4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
1JBTA 3FXDB 4LMLA 3KFWX 2FUPA 3F31A 3OXAA 3AXJA 3CCV3 2CW9A 2VL0A 1FJGT 1XNRT 3CVRA 2Y73A 4EEDA 3RDEA 4BU4A 2WGOA 4AKLA 3FZFB 1JRQA 2CG0A 2M6IA 1W7CA 4MEIA 3K5TA 5LXTE 3TDGA 1UCLA 1M1K4 3VKHA 3URPA 2WDRA 2PJQA 2LE8A 2W56A 2CBIA 3F57A 1NB3I 1EQKA 1UURA 5IYZE 5TGNA 3N8BA 4FJOA 1G8XA 4QH1A 4PK5A 1BNFA 3LG7A 3AA7B 1B7TA 2H89A 2R4IA 3MKDA 1B3SA 2B1XB 2F4VT 5E0OA 4HM6B 3CC73 1UGHI 3SYUA 3HKDE 2F5WA 4X64T 5JQGE 2BKNA 3X41A 5J2UE 2H7VC 1MGWA 4ZI3C 1YKHB 3CX6B 1HNWT 1UGOA 2NTXA 4H9OC 4XAXB 4JLEA 2Z6BA 4IL9A 2CWUA 1V74A 1U5PA 4OX9T 1OEDE 1YXRA 1FGMA 1VQL3 3X40A 3LYGA 3OPCA 4IT4A 3AA6B 2CMRA 3Q9DA 2H0HA 1MMAA 4U3CA 1UX4A 3AE4A 2V7KA 1HKXA 4JF8A 1W09A 3S29A 2WCAA 2V6YA 5HXHA 4TUYE 6GSPA 1KNRA 5IF6A 3FG4A 2W61A 4GSPA 4LMKA 2ODUA 1OEDA 3UU4A 1X79A 4XBFB 1IV7A 4AIUA 1Q42A 4DR2T 5LBQB 2FNQA 1WQLB 4ZM8A 2LRLA 1X1UA 3JADA 2HMNB 5IEPA 1YNVX 1UGIA 3WOEB 3F8HA 5ELJA 1RGGA 2W63A 3R84B 3EJVA 2W0GA 1Q864 2X9XA 2WBLA 5FXXA 3B4OA 3RX6A 3LK3B 2WWVA 3VU7H 5TAOA 3CWZB 1MGRA 4XBTA 2XSHB 3ZMSB 2QGUA 1HG5A 4DR1T 1A2KA 2IAKA 2VASA 4JV5T 3PU8A 2UX0A 3B13A 1CHUA 2ZDJA 4Z90A 5IG0A 5FY7A 3F14A 3N2KE 2VL8A 1XNQT 3FF2A 4EC6A 5C8YE 2DWKA 4LMIA 1U5OA 5JPPA 5L4HA 3CD63 1ZV4X 3LJCA 2J1DG 3OTOT 2QGSA 6RNTA 4YY3T 3DGMA 4GK5E 4HFIA 5L3CB 2K9AA 3T1HT 1QUUA 1UCJA 1X9BA 2BG9C 4JI7T 3AAIA 2X0LB 4JRFA 1JJ22 3DGLA 2VVSA 2KF6A 2XY8B 4O4JE 4U72A 4HFDA 4N3VA 4HM0B 3ZMTB 3RGAA 3RYCE 1OWAA 2F56A 2BG9B 2A15A 3Q3FA 5LA6E 4HWFA 1YI23 3NZQA 4PJLA 1GSPA 5AEWB 8CHOA 1YJN3 1JNZA 4FMCA 4ILBA 4UEMA 2UXNB 5CA1E 3MG3A 3PGBA 3EHCA 3K9MC 4JEHB 4HAAA 3W15B 1JKGB 1WNHA 5JRCA 2WB5A 2WZHA 3C64A 1GY6A 5AQMB 4YTNA 3DGNA 1N9JA 2D42A 5IEOA 1US1A 3B57A 4IE6A 1NWMX 2D0UA 4UXNB 1IT8A 2CEAA 2R6GF 3MSOA 2CBJA 3GN5A 1FEWA 3ZYLA 4YJ3E 3IEEA 1GY7A 4CXYA 1IK3A 1LOXA 3O1IA 4EYUA 2IA7A 4GB5A 3ZCIA 4ERRA 5IENA 1J5ET 4TWDA 2IHR1 5AQRB 5L3DB 4MMYB 1Q40A 3ZFZA 2LSJA 1KK7A 2PTFA 3NKZA 1OHPA 3ECFA 3PCSA 1UUSA 5DABA 5JR9C 4WW0A 4XB5A 4O2AE 5FXWA 3C50A 3AHWA 4K0UA 4NXMT 3DTOA 1VQ83 3KCHA 1HNXT 4PW8A 1D6YA 2W9QA 3AVRA 4ZS3A 1JB5A 5JR9B 5DJQC 3GSPA 2NOXA 4J5GA 2K5BB 4NPPA 1FW7A 1RCLA 5JDGA 4KT3B 1A90A 3E22E 2BKOA 1GMQA 3ABVA 4I50E 4N6MA 1WMOA 5JDHA 3AHSA 4PFOA 3SRZA 2V7MA 1Z1SA 2VWAA 3KSPA 3BK9A 3UFEA 1JBRA 3HR0A 4AQYT 4Z91A 1DMMA 5CGMA 2E9XA 3ESLA 1R4YA 4JUYA 2SPCA 5L47A 1VCTA 2XPKA 3B7CA 2I59A 2XQ4A 1K9M4 2BS4A 2WZIA 2P9BA 2LHNA 3AXJB 5ABGA 3PZWA 4H61A 1LOWA 4EOZB 1WMNA 1TTOA 1FYSA 3DJBA 3MHEA 2CFDA 4R1KA 4A5XA 4IT7A 3F40A 2WOHA 4UR9A 1VQ93 2HMOB 2WU5A 5FVKA 1X1XA 3A5XA 3MK7C 2AE9A 1TP6A 1GD4A 3WHOA 3VR9A 2CFGA 3NUVA 2JQHA 3JAFA 1HFAA 1JNRA 4N6TA 1BSEA 3B5MA 3MA9A 1JN5B 2QRXA 4OFZA 4CI3B 1T8BA 2D1WA 2XQ8A 1LQMB 1HS7A 1UK5A 1D6UA 4QX8B 4KFDA 4OYJA 5LHGB 2JQ5A 2F4YA 3QK9A 1RLSA 1W00A 4HEAA 2YDRA 3ETUA 3AE1A 3AE8A 3CIRA 2BKPA 3OX9A 3VF1A 4IREA 5JBSA 4HZBB 2W9PA 3RYFE 3G06A 4DV5T 3WAKA 3UT5E 4L7KA 5F3JA 2K3WA 3EI0A 4X65T 4KHZF 4NHFA 1Y01A 3PS8A 1YIJ3 5JDLA 3QB5K 2IIUA 4ZHQE 5JTGA 2KT9A 1O7PB 3O8YA 2CFKA 1N34T 4JI1T 4KMCA 4QKNA 1MNLA 4HZ9B 3WOFB 4N6V0 2IUJA 2QA43 4TZ4C 3WA3A 3N9LA 2M6BA 3V99A 3HOHA 2H0GA 5KP3A 4V1Av 1VQN3 3AE6A 1LVFA 3JC6D 5LJMA 2BMQB 2V6YB 3BQKA 4QHOA 4DIDB 4E7ZA 4N6OB 5FXZA 1NO3A 4P1NA 3KSED 3FZHB 2YKSA 4FMAA 1B21A 1ZOYA 5LJNA 3ZPOA 1I2EA 1QAKA 2ZM8A 4OHFA 1BSDA 5FL1A 3NBJA 4PJNA 1OGXA 1SUMB 3KV6A 1N32T 3IMAB 3HKCE 2YFLB 3H3AA 3O1JA 3JVCA 3PJAA 3Q2PA 3C51A 4DV2T 1IJ5A 1NJI4 1QVF2 4CQIA 1Q7Y4 2KLQA 2OQEC 3F7XA 5GSPA 3D79A 4CZZB 4YHHT 1LQGC 4YLHA 3DM8A 4KZ1A 1ULIB 3AB3B 3UQ7A 4B3TT 3CX7B 2QA7A 1WLXA 4I0UA 2XHEB 2WQYA 1IVXA 3HIGA 