4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
4ZZCA 4WHAA 2RA1A 5IW9A 2H7VC 1O7PB 5HEJA 2VURA 1YKEB 2FJEA 1I94T 2JIWA 3EN8A 1IK3A 2CWYA 3LDQB 3A76A 3KCHA 4HM4B 4COFA 5KMGP 1VQP3 4X5TA 2D42A 2LJLA 2DL1A 2PG8A 5IENA 5KX5E 4IGUA 3WOEB 2BKOA 1KNZA 3G713 1CEWI 1MWRA 1NO3A 1E3RA 4IDQA 4X64T 2IC9A 5AIIA 3B4PA 2A9UA 1X1XA 2BG9B 2X51A 3WOFB 1I3IA 1ZKEA 2XAJB 1D0YA 3FXEB 4GHOA 3BQIA 4L8OA 2GK9A 1IYYA 4YXDA 5FYMA 2UGIA 3V5SA 4TWFA 3ZN0B 1HU9A 3FF0A 2GSPA 5L47A 3WAJA 4RNTA 5AQOB 3K9MC 3NRYA 4R9KA 2LHNA 1JKGA 2Y8DA 7GSPA 3TKLB 1XZYA 3N2KE 1YJN3 4QWNB 4BL2A 4WW0A 4TN7B 1IZNB 1JB5A 1OEDE 3B13A 5CJ5A 3WI3A 2XSHB 3MSOA 2FBWA 4ZS2A 3LMLA 2XAQB 3UNLA 1MNLA 1BRHA 1FEWA 3QC9A 3OJAA 2VL8A 4CXYA 3FCSB 5AQHB 3F57A 4K90B 3N9PA 4O4IE 1LRZA 5JDMA 2E5LT 1I6ZA 5ABFA 4UV9B 1RCLA 3ZC1A 2RPAA 1WFDA 2KF4A 3K0ZA 5DQVA 3JUNA 3Q5XA 1RGCA 2OA5A 3QB5A 3I9YA 1UGHI 2FUPA 3NHXA 5J2TE 1MOLA 5AYSC 2IDOB 2XQ9A 2Q07A 4LF6T 4R80A 5LBQB 3EBTA 4H9QC 2VL0A 3S27A 3UFGA 4EZHA 4NUVA 1TJDA 1IAPA 1EUIC 1OEDC 2W4XA 1HNXT 3OXAA 2J4GA 3QRDA 5LB7B 3O8YA 2D2SA 5FXVA 1RGEA 1ZO2A 3ZJ2A 4HWHA 1FUTA 3RPUA 4BA9A 4P1NA 3X42A 5GSPA 1BU4A 1YQ3A 2CXFA 2V1DB 3CWZB 4ZI2C 2KINB 3JAEA 3QUJA 4OYKA 3I0OA 2OWPA 3DGMA 1A2VA 1ASKA 5CLKA 2C11A 3D0TA 4DV4T 3KV6A 3EABA 3CK6A 2E2VA 1XMQT 2FGTA 4IPBA 5CB4E 1W2ZA 1BR0A 3MKDA 3RC8A 4JI1T 3MZKB 5HOHA 2F86B 1VRBA 2H0GA 2QA7A 1DMQA 3VRBA 1RGGA 5EK3A 2A15A 2CFLA 4HM0B 3B5MA 1HG5A 5TAOA 2E9XA 2HOHA 3O4XE 1IV7A 2MF7A 1KQS2 1N9EA 2JQKA 3CVRA 3DUKA 3N2OA 1KWIA 1QMAA 4CDLA 1VQ83 4NHFA 3BQKA 1N34T 2ZLYA 4OUQA 3DH2A 2XSAA 2Y6XA 3MJXA 1M9GA 5M1AA 4U2ZA 4NPBA 2F98A 3KV9A 4QX7B 2PJQA 2BS4A 3JADA 5HXHA 1W4NA 2XM1A 1T98A 3C4ZA 1Y4KA 4QWTA 4TV8E 2KLQA 1QJGA 4UVAB 4YSYA 1FZUA 4ILFA 2XAFB 1D1AA 1BSDA 1US7B 3X40A 5JBSA 1YJW3 2NTXA 2JMHA 1O7WB 3VR9A 5L3EB 2MTQA 4X20E 3C50A 1N33T 4LFBT 4BTXA 2RNTA 3RF1A 1VQL3 3L0RA 4ILAA 1LQMB 2FJAA 5JR9A 4O8SA 3UQ7A 2XY8B 1DU2A 1SE7A 4B3TT 3KVBA 3AE5A 4UVCB 4TWHA 4BIRA 5FY1A 2OOVC 5L3DB 4PW8A 5AQMB 5JDHA 2ZMAA 1W9RA 2CWTA 1E97A 2GU3A 4V1Av 4EOZB 5JDLA 3FKAA 5DREA 3WA2X 3FXDB 3P50A 4IL9A 1MGWA 1RN7A 3IF8B 2CWVA 5BR8T 3RQUA 2ES0A 1WTHA 3LZAA 2V26A 4HAAA 1RGAA 2XTLA 5LGTB 1U5PA 3OWYA 5AIHA 2W62A 2XQ3A 2WDVA 4CN4A 1JV2B 4UVBB 4N6LA 4FMDA 5LCYA 4X62T 3AHSA 5LC7A 5KP4A 2HN2A 3GAXA 1X9BA 2V7IA 3CMLA 3I553 1A90A 1D0ZA 4O4LE 4ZM8A 3ESLA 3T8NA 4PJLA 3J7Yd 3BIRA 1FMWA 2WY2A 2Z6EA 4HVNA 5FNVE 3CCL3 1E1HB 2NP9A 3ECFA 3LT9A 4HN9A 1MMAA 1U4QA 3RHWA 4ISSA 3UTKA 1LVFA 3Q9DA 2WZIA 4EXRA 4YSXA 5G2GA 3O1HA 1O3XA 1G96A 3FLJA 3F7XA 4LMIA 8RNTA 4N6UA 3ZG5A 4CJNA 3FBLA 5JVDE 3F40A 1IV9A 1YVBI 1HX8A 2UUCT 2PFVA 3DY5A 1L5GB 3OKQA 2D9DA 2KRTA 1UCJA 1W5ZA 1SIIA 2WMNA 2XSOB 4JBWF 1JBRA 2D0TA 3D4AA 3WAKA 3C51A 5FW5A 2KZ7B 3DTOA 1IVUA 1G0TA 4IT4A 2Q9QC 1RJOA 3OYXA 1DVDA 5AQRB 3ZN1B 2QRXA 2F99A 2L1SA 2FNQA 1LXEA 2CLYB 2X9YA 5JDQA 3K8PC 4WYVA 1AY7A 3I0QA 2BU4A 4QHOA 2LSGA 3AEFA 1OHSA 2WQYA 5L3FB 2XQ5A 3HKBE 1GMQA 3C4WA 1Q864 2STDA 3AE7A 2ML5A 4I50E 4BJNA 1T8BA 3HKEE 2P0XA 4YHHT 3CX8B 2RSXA 1NB5I 4ANJA 4LMKA 4PAGA 2H88A 4EW5A 2F56A 4MEIA 3LT8A 4P0AA 2KCDA 3CNXA 3EF8A 1Z1SA 4HJLB 1TTOA 4HFEA 1S35A 2UXXB 4DR3T 2N2NA 4LF7T 2YU1A 2BVLA 1NWMX 4GYSA 5JR9B 4FMBA 1MIWA 3M8CA 1CUNA 2IHR1 3FB2A 4TZ4C 1HFAA 5HCJA 1QALA 2K3WA 1JB2A 4EGWA 3CX6B 2RP4A 4MJDA 1BRJA 3LBXB 1O7NB 2LM2A 3RYCE 4TNVA 1RGFA 4MHCA 5BXQA 3HI2A 1VZZA 1S723 2OCTA 1T3BA 4N6MA 4O2HA 3PE0A 5JPUA 3AVSA 4QXHB 2FJBA 2Z77A 2M67A 2YN6A 4HFVA 3L39A 3CD63 2D5UA 2V7JA 5HYAA 3L09A 1WNHA 2IUBA 3FSDA 3UUMA 2I6HA 1T5YA 3Q90A 2XHEB 1OXZA 3QK6A 4U74A 1CQSA 1JRQA 4K0KT 4H63H 4G63A 4CXWA 1TFOA 4HGAA 2SBLA 2WMOA 2LE8A 4ORLA 2X68A 3KFWX 1YW0A 4GSPA 3FZLB 3KBUA 2BKPA 5L3GB 4JI0T 1JZDA 3CKDA 4XDVA 3G16A 9RNTA 2INXA 2L9QA 2QIYA 3SS1A 3F2EA 2VVSA 5LJMA 1V74A 4P09A 3NV0A 1OHOA 4OX9T 1IJ5A 1B2UA 3BLZA 4C90A 1Z8UA 2NTYA 3RIAA 1J5WA 1NNVA 5FP3A 3CME3 3N2GE 1GSPA 1RSNA 2LQVA 3ALAA 3RLFF 1PU4A 3CXC2 1SPUA 1AJ3A 3J7Yq 5IWAT 4FR9A 1W0BA 2C0SA 1GD4A 2HHHT 3AXJA 4RBNA 4H9NC 3FZFB 1I2GA 4HFBA 2CA5A 3ZMUB 3LFMA 3HIIA 3K7CA 3AMOA 2XFSA 3QK9A 3P8CD 5CK6A 1VQ53 4WBNE 5JH7E 4I5QA 3MHEA 3SVAA 5AYRB 1I2EA 1RGHA 4OHFA 3UJMA 2HMLB 1WYCA 4TWDA 2V6YA 3MXZA 2W03A 4OK0A 1IQ8A 2P9BA 4I0UA 2ZM2A 2F5MA 3RYFE 1BIRA 2JRKA 3FG4A 2KXGA 1BGSA 4X1IE 1KF6A 2NOXA 4U72A 1HNWT 4ZI3C 3X1DA 4DUZT 2K54A 1NAFA 5AQQB 2KMFA 3P4SA 2VQFT 3PTRB 1I2FA 4UELA 3KE7A 4MMYB 3ZYLA 1GMRA 2XJ7A 4CI2B 5AIFA 2K5BB 1RN4A 1W6GA 3OV4A 3CC43 3QB5K 2LHRA 5IHYA 1RCKA 1G8XA 2NR4A 3AA7B 3IBPA 3OBVE 1ISKA 1YHQ3 1UCLA 3H3MA 3SXXA 2N1GA 5EEOA 1TIJA 3WODG 1WR0A 3ZMVB 4GK0E 2IC6A 3K3OA 1VQK3 2VKDA 5KP1A 5F3JA 4KHPT 1FA3A 4IREA 3UUNA 2W56B 2F5WA 3FGYA 3I0YA 4K61A 3EAMA 2WM9A 2V5CA 1ULIB 5BVBA 4HWFA 3K3NA 2CWOA 3LK3B 4U31A 2YFIB 3RQWA 2WU5A 4GYRA 2WOFA 4LF9T 2XQ4A 4O2BE 3N8BA 4L9IA 1PY3A 1ZX2A 3GN5B 1HTJF 3T8OA 1GOYA 5LP6E 2J47A 4LF4T 2GXFA 4PFPA 1ZS7A 3PJAJ 2ZA4A 3CQCB 7STDA 1MMDA 4FMCA 1Q814 1UGOA 3X41A 1IBLT 2W66A 3RIUA 3NZPA 3UL6A 2JQ5A 2G0UA 2W00A 2XAGB 1MMNA 1UCIA 3CCR3 1GOUA 3PCRA 3ONJA 5J2UE 6STDA 2HMOB 5M19A 2HMKB 4PK6A 3NQYA 2EHOA 1WMNA 2KF5A 2RFRA 3FG1A 3FBZA 3AB3B 1BNFA 3AEDA 3ETVA 3GZRA 5JRCA 1YVSA 2V8SV 4UXNB 4BTWA 5M4YA 3ZPOA 2DWKA 2X9XA 2BS3A 4NIQA 2OLTA 1R4YA 1EZ3A 2IMLA 1ZEEA 2HMJB 4R4KA 1KFYA 2P09A 1RTUA 4YLHA 2J62A 2GEXA 5CA1E 2CRBA 2V1LA 1R4CA 1AV4A 2ZM8A 2CX1A 3WDGB 2X9HA 3OWUA 1MWUA 3CPW2 3FZWA 1LNIA 4U7IA 2UXDT 3HX8A 1MIVA 2WBLA 2CXDA 1TRPA 4IHJE 5FL0A 3ZMSB 2W61A 2XPKA 3CQXC 4Q25A 1QUUA 2KF6A 3Q5WA 1XNQT 1BUQA 5JREA 3UULA 1LRAA 3MPHA 3DM8A 3S28A 1BOXA 2UUGC 2V6YB 2XF3A 5FMNA 5DJQC 1JB4A 2W9QA 3ONXA 2IW5B 1RRHA 1D6UA 1T2IA 3AE4A 2CXLA 4QH5A 1UI8A 2XFTA 1G02A 1B7TA 3AEBA 5L4EA 2W63A 3LXUX 2LLYA 4AKZA 2HN1A 1HCIA 3VSYA 4EIWA 5J0ZA 2W6JH 2YX9A 5I97A 4JI6T 3UU8A 5HEHA 2X66A 4AQFA 3A5XA 2RBIA 3RI5A 3UUBA 5LHGB 2W04A 4HM7B 3SYUA 1UW1A 2IA7A 2CPTA 2JJ9A 4F6RC 1O7GB 3GZXB 4WYKB 1E7PA 4DBQA 1OGZA 3VRAA 2CFGA 3NM2A 4BJMA 3P4WA 5LOVE 2LSIA 3H37A 2BVMA 3PUAA 3RYHE 3MWZA 2XQAA 4IDNA 1BSBA 3UU6A 3BB9A 1YQ4A 4FCZA 3O1IA 5H6RB 3RDEA 3HR0A 1RMSA 3V92A 4NXNT 1MWSA 1I3FA 1W2B2 1I8VA 4N3VA 2XQ6A 4EXTA 2J8XB 1Q824 4K1UA 3UU3A 2NW9A 3LTBA 3PZWA 3IHRA 5IG0A 4WBOA 5KXJA 5CXOA 3NM7A 4Z8XA 3B8LA 3HA4A 3JUOA 3AE3A 5RNTA 1UUGB 2XAHB 4AISA 3ETUA 3PU8A 4XM4A 2E2TA 5AEUB 3URPA 3X3YA 1RLSA 3ZT5A 4AKGA 2UUAT 4DR6T 2NWBA 1U5OA 1NJI4 2FJDA 3UFEA 4PJMA 2MYSA 4A97A 2RCDA 4TX4A 2LYXA 5EZYE 5IG4A 3FZKB 1FGTA 4N6V0 3OPCA 4GKKT 4MMXB 4I4KA 5AI1A 2HPLA 4CI1B 3F14A 1UDII 2LT3A 1ROAA 3UUXB 3CQGB 1OGXA 1BNRA 3F31A 1HS7A 4B3MT 3N9OA 3G0KA 2Q9QA 4JUYA 4XBXA 2EHOB 5JQGE 1QVG2 1JNRA 4ERRA 1W6CA 4HKAA 1XDPA 4JI5T 4WP5A 3G8ZA 2BMRB 2JDIH 5FXWA 4H61A 1OCVA 3FG3A 4U3CA 4FCJA 3CPZA 2XQ7A 3FHNA 4FI5A 3AAIA 4IE5A 1D0XA 1I70A 1WMPA 2C4BA 2ODUA 4PNIA 1KC84 3ZKRA 1IVWA 1E2AA 4GB5A 1JKGB 3M3ZB 3KKGA 4AEQA 4LMJA 3BNBA 3CIRA 1DE3A 3Q5DA 1FUSA 1J5ET 4X65T 3WMDA 4O02B 1N32T 1B2SA 1B2XA 3S4UA 5L3BB 4BU4A 2ACZA 3U3IA 3TLVA 4UEMA 4ZHQE 5CA0E 1JN5A 3PXMA 5ELJA 3GMIA 1QVF2 1OWAA 2BMQB 5ABFB 3KV4A 3VKGA 2CG0A 2CMRA 4DV3T 1YKHB 4UIGA 1RN1A 5LNKA 3PUZF 1RKYA 3AEGA 4HM1B 5G1LA 4HBRA 3AE8A 5AQPB 3GZYB 4AXPA 3Q1CA 4CPKA 2EHOD 4CXXA 2C5IT 1IJ6A 4HFCA 3H3HA 3KSPA 1M1XB 3ZC0A 3I563 1YIT3 2CCQA 1AR0A 2K24A 2K9AA 4HM8B 3R84B 4DV2T 4IE7A 4IDOA 1T72A 4PJJA 2GEYA 4AKIA 4LF5T 3GZBA 4AKLA 4O2AE 3J9X1 4NXMT 1UURA 3OYZA 2ODVA 5AQSB 2YINA 4N6OB 2WAUA 1MNEA 1JNQA 1SJWA 1VCTA 1FMVA 3F7SA 5EVHA 4FCMA 1WR6A 5FVLA 3AVRA 4AKHA 1SHZC 6GSPA 6RNTA 4XZCA 3D79A 4IE0A 3AGOA 4ZOLE 1D6YA 4XBYA 4JRFA 5FKYA 2KSRA 1WLXA 4ADZA 1IBKT 2GBWB 1T2HA 4BL3A 3WA3A 1D6ZA 2UXCT 3ZEFB 2X0YA 5STDA 2BBHA 2ZM6T 3DMCA 4K0UA 4PJNA 3LH4A 4RNYA 3VF1A 1FGRA 