  4H63 H;  4WNK A;  3F8X A;  5D83 A;  4QWT A;  1DMQ A;  3JVC A;  3UL6 A;  3W15 B;  3HK4 A;  1DVD A;  3T0U A;  4PJJ A;  2GU1 A;  4J8T A;  2W0G A;  2OWP A;  3WAK A;  3U97 A;  2X66 A;  2ZM8 A;  3KN4 A;  3V98 A;  4F6R C;  4ZOL E;  4Q53 A;  2XSO B;  4HJL B;  3KVA A;  4K1U A;  3ZPO A;  2JQ5 A;  3N54 B;  1QSD A;  3LZA A;  5JH7 E;  2K48 A;  3L3P A;  1FGT A;  3G71 3;  7STD A;  2LHR A;  4FCM A;  2ML5 A;  2CFD A;  2HML B;  4N6T A;  1Q40 B;  2F98 A;  1LVK A;  3UUX B;  1GD3 A;  2HMK B;  3MYT A;  3KV6 A;  1QAF A;  4EYC A;  4IIJ E;  1IQY A;  2X51 A;  2LSI A;  4IE4 A;  1LNH A;  4H9Q C;  4HZ9 B;  3CQG B;  3AA1 B;  4PFP A;  1KQS 2;  4OFZ A;  4O3V A;  4UV8 B;  4MJD A;  3KFQ C;  5EZY E;  3BQL A;  4FMB A;  1TU5 A;  3K9M C;  1N5P A;  1BR2 A;  5LP6 E;  2PBI A;  3N9Q A;  5FP3 A;  5FXX A;  4JEU B;  1ULI B;  1YI2 3;  2V7K A;  3CWZ B;  4DMW A;  2L4V A;  3G0K A;  2KWH A;  2YIN A;  4XBT A;  4HM1 B;  4AKH A;  1W6Y A;  1FMV A;  2PG8 A;  2OTJ 3;  5IW9 A;  1EA2 A;  3R84 B;  1WQL B;  1QAL A;  1JRQ A;  2CFL A;  2XH9 A;  1OF5 A;  2IAK A;  5AYS C;  2E2V A;  4MLK A;  4AQF A;  3HKC E;  3FLJ A;  2CKF B;  1HG2 A;  3CCQ 3;  3PS8 A;  3G4S 3;  4STD A;  2CCQ A;  4YHJ A;  2X67 A;  2DHR A;  1U5P A;  2CEA A;  2ODV A;  1QAK A;  1UW1 A;  1OHP A;  2OQE A;  3QK9 A;  3NQY A;  2E2T A;  4QX8 B;  1W2Z A;  1IU7 A;  3K5T A;  3X3Z A;  4O2H A;  3TKL B;  1EZ3 A;  3QRD A;  5JDF A;  2X9W A;  2Q9Q C;  3EJV A;  3C4Z A;  2QA7 A;  1IDP A;  3JUQ A;  3AB3 B;  3HL6 A;  2Q9Q B;  1OHS A;  3D3L A;  3CNM A;  1C7H A;  3AA7 B;  1T98 A;  4KBM B;  3ZC1 A;  5FY1 A;  2WGQ A;  2J1D G;  1FEW A;  1JNQ A;  4FCJ A;  5BXQ A;  1J2B A;  1FGQ A;  4EZ4 A;  4NUV A;  2CLY C;  5F8P A;  2I9W A;  4FCZ A;  1JN5 B;  3PUG A;  3HA4 A;  3O1I A;  2KWI B;  1RJO A;  4LEH A;  1D1B A;  2RCD A;  5CB4 E;  4HKA A;  4WP5 A;  4AKZ A;  5LNK A;  3SWH A;  3FSD A;  5FXV A;  1L5G B;  3CC7 3;  1QVF 2;  3MKI A;  4HM6 B;  2CC3 A;  1MNL A;  1STD A;  4O02 B;  2VAS A;  3KV9 A;  4GK5 E;  3S4U A;  4U74 A;  3X40 A;  2V1D B;  1E97 A;  1NDO B;  1K9M 4;  2IMJ A;  2V1L A;  2JPF A;  3ROB A;  2W9P A;  4O4I E;  1SA0 E;  4OHF A;  2P0M A;  3C64 A;  1WMP A;  3SED A;  2IW5 B;  3FXD B;  2W2C A;  1DMM A;  5LBQ B;  3U78 A;  3SOL A;  3N9N A;  3M65 A;  3BNE A;  2P09 A;  1TFK A;  2BMO B;  2L8K A;  3B7C A;  1JV2 B;  3CX7 B;  2GEY A;  4GK0 E;  2ZLY A;  4MFR A;  2W61 A;  4UVB B;  2K9A A;  4CXX A;  3I9W A;  4MAL A;  1TFO A;  2X9H A;  3LK3 B;  3GZX B;  2YFI B;  2ZDJ A;  4BTX A;  2Y74 A;  3RH3 A;  5LGU B;  1Q40 A;  1UCU A;  2FGT A;  3NHX A;  5EQL A;  3A76 A;  2ZM2 A;  2OA5 A;  2P9B A;  2Q07 A;  1N8R 4;  4J2C A;  