1IJ6A 4HM4B 2XM2A 1HX1B 2BG9E 1UCIA 1D0YA 4FCMA 4LFBT 3MPHA 4R9LA 2KWIB 4R9KA 1MWTA 4UV8B 1I2GA 3B8LA 5AQIB 2X0YA 3M8CA 3IF8B 3OYZA 1FUSA 5AQJB 5KDMC 2F86B 1KSIA 4ZEYA 3L0RA 3AE2A 2NW7A 3N9NA 4I5QA 2AXDS 5AQVB 3A8YC 1OHOA 1ULJB 3I0OA 5HWXA 3HX8A 3ZN0B 1MMDA 2BG9A 1O7WB 2P0XA 1BSBA 2L3LA 2FJAA 3RGRA 3C4XA 1BR1A 3HA4A 2UGIA 5AQSB 4ZI3D 1FUWA 4TWFA 2KCDA 2JMHA 2RPAA 1IVVA 5G2GA 2VVNA 3L09A 3RKGA 3MZKB 3FG3A 4EV6A 1T2IA 1KD14 1E3VA 2LOPA 1RGKA 4QXHB 5DREA 1SARA 3FLJA 3O4XE 2I6HA 2E2AA 4DR3T 2KXPB 5ADXL 3HK4A 4IE5A 3T8OA 4B3RT 3NWIA 1S35A 2LOSA 5ABFB 2B24B 1WYBA 4Q53A 5H6RB 4WWUC 2DNXA 2L4VA 3J7Yq 4DMWA 2LT3A 5BXQA 2OTL3 1YW0A 2DHRA 1Q824 1G73A 2P38A 1VQ63 3NM7A 4N6LA 3BIRA 3AEBA 3DP7A 4FI5A 3HKEE 3GN5B 5ABEA 3PV0F 1XDOA 1EA2A 4P0BA 4X2HA 5HEGA 1EZ3A 1S5AA 5LHHB 3CX8B 1BVIA 1LRAA 4BTYA 5LYJE 1OHSA 1LOVA 3T8NA 1QLBA 2LLYA 3SEDA 3NX0A 4ZS2A 1KQS2 5HEJA 1YGWA 3DH2A 4HM3B 3PJAJ 2CFLA 5IG4A 1Q40B 3FG1A 4HFEA 4IPBA 1I8VA 1EUIC 3LZAA 1BRGA 3IHRA 5JR9A 5HEOA 2HPJA 3DUKA 3LXUX 5ELUA 4KUMB 3TLUA 3DY5A 2UXBT 1GY5A 5CF1A 2K3DA 2V7IA 4JI8T 4CI1B 1BNRA 4X66T 1FMWA 5F8PA 3CC23 4UIGA 4AISA 4HWCA 1GMRA 1MMGA 2M67A 4MBQA 2XUEA 2E9XC 4QWNB 3UNLA 4DV0T 4U74A 1IYYA 5AQNB 5HXCA 5C2TA 1TRQA 3E08A 3WI3A 1MWUA 2YN6A 1ASKA 2E9XB 1Z0PA 3ZMVB 3LH4A 2RP4A 3Q5WA 2PNCA 1G02A 1PU4A 1YKEB 4L0RA 3UU6A 1BOXA 2KF3A 1X1YA 2W6JH 4RNYA 2C11A 4YT0A 2DWGA 4B3ST 4AKRB 1WYCA 2LM9A 2Z7AA 4OK0A 3V5UA 3I1AA 4DR5T 3G16A 1JN5A 4WP5A 3X3YA 5AYSC 3DGYA 2NW8A 2XSAA 3ZLIA 4O2BE 5HYAA 3H37A 5LGTB 3ZCJA 1KC84 4U2ZA 5L3FB 1BAOA 1DMQA 2J47A 1CUNA 4DV6T 5JDNA 1STDA 3KZTA 3UJMA 1UI7A 1YQ4A 1U8CB 1IVWA 3U1WA 1OF5A 4AKHA 3LTDA 1TJDA 3CU3A 5FKYA 2IC9A 2C4BA 3AEEA 1LNIA 1T98A 4EYCA 2QEX3 3JUNA 3UUMA 1WMPA 1K41A 4PJJA 1I2FA 3QC9A 3EF8A 1BRKA 1I0XA 5AEUB 5BIRA 3ZMUB 5AFUL 3KBTA 3MYTA 1T5YA 1MWRA 2BT3A 3WMDA 2DLRA 3N9HA 2GXFA 1AR0A 2YX9A 4TNWA 1EG9B 1I70A 3ER7A 3CCS3 4KX6A 4UF0B 1RTUA 3J9X1 2CHOA 3I9YA 4B3MT 5CLKA 2WWUA 4DR4T 1N9EA 2MAWA 3LTAA 3QOFA 2RFRA 1STFI 4K61A 1SPUA 1I3FA 1MWSA 3P8CD 2Q07A 4KFFA 2XSBA 5KX5E 3AGOA 2XFSA 1CH0A 3FB2A 3HI2A 3V98A 1WR0A 3L39A 3FZWA 1JZOA 2CM0A 5A1LA 2WGQA 1O7NB 2Z76A 1ZKEA 5AQKB 2UUAT 1FGQA 4GHOA 3RI5A 4H9RC 2Y74A 4HKAA 1XZYA 3EDUA 3KV5A 4P09A 4HM7B 4WNKA 5AIIA 4YTMA 3N9OA 1GD3A 2XQ7A 2J4GA 4B6XA 2OQEA 3TLTA 4MLKA 2EHOC 3EQQB 3UTKA 4ORLA 2YFIB 3AE9A 3GMIA 3CCQ3 3F7SA 1VQK3 2SBLA 5DRVA 3HIIA 5ETWA 3SFEA 3S67A 3VHLA 4K1UA 3P4QA 2EHOB 1XMOT 1TU5A 3EBTA 2A9UA 3TKLB 1IBMT 1K28A 3P4SA 5KP4A 1R8IA 3U78A 3HL6A 3SLUA 1RNTA 3AE7A 2K0MA 4BAYB 1BUQA 4UV9B 3PUXF 3FZLB 1BNIA 1Y4KA 1XDPA 2ES0A 5CA0E 1B2XA 1Q814 4JI0T 1YHQ3 4U31A 5FVLA 3ROBA 5M4YA 3V5SA 5JREA 4EV2A 2X66A 3PU3A 1TFKA 1RRLA 4H3UA 4JI6T 2LKHA 5KXJA 2CG1A 3A5EA 4CXWA 4EXRA 4F6RC 2IC6A 4L9IA 1NNVA 3D5IA 5D81A 1SHZC 2V7JA 4I4TE 4QXCB 4MMXB 4QX7B 3CMLA 1UCKA 1WFDA 3LSVA 4N6UA 1RJOA 5ABFA 4O2HA 3SOYA 2BU4A 2BS3A 1OH0A 3AAAB 3CKDA 2P09A 1XWMA 3RC8A 3AVSA 3K63A 2C5KT 2CHNA 4CDLA 1XMQT 3ZG0A 5AQQB 3UUNA 1KNZA 2WO0A 3KVAA 3UUXB 1GOUA 4CN4A 1Q7HA 1IDPA 2CH9A 4HM1B 2OA5A 3HKBE 1VRBA 3LK42 3PE0A 4PAGA 2A72A 1O7HB 4A56A 5LG3A 4LFAT 1GOVA 4LF8T 3LDQB 3BLZA 2OCTA 5LP6E 4CI2B 4ZOLE 1BNSA 2ACXA 5FYMA 4BTXA 3K1SA 2KF4A 2IUBA 4HVNA 1BU4A 5D83A 4Z8XA 5HEUA 3F2EA 1SJWA 3NBXX 3AECA 2BMOB 3ONJA 1E97A 4DKIA 1C7HA 4P0AA 3NBBA 3GZBA 4H9SE 3S27A 2LJLA 5FGOA 5FY0A 2BZBA 2V5DA 5AQTB 2AAEA 3O1HA 1WCRA 5BMVE 3P4RA 3Q2MA 2A3DA 4HFCA 1W6CA 3CNMA 2UXXB 5LHIB 4LEHA 1ZS7A 4IL4A 7STDA 3IPTA 3K3OA 4HKVB 4WBNE 2CE7A 3WODG 4O8SA 3ANWB 4LF5T 1YIT3 4XBXA 3IJEB 2W0QA 3VR8A 4XDWA 3RHWA 2HMMB 1KF6A 2CX0A 3EN1B 1CYVA 2XQYA 5HAXA 