4EV2A 2E9XB 5A1LA 3PGBA 2Q9QB 1QSDA 4Z91A 1BSEA 3BNDA 2CBJA 3DXOA 3SOAA 2UXBT 2V7LA 4XB5A 1UX5A 3CCE3 1SQWA 5JDGA 1JNZA 2CX0A 2QGUA 2WP9A 4HM3B 3VU7H 1BUJA 2CLYC 2LOPA 3AE9A 5EQLA 2R4IA 5HWXA 3JUPA 3ZFZA 3X3ZA 4IIAA 4IL4A 1SARA 5IERA 5HGRA 1Q9EA 5F8PA 2O3OA 3GA8A 1YD8G 2CBIA 3Q5EA 4J8TA 4J2CA 2WSSV 1OH0A 2KXPB 4E7SA 2XH9A 5AEWB 1E3VA 1FIOA 3UU5A 3ER7A 4DV1T 5LYJE 1LOWA 3DP7A 5JDFA 2C5JA 1Q40A 3CCS3 3LTCA 2R41A 3AAAB 2ML6A 3W15B 4LEHA 1YNVX 2CEAA 3C64A 4DMVA 1K28A 4O4JE 1KNRA 3AA0B 1RGLA 4WNKA 1GYBA 2F4VT 1T7SA 3ZJ1A 1IT7A 3EB8A 2X67A 1FW7A 1JN5B 3GRDA 4U7YA 1ULJB 1LQGC 1O7MB 1OHPA 5JR9C 4JI7T 4LMLA 1BNSA 4DNDA 2AAEA 2CHOA 2DHRA 4JV5T 4XAXB 4JF8A 1Q7HA 3LJCA 4WWUC 1Z0PA 1GY6A 2QA43 3Q3FA 1YJ93 1W00A 5LG3A 4DR5T 3HI7A 3AAEB 3F8XA 2LSKA 3ZSSA 3U97A 5BIRA 7RNTA 3RNTA 2E9XD 3P4PA 4E7ZA 1QAFA 5AQJB 4H3UA 2Q9QD 3SFDA 2ACXA 5IYZE 1BSCA 5IUXA 3RX6A 5JPPA 3V5UA 1LVNA 1FJGT 2DLRA 3V98A 2OQEC 2KT9A 2VKOA 1H7CA 4YTMA 5FY0A 2L4VA 4NREA 2JPFA 3CPOA 1LKXA 2DWGA 1HX1B 3HK4A 3JC6D 3IMAB 1UX4A 3D3LA 4XBTA 3SLUA 3PUWF 4AIUA 2CC3A 2PBIA 5CFBA 3LG7A 1S5AA 4KMCA 4LF8T 3ZG0A 1UGIA 3K1SA 1PYLA 3RRWA 1MIYA 4H9SE 4YY3T 1NENA 2VKJA 1IQYA 2H3RA 2A72A 2NW7A 4FMAA 3S5CA 3NKZA 5FXZA 4HWIB 2WGOA 1BNIA 4DV6T 2L8KA 5ABEA 2PZVA 1ZP0A 1MNDA 1KNPA 5LG4A 2LKGA 4GK5E 1VQ73 3P7IA 4A98A 2M7OA 5M18A 2CW9A 1HF8A 2JQQA 2D1WA 3MG3A 3NBRA 3JUQA 1FGMA 1HG2A 4EV5A 4IIJE 2MC8A 1NB3I 3E0ZA 2SPCA 2IMJA 4GKJT 4EEBA 1Y64B 3K3QC 4DV0T 3AHWA 1VOMA 4LZIA 2E2AA 3RGLA 4DVDA 3QNUA 1UCKA 2BDEA 5F5WA 5ELUA 3NQZA 4DMWA 3OWSA 3D9RA 3HOHA 4CZZB 3LK42 3Q2PA 5D81A 2WDRA 3B4OA 5AIGA 1G73A 1I0XA 3VHLA 1KEYA 1PFPA 2H0HA 4EB6E 1KD14 3MK7C 1MMGA 4PK5A 1W09A 1IVXA 1Q40B 4TV9E 2RGQA 4ZEYA 2MBGA 2CKFB 3NBBA 1BRGA 2PNCA 4AQYT 3EDVA 4JYAT 5AQNB 3PYJA 2OV9A 4F8HA 2H0IA 4ZS3A 2BNGA 3NBXX 3A5EA 1OF5A 3U78A 4BTYA 1JJ22 2R6GF 2I59A 2X0HA 4CI3B 3EBYA 1A67A 1STDA 1WYBA 2Y74A 1CYUA 2MOZA 2KWIB 3CCU3 3KBTA 4B6XA 1VQ93 3V99A 2VQET 3G4S3 3EVYA 2L3LA 1TRQA 3PURA 3HKDE 4NUUA 2NW8A 3RH3A 4B3RT 4XDWA 1M1K4 3NBJA 4DR7T 2IUKA 3ZMZB 1OEDA 2CH9A 2WO0A 1IVVA 5LHHB 1N8R4 1FGQA 1Q7Y4 3SFEA 2XSBA 3WHOA 5ABHA 2CE7A 3ZYKA 2I0MA 3CCQ3 2BG9E 5AQKB 1CH0A 4TUYE 4Z90A 4HE8A 1A2PA 2LRLA 3RRCA 3T1HT 3EN1B 2YU2A 2LRKA 2XGNA 2YEVC 3L8RA 4A56A 3STDA 3EI0A 3NV0B 1HKXA 1MWTA 4H9OC 4L0RA 5HCMA 4JI2T 1ZHCA 4R1KA 3D5GA 4A5XA 2OTJ3 4JI8T 4LFAT 2DNXA 4J5KA 2UX0A 4KHZF 4HFDA 3B57A 3OTOT 2JMKA 3T1YT 1LVKA 1B3SA 5L4HA 3ZYMA 4ZI3D 5D82A 3B7CA 1YIJ3 3CX7B 3AXJB 1K8A4 1DMMA 4QKNA 2KWHA 4L5GA 1BR1A 3MACA 4IE4A 3E08A 4QXCB 1X1YA 2WZHA 1B27A 5CF1A 4MLKA 5HWYA 2E2UA 4QXBB 4YTPA 4KUMB 2CG1A 3AMOB 4PFOA 1F8NA 2BG9C 2B1XB 4N6TA 1VQN3 5JTGA 3A7MA 5GONE 4LSOA 2VKHA 2ZM0A 1US1A 4LGQA 4KBMB 3T0UA 2VK9A 3KINB 1RNTA 1OUNA 4IE6A 1RHLA 2LKHA 2CK3H 3KVAA 4ZI7E 1X1WA 3KSED 2VB6A 3EHZA 5LA6E 2W0GA 1UUVB 1N9JA 1M62A 3GWRA 5BU4A 2WCAA 2Y73A 4IT7A 2P05A 1KK7A 4OVMA 4N78D 3PUXF 4X2HA 3VGNA 4MFRA 1WMOA 1TFKA 1VQO3 1U8CB 3RGAA 1ROVA 1N8QA 3RGRA 3EDUA 1B21A 5AQUB 2C10A 4J9AA 3EQQB 1BSAA 3AECA 4QX8B 5DABA 1AVKA 1XWMA 1UK5A 2BS2A 3IPTA 4TX5A 2K48A 5IF6A 2DCFA 1QLBA 2OOVA 4UV8B 5HEOA 1BVIA 3I9WA 4DO0A 3HKCE 1V57A 1OF5B 2YDSA 4EYCA 2H89A 4N6NB 1HYFA 1Y01A 2E5VA 1UUSA 4AI6A 3OW22 5HXSA 4EYYR 5AQFB 2Y48B 1EKMA 4QH1A 1DETA 1YGEA 3HL6A 3KFQC 3WR2A 1W0AA 3N5LA 5CGMA 2I9WA 5TGNA 3EE1A 2E8IA 3TLTA 4DR4T 1Q42A 3FF2A 1TU5A 1EEJA 3A8YC 1OPYA 3I1AA 5L3CB 3F8HA 4U33A 3DZLA 2LOSA 1OEDB 4X2OA 4RZMA 2ZDJA 4KI0F 1HNZT 4KX6A 1I0VA 3CC73 4C91A 1NDOB 2KNDA 3LSVA 4TNWA 4RNZA 1HZ1A 2K3DA 2CWUA 3IEEA 3NX0A 4KFDA 3MG1A 4JLEA 1IU7A 3LTDA 3PU3A 2BZBA 3GWHA 5HXEA 2VVNA 2W9PA 2XR8B 4CCVA 2W2CA 1FGOA 4BAYB 1DVCA 1W7CA 2UXNB 2B76A 3UL5A 4ILBA 1GY5A 1NWWA 4STDA 4I43B 1VCSA 4HWCA 1LOYA 2YK0A 2DI4A 4AKRB 3RIUC 4YT0A 4QH4A 2P38A 3CNMA 3L3PA 2V6XA 4J5GA 2CIUA 3T8UA 3CCM3 3PUVF 4EZ4A 5JRCB 1N5HA 3MYTA 2LSYA 4HFHA 1LNHA 2CHNA 3MKIA 1K734 3TLUA 4GL6A 2EHOC 2HH7A 1VQQA 3PUQA 1X79A 4EEDA 2KAAA 1IT8A 4OYJA 1RDSA 4I4TE 3BNCA 4YJ3E 4AQGA 3AEEA 5FL1A 5C8YE 1DYUA 4UF0A 4U2YA 5IEPA 2LM9A 2HPJA 4HM5B 5AQTB 1V58A 5KP3A 2OTL3 3CCJ3 4OFZA 3M65A 2BBJA 4YHJA 3CC23 1XDOA 3JUMA 3PS8A 3KV5A 4H9PC 4I55E 3UU4A 2GU1A 4YTNA 3ANWA 4KFEA 4M1PA 1J2BA 5LGUB 3OVUA 1KSIA 4ZI2D 3SWHA 4ISTA 3G06A 4IDZA 3NWIA 3CU3A 3ZCIA 2UUBT 3C98B 1NEKA 3AE2A 3N9LA 3RC3A 4DIDB 5ABGA 4AKYA 1C7HA 4DR2T 3R6NA 3EUHA 3EJVA 3N9NA 5EK2A 1VQ63 2KF3A 2AXDS 3EHCA 3AGNA 4AQFC 1N5PA 4CQIA 4G2AA 2AE9A 1W6YA 4P0BA 3ZT6A 1J1JA 3LBXA 2MPKA 3PUYF 4IDPA 5DRVA 1C54A 3SRZA 3N9QA 2WOHA 4L7KA 4GIWA 2Z7AA 3FH1A 4HM2B 4KP3C 1M7KA 2CFDA 2GBXB 2YDRA 2X9WA 1WCRA 2XQYA 1X1UA 3ZT7A 4Q53A 2OQEA 5H6QB 1L0VA 4HYZA 2V7MA 1RGKA 2IUJA 3K63A 1S94A 5FGOA 2CFKA 5LGNB 4KVHA 3JVCA 2J1DG 4H63V 4JEHB 5FXXA 3HIGA 3C4XA 4MMZB 2H7OA 4G1MB 2QVAA 5FVKA 5LJNA 4UR9A 2W0QA 2O9UX 4HZ9B 1EA2A 1VQM3 3SOLA 3SEDA 5HXRA 3E99A 4ASKA 2A2FX 3TLWA 2B24B 4X1KE 2CFWA 4WFOA 3O9XA 3ZLIA 3RKOA 1MGRA 3AE6A 1K9M4 5J1GA 4ZXLA 4LFCT 1EG9B 1RRLA 3BU4A 3NXJA 4O3VA 3LYGA 3IA3A 4NPPA 2WGQA 5HAXA 3EC9A 3PUGA 1GQEA 5LMUT 5AQVB 3AE1A 2K0MA 8CHOA 1BAOA 2QYWA 1GY7A 4U13A 2E9XC 4JEUB 3NUVA 2HMNB 3EX9A 1K41A 4WZXA 3KZTA 3KN4A 3UT5E 1YXRA 3RKGA 2A3DA 3PCSA 2YKSA 2VWAA 4L8PA 5IG5A 1D1CA 2XQ8A 3FZHB 4UF0B 3PUSA 1EQKA 2AADA 1QAKA 4CN1A 2BHMA 1BNJA 3JC6C 3NVOA 5IG3A 2PTFA 3PDYA 2XASB 1BRKA 1ZGXA 2D0UA 3ROBA 3CMA3 2BMOB 3MA9A 4O4HE 4PEJA 2WB5A 3X3XA 1BANA 3LOYA 3UB1A 4KZ1A 3ANWB 5HXCA 2JQ9A 3RIFA 2WWUA 1W02A 4HM6B 3ZMTB 1BNGA 4EV6A 4KT3B 3P4RA 1UUWB 4DV5T 1A2KA 3VKHA 1JBSA 1YI23 2Z6BA 3F9SA 3ONLC 5C2TA 1LOXA 4JI4T 1BR4A 3KDSE 2C5KT 2XGLA 3OX9A 1GS3A 3DGNA 3CCV3 5LHIB 2BT3A 1TUHA 2UU9T 3Q2MA 2WDQA 2WU2A 4YSZA 2P0MA 3PV0F 4DBRA 2F4YA 3AA1B 4HZBB 2W56A 2YOEA 1LOVA 5LMNT 1YGWA 1AVLA 5L2LA 5ETWA 3IJEB 3TDGA 1GMPA 1BRNL 4EBGA 5JDNA 3E22E 4HOHA 1GOVA 3GN5A 1UCUA 1STFI 2IIUA 3BNEA 2YFLB 5HEGA 3DGYA 4ILUA 1W01A 4FJOA 1IBMT 3JAFA 2QEX3 4HTEA 5DQWA 2CHCA 1SUMB 3G6E3 4DKIA 2XUEA 4HEAA 4DV7T 1ZV4X 3GSPA 2IYJA 2BO9B 3H51A 2VASA 2WS3A 4KFFA 1BR2A 1OACA 5AQGB 1RNBA 3NRXA 1NU3A 3K5TA 4ZZBA 5IEOA 3N9MA 2XZEA 2B1EA 2FXTA 3O1JA 1TP6A 4B3ST 3ABVA 4EYUA 1B20A 1FUWA 2MAWA 3DJBA 2BG9A 2XM2A 1N36T 3ZSTA 1FYSA 4X1YE 4PK4A 1V9DA 3KIIA 1B2MA 4YFSA 3U1WA 5FY7A 2IAKA 1AQZA 1B2ZA 5A0OB 5CF2A 4YJ2E 1JZOA 4MBQA 3QOFA 3N9HA 3SX1A 2XEPA 3S29A 1XNRT 2SARA 3H3AA 1JBTA 3TLSA 3VR8A 2W67A 5ADXL 3ZCJA 4XBFB 5AQIB 3BK9A 2M6BA 2QGSA 3P4QA 3HZPA 2N9DA 4X66T 3NZQA 2XRXB 2V7KA 3S67A 4LYLB 4K1VA 2Z76A 1R8IA 1WQLB 2V5DA 2YDQA 2BIRA 1O7HB 2W2UA 1ZOYA 5D83A 4CN6A 5AQLB 1DMNA 2LSJA 5LBMA 1GD3A 3RYIE 3N54B 1CHUA 5LXTE 3LK2B 4JI3T 1SIHA 2CM0A 2LEHA 1D1BA 4HKVB 1IQXA 4WYKA 1SA0E 4DUYT 2M6IA 1XMOT 5AFUL 2YFJB 4H9RC 3BQLA 2ZL8A 3D5IA 2HMMB 3AA6B 1HR0T 1BRSA 5G1KA 3JCFA 1UI7A 2WWVA 4DR1T 3SOYA 1WRDA 3MG2A 3UQ4A 5BMVE 1BRIA 2X0LB 5LC6A 3AEAA 5EK4A 3PJAA 4R9LA 4HFIA 5E0OA 1M904 2JQHA 1VQ43 4HWDA 5KDMC 2BKNA 5HEUA 1IDPA 4EC6A 5C3JA 1CYVA 3FZMB 4ILCA 3DGLA 4MALA 1BNEA 2IY2A 4EAHA 3LTAA 2ZHXB 4GOUA 3DGOA
chains in the Genus database with same CATH topology