3H3H A;  1LOX A;  4BAY B;  1FGM A;  3UB1 A;  5IHY A;  1D0Z A;  4XZC A;  2XQY A;  1OPY A;  1W5Z A;  1JJ2 2;  3BND A;  3FG1 A;  1QUU A;  3JUO A;  1JB2 A;  3KBU A;  1Y64 B;  4O4H E;  1UI7 A;  3VKH A;  1VQ7 3;  3PE0 A;  1VQL 3;  3UUN A;  1MMN A;  4IHJ E;  3NUV A;  3B8L A;  1CUN A;  2ZM0 A;  1D6U A;  3RRC A;  3AAE B;  3LTA A;  2IUJ A;  4PFO A;  3DGM A;  4EZH A;  3WA3 A;  5L3C B;  4UV9 B;  3GWR A;  3U3I A;  5A1L A;  4ASK A;  5LG4 A;  4O2B E;  1SII A;  2X9Y A;  1K28 A;  5LYJ E;  5EEO A;  5E0O A;  2FNQ A;  3MZK B;  5JPP A;  3IF8 B;  3NQZ A;  1DYU A;  1QMA A;  5H6Q B;  3S67 A;  5KX5 E;  1IVV A;  3PGB A;  3F9S A;  2G0U A;  3NBR A;  1CYU A;  5FXZ A;  3DP7 A;  3CMA 3;  4R9K A;  5M4Y A;  1F8N A;  1D1C A;  5BMV E;  3NV0 B;  1VZZ A;  1AJ3 A;  2JRK A;  1YJW 3;  2V26 A;  1TP6 A;  3MWZ A;  3LJC A;  2E2U A;  4UEL A;  5FGO A;  1GY7 A;  1HKX A;  4IE0 A;  2PZV A;  4L9I A;  4HYZ A;  3MG2 A;  1WRD A;  2VWA A;  2LM9 A;  4H9O C;  3NRX A;  3EC9 A;  3GAX A;  5JDL A;  2CA5 A;  2E9X D;  2LYX A;  4YLH A;  2NWB A;  4UXN B;  6STD A;  2LOP A;  4CZZ B;  3N9H A;  4PK5 A;  4TN7 B;  4UF0 A;  1H7C A;  1WLX A;  3GZY B;  1WR6 A;  4HN9 A;  2E9X C;  1BR1 A;  3Q5W A;  5L3G B;  1D6Y A;  2KRT A;  3PYJ A;  5HXC A;  3NBJ A;  2MOZ A;  2WOF A;  3UUM A;  1IAP A;  1W7C A;  3RPU A;  5HGR A;  3RC3 A;  3UJM A;  2XGL A;  3FGY A;  4N6V 0;  4NUU A;  3OYX A;  3CPO A;  2YK0 A;  4V1A v;  3DTO A;  1Q81 4;  3ZCJ A;  3R6N A;  2LJL A;  2INX A;  3UUL A;  3BQI A;  3SXX A;  2WM9 A;  1RN7 A;  4FJO A;  3I9Y A;  4WBN E;  4L8O A;  3FCS B;  1NU3 A;  1PU4 A;  3ANW A;  1VQK 3;  1GY5 A;  5JRE A;  2ML6 A;  1CEW I;  2A15 A;  3EDU A;  4EIW A;  5AII A;  5CLK A;  3FF0 A;  3RYH E;  3BK9 A;  2BMQ B;  2D2S A;  4JF8 A;  5J2U E;  1W00 A;  1VRB A;  3RKO A;  1FA3 A;  1HS7 A;  3HR0 A;  3KVB A;  5CF1 A;  4HGA A;  1IJ6 A;  4DVD A;  2F86 B;  5FY7 A;  2QIY A;  4AXP A;  3N9L A;  3UNL A;  3P8C D;  1IVX A;  5JDM A;  5ELJ A;  4DBR A;  1B7T A;  3B57 A;  2GU3 A;  3CCJ 3;  1HX8 A;  3NM2 A;  3EHC A;  2JMH A;  4IE7 A;  3PCS A;  5LJM A;  2XHE B;  4CCV A;  3NBX X;  3ZJ2 A;  1NWM X;  2MYS A;  3S5C A;  4PW8 A;  3F14 A;  3JUN A;  4LMI A;  1UX5 A;  3OXA A;  4PJN A;  3ER7 A;  4DND A;  2NTX A;  3KV4 A;  3OJA A;  4RZM A;  2C11 A;  3IPT A;  3LK4 2;  2ODU A;  5HWX A;  3CCM 3;  4ANJ A;  4L7K A;  4IDZ A;  1FIO A;  2B24 B;  8CHO A;  3UL5 A;  4JUY A;  2SBL A;  4L8P A;  5I97 A;  3EBT A;  3RC8 A;  1W4N A;  5H6R B;  5IEN A;  1N9E A;  3KIN B;  4CI1 B;  1O3X A;  3LG7 A;  2X0L B;  2CFW A;  2LQV A;  2YFL B;  3P7I A;  1VQ5 3;  2CW9 A;  3NZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...