3RF1A 4DV1T 4TX4A 3Q5DA 3CPW2 2YDSA 1FGOA 4CXXA 5M1AA 4X20E 2N2NA 1D1AA 1VQM3 3IA3A 3L8RA 3Q5XA 5LBMA 4KBMB 2CRBA 1BIRA 4FCZA 1IBLT 2GEXA 1VZZA 4L8OA 3E99A 1RNBA 2BVLA 2CPTA 4I43B 3TLWA 2RA1A 4M1PA 1C54A 3AEFA 3NXJA 3ZT6A 3CK6A 1DMNA 2XQ3A 3N9MA 5M18A 4ILUA 1HU9A 1L0VA 1D1BA 2W62A 2VQET 4KFEA 3ZN1B 7GSPA 1N8QA 4TV8E 2KZ7B 3AA0B 2INXA 2JRKA 1ROVA 1IV9A 4LMJA 1BNGA 1OF5B 4H9NC 3NM2A 2WOFA 4HOHA 1KWIA 1BGSA 1W0AA 1QALA 1DU2A 2CX1A 3A76A 1J5WA 4AKZA 4TNVA 3U97A 5HOHA 3FZMB 4AI6A 5BU4A 1V58A 2Z77A 2WS3A 4IDNA 2YU1A 4RNZA 3LMLA 3PUYF 3R6NA 5EK4A 1HX8A 4OYKA 4UF0A 2QVAA 1RGAA 2GSPA 5LC7A 2A2FX 2XAQB 4QXBB 4H9QC 2CXDA 3N9QA 1O3XA 3ZC0A 4U13A 4LF9T 2W2UA 3S28A 2IYJA 5D82A 1OUNA 3KVBA 2VQFT 1QAFA 1VQ73 4NIQA 2PG8A 5HXEA 2XH9A 1RDSA 3I553 1MMNA 1FUTA 4HBRA 5LMUT 2CIUA 2HMKB 2KXGA 3EUHA 1BR4A 1NU3A 2E9XD 4L8PA 1RSNA 1YGEA 2R41A 3ZKRA 3BU4A 2UXDT 2ZHXB 1EKMA 3ZJ1A 3QB5A 3Q1CA 2UUBT 1HTJF 2JQKA 3PUGA 2GU1A 4TWHA 1IT7A 1HCIA 2WDVA 2CCQA 2GEYA 2XQAA 4IIAA 4R80A 4LSOA 2UXCT 1OXZA 5JVDE 1CQSA 4AXPA 4U2YA 3OVUA 4UELA 2XQ6A 3NZPA 4YHJA 2HH7A 2XQ9A 2K48A 1G0TA 4HFVA 3FBZA 4IIJE 3UL5A 4ILFA 5AIHA 1BNJA 3X3XA 2ODVA 1T3BA 3JUMA 3PTRB 2EHOA 2RBIA 4U7IA 4U33A 4O02B 1LRZA 1ZGXA 1UUGB 4Q25A 1VQ53 2W66A 3CPZA 1E1HB 2OWPA 3ZEFB 2J8XB 1RN4A 4DV3T 3JAEA 3ZYMA 4E7SA 3D4AA 3NHXA 4HM5B 2X9WA 4WBOA 4J5KA 4IE4A 2XGLA 4OVMA 1AJ3A 2BMRB 3OYXA 2RCDA 2JDIH 5LGUB 5LNKA 3D0TA 1KNPA 1I6ZA 1WTHA 2BBJA 4ANJA 4DR6T 5IG3A 2Q9QC 1W2ZA 2CWTA 3PXMA 1GQEA 2STDA 3HI7A 1B2UA 4EIWA 2BHMA 3CNXA 3SXXA 4EEBA 2BBHA 4IE0A 4EB6E 4U7YA 2Q9QB 2JPFA 3D9RA 3C4ZA 1JB4A 3KV4A 5EQLA 1E2AA 1GS3A 1CYUA 5F5WA 1IAPA 1BANA 5AQHB 3MXZA 2D5UA 4G1MB 4FR9A 2VKHA 1YJ93 1RGLA 4FCJA 4ZXLA 1MIVA 4CJNA 1M7KA 3A7MA 4ZI2C 1M62A 3T0UA 5L4EA 3RC3A 3ZT7A 2BIRA 2YOEA 1HNZT 4HFHA 1SA0E 4BTWA 3UQ4A 2GK9A 3ONLC 2L9QA 2H3RA 4NXNT 1AVKA 4I4KA 3UU3A 4IDZA 4PJMA 1B2SA 3NV0A 4PFPA 3DXOA 2FGTA 1YQ3A 1BRHA 2X51A 5G1KA 3P50A 4ADZA 2LQVA 4LGQA 4MMZB 1W9RA 3G6E3 4HJLB 3AMOB 2BO9B 4G2AA 4A98A 4N6NB 2GBWB 1QVG2 1NENA 2V8SV 3JUOA 1ZP0A 2MBGA 3CQCB 2XSOB 2C5IT 4X1KE 2B1EA 5FP3A 1LKXA 3VRBA 2CLYC 4GKJT 1AY7A 3RRCA 3UU5A 2BVMA 4YSXA 3UB1A 4O4IE 2XZEA 1B2MA 2VB6A 2EHOD 2PBIA 3M65A 5CB4E 4CCVA 4JEUB 3ANWA 4J8TA 3JC6C 5CJ5A 1PY3A 2ZM2A 2K24A 2X67A 4K1VA 2CLYB 4RZMA 4WYKB 4YFSA 5L3EB 4K0KT 2X9YA 3STDA 4H9PC 1A2PA 2JIWA 2XAJB 1K734 2YINA 2HMLB 1Q9EA 1TFOA 3Q90A 2QIYA 1RKYA 3DZLA 3SFDA 1BRSA 4AQFC 1LXEA 1BRNL 3ONXA 1N8R4 4BA9A 2CXFA 3MG1A 3EB8A 2OTJ3 4RBNA 4HWDA 3GZYB 3C98B 4IDPA 5AYRB 2MF7A 3OWYA 4QWTA 1YJW3 1WRDA 2E2UA 4LF6T 2LM2A 4AKIA 2K54A 2X68A 1HZ1A 2H0IA 3RKOA 4X5TA 4H63V 3BNCA 4O4LE 3KN4A 3ZSSA 3FH1A 2JJ9A 1D0ZA 3N2OA 3T1YT 1FGTA 3LOYA 5EEOA 2XAGB 4J2CA 2FXTA 1RRHA 4N78D 2XAFB 5DQWA 3RYHE 2E5VA 2MPKA 2XR8B 2ZL8A 3BNEA 2XFTA 5EVHA 2ML6A 1O7MB 5FNVE 1VQQA 4TX5A 3TLSA 2DCFA 3E0ZA 3ZT5A 1UI8A 1G96A 3T8UA 1BR0A 4LF4T 4NUUA 2OOVC 3AEGA 2FJBA 3CQXC 4UVBB 1S723 5DQVA 3B4PA 4CPKA 4UVAB 5IERA 1R4CA 2ML5A 2H88A 2JQQA 4ISSA 4ASKA 4DV7T 4UVCB 1BRJA 1TUHA 1RGCA 3CCE3 4ILCA 1NWWA 5HEHA 1JNQA 5CK6A 2E5LT 3N5LA 1TIJA 3RGLA 3X1DA 5JDMA 4AQGA 5GONE 2XRXB 3DGOA 3FGYA 3KIIA 3EBYA 2WMNA 4QH5A 2KF5A 3KINB 2F5MA 2J62A 3PURA 3QUJA 3LBXB 1HF8A 1D1CA 5AQFB 3BNDA 4LFCT 3AE5A 3C4WA 1N33T 3J7Yd 3ZYKA 4BIRA 2XGNA 5G1LA 1OACA 3GZXB 5HXSA 1M9GA 2NR4A 2B76A 4COFA 3H3HA 2JQ9A 3MJXA 5FXVA 4IDQA 2E2TA 2XASB 4TN7B 4EGWA 2YDQA 3OKQA 3SOLA 3G0KA 1WR6A 5A0OB 4KVHA 1DYUA 2NP9A 2YK0A 3OWUA 2KNDA 2XQ5A 1IQXA 1JBSA 1NDOB 1KEYA 5AQOB 4PK4A 4XM4A 1Y64B 3I9WA 4EBGA 4JI3T 4EAHA 3ZMZB 3V92A 1J1JA 2XJ7A 5J2TE 4TV9E 3ETVA 2WMOA 2RSXA 2IMLA 3H3MA 2P05A 