4WHAA 2RA1A 5IW9A 2H7VC 1O7PB 1YKEB 3EN8A 1IK3A 2CWYA 3A76A 4HM4B 5KMGP 1VQP3 2D42A 2LJLA 2PG8A 5IENA 5KX5E 4IGUA 3WOEB 1KNZA 3G713 1CEWI 1NO3A 1E3RA 2IC9A 5AIIA 3B4PA 2X51A 3WOFB 1ZKEA 2XAJB 1D0YA 3FXEB 4L8OA 3BQIA 2GK9A 5FYMA 3V5SA 3ZN0B 1HU9A 3FF0A 3WAJA 3K9MC 3NRYA 4R9KA 2LHNA 1JKGA 2Y8DA 3TKLB 3N2KE 1YJN3 4QWNB 4WW0A 4TN7B 1IZNB 1JB5A 3B13A 3WI3A 2XSHB 3MSOA 3LMLA 4ZS2A 2XAQB 3UNLA 1MNLA 1FEWA 3QC9A 3OJAA 2VL8A 4CXYA 3FCSB 3F57A 4K90B 3N9PA 4O4IE 1LRZA 5JDMA 4UV9B 3ZC1A 3K0ZA 5DQVA 3JUNA 3Q5XA 2OA5A 3I9YA 3NHXA 5J2TE 1MOLA 5AYSC 2Q07A 4R80A 5LBQB 3EBTA 4H9QC 3S27A 4EZHA 4NUVA 1IAPA 3OXAA 3QRDA 3O8YA 2D2SA 5FXVA 1ZO2A 3ZJ2A 3RPUA 4BA9A 3X42A 2CXFA 2V1DB 3CWZB 4ZI2C 2KINB 3QUJA 4OYKA 3I0OA 2OWPA 3DGMA 1A2VA 1ASKA 5CLKA 2C11A 3D0TA 3KV6A 2E2VA 2FGTA 4IPBA 5CB4E 1W2ZA 1BR0A 3MKDA 3RC8A 3MZKB 2F86B 1VRBA 2QA7A 1DMQA 2A15A 4HM0B 5EK3A 2CFLA 1HG5A 5TAOA 2E9XA 3O4XE 1IV7A 2MF7A 1KQS2 1N9EA 3CVRA 3DUKA 3N2OA 1KWIA 1QMAA 4CDLA 1VQ83 4NHFA 3BQKA 2ZLYA 4OUQA 2Y6XA 3MJXA 1M9GA 2F98A 3KV9A 4QX7B 2PJQA 5HXHA 1W4NA 3C4ZA 1T98A 1Y4KA 4QWTA 4TV8E 2KLQA 1QJGA 4UVAB 2XAFB 1D1AA 1US7B 3X40A 5JBSA 1YJW3 2NTXA 2JMHA 1O7WB 5L3EB 2MTQA 4X20E 3C50A 4BTXA 1VQL3 3L0RA 5JR9A 4O8SA 3KVBA 4UVCB 5FY1A 2OOVC 4PW8A 5JDHA 5L3DB 2ZMAA 2CWTA 1E97A 2GU3A 4V1Av 3FKAA 4EOZB 5JDLA 5DREA 3WA2X 3FXDB 1RN7A 3IF8B 2CWVA 2ES0A 1WTHA 3LZAA 2V26A 2XTLA 5LGTB 1U5PA 3OWYA 5AIHA 2W62A 1JV2B 4UVBB 4N6LA 4FMDA 5LCYA 5LC7A 5KP4A 3GAXA 2V7IA 3CMLA 3I553 1A90A 1D0ZA 4O4LE 4ZM8A 3ESLA 3T8NA 4PJLA 3J7Yd 1FMWA 2Z6EA 4HVNA 5FNVE 3CCL3 1E1HB 2NP9A 3ECFA 3LT9A 4HN9A 1MMAA 1U4QA 4ISSA 3UTKA 1LVFA 3Q9DA 4EXRA 5G2GA 3O1HA 1O3XA 1G96A 3FLJA 3F7XA 4LMIA 4N6UA 3FBLA 5JVDE 3F40A 1IV9A 1YVBI 1HX8A 2PFVA 3DY5A 1L5GB 3OKQA 2KRTA 1W5ZA 1SIIA 2WMNA 2XSOB 2D0TA 3WAKA 3C51A 5FW5A 2KZ7B 3DTOA 1IVUA 2Q9QC 1RJOA 3OYXA 1DVDA 3ZN1B 2F99A 2FNQA 1LXEA 2CLYB 2X9YA 5JDQA 3K8PC 3I0QA 4QHOA 2LSGA 1OHSA 5L3FB 3HKBE 3C4WA 1Q864 2STDA 2ML5A 4I50E 4BJNA 3HKEE 2P0XA 3CX8B 2RSXA 1NB5I 4ANJA 4PAGA 4MEIA 3LT8A 4P0AA 2KCDA 3CNXA 3EF8A 1Z1SA 4HJLB 1S35A 2UXXB 2N2NA 2YU1A 2BVLA 1NWMX 4GYSA 5JR9B 4FMBA 1MIWA 3M8CA 1CUNA 3FB2A 4TZ4C 1HFAA 1QALA 1JB2A 3CX6B 2RP4A 4MJDA 3LBXB 1O7NB 3RYCE 4MHCA 5BXQA 3HI2A 1VZZA 1S723 2OCTA 4N6MA 4O2HA 3PE0A 5JPUA 3AVSA 4QXHB 2Z77A 2M67A 4HFVA 3CD63 2D5UA 2V7JA 5HYAA 3L09A 1WNHA 3FSDA 3UUMA 1T5YA 3Q90A 2XHEB 1OXZA 3QK6A 4U74A 1CQSA 1JRQA 4H63H 4G63A 4CXWA 1TFOA 4HGAA 2SBLA 2WMOA 2LE8A 4ORLA 2X68A 3KFWX 1YW0A 3KBUA 5L3GB 3CKDA 4XDVA 3G16A 2INXA 2L9QA 2QIYA 3SS1A 3F2EA 1V74A 5LJMA 4P09A 3NV0A 1OHOA 1IJ5A 3BLZA 4C90A 3CME3 2NTYA 5FP3A 3N2GE 2LQVA 3ALAA 1PU4A 3CXC2 1SPUA 1AJ3A 3J7Yq 4FR9A 2C0SA 1GD4A 4RBNA 4H9NC 2CA5A 3ZMUB 3LFMA 3HIIA 3K7CA 3AMOA 2XFSA 3QK9A 3P8CD 5CK6A 1VQ53 4WBNE 5JH7E 3MHEA 3SVAA 5AYRB 4OHFA 3UJMA 2HMLB 1WYCA 3MXZA 2W03A 4OK0A 1IQ8A 2P9BA 2ZM2A 3RYFE 2JRKA 3FG4A 2KXGA 4X1IE 2NOXA 4U72A 4ZI3C 2K54A 1NAFA 2KMFA 3PTRB 4UELA 3KE7A 4MMYB 3ZYLA 4CI2B 5AIFA 2K5BB 1W6GA 3OV4A 3CC43 2LHRA 5IHYA 1G8XA 3AA7B 3IBPA 3OBVE 1ISKA 1YHQ3 3SXXA 2N1GA 5EEOA 1TIJA 3WODG 3ZMVB 4GK0E 2IC6A 3K3OA 1VQK3 2VKDA 5KP1A 5F3JA 1FA3A 3UUNA 2W56B 3FGYA 3I0YA 4K61A 2WM9A 1ULIB 5BVBA 3K3NA 2CWOA 3LK3B 2YFIB 4GYRA 2WOFA 4O2BE 3N8BA 4L9IA 1ZX2A 3GN5B 1HTJF 3T8OA 5LP6E 2GXFA 4PFPA 3CQCB 7STDA 1MMDA 4FMCA 1Q814 3X41A 3NZPA 3UL6A 2JQ5A 2G0UA 2W00A 2XAGB 1MMNA 3CCR3 3PCRA 5J2UE 6STDA 2HMOB 2HMKB 4PK6A 3NQYA 2EHOA 1WMNA 2RFRA 3FG1A 3FBZA 3AB3B 3GZRA 3ETVA 5JRCA 4UXNB 4BTWA 5M4YA 3ZPOA 2DWKA 2X9XA 1EZ3A 2HMJB 1ZEEA 4R4KA 2P09A 4YLHA 2GEXA 5CA1E 2V1LA 1R4CA 1AV4A 2ZM8A 3WDGB 2X9HA 3OWUA 3CPW2 3FZWA 3HX8A 1MIVA 2WBLA 2CXDA 4IHJE 3ZMSB 2W61A 3CQXC 1QUUA 3Q5WA 1BUQA 5JREA 3UULA 3MPHA 3DM8A 3S28A 2XF3A 5FMNA 5DJQC 1JB4A 2W9QA 3ONXA 2IW5B 1RRHA 1D6UA 2CXLA 1UI8A 2XFTA 1B7TA 2W63A 3LXUX 4AKZA 1HCIA 3VSYA 4EIWA 2W6JH 2YX9A 5I97A 2X66A 4AQFA 3A5XA 5LHGB 2W04A 4HM7B 1UW1A 2IA7A 2JJ9A 4F6RC 1O7GB 3GZXB 4WYKB 4DBQA 1OGZA 2CFGA 3NM2A 4BJMA 5LOVE 2LSIA 3H37A 2BVMA 3PUAA 3RYHE 3MWZA 3BB9A 4FCZA 3O1IA 5H6RB 3RDEA 3HR0A 3V92A 1W2B2 4N3VA 4EXTA 1Q824 4K1UA 3LTBA 2NW9A 3PZWA 3IHRA 5IG0A 4WBOA 5CXOA 3NM7A 4Z8XA 3B8LA 3HA4A 3JUOA 2XAHB 3ETUA 3PU8A 4XM4A 2E2TA 5AEUB 3X3YA 4AKGA 2NWBA 1U5OA 1NJI4 3UFEA 4PJMA 2MYSA 2RCDA 4TX4A 2LYXA 5EZYE 5IG4A 1FGTA 4N6V0 4MMXB 4I4KA 5AI1A 2HPLA 4CI1B 3F14A 2LT3A 1ROAA 3UUXB 3CQGB 1OGXA 3F31A 1HS7A 3N9OA 3G0KA 2Q9QA 4JUYA 4XBXA 2EHOB 5JQGE 1QVG2 4ERRA 1W6CA 4HKAA 4WP5A 3G8ZA 2BMRB 2JDIH 5FXWA 4H61A 1OCVA 3FG3A 4FCJA 3CPZA 3FHNA 4FI5A 3AAIA 4IE5A 1D0XA 1WMPA 1KC84 2ODUA 4PNIA 1IVWA 4GB5A 1JKGB 3KKGA 4AEQA 3BNBA 3WMDA 4O02B 3S4UA 5L3BB 3U3IA 4UEMA 4ZHQE 5CA0E 1JN5A 3PXMA 5ELJA 3GMIA 1QVF2 1OWAA 2BMQB 3KV4A 3VKGA 2CG0A 2CMRA 1YKHB 4UIGA 5LNKA 1RKYA 4HM1B 4HBRA 3GZYB 4AXPA 3Q1CA 2EHOD 4CXXA 2C5IT 1IJ6A 3H3HA 3KSPA 1M1XB 3ZC0A 3I563 1YIT3 2CCQA 1AR0A 2K24A 2K9AA 4HM8B 3R84B 4IE7A 4PJJA 2GEYA 4AKIA 3GZBA 4AKLA 4O2AE 3J9X1 3OYZA 2ODVA 2YINA 4N6OB 2WAUA 1MNEA 1JNQA 1SJWA 1FMVA 3F7SA 5EVHA 4FCMA 1WR6A 3AVRA 4AKHA 1SHZC 4XZCA 4IE0A 4ZOLE 1D6YA 4XBYA 4JRFA 4ADZA 1WLXA 2GBWB 3WA3A 1D6ZA 3ZEFB 5STDA 3DMCA 4K0UA 4PJNA 3LH4A 4RNYA 3VF1A 1FGRA 4EV2A 2E9XB 5A1LA 3PGBA 2Q9QB 1QSDA 3SOAA 3BNDA 3DXOA 2V7LA 4XB5A 1UX5A 3CCE3 1SQWA 5JDGA 2QGUA 4HM3B 3VU7H 2CLYC 2LOPA 5EQLA 2R4IA 5HWXA 3JUPA 3X3ZA 4IIAA 5IERA 5HGRA 5F8PA 2O3OA 3GA8A 1YD8G 4J8TA 4J2CA 2WSSV 1OH0A 2KXPB 4E7SA 2XH9A 5AEWB 1E3VA 1FIOA 3ER7A 5LYJE 3DP7A 5JDFA 2C5JA 1Q40A 3CCS3 3LTCA 3AAAB 2ML6A 3W15B 4LEHA 2CEAA 3C64A 4DMVA 1K28A 4O4JE 3AA0B 4WNKA 1GYBA 3ZJ1A 1IT7A 3EB8A 2X67A 1JN5B 3GRDA 1ULJB 1O7MB 1OHPA 5JR9C 4DNDA 2DHRA 4XAXB 4JF8A 3LJCA 4WWUC 1Z0PA 1GY6A 2QA43 1YJ93 1W00A 3HI7A 3AAEB 3F8XA 2LSKA 3U97A 2E9XD 4E7ZA 1QAFA 4H3UA 2Q9QD 2ACXA 5IYZE 3RX6A 5JPPA 3V5UA 1LVNA 2DLRA 3V98A 2OQEC 2KT9A 2VKOA 1H7CA 5FY0A 2L4VA 4NREA 2JPFA 3CPOA 1LKXA 2DWGA 3HK4A 3JC6D 3IMAB 1UX4A 3D3LA 4XBTA 3SLUA 2CC3A 2PBIA 3LG7A 1S5AA 4KMCA 3RRWA 1MIYA 4H9SE 1IQYA 2VKJA 2H3RA 2A72A 2NW7A 4FMAA 3S5CA 5FXZA 2WGOA 2L8KA 2PZVA 1MNDA 5LG4A 4GK5E 1VQ73 3P7IA 2M7OA 2CW9A 1HF8A 2JQQA 2D1WA 3MG3A 3NBRA 3JUQA 1FGMA 1HG2A 4EV5A 4IIJE 2MC8A 1NB3I 3E0ZA 2SPCA 2IMJA 1Y64B 3K3QC 1VOMA 4LZIA 4DVDA 2BDEA 5ELUA 3NQZA 4DMWA 3OWSA 3D9RA 4CZZB 3LK42 3Q2PA 5D81A 3B4OA 5AIGA 1G73A 3VHLA 1PFPA 4EB6E 1KD14 3MK7C 1MMGA 4PK5A 1IVXA 1Q40B 4TV9E 2RGQA 2MBGA 2CKFB 3NBBA 2PNCA 3EDVA 3PYJA 4ZS3A 2BNGA 3NBXX 1OF5A 3U78A 4BTYA 1JJ22 2I59A 4CI3B 3EBYA 1A67A 1STDA 1WYBA 2Y74A 1CYUA 2MOZA 2KWIB 3CCU3 3KBTA 4B6XA 1VQ93 3V99A 3G4S3 3EVYA 2L3LA 3PURA 3HKDE 4NUUA 2NW8A 3RH3A 4XDWA 1M1K4 3NBJA 2IUKA 3ZMZB 2CH9A 2WO0A 1IVVA 5LHHB 1N8R4 1FGQA 1Q7Y4 2CE7A 3ZYKA 3CCQ3 4TUYE 4HE8A 3RRCA 3EN1B 2YU2A 2XGNA 2YEVC 4A56A 3STDA 3NV0B 1HKXA 4H9OC 4L0RA 1ZHCA 4R1KA 2OTJ3 2DNXA 2UX0A 3B57A 2JMKA 1LVKA 4ZI3D 3ZYMA 5D82A 3B7CA 1YIJ3 3CX7B 1K8A4 1DMMA 4QKNA 2KWHA 4L5GA 1BR1A 3MACA 4IE4A 3E08A 4QXCB 5CF1A 4MLKA 5HWYA 2E2UA 4QXBB 4KUMB 2CG1A 3AMOB 4PFOA 1F8NA 2B1XB 4N6TA 1VQN3 5GONE 4LSOA 2VKHA 2ZM0A 1US1A 4LGQA 4KBMB 3T0UA 2VK9A 3KINB 1OUNA 4IE6A 2CK3H 3KVAA 4ZI7E 3KSED 2VB6A 5LA6E 1UUVB 2W0GA 1N9JA 3GWRA 2Y73A 4IT7A 2P05A 1KK7A 4OVMA 4N78D 4X2HA 3VGNA 4MFRA 1WMOA 1TFKA 1VQO3 1U8CB 3RGAA 1ROVA 1N8QA 3RGRA 3EDUA 2C10A 4J9AA 3EQQB 4QX8B 5DABA 1AVKA 3IPTA 4TX5A 2K48A 5IF6A 2DCFA 2OOVA 4UV8B 3I9WA 4DO0A 3HKCE 1OF5B 4EYCA 4N6NB 4AI6A 3OW22 5HXSA 4EYYR 1EKMA 2Y48B 1YGEA 3HL6A 3KFQC 3N5LA 2I9WA 5TGNA 3EE1A 2E8IA 1Q42A 3FF2A 1TU5A 1OPYA 3I1AA 5L3CB 3F8HA 3DZLA 2LOSA 4X2OA 4RZMA 2ZDJA 3CC73 4C91A 1NDOB 2KNDA 4RNZA 2CWUA 3IEEA 3NX0A 4KFDA 3MG1A 4JLEA 1IU7A 3LTDA 3PU3A 2BZBA 3GWHA 5HXEA 2W9PA 2XR8B 4CCVA 2W2CA 1FGOA 4BAYB 1DVCA 1W7CA 2UXNB 3UL5A 1GY5A 1NWWA 4STDA 4I43B 2YK0A 2DI4A 4AKRB 2P38A 3CNMA 3L3PA 2CIUA 3T8UA 3CCM3 5JRCB 4EZ4A 1N5HA 3MYTA 2LSYA 1LNHA 3MKIA 1K734 4GL6A 2EHOC 2HH7A 3PUQA 1X79A 1IT8A 4OYJA 4I4TE 3BNCA 4YJ3E 4AQGA 5C8YE 1DYUA 4UF0A 5IEPA 2LM9A 2HPJA 4HM5B 5KP3A 2OTL3 3CCJ3 4OFZA 3M65A 4YHJA 3CC23 3JUMA 3PS8A 3KV5A 4H9PC 4I55E 2GU1A 3ANWA 4KFEA 4M1PA 1J2BA 5LGUB 1KSIA 4ZI2D 3SWHA 4ISTA 4IDZA 3CU3A 3ZCIA 3C98B 3N9LA 3RC3A 4AKYA 1C7HA 3R6NA 3EUHA 3EJVA 3N9NA 5EK2A 1VQ63 3EHCA 4AQFC 1N5PA 4CQIA 4G2AA 1W6YA 4P0BA 3LBXA 5DRVA 3SRZA 3N9QA 2WOHA 4L7KA 4GIWA 2Z7AA 3FH1A 4HM2B 4KP3C 2CFDA 2GBXB 2X9WA 2XQYA 4Q53A 2OQEA 5H6QB 4HYZA 2V7MA 2IUJA 3K63A 1S94A 5FGOA 2CFKA 5LGNB 4KVHA 3JVCA 2J1DG 4H63V 4JEHB 5FXXA 3HIGA 3C4XA 4MMZB 2H7OA 4G1MB 5LJNA 2W0QA 2O9UX 4HZ9B 1EA2A 1VQM3 3SOLA 3SEDA 5HXRA 3E99A 4ASKA 2A2FX 2CFWA 2B24B 4X1KE 4WFOA 3O9XA 3ZLIA 3RKOA 1K9M4 5J1GA 1EG9B 1RRLA 3NXJA 4O3VA 3LYGA 2WGQA 5HAXA 3EC9A 3PUGA 2K0MA 8CHOA 1GY7A 4U13A 2E9XC 4JEUB 3NUVA 2HMNB 3EX9A 1K41A 3KZTA 3KN4A 3UT5E 2A3DA 3PCSA 2VWAA 4L8PA 5IG5A 1D1CA 4UF0B 3PUSA 1EQKA 1QAKA 2BHMA 3JC6C 5IG3A 3PDYA 2XASB 2D0UA 3ROBA 3CMA3 2BMOB 3MA9A 4O4HE 4PEJA 3X3XA 3LOYA 3UB1A 4KZ1A 3ANWB 5HXCA 2WWUA 1W02A 4HM6B 3ZMTB 1UUWB 1A2KA 3VKHA 1YI23 2Z6BA 3F9SA 1LOXA 1BR4A 3KDSE 2C5KT 2XGLA 3OX9A 1GS3A 3DGNA 3CCV3 5LHIB 2BT3A 1TUHA 3Q2MA 2P0MA 4DBRA 3AA1B 4HZBB 2W56A 1AVLA 5L2LA 5ETWA 3IJEB 3TDGA 4EBGA 5JDNA 3E22E 3GN5A 1UCUA 1STFI 3BNEA 2YFLB 4ILUA 1W01A 4FJOA 2QEX3 4HTEA 5DQWA 2CHCA 3G6E3 2XUEA 4HEAA 1ZV4X 2BO9B 3H51A 2VASA 4KFFA 1BR2A 1OACA 3NRXA 1NU3A 3K5TA 5IEOA 3N9MA 2B1EA 2FXTA 3O1JA 1TP6A 4EYUA 1FUWA 3DJBA 4X1YE 4PK4A 1V9DA 3KIIA 4YFSA 3U1WA 5FY7A 2IAKA 5A0OB 5CF2A 4YJ2E 4MBQA 3N9HA 3SX1A 2XEPA 3S29A 3H3AA 5ADXL 3ZCJA 4XBFB 3BK9A 2QGSA 3HZPA 2N9DA 3NZQA 2XRXB 2V7KA 3S67A 4K1VA 2Z76A 1WQLB 1O7HB 5D83A 1DMNA 2LSJA 5LBMA 1GD3A 3RYIE 3N54B 5LXTE 3LK2B 1SIHA 2CM0A 2LEHA 1D1BA 4HKVB 1IQXA 4WYKA 1SA0E 5AFUL 2YFJB 4H9RC 3BQLA 2ZL8A 2HMMB 3AA6B 1UI7A 3SOYA 1WRDA 3MG2A 5BMVE 2X0LB 5LC6A 5EK4A 4R9LA 5E0OA 1M904 1VQ43 5KDMC 1IDPA 4EC6A 1CYVA 3DGLA 4MALA 4EAHA 3LTAA 4GOUA 3DGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 4ZZC A;  4WHA A;  2RA1 A;  5IW9 A;  2H7V C;  1O7P B;  5HEJ A;  2VUR A;  1YKE B;  2FJE A;  1I94 T;  2JIW A;  3EN8 A;  1IK3 A;  2CWY A;  3LDQ B;  3A76 A;  3KCH A;  4HM4 B;  4COF A;  5KMG P;  1VQP 3;  4X5T A;  2D42 A;  2LJL A;  2DL1 A;  2PG8 A;  5IEN A;  5KX5 E;  4IGU A;  3WOE B;  2BKO A;  1KNZ A;  3G71 3;  1CEW I;  1MWR A;  1NO3 A;  1E3R A;  4IDQ A;  4X64 T;  2IC9 A;  5AII A;  3B4P A;  2A9U A;  1X1X A;  2BG9 B;  2X51 A;  3WOF B;  1I3I A;  1ZKE A;  2XAJ B;  1D0Y A;  3FXE B;  4GHO A;  3BQI A;  4L8O A;  2GK9 A;  1IYY A;  4YXD A;  5FYM A;  2UGI A;  3V5S A;  4TWF A;  3ZN0 B;  1HU9 A;  3FF0 A;  2GSP A;  5L47 A;  3WAJ A;  4RNT A;  5AQO B;  3K9M C;  3NRY A;  4R9K A;  2LHN A;  1JKG A;  2Y8D A;  7GSP A;  3TKL B;  1XZY A;  3N2K E;  1YJN 3;  4QWN B;  4BL2 A;  4WW0 A;  4TN7 B;  1IZN B;  1JB5 A;  1OED E;  3B13 A;  5CJ5 A;  3WI3 A;  2XSH B;  3MSO A;  2FBW A;  4ZS2 A;  3LML A;  2XAQ B;  3UNL A;  1MNL A;  1BRH A;  1FEW A;  3QC9 A;  3OJA A;  2VL8 A;  4CXY A;  3FCS B;  5AQH B;  3F57 A;  4K90 B;  3N9P A;  4O4I E;  1LRZ A;  5JDM A;  2E5L T;  1I6Z A;  5ABF A;  4UV9 B;  1RCL A;  3ZC1 A;  2RPA A;  1WFD A;  2KF4 A;  3K0Z A;  5DQV A;  3JUN A;  3Q5X A;  1RGC A;  2OA5 A;  3QB5 A;  3I9Y A;  1UGH I;  2FUP A;  3NHX A;  5J2T E;  1MOL A;  5AYS C;  2IDO B;  2XQ9 A;  2Q07 A;  4LF6 T;  4R80 A;  5LBQ B;  3EBT A;  4H9Q C;  2VL0 A;  3S27 A;  3UFG A;  4EZH A;  4NUV A;  1TJD A;  1IAP A;  1EUI C;  1OED C;  2W4X A;  1HNX T;  3OXA A;  2J4G A;  3QRD A;  5LB7 B;  3O8Y A;  2D2S A;  5FXV A;  1RGE A;  1ZO2 A;  3ZJ2 A;  4HWH A;  1FUT A;  3RPU A;  4BA9 A;  4P1N A;  3X42 A;  5GSP A;  1BU4 A;  1YQ3 A;  2CXF A;  2V1D B;  3CWZ B;  4ZI2 C;  2KIN B;  3JAE A;  3QUJ A;  4OYK A;  3I0O A;  2OWP A;  3DGM A;  1A2V A;  1ASK A;  5CLK A;  2C11 A;  3D0T A;  4DV4 T;  3KV6 A;  3EAB A;  3CK6 A;  2E2V A;  1XMQ T;  2FGT A;  4IPB A;  5CB4 E;  1W2Z A;  1BR0 A;  3MKD A;  3RC8 A;  4JI1 T;  3MZK B;  5HOH A;  2F86 B;  1VRB A;  2H0G A;  2QA7 A;  1DMQ A;  3VRB A;  1RGG A;  5EK3 A;  2A15 A;  2CFL A;  4HM0 B;  3B5M A;  1HG5 A;  5TAO A;  2E9X A;  2HOH A;  3O4X E;  1IV7 A;  2MF7 A;  1KQS 2;  1N9E A;  2JQK A;  3CVR A;  3DUK A;  3N2O A;  1KWI A;  1QMA A;  4CDL A;  1VQ8 3;  4NHF A;  3BQK A;  1N34 T;  2ZLY A;  4OUQ A;  3DH2 A;  2XSA A;  2Y6X A;  3MJX A;  1M9G A;  5M1A A;  4U2Z A;  4NPB A;  2F98 A;  3KV9 A;  4QX7 B;  2PJQ A;  2BS4 A;  3JAD A;  5HXH A;  1W4N A;  2XM1 A;  1T98 A;  3C4Z A;  1Y4K A;  4QWT A;  4TV8 E;  2KLQ A;  1QJG A;  4UVA B;  4YSY A;  1FZU A;  4ILF A;  2XAF B;  1D1A A;  1BSD A;  1US7 B;  3X40 A;  5JBS A;  1YJW 3;  2NTX A;  2JMH A;  1O7W B;  3VR9 A;  5L3E B;  2MTQ A;  4X20 E;  3C50 A;  1N33 T;  4LFB T;  4BTX A;  2RNT A;  3RF1 A;  1VQL 3;  3L0R A;  4ILA A;  1LQM B;  2FJA A;  5JR9 A;  4O8S A;  3UQ7 A;  2XY8 B;  1DU2 A;  1SE7 A;  4B3T T;  3KVB A;  3AE5 A;  4UVC B;  4TWH A;  4BIR A;  5FY1 A;  2OOV C;  5L3D B;  4PW8 A;  5AQM B;  5JDH A;  2ZMA A;  1W9R A;  2CWT A;  1E97 A;  2GU3 A;  4V1A v;  4EOZ B;  5JDL A;  3FKA A;  5DRE A;  3WA2 X;  3FXD B;  3P50 A;  4IL9 A;  1MGW A;  1RN7 A;  3IF8 B;  2CWV A;  5BR8 T;  3RQU A;  2ES0 A;  1WTH A;  3LZA A;  2V26 A;  4HAA A;  1RGA A;  2XTL A;  5LGT B;  1U5P A;  3OWY A;  5AIH A;  2W62 A;  2XQ3 A;  2WDV A;  4CN4 A;  1JV2 B;  4UVB B;  4N6L A;  4FMD A;  5LCY A;  4X62 T;  3AHS A;  5LC7 A;  5KP4 A;  2HN2 A;  3GAX A;  1X9B A;  2V7I A;  3CML A;  3I55 3;  1A90 A;  1D0Z A;  4O4L E;  4ZM8 A;  3ESL A;  3T8N A;  4PJL A;  3J7Y d;  3BIR A;  1FMW A;  2WY2 A;  2Z6E A;  4HVN A;  5FNV E;  3CCL 3;  1E1H B;  2NP9 A;  3ECF A;  3LT9 A;  4HN9 A;  1MMA A;  1U4Q A;  3RHW A;  4ISS A;  3UTK A;  1LVF A;  3Q9D A;  2WZI A;  4EXR A;  4YSX A;  5G2G A;  3O1H A;  1O3X A;  1G96 A;  3FLJ A;  3F7X A;  4LMI A;  8RNT A;  4N6U A;  3ZG5 A;  4CJN A;  3FBL A;  5JVD E;  3F40 A;  1IV9 A;  1YVB I;  1HX8 A;  2UUC T;  2PFV A;  3DY5 A;  1L5G B;  3OKQ A;  2D9D A;  2KRT A;  1UCJ A;  1W5Z A;  1SII A;  2WMN A;  2XSO B;  4JBW F;  1JBR A;  2D0T A;  3D4A A;  3WAK A;  3C51 A;  5FW5 A;  2KZ7 B;  3DTO A;  1IVU A;  1G0T A;  4IT4 A;  2Q9Q C;  1RJO A;  3OYX A;  1DVD A;  5AQR B;  3ZN1 B;  2QRX A;  2F99 A;  2L1S A;  2FNQ A;  1LXE A;  2CLY B;  2X9Y A;  5JDQ A;  3K8P C;  4WYV A;  1AY7 A;  3I0Q A;  2BU4 A;  4QHO A;  2LSG A;  3AEF A;  1OHS A;  2WQY A;  5L3F B;  2XQ5 A;  3HKB E;  1GMQ A;  3C4W A;  1Q86 4;  2STD A;  3AE7 A;  2ML5 A;  4I50 E;  4BJN A;  1T8B A;  3HKE E;  2P0X A;  4YHH T;  3CX8 B;  2RSX A;  1NB5 I;  4ANJ A;  4LMK A;  4PAG A;  2H88 A;  4EW5 A;  2F56 A;  4MEI A;  3LT8 A;  4P0A A;  2KCD A;  3CNX A;  3EF8 A;  1Z1S A;  4HJL B;  1TTO A;  4HFE A;  1S35 A;  2UXX B;  4DR3 T;  2N2N A;  4LF7 T;  2YU1 A;  2BVL A;  1NWM X;  4GYS A;  5JR9 B;  4FMB A;  1MIW A;  3M8C A;  1CUN A;  2IHR 1;  3FB2 A;  4TZ4 C;  1HFA A;  5HCJ A;  1QAL A;  2K3W A;  1JB2 A;  4EGW A;  3CX6 B;  2RP4 A;  4MJD A;  1BRJ A;  3LBX B;  1O7N B;  2LM2 A;  3RYC E;  4TNV A;  1RGF A;  4MHC A;  5BXQ A;  3HI2 A;  1VZZ A;  1S72 3;  2OCT A;  1T3B A;  4N6M A;  4O2H A;  3PE0 A;  5JPU A;  3AVS A;  4QXH B;  2FJB A;  2Z77 A;  2M67 A;  2YN6 A;  4HFV A;  3L39 A;  3CD6 3;  2D5U A;  2V7J A;  5HYA A;  3L09 A;  1WNH A;  2IUB A;  3FSD A;  3UUM A;  2I6H A;  1T5Y A;  3Q90 A;  2XHE B;  1OXZ A;  3QK6 A;  4U74 A;  1CQS A;  1JRQ A;  4K0K T;  4H63 H;  4G63 A;  4CXW A;  1TFO A;  4HGA A;  2SBL A;  2WMO A;  2LE8 A;  4ORL A;  2X68 A;  3KFW X;  1YW0 A;  4GSP A;  3FZL B;  3KBU A;  2BKP A;  5L3G B;  4JI0 T;  1JZD A;  3CKD A;  4XDV A;  3G16 A;  9RNT A;  2INX A;  2L9Q A;  2QIY A;  3SS1 A;  3F2E A;  2VVS A;  5LJM A;  1V74 A;  4P09 A;  3NV0 A;  1OHO A;  4OX9 T;  1IJ5 A;  1B2U A;  3BLZ A;  4C90 A;  1Z8U A;  2NTY A;  3RIA A;  1J5W A;  1NNV A;  5FP3 A;  3CME 3;  3N2G E;  1GSP A;  1RSN A;  2LQV A;  3ALA A;  3RLF F;  1PU4 A;  3CXC 2;  1SPU A;  1AJ3 A;  3J7Y q;  5IWA T;  4FR9 A;  1W0B A;  2C0S A;  1GD4 A;  2HHH T;  3AXJ A;  4RBN A;  4H9N C;  3FZF B;  1I2G A;  4HFB A;  2CA5 A;  3ZMU B;  3LFM A;  3HII A;  3K7C A;  3AMO A;  2XFS A;  3QK9 A;  3P8C D;  5CK6 A;  1VQ5 3;  4WBN E;  5JH7 E;  