1Z8UA 1MIYA 5L3GB 3I0QA 3IBPA 5KP1A 2W04A 4HGAA 2CA5A 4BL3A 3BNBA 5IWAT 4LF7T 2X9HA 1ZEEA 3AGNA 3EAMA 4C91A 2KAAA 3Q5EA 2KRTA 3NVOA 5KMGP 2FBWA 5AI1A 2Y8DA 1US7B 3MACA 3KDSE 3FCSB 3NQYA 2HPLA 2IMJA 2Y48B 3FZKB 1HG2A 3UUBA 1CEWI 2M7OA 2G0UA 3LFMA 1BSCA 4DVDA 4HM2B 2P0MA 5AQUB 3PUZF 2DI4A 2KWHA 2CWOA 5IHYA 3H51A 2Q9QA 1UCUA 3RIAA 2ZLYA 4ISTA 5FL0A 3RIUC 2LHRA 1M1XB 1UX5A 2I0MA 4PNIA 4AKYA 1B27A 3VSYA 3GWHA 1B2ZA 3RLFF 1RGHA 1LOYA 4BJNA 3L3PA 2KINB 5CFBA 4DBQA 1N5HA 3AEAA 3VRAA 2HN1A 3RRWA 3FBLA 1VOMA 3OW22 1KFYA 1QMAA 5AIGA 3K3QC 3DMCA 1FGRA 4DNDA 4NREA 4YSZA 2SARA 3AA1B 3CCU3 4IGUA 3RYIE 1W4NA 1W2B2 3ZSTA 3X42A 4EYYR 4GYSA 1LVKA 1I3IA 5RNTA 3AE3A 4MFRA 3NV0B 5J0ZA 2NTYA 1RCKA 1T2HA 3GWRA 2E2VA 3AMOA 1IBKT 3KKGA 2O9UX 2VKDA 3D5GA 3GRDA 2WU2A 1NB5I 4IE7A 2AADA 2OV9A 3FF0A 1N5PA 1IZNB 3EN8A 3PUSA 1GOYA 2W67A 3I0YA 3PUAA 2UUCT 4EXTA 1AQZA 3GZRA 2ZMAA 1LVNA 3GA8A 3NRXA 3LTBA 5LGNB 1YD8G 2RGQA 1FMVA 2L8KA 2XAHB 3RIFA 3UFGA 4DR7T 3VGNA 1M904 4WYKA 4JBWF 1V57A 4K90B 1IQ8A 1A67A 3WDGB 1BR2A 4KI0F 2HHHT 2VURA 1ISKA 4GKKT 1D6ZA 1E7PA 1HYFA 2V1LA 3WR2A 4ZZCA 4GK0E 3U3IA 3D3LA 5LOVE 5IUXA 4XBYA 6STDA 5BR8T 1DETA 3SVAA 4DBRA 4HWHA 1K8A4 4KP3C 1W01A 3CMA3 4KHPT 3OWSA 4XZCA 3S5CA 3KFQC 4AQFA 3LK2B 1W0BA 4ZZBA 4FMDA 2CHCA 2W00A 2XF3A 5M19A 4BL2A 2VK9A 2HOHA 2MYSA 2ZM6T 1UUVB 4R4KA 3CPOA 4HM8B 4WHAA 4BJMA 1L5GB 2YEVC 1MIWA 2Q9QD 2CC3A 2GBXB 4HFBA 1HR0T 4WZXA 1EEJA 4NPBA 2NWBA 2MOZA 3PUVF 2BDEA 3EX9A 1B20A 1MNEA 4LZIA 4NUVA 3CME3 4HYZA 5LCYA 1I0VA 1OCVA 2MC8A 1A2VA 3CXC2 5JPUA 3EE1A 3ZC1A 4YSYA 3K0ZA 1NEKA 4ZI2D 5LMNT 1TRPA 5AQGB 5LG4A 2W03A 2WY2A 1FZUA 2W56B 2YFJB 2ZA4A 3ZJ2A 3O9XA 4O3VA 4MHCA 3NBRA 2XM1A 4GIWA 5AIFA 1E3RA 1GYBA 1YVBI 4YJ2E 3P4PA 1V9DA 1RN1A 1VQP3 4EV5A 4ZI7E 2OOVA 3FSDA 2D0TA 3AAEB 4EZHA 1ZO2A 4MALA 4DMVA 4JI4T 3PCRA 2W4XA 3OBVE 3AEDA 3K8PC 4JYAT 5CXOA 4C90A 3LTCA 5HGRA 3CCR3 1U4QA 2MTQA 2C10A 1JZDA 3SX1A 2WAUA 2W2CA 2FJDA 3VKGA 4YXDA 1MOLA 1LNHA 4WYVA 3N2GE 2UU9T 2QYWA 3LBXA 2D9DA 1PFPA 3CCM3 3UULA 1AV4A 1RMSA 2NW9A 1W6GA 3SS1A 5HCJA 3G713 1S94A 5HCMA 2KSRA 1H7CA 3PUQA 2VKOA 1UDII 4GOUA 2IUKA 3F9SA 1QSDA 2LKGA 1T7SA 4JI2T 2CXLA 3S4UA 3RH3A 1VQO3 4H63H 3PYJA 5LB7B 3QK6A 2F99A 2LSYA 4X1YE 1OEDC 1DE3A 4MJDA 5BVBA 2F98A 1GMPA 3RQUA 9RNTA 2V1DB 3RQWA 3FXEB 2Y6XA 5H6QB 1UW1A 3RPUA 4WFOA 1OEDB 4PK6A 3KE7A 4DV4T 1BRIA 2WSSV 3OJAA 3QRDA 3N9PA 2N1GA 1J2BA 4AKGA 2GU3A 5JH7E 3EVYA 5JDQA 1OGZA 5LC6A 7RNTA 1QJGA 4AEQA 3PDYA 5EK3A 2LSGA 3RNTA 5J1GA 3CCJ3 1NAFA 2PFVA 3CQGB 2FJEA 1BNEA 5HXRA 4HE8A 3P4WA 3N54B 1IU7A 2CKFB 4F8HA 2LSKA 1ZX2A 8RNTA 3GAXA 3FKAA 5IW9A 1N36T 4PEJA 2CWYA 1X1WA 2C5JA 4A97A 3I563 1ROAA 4RNTA 4X1IE 4FMBA 4X2OA 2YU2A 3FHNA 3MG2A 2H7OA 2VKJA 4G63A 3G8ZA 3ZG5A 2WDQA 4EZ4A 1SIHA 5STDA 3SOAA 1IVUA 4JI5T 2IW5B 3LT9A 4OUQA 1DVCA 5C3JA 2O3OA 4CN6A 4HWIB 1AVLA 3KV9A 3EC9A 5I97A 4XDVA 3UL6A 2N9DA 4J9AA 2WM9A 1RN7A 5L2LA 1W02A 2LSIA 3G4S3 5ABHA 2XTLA 3EDVA 5IG5A 3RIUA 1SIIA 1I94T 3QNUA 4HN9A 3K7CA 2Z6EA 2CK3H 1MNDA 5FY1A 1VCSA 4IDOA 4DUYT 3BQIA 4QH4A 1ZHCA 1BSAA 2V6XA 4L5GA 4DUZT 5CF2A 1DVDA 1JKGA 2V7LA 3NRYA 1FA3A 1W5ZA 5HWYA 3JUPA 2KMFA 2D2SA 4IHJE 3CCL3 5AQPB 3JUQA 1O7GB 3OV4A 1FIOA 5JRCB 1JB2A 2CFWA 5FW5A 3CC43 2BNGA 5EK2A 1OPYA 3BB9A 2CWVA 5FMNA 2ACZA 4STDA 1UUWB 1YVSA 2V5CA 2XEPA 3F8XA 3NQZA 3EABA 3EHZA 1RHLA 1IQYA 2HMJB 3LT8A 5JDFA 2PZVA 3PUWF 4CN1A 2I9WA 1F8NA 3TLVA 4O4HE 3ALAA 4X62T 5L3BB 1JV2B 2BS2A 2LRKA 4EW5A 1D0XA 1SE7A 2IY2A 4LYLB 2C0SA 1RGFA 1RGEA 4HTEA 2E8IA 4DO0A 5EZYE 2ZM0A 2UUGC 1PYLA 4GYRA 3MKIA 2V26A 2OLTA 2LYXA 4I55E 2HN2A 3KBUA 2IDOB 1W6YA 3JCFA 1T72A 4GL6A 3UU8A 2X0HA 2DL1A 2JMKA 2WP9A 4YTPA 2L1SA 1SQWA 3X3ZA 4ILAA 3P7IA 5AQLB 3MWZA 2LEHA 3HZPA 3WAJA 3M3ZB 1VQ43 3BQLA 3WA2X 3SWHA 1BUJA 2RNTA 3K3NA