4I5Q A;  3MHE A;  3SVA A;  5AYR B;  1I2E A;  1RGH A;  4OHF A;  3UJM A;  2HML B;  1WYC A;  4TWD A;  2V6Y A;  3MXZ A;  2W03 A;  4OK0 A;  1IQ8 A;  2P9B A;  4I0U A;  2ZM2 A;  2F5M A;  3RYF E;  1BIR A;  2JRK A;  3FG4 A;  2KXG A;  1BGS A;  4X1I E;  1KF6 A;  2NOX A;  4U72 A;  1HNW T;  4ZI3 C;  3X1D A;  4DUZ T;  2K54 A;  1NAF A;  5AQQ B;  2KMF A;  3P4S A;  2VQF T;  3PTR B;  1I2F A;  4UEL A;  3KE7 A;  4MMY B;  3ZYL A;  1GMR A;  2XJ7 A;  4CI2 B;  5AIF A;  2K5B B;  1RN4 A;  1W6G A;  3OV4 A;  3CC4 3;  3QB5 K;  2LHR A;  5IHY A;  1RCK A;  1G8X A;  2NR4 A;  3AA7 B;  3IBP A;  3OBV E;  1ISK A;  1YHQ 3;  1UCL A;  3H3M A;  3SXX A;  2N1G A;  5EEO A;  1TIJ A;  3WOD G;  1WR0 A;  3ZMV B;  4GK0 E;  2IC6 A;  3K3O A;  1VQK 3;  2VKD A;  5KP1 A;  5F3J A;  4KHP T;  1FA3 A;  4IRE A;  3UUN A;  2W56 B;  2F5W A;  3FGY A;  3I0Y A;  4K61 A;  3EAM A;  2WM9 A;  2V5C A;  1ULI B;  5BVB A;  4HWF A;  3K3N A;  2CWO A;  3LK3 B;  4U31 A;  2YFI B;  3RQW A;  2WU5 A;  4GYR A;  2WOF A;  4LF9 T;  2XQ4 A;  4O2B E;  3N8B A;  4L9I A;  1PY3 A;  1ZX2 A;  3GN5 B;  1HTJ F;  3T8O A;  1GOY A;  5LP6 E;  2J47 A;  4LF4 T;  2GXF A;  4PFP A;  1ZS7 A;  3PJA J;  2ZA4 A;  3CQC B;  7STD A;  1MMD A;  4FMC A;  1Q81 4;  1UGO A;  3X41 A;  1IBL T;  2W66 A;  3RIU A;  3NZP A;  3UL6 A;  2JQ5 A;  2G0U A;  2W00 A;  2XAG B;  1MMN A;  1UCI A;  3CCR 3;  1GOU A;  3PCR A;  3ONJ A;  5J2U E;  6STD A;  2HMO B;  5M19 A;  2HMK B;  4PK6 A;  3NQY A;  2EHO A;  1WMN A;  2KF5 A;  2RFR A;  3FG1 A;  3FBZ A;  3AB3 B;  1BNF A;  3AED A;  3ETV A;  3GZR A;  5JRC A;  1YVS A;  2V8S V;  4UXN B;  4BTW A;  5M4Y A;  3ZPO A;  2DWK A;  2X9X A;  2BS3 A;  4NIQ A;  2OLT A;  1R4Y A;  1EZ3 A;  2IML A;  1ZEE A;  2HMJ B;  4R4K A;  1KFY A;  2P09 A;  1RTU A;  4YLH A;  2J62 A;  2GEX A;  5CA1 E;  2CRB A;  2V1L A;  1R4C A;  1AV4 A;  2ZM8 A;  2CX1 A;  3WDG B;  2X9H A;  3OWU A;  1MWU A;  3CPW 2;  3FZW A;  1LNI A;  4U7I A;  2UXD T;  3HX8 A;  1MIV A;  2WBL A;  2CXD A;  1TRP A;  4IHJ E;  5FL0 A;  3ZMS B;  2W61 A;  2XPK A;  3CQX C;  4Q25 A;  1QUU A;  2KF6 A;  3Q5W A;  1XNQ T;  1BUQ A;  5JRE A;  3UUL A;  1LRA A;  3MPH A;  3DM8 A;  3S28 A;  1BOX A;  2UUG C;  2V6Y B;  2XF3 A;  5FMN A;  5DJQ C;  1JB4 A;  2W9Q A;  3ONX A;  2IW5 B;  1RRH A;  1D6U A;  1T2I A;  3AE4 A;  2CXL A;  4QH5 A;  1UI8 A;  2XFT A;  1G02 A;  1B7T A;  3AEB A;  5L4E A;  2W63 A;  3LXU X;  2LLY A;  4AKZ A;  2HN1 A;  1HCI A;  3VSY A;  4EIW A;  5J0Z A;  2W6J H;  2YX9 A;  5I97 A;  4JI6 T;  3UU8 A;  5HEH A;  2X66 A;  4AQF A;  3A5X A;  2RBI A;  3RI5 A;  3UUB A;  5LHG B;  2W04 A;  4HM7 B;  3SYU A;  1UW1 A;  2IA7 A;  2CPT A;  2JJ9 A;  4F6R C;  1O7G B;  3GZX B;  4WYK B;  1E7P A;  4DBQ A;  1OGZ A;  3VRA A;  2CFG A;  3NM2 A;  4BJM A;  3P4W A;  5LOV E;  2LSI A;  3H37 A;  2BVM A;  3PUA A;  3RYH E;  3MWZ A;  2XQA A;  4IDN A;  1BSB A;  3UU6 A;  3BB9 A;  1YQ4 A;  4FCZ A;  3O1I A;  5H6R B;  3RDE A;  3HR0 A;  1RMS A;  3V92 A;  4NXN T;  1MWS A;  1I3F A;  1W2B 2;  1I8V A;  4N3V A;  2XQ6 A;  4EXT A;  2J8X B;  1Q82 4;  4K1U A;  3UU3 A;  2NW9 A;  3LTB A;  3PZW A;  3IHR A;  5IG0 A;  4WBO A;  5KXJ A;  5CXO A;  3NM7 A;  4Z8X A;  3B8L A;  3HA4 A;  3JUO A;  3AE3 A;  5RNT A;  1UUG B;  2XAH B;  4AIS A;  3ETU A;  3PU8 A;  4XM4 A;  2E2T A;  5AEU B;  3URP A;  3X3Y A;  1RLS A;  3ZT5 A;  4AKG A;  2UUA T;  4DR6 T;  2NWB A;  1U5O A;  1NJI 4;  2FJD A;  3UFE A;  4PJM A;  2MYS A;  4A97 A;  2RCD A;  4TX4 A;  2LYX A;  5EZY E;  5IG4 A;  3FZK B;  1FGT A;  4N6V 0;  3OPC A;  4GKK T;  4MMX B;  4I4K A;  5AI1 A;  2HPL A;  4CI1 B;  3F14 A;  1UDI I;  2LT3 A;  1ROA A;  3UUX B;  3CQG B;  1OGX A;  1BNR A;  3F31 A;  1HS7 A;  4B3M T;  3N9O A;  3G0K A;  2Q9Q A;  4JUY A;  4XBX A;  2EHO B;  5JQG E;  1QVG 2;  1JNR A;  4ERR A;  1W6C A;  4HKA A;  1XDP A;  4JI5 T;  4WP5 A;  3G8Z A;  2BMR B;  2JDI H;  5FXW A;  4H61 A;  1OCV A;  3FG3 A;  4U3C A;  4FCJ A;  3CPZ A;  2XQ7 A;  3FHN A;  4FI5 A;  3AAI A;  4IE5 A;  1D0X A;  1I70 A;  1WMP A;  2C4B A;  2ODU A;  4PNI A;  1KC8 4;  3ZKR A;  1IVW A;  1E2A A;  4GB5 A;  1JKG B;  3M3Z B;  3KKG A;  4AEQ A;  4LMJ A;  3BNB A;  3CIR A;  1DE3 A;  3Q5D A;  1FUS A;  1J5E T;  4X65 T;  3WMD A;  4O02 B;  1N32 T;  1B2S A;  1B2X A;  3S4U A;  5L3B B;  4BU4 A;  2ACZ A;  3U3I A;  3TLV A;  4UEM A;  4ZHQ E;  5CA0 E;  1JN5 A;  3PXM A;  5ELJ A;  3GMI A;  1QVF 2;  1OWA A;  2BMQ B;  5ABF B;  3KV4 A;  3VKG A;  2CG0 A;  2CMR A;  4DV3 T;  1YKH B;  4UIG A;  1RN1 A;  5LNK A;  3PUZ F;  1RKY A;  3AEG A;  4HM1 B;  5G1L A;  4HBR A;  3AE8 A;  5AQP B;  3GZY B;  4AXP A;  3Q1C A;  4CPK A;  2EHO D;  4CXX A;  2C5I T;  1IJ6 A;  4HFC A;  3H3H A;  3KSP A;  1M1X B;  3ZC0 A;  3I56 3;  1YIT 3;  2CCQ A;  1AR0 A;  2K24 A;  2K9A A;  4HM8 B;  3R84 B;  4DV2 T;  4IE7 A;  4IDO A;  1T72 A;  4PJJ A;  2GEY A;  4AKI A;  4LF5 T;  3GZB A;  4AKL A;  4O2A E;  3J9X 1;  4NXM T;  1UUR A;  3OYZ A;  2ODV A;  5AQS B;  2YIN A;  4N6O B;  2WAU A;  1MNE A;  1JNQ A;  1SJW A;  1VCT A;  1FMV A;  3F7S A;  5EVH A;  4FCM A;  1WR6 A;  5FVL A;  3AVR A;  4AKH A;  1SHZ C;  6GSP A;  6RNT A;  4XZC A;  3D79 A;  4IE0 A;  3AGO A;  4ZOL E;  1D6Y A;  4XBY A;  4JRF A;  5FKY A;  2KSR A;  1WLX A;  4ADZ A;  1IBK T;  2GBW B;  1T2H A;  4BL3 A;  3WA3 A;  1D6Z A;  2UXC T;  3ZEF B;  2X0Y A;  5STD A;  2BBH A;  2ZM6 T;  3DMC A;  4K0U A;  4PJN A;  3LH4 A;  4RNY A;  3VF1 A;  1FGR A;  4EV2 A;  2E9X B;  5A1L A;  3PGB A;  2Q9Q B;  1QSD A;  4Z91 A;  1BSE A;  3BND A;  2CBJ A;  3DXO A;  3SOA A;  2UXB T;  2V7L A;  4XB5 A;  1UX5 A;  3CCE 3;  1SQW A;  5JDG A;  1JNZ A;  2CX0 A;  2QGU A;  2WP9 A;  4HM3 B;  3VU7 H;  1BUJ A;  2CLY C;  2LOP A;  3AE9 A;  5EQL A;  2R4I A;  5HWX A;  3JUP A;  3ZFZ A;  3X3Z A;  4IIA A;  4IL4 A;  1SAR A;  5IER A;  5HGR A;  1Q9E A;  5F8P A;  2O3O A;  3GA8 A;  1YD8 G;  2CBI A;  3Q5E A;  4J8T A;  4J2C A;  2WSS V;  1OH0 A;  2KXP B;  4E7S A;  2XH9 A;  5AEW B;  1E3V A;  1FIO A;  3UU5 A;  3ER7 A;  4DV1 T;  5LYJ E;  1LOW A;  3DP7 A;  5JDF A;  2C5J A;  1Q40 A;  3CCS 3;  3LTC A;  2R41 A;  3AAA B;  2ML6 A;  3W15 B;  4LEH A;  1YNV X;  2CEA A;  3C64 A;  4DMV A;  1K28 A;  4O4J E;  1KNR A;  3AA0 B;  1RGL A;  4WNK A;  1GYB A;  2F4V T;  1T7S A;  3ZJ1 A;  1IT7 A;  3EB8 A;  2X67 A;  1FW7 A;  1JN5 B;  3GRD A;  4U7Y A;  1ULJ B;  1LQG C;  1O7M B;  1OHP A;  5JR9 C;  4JI7 T;  4LML A;  1BNS A;  4DND A;  2AAE A;  2CHO A;  2DHR A;  4JV5 T;  4XAX B;  4JF8 A;  1Q7H A;  3LJC A;  4WWU C;  1Z0P A;  1GY6 A;  2QA4 3;  3Q3F A;  1YJ9 3;  1W00 A;  5LG3 A;  4DR5 T;  3HI7 A;  3AAE B;  3F8X A;  2LSK A;  3ZSS A;  3U97 A;  5BIR A;  7RNT A;  3RNT A;  2E9X D;  3P4P A;  4E7Z A;  1QAF A;  5AQJ B;  4H3U A;  2Q9Q D;  3SFD A;  2ACX A;  5IYZ E;  1BSC A;  5IUX A;  3RX6 A;  5JPP A;  3V5U A;  1LVN A;  1FJG T;  2DLR A;  3V98 A;  2OQE C;  2KT9 A;  2VKO A;  1H7C A;  4YTM A;  5FY0 A;  2L4V A;  4NRE A;  2JPF A;  3CPO A;  1LKX A;  2DWG A;  1HX1 B;  3HK4 A;  3JC6 D;  3IMA B;  1UX4 A;  3D3L A;  4XBT A;  3SLU A;  3PUW F;  4AIU A;  2CC3 A;  2PBI A;  5CFB A;  3LG7 A;  1S5A A;  4KMC A;  4LF8 T;  3ZG0 A;  1UGI A;  3K1S A;  1PYL A;  3RRW A;  1MIY A;  4H9S E;  4YY3 T;  1NEN A;  2VKJ A;  1IQY A;  2H3R A;  2A72 A;  2NW7 A;  4FMA A;  3S5C A;  3NKZ A;  5FXZ A;  4HWI B;  2WGO A;  1BNI A;  4DV6 T;  2L8K A;  5ABE A;  2PZV A;  1ZP0 A;  1MND A;  1KNP A;  5LG4 A;  2LKG A;  4GK5 E;  1VQ7 3;  3P7I A;  4A98 A;  2M7O A;  5M18 A;  2CW9 A;  1HF8 A;  2JQQ A;  2D1W A;  3MG3 A;  3NBR A;  3JUQ A;  1FGM A;  1HG2 A;  4EV5 A;  4IIJ E;  2MC8 A;  1NB3 I;  3E0Z A;  2SPC A;  2IMJ A;  4GKJ T;  4EEB A;  1Y64 B;  3K3Q C;  4DV0 T;  3AHW A;  1VOM A;  4LZI A;  2E2A A;  3RGL A;  4DVD A;  3QNU A;  1UCK A;  2BDE A;  5F5W A;  5ELU A;  3NQZ A;  4DMW A;  3OWS A;  3D9R A;  3HOH A;  4CZZ B;  3LK4 2;  3Q2P A;  5D81 A;  2WDR A;  3B4O A;  5AIG A;  1G73 A;  1I0X A;  3VHL A;  1KEY A;  1PFP A;  2H0H A;  4EB6 E;  1KD1 4;  3MK7 C;  1MMG A;  4PK5 A;  1W09 A;  1IVX A;  1Q40 B;  4TV9 E;  2RGQ A;  4ZEY A;  2MBG A;  2CKF B;  3NBB A;  1BRG A;  2PNC A;  4AQY T;  3EDV A;  4JYA T;  5AQN B;  3PYJ A;  2OV9 A;  4F8H A;  2H0I A;  4ZS3 A;  2BNG A;  3NBX X;  3A5E A;  1OF5 A;  3U78 A;  4BTY A;  1JJ2 2;  2R6G F;  2I59 A;  2X0H A;  4CI3 B;  3EBY A;  1A67 A;  1STD A;  1WYB A;  2Y74 A;  1CYU A;  2MOZ A;  2KWI B;  3CCU 3;  3KBT A;  4B6X A;  1VQ9 3;  3V99 A;  2VQE T;  3G4S 3;  3EVY A;  2L3L A;  1TRQ A;  3PUR A;  3HKD E;  4NUU A;  2NW8 A;  3RH3 A;  4B3R T;  4XDW A;  1M1K 4;  3NBJ A;  4DR7 T;  2IUK A;  3ZMZ B;  1OED A;  2CH9 A;  2WO0 A;  1IVV A;  5LHH B;  1N8R 4;  1FGQ A;  1Q7Y 4;  3SFE A;  2XSB A;  3WHO A;  5ABH A;  2CE7 A;  3ZYK A;  2I0M A;  3CCQ 3;  2BG9 E;  5AQK B;  1CH0 A;  4TUY E;  4Z90 A;  4HE8 A;  1A2P A;  2LRL A;  3RRC A;  3T1H T;  3EN1 B;  2YU2 A;  2LRK A;  2XGN A;  2YEV C;  3L8R A;  4A56 A;  3STD A;  3EI0 A;  3NV0 B;  1HKX A;  1MWT A;  4H9O C;  4L0R A;  5HCM A;  4JI2 T;  1ZHC A;  4R1K A;  3D5G A;  4A5X A;  2OTJ 3;  4JI8 T;  4LFA T;  2DNX A;  4J5K A;  2UX0 A;  4KHZ F;  4HFD A;  3B57 A;  3OTO T;  2JMK A;  3T1Y T;  1LVK A;  1B3S A;  5L4H A;  3ZYM A;  4ZI3 D;  5D82 A;  3B7C A;  1YIJ 3;  3CX7 B;  3AXJ B;  1K8A 4;  1DMM A;  4QKN A;  2KWH A;  4L5G A;  1BR1 A;  3MAC A;  4IE4 A;  3E08 A;  4QXC B;  1X1Y A;  2WZH A;  1B27 A;  5CF1 A;  4MLK A;  5HWY A;  2E2U A;  4QXB B;  4YTP A;  4KUM B;  2CG1 A;  3AMO B;  4PFO A;  1F8N A;  2BG9 C;  2B1X B;  4N6T A;  1VQN 3;  5JTG A;  3A7M A;  5GON E;  4LSO A;  2VKH A;  2ZM0 A;  1US1 A;  4LGQ A;  4KBM B;  3T0U A;  2VK9 A;  3KIN B;  1RNT A;  1OUN A;  4IE6 A;  1RHL A;  2LKH A;  2CK3 H;  3KVA A;  4ZI7 E;  1X1W A;  3KSE D;  2VB6 A;  3EHZ A;  5LA6 E;  2W0G A;  1UUV B;  1N9J A;  1M62 A;  3GWR A;  5BU4 A;  2WCA A;  2Y73 A;  4IT7 A;  2P05 A;  1KK7 A;  4OVM A;  4N78 D;  3PUX F;  4X2H A;  3VGN A;  4MFR A;  1WMO A;  1TFK A;  1VQO 3;  1U8C B;  3RGA A;  1ROV A;  1N8Q A;  3RGR A;  3EDU A;  1B21 A;  5AQU B;  2C10 A;  4J9A A;  3EQQ B;  1BSA A;  3AEC A;  4QX8 B;  5DAB A;  1AVK A;  1XWM A;  1UK5 A;  2BS2 A;  3IPT A;  4TX5 A;  2K48 A;  5IF6 A;  2DCF A;  1QLB A;  2OOV A;  4UV8 B;  5HEO A;  1BVI A;  3I9W A;  4DO0 A;  3HKC E;  1V57 A;  1OF5 B;  2YDS A;  4EYC A;  2H89 A;  4N6N B;  1HYF A;  1Y01 A;  2E5V A;  1UUS A;  4AI6 A;  3OW2 2;  5HXS A;  4EYY R;  5AQF B;  2Y48 B;  1EKM A;  4QH1 A;  1DET A;  1YGE A;  3HL6 A;  3KFQ C;  3WR2 A;  1W0A A;  3N5L A;  5CGM A;  2I9W A;  5TGN A;  3EE1 A;  2E8I A;  3TLT A;  4DR4 T;  1Q42 A;  3FF2 A;  1TU5 A;  1EEJ A;  3A8Y C;  1OPY A;  3I1A A;  5L3C B;  3F8H A;  4U33 A;  3DZL A;  2LOS A;  1OED B;  4X2O A;  4RZM A;  2ZDJ A;  4KI0 F;  1HNZ T;  4KX6 A;  1I0V A;  3CC7 3;  4C91 A;  1NDO B;  2KND A;  3LSV A;  4TNW A;  4RNZ A;  1HZ1 A;  2K3D A;  2CWU A;  3IEE A;  3NX0 A;  4KFD A;  3MG1 A;  4JLE A;  1IU7 A;  3LTD A;  3PU3 A;  2BZB A;  3GWH A;  5HXE A;  2VVN A;  2W9P A;  2XR8 B;  4CCV A;  2W2C A;  1FGO A;  4BAY B;  1DVC A;  1W7C A;  2UXN B;  2B76 A;  3UL5 A;  4ILB A;  1GY5 A;  1NWW A;  4STD A;  4I43 B;  1VCS A;  4HWC A;  1LOY A;  2YK0 A;  2DI4 A;  4AKR B;  3RIU C;  4YT0 A;  4QH4 A;  2P38 A;  3CNM A;  3L3P A;  2V6X A;  4J5G A;  2CIU A;  3T8U A;  3CCM 3;  3PUV F;  4EZ4 A;  5JRC B;  1N5H A;  3MYT A;  2LSY A;  4HFH A;  1LNH A;  2CHN A;  3MKI A;  1K73 4;  3TLU A;  4GL6 A;  2EHO C;  2HH7 A;  1VQQ A;  3PUQ A;  1X79 A;  4EED A;  2KAA A;  1IT8 A;  4OYJ A;  1RDS A;  4I4T E;  3BNC A;  4YJ3 E;  4AQG A;  3AEE A;  5FL1 A;  5C8Y E;  1DYU A;  4UF0 A;  4U2Y A;  5IEP A;  2LM9 A;  2HPJ A;  4HM5 B;  5AQT B;  1V58 A;  5KP3 A;  2OTL 3;  3CCJ 3;  4OFZ A;  3M65 A;  2BBJ A;  4YHJ A;  3CC2 3;  1XDO A;  3JUM A;  3PS8 A;  3KV5 A;  4H9P C;  4I55 E;  3UU4 A;  2GU1 A;  4YTN A;  3ANW A;  4KFE A;  4M1P A;  1J2B A;  5LGU B;  3OVU A;  1KSI A;  4ZI2 D;  3SWH A;  4IST A;  3G06 A;  4IDZ A;  3NWI A;  3CU3 A;  3ZCI A;  2UUB T;  3C98 B;  1NEK A;  3AE2 A;  3N9L A;  3RC3 A;  4DID B;  5ABG A;  4AKY A;  1C7H A;  4DR2 T;  3R6N A;  3EUH A;  3EJV A;  3N9N A;  5EK2 A;  1VQ6 3;  2KF3 A;  2AXD S;  3EHC A;  3AGN A;  4AQF C;  1N5P A;  4CQI A;  4G2A A;  2AE9 A;  1W6Y A;  4P0B A;  3ZT6 A;  1J1J A;  3LBX A;  2MPK A;  3PUY F;  4IDP A;  5DRV A;  1C54 A;  3SRZ A;  3N9Q A;  2WOH A;  4L7K A;  4GIW A;  2Z7A A;  3FH1 A;  4HM2 B;  4KP3 C;  1M7K A;  2CFD A;  2GBX B;  2YDR A;  2X9W A;  1WCR A;  2XQY A;  1X1U A;  3ZT7 A;  4Q53 A;  2OQE A;  5H6Q B;  1L0V A;  4HYZ A;  2V7M A;  1RGK A;  2IUJ A;  3K63 A;  1S94 A;  5FGO A;  2CFK A;  5LGN B;  4KVH A;  3JVC A;  2J1D G;  4H63 V;  4JEH B;  5FXX A;  3HIG A;  3C4X A;  4MMZ B;  2H7O A;  4G1M B;  2QVA A;  5FVK A;  5LJN A;  4UR9 A;  2W0Q A;  2O9U X;  4HZ9 B;  1EA2 A;  1VQM 3;  3SOL A;  3SED A;  5HXR A;  3E99 A;  4ASK A;  2A2F X;  3TLW A;  2B24 B;  4X1K E;  2CFW A;  4WFO A;  3O9X A;  3ZLI A;  3RKO A;  1MGR A;  3AE6 A;  1K9M 4;  5J1G A;  4ZXL A;  4LFC T;  1EG9 B;  1RRL A;  3BU4 A;  3NXJ A;  4O3V A;  3LYG A;  3IA3 A;  4NPP A;  2WGQ A;  5HAX A;  3EC9 A;  3PUG A;  1GQE A;  5LMU T;  5AQV B;  3AE1 A;  2K0M A;  8CHO A;  1BAO A;  2QYW A;  1GY7 A;  4U13 A;  2E9X C;  4JEU B;  3NUV A;  2HMN B;  3EX9 A;  1K41 A;  4WZX A;  3KZT A;  3KN4 A;  3UT5 E;  1YXR A;  3RKG A;  2A3D A;  3PCS A;  2YKS A;  2VWA A;  4L8P A;  5IG5 A;  1D1C A;  2XQ8 A;  3FZH B;  4UF0 B;  3PUS A;  1EQK A;  2AAD A;  1QAK A;  4CN1 A;  2BHM A;  1BNJ A;  3JC6 C;  3NVO A;  5IG3 A;  2PTF A;  3PDY A;  2XAS B;  1BRK A;  1ZGX A;  2D0U A;  3ROB A;  3CMA 3;  2BMO B;  3MA9 A;  4O4H E;  4PEJ A;  2WB5 A;  3X3X A;  1BAN A;  3LOY A;  3UB1 A;  4KZ1 A;  3ANW B;  5HXC A;  2JQ9 A;  3RIF A;  2WWU A;  1W02 A;  4HM6 B;  3ZMT B;  1BNG A;  4EV6 A;  4KT3 B;  3P4R A;  1UUW B;  4DV5 T;  1A2K A;  3VKH A;  1JBS A;  1YI2 3;  2Z6B A;  3F9S A;  3ONL C;  5C2T A;  1LOX A;  4JI4 T;  1BR4 A;  3KDS E;  2C5K T;  2XGL A;  3OX9 A;  1GS3 A;  3DGN A;  3CCV 3;  5LHI B;  2BT3 A;  1TUH A;  2UU9 T;  3Q2M A;  2WDQ A;  2WU2 A;  4YSZ A;  2P0M A;  3PV0 F;  4DBR A;  2F4Y A;  3AA1 B;  4HZB B;  2W56 A;  2YOE A;  1LOV A;  5LMN T;  1YGW A;  1AVL A;  5L2L A;  5ETW A;  3IJE B;  3TDG A;  1GMP A;  1BRN L;  4EBG A;  5JDN A;  3E22 E;  4HOH A;  1GOV A;  3GN5 A;  1UCU A;  1STF I;  2IIU A;  3BNE A;  2YFL B;  5HEG A;  3DGY A;  4ILU A;  1W01 A;  4FJO A;  1IBM T;  3JAF A;  2QEX 3;  4HTE A;  5DQW A;  2CHC A;  1SUM B;  3G6E 3;  4DKI A;  2XUE A;  4HEA A;  4DV7 T;  1ZV4 X;  3GSP A;  2IYJ A;  2BO9 B;  3H51 A;  2VAS A;  2WS3 A;  4KFF A;  1BR2 A;  1OAC A;  5AQG B;  1RNB A;  3NRX A;  1NU3 A;  3K5T A;  4ZZB A;  5IEO A;  3N9M A;  2XZE A;  2B1E A;  2FXT A;  3O1J A;  1TP6 A;  4B3S T;  3ABV A;  4EYU A;  1B20 A;  1FUW A;  2MAW A;  3DJB A;  2BG9 A;  2XM2 A;  1N36 T;  3ZST A;  1FYS A;  4X1Y E;  4PK4 A;  1V9D A;  3KII A;  1B2M A;  4YFS A;  3U1W A;  5FY7 A;  2IAK A;  1AQZ A;  1B2Z A;  5A0O B;  5CF2 A;  4YJ2 E;  1JZO A;  4MBQ A;  3QOF A;  3N9H A;  3SX1 A;  2XEP A;  3S29 A;  1XNR T;  2SAR A;  3H3A A;  1JBT A;  3TLS A;  3VR8 A;  2W67 A;  5ADX L;  3ZCJ A;  4XBF B;  5AQI B;  3BK9 A;  2M6B A;  2QGS A;  3P4Q A;  3HZP A;  2N9D A;  4X66 T;  3NZQ A;  2XRX B;  2V7K A;  3S67 A;  4LYL B;  4K1V A;  2Z76 A;  1R8I A;  1WQL B;  2V5D A;  2YDQ A;  2BIR A;  1O7H B;  2W2U A;  1ZOY A;  5D83 A;  4CN6 A;  5AQL B;  1DMN A;  2LSJ A;  5LBM A;  1GD3 A;  3RYI E;  3N54 B;  1CHU A;  5LXT E;  3LK2 B;  4JI3 T;  1SIH A;  2CM0 A;  2LEH A;  1D1B A;  4HKV B;  1IQX A;  4WYK A;  1SA0 E;  4DUY T;  2M6I A;  1XMO T;  5AFU L;  2YFJ B;  4H9R C;  3BQL A;  2ZL8 A;  3D5I A;  2HMM B;  3AA6 B;  1HR0 T;  1BRS A;  5G1K A;  3JCF A;  1UI7 A;  2WWV A;  4DR1 T;  3SOY A;  1WRD A;  3MG2 A;  3UQ4 A;  5BMV E;  1BRI A;  2X0L B;  5LC6 A;  3AEA A;  5EK4 A;  3PJA A;  4R9L A;  4HFI A;  5E0O A;  1M90 4;  2JQH A;  1VQ4 3;  4HWD A;  5KDM C;  2BKN A;  5HEU A;  1IDP A;  4EC6 A;  5C3J A;  1CYV A;  3FZM B;  4ILC A;  3DGL A;  4MAL A;  1BNE A;  2IY2 A;  4EAH A;  3LTA A;  2ZHX B;  4GOU A;  3DGO A; 