chains in the Genus database with same CATH topology
3FXDB 3KFWX 3F31A 3OXAA 3CCV3 2CW9A 3CVRA 2Y73A 3RDEA 2WGOA 4AKLA 1JRQA 2CG0A 1W7CA 4MEIA 3K5TA 5LXTE 3TDGA 1M1K4 3VKHA 2PJQA 2LE8A 2W56A 3F57A 1EQKA 1NB3I 5IYZE 5TGNA 3N8BA 4FJOA 1G8XA 4PK5A 3LG7A 3AA7B 1B7TA 2R4IA 3MKDA 2B1XB 5E0OA 4HM6B 3CC73 3HKDE 5JQGE 3X41A 5J2UE 2H7VC 4ZI3C 1YKHB 3CX6B 2NTXA 4H9OC 4XAXB 4JLEA 2Z6BA 2CWUA 1V74A 1U5PA 1FGMA 1VQL3 3X40A 3LYGA 3AA6B 2CMRA 3Q9DA 1MMAA 1UX4A 4JF8A 2V7KA 1HKXA 3S29A 5HXHA 4TUYE 5IF6A 3FG4A 2W61A 2ODUA 1X79A 4XBFB 1IV7A 1Q42A 5LBQB 2FNQA 1WQLB 4ZM8A 2HMNB 5IEPA 3WOEB 3F8HA 5ELJA 2W63A 3R84B 3EJVA 2W0GA 1Q864 2X9XA 2WBLA 5FXXA 3B4OA 3RX6A 3LK3B 3VU7H 5TAOA 3CWZB 4XBTA 2XSHB 3ZMSB 2QGUA 1HG5A 1A2KA 2IAKA 2VASA 3PU8A 2UX0A 3B13A 2ZDJA 5IG0A 5FY7A 3F14A 3N2KE 2VL8A 3FF2A 4EC6A 5C8YE 2DWKA 4LMIA 1U5OA 5JPPA 3CD63 1ZV4X 3LJCA 2J1DG 2QGSA 3DGMA 4GK5E 5L3CB 2K9AA 1QUUA 3AAIA 2X0LB 4JRFA 1JJ22 3DGLA 4O4JE 4U72A 4N3VA 4HM0B 3ZMTB 3RGAA 3RYCE 1OWAA 2A15A 5LA6E 1YI23 3NZQA 4PJLA 5AEWB 8CHOA 1YJN3 4FMCA 4UEMA 2UXNB 5CA1E 3MG3A 3PGBA 3EHCA 3K9MC 4JEHB 3W15B 1JKGB 1WNHA 5JRCA 3C64A 1GY6A 3DGNA 1N9JA 2D42A 5IEOA 1US1A 3B57A 4IE6A 1NWMX 2D0UA 4UXNB 1IT8A 2CEAA 3MSOA 3GN5A 1FEWA 3ZYLA 4YJ3E 3IEEA 1GY7A 4CXYA 1IK3A 1LOXA 3O1IA 4EYUA 2IA7A 4GB5A 3ZCIA 4ERRA 5IENA 5L3DB 4MMYB 1Q40A 2LSJA 1KK7A 1OHPA 3ECFA 3PCSA 5DABA 5JR9C 4WW0A 4XB5A 4O2AE 5FXWA 3C50A 4K0UA 3DTOA 1VQ83 4PW8A 1D6YA 2W9QA 3AVRA 4ZS3A 1JB5A 5JR9B 5DJQC 2NOXA 2K5BB 1A90A 5JDGA 3E22E 4I50E 4N6MA 1WMOA 5JDHA 4PFOA 3SRZA 2V7MA 1Z1SA 2VWAA 3KSPA 3BK9A 3UFEA 3HR0A 1DMMA 2E9XA 3ESLA 4JUYA 2SPCA 3B7CA 2I59A 1K9M4 3PZWA 4H61A 2P9BA 2LHNA 4EOZB 1WMNA 3DJBA 3MHEA 2CFDA 4R1KA 4IT7A 3F40A 2WOHA 1VQ93 2HMOB 3A5XA 3MK7C 1TP6A 1GD4A 2CFGA 3NUVA 1HFAA 4N6TA 3MA9A 1JN5B 4OFZA 4CI3B 2D1WA 1HS7A 1D6UA 4QX8B 4KFDA 4OYJA 5LHGB 2JQ5A 3QK9A 1W00A 4HEAA 3ETUA 3OX9A 3VF1A 5JBSA 4HZBB 2W9PA 3RYFE 3WAKA 3UT5E 4L7KA 5F3JA 4NHFA 3PS8A 1YIJ3 5JDLA 4ZHQE 2KT9A 1O7PB 3O8YA 2CFKA 1MNLA 4KMCA 4QKNA 4HZ9B 3WOFB 4N6V0 2IUJA 2QA43 4TZ4C 3WA3A 3N9LA 3V99A 5KP3A 4V1Av 1VQN3 3JC6D 1LVFA 5LJMA 2BMQB 3BQKA 4QHOA 4E7ZA 4N6OB 5FXZA 1NO3A 3KSED 4FMAA 5LJNA 3ZPOA 1QAKA 2ZM8A 4OHFA 3NBJA 4PJNA 1OGXA 3KV6A 3IMAB 3HKCE 2YFLB 3H3AA 3O1JA 3JVCA 3Q2PA 3C51A 1IJ5A 1NJI4 1QVF2 4CQIA 1Q7Y4 2KLQA 2OQEC 3F7XA 4CZZB 4YLHA 3DM8A 4KZ1A 1ULIB 3AB3B 3CX7B 2QA7A 1WLXA 2XHEB 1IVXA 3HIGA 1IJ6A 4HM4B 4FCMA 4R9LA 1D0YA 3MPHA 4R9KA 2KWIB 4UV8B 3B8LA 3M8CA 3IF8B 3OYZA 2F86B 5KDMC 1KSIA 3L0RA 2NW7A 3N9NA 1OHOA 1ULJB 3I0OA 5HWXA 3HX8A 3ZN0B 1MMDA 1O7WB 2P0XA 2L3LA 3RGRA 3C4XA 1BR1A 3HA4A 4ZI3D 1FUWA 2KCDA 2JMHA 1IVVA 5G2GA 3L09A 3MZKB 3FG3A 1KD14 1E3VA 2LOPA 4QXHB 5DREA 3FLJA 3O4XE 2KXPB 5ADXL 3HK4A 4IE5A 3T8OA 1S35A 2LOSA 2B24B 1WYBA 4Q53A 5H6RB 4WWUC 2DNXA 2L4VA 3J7Yq 4DMWA 2LT3A 5BXQA 2OTL3 1YW0A 2DHRA 1Q824 1G73A 2P38A 1VQ63 3NM7A 4N6LA 3DP7A 4FI5A 3HKEE 3GN5B 1EA2A 4P0BA 4X2HA 1EZ3A 1S5AA 5LHHB 3CX8B 4BTYA 5LYJE 1OHSA 3T8NA 3SEDA 3NX0A 4ZS2A 1KQS2 4HM3B 2CFLA 5IG4A 1Q40B 3FG1A 4IPBA 3LZAA 3IHRA 5JR9A 3DUKA 2HPJA 3LXUX 5ELUA 4KUMB 3DY5A 1GY5A 5CF1A 2V7IA 4CI1B 1FMWA 5F8PA 3CC23 4UIGA 1MMGA 2M67A 4MBQA 2XUEA 2E9XC 4QWNB 3UNLA 4U74A 5HXCA 3E08A 3WI3A 1ASKA 2E9XB 1Z0PA 3ZMVB 3LH4A 2RP4A 3Q5WA 2PNCA 1PU4A 1YKEB 4L0RA 2W6JH 4RNYA 2C11A 2DWGA 4AKRB 1WYCA 2LM9A 2Z7AA 4OK0A 3V5UA 3I1AA 3G16A 1JN5A 4WP5A 3X3YA 5AYSC 2NW8A 3ZLIA 4O2BE 5HYAA 3H37A 5LGTB 3ZCJA 1KC84 5L3FB 1DMQA 1CUNA 5JDNA 1STDA 3KZTA 3UJMA 1UI7A 