#chains in the Genus database with same CATH homology
 4WHA A;  2RA1 A;  5IW9 A;  2H7V C;  1O7P B;  1YKE B;  3EN8 A;  1IK3 A;  2CWY A;  3A76 A;  4HM4 B;  5KMG P;  1VQP 3;  2D42 A;  2LJL A;  2PG8 A;  5IEN A;  5KX5 E;  4IGU A;  3WOE B;  1KNZ A;  3G71 3;  1CEW I;  1NO3 A;  1E3R A;  2IC9 A;  5AII A;  3B4P A;  2X51 A;  3WOF B;  1ZKE A;  2XAJ B;  1D0Y A;  3FXE B;  4L8O A;  3BQI A;  2GK9 A;  5FYM A;  3V5S A;  3ZN0 B;  1HU9 A;  3FF0 A;  3WAJ A;  3K9M C;  3NRY A;  4R9K A;  2LHN A;  1JKG A;  2Y8D A;  3TKL B;  3N2K E;  1YJN 3;  4QWN B;  4WW0 A;  4TN7 B;  1IZN B;  1JB5 A;  3B13 A;  3WI3 A;  2XSH B;  3MSO A;  3LML A;  4ZS2 A;  2XAQ B;  3UNL A;  1MNL A;  1FEW A;  3QC9 A;  3OJA A;  2VL8 A;  4CXY A;  3FCS B;  3F57 A;  4K90 B;  3N9P A;  4O4I E;  1LRZ A;  5JDM A;  4UV9 B;  3ZC1 A;  3K0Z A;  5DQV A;  3JUN A;  3Q5X A;  2OA5 A;  3I9Y A;  3NHX A;  5J2T E;  1MOL A;  5AYS C;  2Q07 A;  4R80 A;  5LBQ B;  3EBT A;  4H9Q C;  3S27 A;  4EZH A;  4NUV A;  1IAP A;  3OXA A;  3QRD A;  3O8Y A;  2D2S A;  5FXV A;  1ZO2 A;  3ZJ2 A;  3RPU A;  4BA9 A;  3X42 A;  2CXF A;  2V1D B;  3CWZ B;  4ZI2 C;  2KIN B;  3QUJ A;  4OYK A;  3I0O A;  2OWP A;  3DGM A;  1A2V A;  1ASK A;  5CLK A;  2C11 A;  3D0T A;  3KV6 A;  2E2V A;  2FGT A;  4IPB A;  5CB4 E;  1W2Z A;  1BR0 A;  3MKD A;  3RC8 A;  3MZK B;  2F86 B;  1VRB A;  2QA7 A;  1DMQ A;  2A15 A;  4HM0 B;  5EK3 A;  2CFL A;  1HG5 A;  5TAO A;  2E9X A;  3O4X E;  1IV7 A;  2MF7 A;  1KQS 2;  1N9E A;  3CVR A;  3DUK A;  3N2O A;  1KWI A;  1QMA A;  4CDL A;  1VQ8 3;  4NHF A;  3BQK A;  2ZLY A;  4OUQ A;  2Y6X A;  3MJX A;  1M9G A;  2F98 A;  3KV9 A;  4QX7 B;  2PJQ A;  5HXH A;  1W4N A;  3C4Z A;  1T98 A;  1Y4K A;  4QWT A;  4TV8 E;  2KLQ A;  1QJG A;  4UVA B;  2XAF B;  1D1A A;  1US7 B;  3X40 A;  5JBS A;  1YJW 3;  2NTX A;  2JMH A;  1O7W B;  5L3E B;  2MTQ A;  4X20 E;  3C50 A;  4BTX A;  1VQL 3;  3L0R A;  5JR9 A;  4O8S A;  3KVB A;  4UVC B;  5FY1 A;  2OOV C;  4PW8 A;  5JDH A;  5L3D B;  2ZMA A;  2CWT A;  1E97 A;  2GU3 A;  4V1A v;  3FKA A;  4EOZ B;  5JDL A;  5DRE A;  3WA2 X;  3FXD B;  1RN7 A;  3IF8 B;  2CWV A;  2ES0 A;  1WTH A;  3LZA A;  2V26 A;  2XTL A;  5LGT B;  1U5P A;  3OWY A;  5AIH A;  2W62 A;  1JV2 B;  4UVB B;  4N6L A;  4FMD A;  5LCY A;  5LC7 A;  5KP4 A;  3GAX A;  2V7I A;  3CML A;  3I55 3;  1A90 A;  1D0Z A;  4O4L E;  4ZM8 A;  3ESL A;  3T8N A;  4PJL A;  3J7Y d;  1FMW A;  2Z6E A;  4HVN A;  5FNV E;  3CCL 3;  1E1H B;  2NP9 A;  3ECF A;  3LT9 A;  4HN9 A;  1MMA A;  1U4Q A;  4ISS A;  3UTK A;  1LVF A;  3Q9D A;  4EXR A;  5G2G A;  3O1H A;  1O3X A;  1G96 A;  3FLJ A;  3F7X A;  4LMI A;  4N6U A;  3FBL A;  5JVD E;  3F40 A;  1IV9 A;  1YVB I;  1HX8 A;  2PFV A;  3DY5 A;  1L5G B;  3OKQ A;  2KRT A;  1W5Z A;  1SII A;  2WMN A;  2XSO B;  2D0T A;  3WAK A;  3C51 A;  5FW5 A;  2KZ7 B;  3DTO A;  1IVU A;  2Q9Q C;  1RJO A;  3OYX A;  1DVD A;  3ZN1 B;  2F99 A;  2FNQ A;  1LXE A;  2CLY B;  2X9Y A;  5JDQ A;  3K8P C;  3I0Q A;  4QHO A;  2LSG A;  1OHS A;  5L3F B;  3HKB E;  3C4W A;  1Q86 4;  2STD A;  2ML5 A;  4I50 E;  4BJN A;  3HKE E;  2P0X A;  3CX8 B;  2RSX A;  1NB5 I;  4ANJ A;  4PAG A;  4MEI A;  3LT8 A;  4P0A A;  2KCD A;  3CNX A;  3EF8 A;  1Z1S A;  4HJL B;  1S35 A;  2UXX B;  2N2N A;  2YU1 A;  2BVL A;  1NWM X;  4GYS A;  5JR9 B;  4FMB A;  1MIW A;  3M8C A;  1CUN A;  3FB2 A;  4TZ4 C;  1HFA A;  1QAL A;  1JB2 A;  3CX6 B;  2RP4 A;  4MJD A;  3LBX B;  1O7N B;  3RYC E;  4MHC A;  5BXQ A;  3HI2 A;  1VZZ A;  1S72 3;  2OCT A;  4N6M A;  4O2H A;  3PE0 A;  5JPU A;  3AVS A;  4QXH B;  2Z77 A;  2M67 A;  4HFV A;  3CD6 3;  2D5U A;  2V7J A;  5HYA A;  3L09 A;  1WNH A;  3FSD A;  3UUM A;  1T5Y A;  3Q90 A;  2XHE B;  1OXZ A;  3QK6 A;  4U74 A;  1CQS A;  1JRQ A;  4H63 H;  4G63 A;  4CXW A;  1TFO A;  4HGA A;  2SBL A;  2WMO A;  2LE8 A;  4ORL A;  2X68 A;  3KFW X;  1YW0 A;  3KBU A;  5L3G B;  3CKD A;  4XDV A;  3G16 A;  2INX A;  2L9Q A;  2QIY A;  3SS1 A;  3F2E A;  1V74 A;  5LJM A;  4P09 A;  3NV0 A;  1OHO A;  1IJ5 A;  3BLZ A;  4C90 A;  3CME 3;  2NTY A;  5FP3 A;  3N2G E;  2LQV A;  3ALA A;  1PU4 A;  3CXC 2;  1SPU A;  1AJ3 A;  3J7Y q;  4FR9 A;  2C0S A;  1GD4 A;  4RBN A;  4H9N C;  2CA5 A;  3ZMU B;  3LFM A;  3HII A;  3K7C A;  3AMO A;  2XFS A;  3QK9 A;  3P8C D;  5CK6 A;  1VQ5 3;  4WBN E;  5JH7 E;  3MHE A;  3SVA A;  5AYR B;  4OHF A;  3UJM A;  2HML B;  1WYC A;  3MXZ A;  2W03 A;  4OK0 A;  1IQ8 A;  2P9B A;  2ZM2 A;  3RYF E;  2JRK A;  3FG4 A;  2KXG A;  4X1I E;  2NOX A;  4U72 A;  4ZI3 C;  2K54 A;  1NAF A;  2KMF A;  3PTR B;  4UEL A;  3KE7 A;  4MMY B;  3ZYL A;  4CI2 B;  5AIF A;  2K5B B;  1W6G A;  3OV4 A;  3CC4 3;  2LHR A;  5IHY A;  1G8X A;  3AA7 B;  3IBP A;  3OBV E;  1ISK A;  1YHQ 3;  3SXX A;  2N1G A;  5EEO A;  1TIJ A;  3WOD G;  3ZMV B;  4GK0 E;  2IC6 A;  3K3O A;  1VQK 3;  2VKD A;  5KP1 A;  5F3J A;  1FA3 A;  3UUN A;  2W56 B;  3FGY A;  3I0Y A;  4K61 A;  2WM9 A;  1ULI B;  5BVB A;  3K3N A;  2CWO A;  3LK3 B;  2YFI B;  4GYR A;  2WOF A;  4O2B E;  3N8B A;  4L9I A;  1ZX2 A;  3GN5 B;  1HTJ F;  3T8O A;  5LP6 E;  2GXF A;  4PFP A;  3CQC B;  7STD A;  1MMD A;  4FMC A;  1Q81 4;  3X41 A;  3NZP A;  3UL6 A;  2JQ5 A;  2G0U A;  2W00 A;  2XAG B;  1MMN A;  3CCR 3;  3PCR A;  5J2U E;  6STD A;  2HMO B;  2HMK B;  4PK6 A;  3NQY A;  2EHO A;  1WMN A;  2RFR A;  3FG1 A;  3FBZ A;  3AB3 B;  3GZR A;  3ETV A;  5JRC A;  4UXN B;  4BTW A;  5M4Y A;  3ZPO A;  2DWK A;  2X9X A;  1EZ3 A;  2HMJ B;  1ZEE A;  4R4K A;  2P09 A;  4YLH A;  2GEX A;  5CA1 E;  2V1L A;  1R4C A;  1AV4 A;  2ZM8 A;  3WDG B;  2X9H A;  3OWU A;  3CPW 2;  3FZW A;  3HX8 A;  1MIV A;  2WBL A;  2CXD A;  4IHJ E;  3ZMS B;  2W61 A;  3CQX C;  1QUU A;  3Q5W A;  1BUQ A;  5JRE A;  3UUL A;  3MPH A;  3DM8 A;  3S28 A;  2XF3 A;  5FMN A;  5DJQ C;  1JB4 A;  2W9Q A;  3ONX A;  2IW5 B;  1RRH A;  1D6U A;  2CXL A;  1UI8 A;  2XFT A;  1B7T A;  2W63 A;  3LXU X;  4AKZ A;  1HCI A;  3VSY A;  4EIW A;  2W6J H;  2YX9 A;  5I97 A;  2X66 A;  4AQF A;  3A5X A;  5LHG B;  2W04 A;  4HM7 B;  1UW1 A;  2IA7 A;  2JJ9 A;  4F6R C;  1O7G B;  3GZX B;  4WYK B;  4DBQ A;  1OGZ A;  2CFG A;  3NM2 A;  4BJM A;  5LOV E;  2LSI A;  3H37 A;  2BVM A;  3PUA A;  3RYH E;  3MWZ A;  3BB9 A;  4FCZ A;  3O1I A;  5H6R B;  3RDE A;  3HR0 A;  3V92 A;  1W2B 2;  4N3V A;  4EXT A;  1Q82 4;  4K1U A;  3LTB A;  2NW9 A;  3PZW A;  3IHR A;  5IG0 A;  4WBO A;  5CXO A;  3NM7 A;  4Z8X A;  3B8L A;  3HA4 A;  3JUO A;  2XAH B;  3ETU A;  3PU8 A;  4XM4 A;  2E2T A;  5AEU B;  3X3Y A;  4AKG A;  2NWB A;  1U5O A;  1NJI 4;  3UFE A;  4PJM A;  2MYS A;  2RCD A;  4TX4 A;  2LYX A;  5EZY E;  5IG4 A;  1FGT A;  4N6V 0;  4MMX B;  4I4K A;  5AI1 A;  2HPL A;  4CI1 B;  3F14 A;  2LT3 A;  1ROA A;  3UUX B;  3CQG B;  1OGX A;  3F31 A;  1HS7 A;  3N9O A;  3G0K A;  2Q9Q A;  4JUY A;  4XBX A;  2EHO B;  5JQG E;  1QVG 2;  4ERR A;  1W6C A;  4HKA A;  4WP5 A;  3G8Z A;  2BMR B;  2JDI H;  5FXW A;  4H61 A;  1OCV A;  3FG3 A;  4FCJ A;  3CPZ A;  3FHN A;  4FI5 A;  3AAI A;  4IE5 A;  1D0X A;  1WMP A;  1KC8 4;  2ODU A;  4PNI A;  1IVW A;  4GB5 A;  1JKG B;  3KKG A;  4AEQ A;  3BNB A;  3WMD A;  4O02 B;  3S4U A;  5L3B B;  3U3I A;  4UEM A;  4ZHQ E;  5CA0 E;  1JN5 A;  3PXM A;  5ELJ A;  3GMI A;  1QVF 2;  1OWA A;  2BMQ B;  3KV4 A;  3VKG A;  2CG0 A;  2CMR A;  1YKH B;  4UIG A;  5LNK A;  1RKY A;  4HM1 B;  4HBR A;  3GZY B;  4AXP A;  3Q1C A;  2EHO D;  4CXX A;  2C5I T;  1IJ6 A;  3H3H A;  3KSP A;  1M1X B;  3ZC0 A;  3I56 3;  1YIT 3;  2CCQ A;  1AR0 A;  2K24 A;  2K9A A;  4HM8 B;  3R84 B;  4IE7 A;  4PJJ A;  2GEY A;  4AKI A;  3GZB A;  4AKL A;  4O2A E;  3J9X 1;  3OYZ A;  2ODV A;  2YIN A;  4N6O B;  2WAU A;  1MNE A;  1JNQ A;  1SJW A;  1FMV A;  3F7S A;  5EVH A;  4FCM A;  1WR6 A;  3AVR A;  4AKH A;  1SHZ C;  4XZC A;  4IE0 A;  4ZOL E;  1D6Y A;  4XBY A;  4JRF A;  4ADZ A;  1WLX A;  2GBW B;  3WA3 A;  1D6Z A;  3ZEF B;  5STD A;  3DMC A;  4K0U A;  4PJN A;  3LH4 A;  4RNY A;  3VF1 A;  1FGR A;  4EV2 A;  2E9X B;  5A1L A;  3PGB A;  2Q9Q B;  1QSD A;  3SOA A;  3BND A;  3DXO A;  2V7L A;  4XB5 A;  1UX5 A;  3CCE 3;  1SQW A;  5JDG A;  2QGU A;  4HM3 B;  3VU7 H;  2CLY C;  2LOP A;  5EQL A;  2R4I A;  5HWX A;  3JUP A;  3X3Z A;  4IIA A;  5IER A;  5HGR A;  5F8P A;  2O3O A;  3GA8 A;  1YD8 G;  4J8T A;  4J2C A;  2WSS V;  1OH0 A;  2KXP B;  4E7S A;  2XH9 A;  5AEW B;  1E3V A;  1FIO A;  3ER7 A;  5LYJ E;  3DP7 A;  5JDF A;  2C5J A;  1Q40 A;  3CCS 3;  3LTC A;  3AAA B;  2ML6 A;  3W15 B;  4LEH A;  2CEA A;  3C64 A;  4DMV A;  1K28 A;  4O4J E;  3AA0 B;  4WNK A;  1GYB A;  3ZJ1 A;  1IT7 A;  3EB8 A;  2X67 A;  1JN5 B;  3GRD A;  1ULJ B;  1O7M B;  1OHP A;  5JR9 C;  4DND A;  2DHR A;  4XAX B;  4JF8 A;  3LJC A;  4WWU C;  1Z0P A;  1GY6 A;  2QA4 3;  1YJ9 3;  1W00 A;  3HI7 A;  3AAE B;  3F8X A;  2LSK A;  3U97 A;  2E9X D;  4E7Z A;  1QAF A;  4H3U A;  2Q9Q D;  2ACX A;  5IYZ E;  3RX6 A;  5JPP A;  3V5U A;  1LVN A;  2DLR A;  3V98 A;  2OQE C;  2KT9 A;  2VKO A;  1H7C A;  5FY0 A;  2L4V A;  4NRE A;  2JPF A;  3CPO A;  1LKX A;  2DWG A;  3HK4 A;  3JC6 D;  3IMA B;  1UX4 A;  3D3L A;  4XBT A;  3SLU A;  2CC3 A;  2PBI A;  3LG7 A;  1S5A A;  4KMC A;  3RRW A;  1MIY A;  4H9S E;  1IQY A;  2VKJ A;  2H3R A;  2A72 A;  2NW7 A;  4FMA A;  3S5C A;  5FXZ A;  2WGO A;  2L8K A;  2PZV A;  1MND A;  5LG4 A;  4GK5 E;  1VQ7 3;  3P7I A;  2M7O A;  2CW9 A;  1HF8 A;  2JQQ A;  2D1W A;  3MG3 A;  3NBR A;  3JUQ A;  1FGM A;  1HG2 A;  4EV5 A;  4IIJ E;  2MC8 A;  1NB3 I;  3E0Z A;  2SPC A;  2IMJ A;  1Y64 B;  3K3Q C;  1VOM A;  4LZI A;  4DVD A;  2BDE A;  5ELU A;  3NQZ A;  4DMW A;  3OWS A;  3D9R A;  4CZZ B;  3LK4 2;  3Q2P A;  5D81 A;  3B4O A;  5AIG A;  1G73 A;  3VHL A;  1PFP A;  4EB6 E;  1KD1 4;  3MK7 C;  1MMG A;  4PK5 A;  1IVX A;  1Q40 B;  4TV9 E;  2RGQ A;  2MBG A;  2CKF B;  3NBB A;  2PNC A;  3EDV A;  3PYJ A;  4ZS3 A;  2BNG A;  3NBX X;  1OF5 A;  3U78 A;  4BTY A;  1JJ2 2;  2I59 A;  4CI3 B;  3EBY A;  1A67 A;  1STD A;  1WYB A;  2Y74 A;  1CYU A;  2MOZ A;  2KWI B;  3CCU 3;  3KBT A;  4B6X A;  1VQ9 3;  3V99 A;  3G4S 3;  3EVY A;  2L3L A;  3PUR A;  3HKD E;  4NUU A;  2NW8 A;  3RH3 A;  4XDW A;  1M1K 4;  3NBJ A;  2IUK A;  3ZMZ B;  2CH9 A;  2WO0 A;  1IVV A;  5LHH B;  1N8R 4;  1FGQ A;  1Q7Y 4;  2CE7 A;  3ZYK A;  3CCQ 3;  4TUY E;  4HE8 A;  3RRC A;  3EN1 B;  2YU2 A;  2XGN A;  2YEV C;  4A56 A;  3STD A;  3NV0 B;  1HKX A;  4H9O C;  4L0R A;  1ZHC A;  4R1K A;  2OTJ 3;  2DNX A;  2UX0 A;  3B57 A;  2JMK A;  1LVK A;  4ZI3 D;  3ZYM A;  5D82 A;  3B7C A;  1YIJ 3;  3CX7 B;  1K8A 4;  1DMM A;  4QKN A;  2KWH A;  4L5G A;  1BR1 A;  3MAC A;  4IE4 A;  3E08 A;  4QXC B;  5CF1 A;  4MLK A;  5HWY A;  2E2U A;  4QXB B;  4KUM B;  2CG1 A;  3AMO B;  4PFO A;  1F8N A;  2B1X B;  4N6T A;  1VQN 3;  5GON E;  4LSO A;  2VKH A;  2ZM0 A;  1US1 A;  4LGQ A;  4KBM B;  3T0U A;  2VK9 A;  3KIN B;  1OUN A;  4IE6 A;  2CK3 H;  3KVA A;  4ZI7 E;  3KSE D;  2VB6 A;  5LA6 E;  1UUV B;  2W0G A;  1N9J A;  3GWR A;  2Y73 A;  4IT7 A;  2P05 A;  1KK7 A;  4OVM A;  4N78 D;  4X2H A;  3VGN A;  4MFR A;  1WMO A;  1TFK A;  1VQO 3;  1U8C B;  3RGA A;  1ROV A;  1N8Q A;  3RGR A;  3EDU A;  2C10 A;  4J9A A;  3EQQ B;  4QX8 B;  5DAB A;  1AVK A;  3IPT A;  4TX5 A;  2K48 A;  5IF6 A;  2DCF A;  2OOV A;  4UV8 B;  3I9W A;  4DO0 A;  3HKC E;  1OF5 B;  4EYC A;  4N6N B;  4AI6 A;  3OW2 2;  5HXS A;  4EYY R;  1EKM A;  2Y48 B;  1YGE A;  3HL6 A;  3KFQ C;  3N5L A;  2I9W A;  5TGN A;  3EE1 A;  2E8I A;  1Q42 A;  3FF2 A;  1TU5 A;  1OPY A;  3I1A A;  5L3C B;  3F8H A;  3DZL A;  2LOS A;  4X2O A;  4RZM A;  2ZDJ A;  3CC7 3;  4C91 A;  1NDO B;  2KND A;  4RNZ A;  2CWU A;  3IEE A;  3NX0 A;  4KFD A;  3MG1 A;  4JLE A;  1IU7 A;  3LTD A;  3PU3 A;  2BZB A;  3GWH A;  5HXE A;  2W9P A;  2XR8 B;  4CCV A;  2W2C A;  1FGO A;  4BAY B;  1DVC A;  1W7C A;  2UXN B;  3UL5 A;  1GY5 A;  1NWW A;  4STD A;  4I43 B;  2YK0 A;  2DI4 A;  4AKR B;  2P38 A;  3CNM A;  3L3P A;  2CIU A;  3T8U A;  3CCM 3;  5JRC B;  4EZ4 A;  1N5H A;  3MYT A;  2LSY A;  1LNH A;  3MKI A;  1K73 4;  4GL6 A;  2EHO C;  2HH7 A;  3PUQ A;  1X79 A;  1IT8 A;  4OYJ A;  4I4T E;  3BNC A;  4YJ3 E;  4AQG A;  5C8Y E;  1DYU A;  4UF0 A;  5IEP A;  2LM9 A;  2HPJ A;  4HM5 B;  5KP3 A;  2OTL 3;  3CCJ 3;  4OFZ A;  3M65 A;  4YHJ A;  3CC2 3;  3JUM A;  3PS8 A;  3KV5 A;  4H9P C;  4I55 E;  2GU1 A;  3ANW A;  4KFE A;  4M1P A;  1J2B A;  5LGU B;  1KSI A;  4ZI2 D;  3SWH A;  4IST A;  4IDZ A;  3CU3 A;  3ZCI A;  3C98 B;  3N9L A;  3RC3 A;  4AKY A;  1C7H A;  3R6N A;  3EUH A;  3EJV A;  3N9N A;  5EK2 A;  1VQ6 3;  3EHC A;  4AQF C;  1N5P A;  4CQI A;  4G2A A;  1W6Y A;  4P0B A;  3LBX A;  5DRV A;  3SRZ A;  3N9Q A;  2WOH A;  4L7K A;  4GIW A;  2Z7A A;  3FH1 A;  4HM2 B;  4KP3 C;  2CFD A;  2GBX B;  2X9W A;  2XQY A;  4Q53 A;  2OQE A;  5H6Q B;  4HYZ A;  2V7M A;  2IUJ A;  3K63 A;  1S94 A;  5FGO A;  2CFK A;  5LGN B;  4KVH A;  3JVC A;  2J1D G;  4H63 V;  4JEH B;  5FXX A;  3HIG A;  3C4X A;  4MMZ B;  2H7O A;  4G1M B;  5LJN A;  2W0Q A;  2O9U X;  4HZ9 B;  1EA2 A;  1VQM 3;  3SOL A;  3SED A;  5HXR A;  3E99 A;  4ASK A;  2A2F X;  2CFW A;  2B24 B;  4X1K E;  4WFO A;  3O9X A;  3ZLI A;  3RKO A;  1K9M 4;  5J1G A;  1EG9 B;  1RRL A;  3NXJ A;  4O3V A;  3LYG A;  2WGQ A;  5HAX A;  3EC9 A;  3PUG A;  2K0M A;  8CHO A;  1GY7 A;  4U13 A;  2E9X C;  4JEU B;  3NUV A;  2HMN B;  3EX9 A;  1K41 A;  3KZT A;  3KN4 A;  3UT5 E;  2A3D A;  3PCS A;  2VWA A;  4L8P A;  5IG5 A;  1D1C A;  4UF0 B;  3PUS A;  1EQK A;  1QAK A;  2BHM A;  3JC6 C;  5IG3 A;  3PDY A;  2XAS B;  2D0U A;  3ROB A;  3CMA 3;  2BMO B;  3MA9 A;  4O4H E;  4PEJ A;  3X3X A;  3LOY A;  3UB1 A;  4KZ1 A;  3ANW B;  5HXC A;  2WWU A;  1W02 A;  4HM6 B;  3ZMT B;  1UUW B;  1A2K A;  3VKH A;  1YI2 3;  2Z6B A;  3F9S A;  1LOX A;  1BR4 A;  3KDS E;  2C5K T;  2XGL A;  3OX9 A;  1GS3 A;  3DGN A;  3CCV 3;  5LHI B;  2BT3 A;  1TUH A;  3Q2M A;  2P0M A;  4DBR A;  3AA1 B;  4HZB B;  2W56 A;  1AVL A;  5L2L A;  5ETW A;  3IJE B;  3TDG A;  4EBG A;  5JDN A;  3E22 E;  3GN5 A;  1UCU A;  1STF I;  3BNE A;  2YFL B;  4ILU A;  1W01 A;  4FJO A;  2QEX 3;  4HTE A;  5DQW A;  2CHC A;  3G6E 3;  2XUE A;  4HEA A;  1ZV4 X;  2BO9 B;  3H51 A;  2VAS A;  4KFF A;  1BR2 A;  1OAC A;  3NRX A;  1NU3 A;  3K5T A;  5IEO A;  3N9M A;  2B1E A;  2FXT A;  3O1J A;  1TP6 A;  4EYU A;  1FUW A;  3DJB A;  4X1Y E;  4PK4 A;  1V9D A;  3KII A;  4YFS A;  3U1W A;  5FY7 A;  2IAK A;  5A0O B;  5CF2 A;  4YJ2 E;  4MBQ A;  3N9H A;  3SX1 A;  2XEP A;  3S29 A;  3H3A A;  5ADX L;  3ZCJ A;  4XBF B;  3BK9 A;  2QGS A;  3HZP A;  2N9D A;  3NZQ A;  2XRX B;  2V7K A;  3S67 A;  4K1V A;  2Z76 A;  1WQL B;  1O7H B;  5D83 A;  1DMN A;  2LSJ A;  5LBM A;  1GD3 A;  3RYI E;  3N54 B;  5LXT E;  3LK2 B;  1SIH A;  2CM0 A;  2LEH A;  1D1B A;  4HKV B;  1IQX A;  4WYK A;  1SA0 E;  5AFU L;  2YFJ B;  4H9R C;  3BQL A;  2ZL8 A;  2HMM B;  3AA6 B;  1UI7 A;  3SOY A;  1WRD A;  3MG2 A;  5BMV E;  2X0L B;  5LC6 A;  5EK4 A;  4R9L A;  5E0O A;  1M90 4;  1VQ4 3;  5KDM C;  1IDP A;  4EC6 A;  1CYV A;  3DGL A;  4MAL A;  4EAH A;  3LTA A;  4GOU A;  3DGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...