1U8CB 1IVWA 3U1WA 1OF5A 4AKHA 3LTDA 3CU3A 2IC9A 1T98A 4EYCA 2QEX3 3JUNA 3UUMA 1WMPA 1K41A 4PJJA 3QC9A 3EF8A 5AEUB 3ZMUB 5AFUL 3KBTA 3MYTA 1T5YA 2BT3A 3WMDA 2DLRA 3N9HA 2GXFA 1AR0A 2YX9A 1EG9B 3ER7A 3CCS3 4UF0B 3J9X1 3I9YA 5CLKA 2WWUA 1N9EA 3LTAA 2RFRA 1STFI 4K61A 1SPUA 3P8CD 2Q07A 4KFFA 5KX5E 2XFSA 3FB2A 3HI2A 3V98A 3FZWA 2CM0A 5A1LA 2WGQA 1O7NB 2Z76A 1ZKEA 1FGQA 4H9RC 2Y74A 4HKAA 3EDUA 3KV5A 4P09A 4HM7B 4WNKA 5AIIA 3N9OA 1GD3A 4B6XA 2OQEA 4MLKA 2EHOC 3EQQB 3UTKA 4ORLA 2YFIB 3GMIA 3CCQ3 3F7SA 1VQK3 2SBLA 5DRVA 3HIIA 5ETWA 3S67A 3VHLA 4K1UA 2EHOB 1TU5A 3EBTA 3TKLB 1K28A 5KP4A 3U78A 3HL6A 3SLUA 2K0MA 4BAYB 1BUQA 4UV9B 1Y4KA 2ES0A 5CA0E 1Q814 1YHQ3 3ROBA 5M4YA 3V5SA 5JREA 4EV2A 2X66A 3PU3A 1TFKA 1RRLA 4H3UA 2CG1A 4CXWA 4EXRA 4F6RC 2IC6A 4L9IA 5D81A 1SHZC 2V7JA 4I4TE 4QXCB 4MMXB 4QX7B 3CMLA 4N6UA 1RJOA 4O2HA 3SOYA 1OH0A 3AAAB 3CKDA 2P09A 3RC8A 3AVSA 3K63A 2C5KT 4CDLA 3UUNA 1KNZA 2WO0A 3KVAA 3UUXB 1IDPA 2CH9A 4HM1B 2OA5A 3HKBE 1VRBA 3LK42 3PE0A 4PAGA 2A72A 1O7HB 4A56A 3BLZA 2OCTA 5LP6E 4CI2B 4ZOLE 2ACXA 5FYMA 4BTXA 4HVNA 5D83A 4Z8XA 3F2EA 1SJWA 3NBXX 2BMOB 1E97A 1C7HA 4P0AA 3NBBA 3GZBA 4H9SE 3S27A 2LJLA 5FGOA 5FY0A 2BZBA 3O1HA 5BMVE 3Q2MA 2A3DA 1W6CA 3CNMA 2UXXB 5LHIB 4LEHA 7STDA 3IPTA 3K3OA 4HKVB 4WBNE 2CE7A 3WODG 4O8SA 3ANWB 1YIT3 4XBXA 3IJEB 2W0QA 4XDWA 2HMMB 3EN1B 1CYVA 2XQYA 5HAXA 4TX4A 3CPW2 1FGOA 4CXXA 4X20E 2N2NA 1D1AA 1VQM3 3Q5XA 5LBMA 4KBMB 4FCZA 2GEXA 1VZZA 4L8OA 3E99A 2BVLA 4I43B 2RA1A 4M1PA 3NXJA 1DMNA 3N9MA 4ILUA 1HU9A 1D1BA 2W62A 4KFEA 3ZN1B 1N8QA 4TV8E 2KZ7B 3AA0B 2INXA 2JRKA 1ROVA 1IV9A 1OF5B 4H9NC 3NM2A 2WOFA 1KWIA 1QALA 3A76A 4AKZA 3U97A 4AI6A 2Z77A 2YU1A 4RNZA 3LMLA 3R6NA 5EK4A 1HX8A 4OYKA 4UF0A 5LC7A 2A2FX 2XAQB 4QXBB 4H9QC 2CXDA 3N9QA 1O3XA 3ZC0A 4U13A 3S28A 5D82A 1OUNA 3KVBA 1QAFA 1VQ73 2PG8A 5HXEA 2XH9A 3I553 1MMNA 4HBRA 2CIUA 2HMKB 2KXGA 3EUHA 1BR4A 1NU3A 2E9XD 4L8PA 1YGEA 1EKMA 3ZJ1A 3Q1CA 1HTJF 3PUGA 2GU1A 1IT7A 1HCIA 2GEYA 2CCQA 4IIAA 4R80A 4LSOA 1OXZA 5JVDE 1CQSA 4AXPA 4UELA 3NZPA 4YHJA 2HH7A 2K48A 4HFVA 3FBZA 4IIJE 3UL5A 5AIHA 3X3XA 2ODVA 3JUMA 3PTRB 2EHOA 4O02B 1LRZA 1VQ53 3CPZA 1E1HB 2OWPA 3ZEFB 3ZYMA 4HM5B 4E7SA 3NHXA 2X9WA 4WBOA 4IE4A 2XGLA 4OVMA 1AJ3A 2BMRB 3OYXA 2RCDA 2JDIH 5LGUB 5LNKA 3D0TA 1WTHA 4ANJA 5IG3A 2Q9QC 1W2ZA 2CWTA 3PXMA 2STDA 3HI7A 4EIWA 2BHMA 3CNXA 3SXXA 4IE0A 4EB6E 2Q9QB 2JPFA 3D9RA 3C4ZA 1JB4A 3KV4A 5EQLA 1GS3A 1CYUA 1IAPA 3MXZA 2D5UA 4G1MB 4FR9A 2VKHA 1YJ93 4FCJA 1MIVA 4ZI2C 3T0UA 3RC3A 1SA0E 4BTWA 2GK9A 2L9QA 2H3RA 1AVKA 4I4KA 4IDZA 4PJMA 3NV0A 4PFPA 3DXOA 2FGTA 2X51A 4ADZA 2LQVA 4LGQA 4MMZB 3G6E3 4HJLB 3AMOB 2BO9B 4G2AA 4N6NB 2GBWB 1QVG2 3JUOA 2MBGA 3CQCB 2XSOB 2C5IT 4X1KE 2B1EA 5FP3A 1LKXA 2CLYC 3RRCA 2BVMA 3UB1A 4O4IE 2VB6A 2EHOD 2PBIA 3M65A 5CB4E 4CCVA 4JEUB 3ANWA 4J8TA 3JC6C 2ZM2A 2K24A 2X67A 4K1VA 2CLYB 4RZMA 4WYKB 4YFSA 5L3EB 2X9YA 3STDA 4H9PC 2XAJB 1K734 2YINA 2HMLB 1TFOA 3Q90A 2QIYA 1RKYA 3DZLA 1LXEA 4AQFC 3ONXA 1N8R4 4BA9A 2CXFA 3MG1A 3EB8A 2OTJ3 4RBNA 3GZYB 3C98B 5AYRB 2MF7A 3OWYA 4QWTA 1YJW3 1WRDA 2E2UA 4AKIA 2K54A 2X68A 3RKOA 4H63V 3BNCA 4O4LE 3KN4A 3FH1A 2JJ9A 1D0ZA 3N2OA 1FGTA 3LOYA 5EEOA 2XAGB 4J2CA 2FXTA 1RRHA 4N78D 2XAFB 2ZL8A 5DQWA 2XR8B 3RYHE 3BNEA 2XFTA 5EVHA 2ML6A 1O7MB 5FNVE 4TX5A 2DCFA 3E0ZA 1UI8A 1G96A 3T8UA 1BR0A 4NUUA 2OOVC 3CQXC 4UVBB 1S723 5DQVA 3B4PA 4UVAB 5IERA 1R4CA 2ML5A 2JQQA 4ISSA 4ASKA 4UVCB 1TUHA 3CCE3 1NWWA 1JNQA 5CK6A 3N5LA 1TIJA 5JDMA 4AQGA 5GONE 2XRXB 3DGOA 3FGYA 3KIIA 3EBYA 2WMNA 3KINB 3PURA 3QUJA 3LBXB 1HF8A 1D1CA 3BNDA 3C4WA 3J7Yd 3ZYKA 2XGNA 1OACA 3GZXB 5HXSA 1M9GA 3H3HA 3MJXA 5FXVA 2E2TA 2XASB 4TN7B 3OKQA 3SOLA 3G0KA 1WR6A 5A0OB 4KVHA 1DYUA 2NP9A 2YK0A 3OWUA 2KNDA 1IQXA 1NDOB 4PK4A 4XM4A 1Y64B 3I9WA 4EBGA 4EAHA 3ZMZB 3V92A 5J2TE 4TV9E 3ETVA 2WMOA 2RSXA 2P05A 1MIYA 5L3GB 3I0QA 3IBPA 5KP1A 2W04A 4HGAA 2CA5A 3BNBA 2X9HA 1ZEEA 4C91A 2KRTA 5KMGP 5AI1A 2Y8DA 1US7B 3MACA 3KDSE 3FCSB 3NQYA 2HPLA 2IMJA 2Y48B 1HG2A 1CEWI 2M7OA 2G0UA 3LFMA 4DVDA 4HM2B 2P0MA 2DI4A 2KWHA 2CWOA 5IHYA 3H51A 2Q9QA 1UCUA 2ZLYA 4ISTA 2LHRA 1M1XB 1UX5A 4PNIA 4AKYA 3VSYA 3GWHA 4BJNA 3L3PA 2KINB 4DBQA 1N5HA 3RRWA 3FBLA 1VOMA 3OW22 1QMAA 5AIGA 3K3QC 3DMCA 1FGRA 4DNDA 4NREA 3AA1B 3CCU3 4IGUA 3RYIE 1W4NA 1W2B2 3X42A 4EYYR 4GYSA 1LVKA 4MFRA 3NV0B 2NTYA 3GWRA 2E2VA 3AMOA 3KKGA 2O9UX 2VKDA 3GRDA 1NB5I 4IE7A 3FF0A 1N5PA 1IZNB 3EN8A 3PUSA 3I0YA 3PUAA 4EXTA 3GZRA 2ZMAA 1LVNA 3GA8A 3NRXA 3LTBA 5LGNB 1YD8G 2RGQA 1FMVA 2L8KA 2XAHB 3VGNA 1M904 4WYKA 4K90B 1IQ8A 1A67A 3WDGB 1BR2A 1ISKA 1D6ZA 2V1LA 4GK0E 3U3IA 3D3LA 5LOVE 6STDA 4XBYA 3SVAA 4DBRA 1K8A4 4KP3C 1W01A 3CMA3 3OWSA 4XZCA 3S5CA 3KFQC 4AQFA 3LK2B 4FMDA 2CHCA 2W00A 2XF3A 2VK9A 2MYSA 1UUVB 4WHAA 4R4KA 3CPOA 4HM8B 4BJMA 1L5GB 2YEVC 1MIWA 2Q9QD 2CC3A 2GBXB 2NWBA 2MOZA 2BDEA 3EX9A 1MNEA 4LZIA 4NUVA 3CME3 4HYZA 5LCYA 1OCVA 2MC8A 1A2VA 3CXC2 5JPUA 3EE1A 3ZC1A 3K0ZA 4ZI2D 2W03A 5LG4A 2W56B 2YFJB 3ZJ2A 3O9XA 4O3VA 4MHCA 3NBRA 4GIWA 5AIFA 1E3RA 1GYBA 1YVBI 4YJ2E 1V9DA 1VQP3 4EV5A 4ZI7E 2OOVA 3FSDA 2D0TA 3AAEB 4EZHA 1ZO2A 4MALA 4DMVA 3PCRA 3OBVE 3K8PC 5CXOA 4C90A 3LTCA 5HGRA 3CCR3 1U4QA 2MTQA 2C10A 3SX1A 2WAUA 2W2CA 3VKGA 1MOLA 1LNHA 3N2GE 3LBXA 1PFPA 3CCM3 3UULA 1AV4A 2NW9A 1W6GA 3SS1A 3G713 1S94A 1H7CA 3PUQA 2VKOA 4GOUA 2IUKA 3F9SA 1QSDA 2CXLA 3S4UA 3RH3A 1VQO3 4H63H 3PYJA 2F99A 3QK6A 2LSYA 4X1YE 4MJDA 5BVBA 2F98A 2V1DB 3FXEB 2Y6XA 5H6QB 1UW1A 3RPUA 4WFOA 4PK6A 3KE7A 2WSSV 3OJAA 3QRDA 3N9PA 2N1GA 1J2BA 4AKGA 2GU3A 5JH7E 3EVYA 5JDQA 1OGZA 5LC6A 1QJGA 4AEQA 3PDYA 5EK3A 2LSGA 5J1GA 3CCJ3 1NAFA 2PFVA 3CQGB 5HXRA 4HE8A 3N54B 1IU7A 2CKFB 2LSKA 1ZX2A 3GAXA 3FKAA 5IW9A 4PEJA 2CWYA 2C5JA 3I563 1ROAA 4X1IE 4FMBA 4X2OA 2YU2A 3FHNA 3MG2A 2H7OA 2VKJA 4G63A 3G8ZA 4EZ4A 1SIHA 5STDA 3SOAA 1IVUA 2IW5B 3LT9A 4OUQA 1DVCA 2O3OA 1AVLA 3KV9A 3EC9A 5I97A 4XDVA 3UL6A 2N9DA 4J9AA 2WM9A 1RN7A 5L2LA 1W02A 2LSIA 3G4S3 2XTLA 3EDVA 5IG5A 1SIIA 4HN9A 3K7CA 2Z6EA 2CK3H 1MNDA 5FY1A 3BQIA 1ZHCA 4L5GA 5CF2A 1DVDA 1JKGA 2V7LA 3NRYA 1FA3A 1W5ZA 5HWYA 3JUPA 2KMFA 2D2SA 4IHJE 3CCL3 3JUQA 1O7GB 3OV4A 1FIOA 5JRCB 1JB2A 2CFWA 5FW5A 3CC43 2BNGA 5EK2A 1OPYA 3BB9A 2CWVA 5FMNA 4STDA 1UUWB 2XEPA 3F8XA 3NQZA 1IQYA 2HMJB 3LT8A 5JDFA 2PZVA 2I9WA 1F8NA 4O4HE 3ALAA 5L3BB 1JV2B 1D0XA 2C0SA 4HTEA 2E8IA 4DO0A 5EZYE 2ZM0A 4GYRA 3MKIA 2V26A 2LYXA 4I55E 3KBUA 1W6YA 4GL6A 2JMKA 1SQWA 3X3ZA 3P7IA 3MWZA 2LEHA 3HZPA 3WAJA 1VQ43 3BQLA 3WA2X 3SWHA 3K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 1JBT A;  3FXD B;  4LML A;  3KFW X;  2FUP A;  3F31 A;  3OXA A;  3AXJ A;  3CCV 3;  2CW9 A;  2VL0 A;  1FJG T;  1XNR T;  3CVR A;  2Y73 A;  4EED A;  3RDE A;  4BU4 A;  2WGO A;  4AKL A;  3FZF B;  1JRQ A;  2CG0 A;  2M6I A;  1W7C A;  4MEI A;  3K5T A;  5LXT E;  3TDG A;  1UCL A;  1M1K 4;  3VKH A;  3URP A;  2WDR A;  2PJQ A;  2LE8 A;  2W56 A;  2CBI A;  3F57 A;  1NB3 I;  1EQK A;  1UUR A;  5IYZ E;  5TGN A;  3N8B A;  4FJO A;  1G8X A;  4QH1 A;  4PK5 A;  1BNF A;  3LG7 A;  3AA7 B;  1B7T A;  2H89 A;  2R4I A;  3MKD A;  1B3S A;  2B1X B;  2F4V T;  5E0O A;  4HM6 B;  3CC7 3;  1UGH I;  3SYU A;  3HKD E;  2F5W A;  4X64 T;  5JQG E;  2BKN A;  3X41 A;  5J2U E;  2H7V C;  1MGW A;  4ZI3 C;  1YKH B;  3CX6 B;  1HNW T;  1UGO A;  2NTX A;  4H9O C;  4XAX B;  4JLE A;  2Z6B A;  4IL9 A;  2CWU A;  1V74 A;  1U5P A;  4OX9 T;  1OED E;  1YXR A;  1FGM A;  1VQL 3;  3X40 A;  3LYG A;  3OPC A;  4IT4 A;  3AA6 B;  2CMR A;  3Q9D A;  2H0H A;  1MMA A;  4U3C A;  1UX4 A;  3AE4 A;  2V7K A;  1HKX A;  4JF8 A;  1W09 A;  3S29 A;  2WCA A;  2V6Y A;  5HXH A;  4TUY E;  6GSP A;  1KNR A;  5IF6 A;  3FG4 A;  2W61 A;  4GSP A;  4LMK A;  2ODU A;  1OED A;  3UU4 A;  1X79 A;  4XBF B;  1IV7 A;  4AIU A;  1Q42 A;  4DR2 T;  5LBQ B;  2FNQ A;  1WQL B;  4ZM8 A;  2LRL A;  1X1U A;  3JAD A;  2HMN B;  5IEP A;  1YNV X;  1UGI A;  3WOE B;  3F8H A;  5ELJ A;  1RGG A;  2W63 A;  3R84 B;  3EJV A;  2W0G A;  1Q86 4;  2X9X A;  2WBL A;  5FXX A;  3B4O A;  3RX6 A;  3LK3 B;  2WWV A;  3VU7 H;  5TAO A;  3CWZ B;  1MGR A;  4XBT A;  2XSH B;  3ZMS B;  2QGU A;  1HG5 A;  4DR1 T;  1A2K A;  2IAK A;  2VAS A;  4JV5 T;  3PU8 A;  2UX0 A;  3B13 A;  1CHU A;  2ZDJ A;  4Z90 A;  5IG0 A;  5FY7 A;  3F14 A;  3N2K E;  2VL8 A;  1XNQ T;  3FF2 A;  4EC6 A;  5C8Y E;  2DWK A;  4LMI A;  1U5O A;  5JPP A;  5L4H A;  3CD6 3;  1ZV4 X;  3LJC A;  2J1D G;  3OTO T;  2QGS A;  6RNT A;  4YY3 T;  3DGM A;  4GK5 E;  4HFI A;  5L3C B;  2K9A A;  3T1H T;  1QUU A;  1UCJ A;  1X9B A;  2BG9 C;  4JI7 T;  3AAI A;  2X0L B;  4JRF A;  1JJ2 2;  3DGL A;  2VVS A;  2KF6 A;  2XY8 B;  4O4J E;  4U72 A;  4HFD A;  4N3V A;  4HM0 B;  3ZMT B;  3RGA A;  3RYC E;  1OWA A;  2F56 A;  2BG9 B;  2A15 A;  3Q3F A;  5LA6 E;  4HWF A;  1YI2 3;  3NZQ A;  4PJL A;  1GSP A;  5AEW B;  8CHO A;  1YJN 3;  1JNZ A;  4FMC A;  4ILB A;  4UEM A;  2UXN B;  5CA1 E;  3MG3 A;  3PGB A;  3EHC A;  3K9M C;  4JEH B;  4HAA A;  3W15 B;  1JKG B;  1WNH A;  5JRC A;  2WB5 A;  2WZH A;  3C64 A;  1GY6 A;  5AQM B;  4YTN A;  3DGN A;  1N9J A;  2D42 A;  5IEO A;  1US1 A;  3B57 A;  4IE6 A;  1NWM X;  2D0U A;  4UXN B;  1IT8 A;  2CEA A;  2R6G F;  3MSO A;  2CBJ A;  3GN5 A;  1FEW A;  3ZYL A;  4YJ3 E;  3IEE A;  1GY7 A;  4CXY A;  1IK3 A;  1LOX A;  3O1I A;  4EYU A;  2IA7 A;  4GB5 A;  3ZCI A;  4ERR A;  5IEN A;  1J5E T;  4TWD A;  2IHR 1;  5AQR B;  5L3D B;  4MMY B;  1Q40 A;  3ZFZ A;  2LSJ A;  1KK7 A;  2PTF A;  3NKZ A;  1OHP A;  3ECF A;  3PCS A;  1UUS A;  5DAB A;  5JR9 C;  4WW0 A;  4XB5 A;  4O2A E;  5FXW A;  3C50 A;  3AHW A;  4K0U A;  4NXM T;  3DTO A;  1VQ8 3;  3KCH A;  1HNX T;  4PW8 A;  1D6Y A;  2W9Q A;  3AVR A;  4ZS3 A;  1JB5 A;  5JR9 B;  5DJQ C;  3GSP A;  2NOX A;  4J5G A;  2K5B B;  4NPP A;  1FW7 A;  1RCL A;  5JDG A;  4KT3 B;  1A90 A;  3E22 E;  2BKO A;  1GMQ A;  3ABV A;  4I50 E;  4N6M A;  1WMO A;  5JDH A;  3AHS A;  4PFO A;  3SRZ A;  2V7M A;  1Z1S A;  2VWA A;  3KSP A;  3BK9 A;  3UFE A;  1JBR A;  3HR0 A;  4AQY T;  4Z91 A;  1DMM A;  5CGM A;  2E9X A;  3ESL A;  1R4Y A;  4JUY A;  2SPC A;  5L47 A;  1VCT A;  2XPK A;  3B7C A;  2I59 A;  2XQ4 A;  1K9M 4;  2BS4 A;  2WZI A;  2P9B A;  2LHN A;  3AXJ B;  5ABG A;  3PZW A;  4H61 A;  1LOW A;  4EOZ B;  1WMN A;  1TTO A;  1FYS A;  3DJB A;  3MHE A;  2CFD A;  4R1K A;  4A5X A;  4IT7 A;  3F40 A;  2WOH A;  4UR9 A;  1VQ9 3;  2HMO B;  2WU5 A;  5FVK A;  1X1X A;  3A5X A;  3MK7 C;  2AE9 A;  1TP6 A;  1GD4 A;  3WHO A;  3VR9 A;  2CFG A;  3NUV A;  2JQH A;  3JAF A;  1HFA A;  1JNR A;  4N6T A;  1BSE A;  3B5M A;  3MA9 A;  1JN5 B;  2QRX A;  4OFZ A;  4CI3 B;  1T8B A;  2D1W A;  2XQ8 A;  1LQM B;  1HS7 A;  1UK5 A;  1D6U A;  4QX8 B;  4KFD A;  4OYJ A;  5LHG B;  2JQ5 A;  2F4Y A;  3QK9 A;  1RLS A;  1W00 A;  4HEA A;  2YDR A;  3ETU A;  3AE1 A;  3AE8 A;  3CIR A;  2BKP A;  3OX9 A;  3VF1 A;  4IRE A;  5JBS A;  4HZB B;  2W9P A;  3RYF E;  3G06 A;  4DV5 T;  3WAK A;  3UT5 E;  4L7K A;  5F3J A;  2K3W A;  3EI0 A;  4X65 T;  4KHZ F;  4NHF A;  1Y01 A;  3PS8 A;  1YIJ 3;  5JDL A;  3QB5 K;  2IIU A;  4ZHQ E;  5JTG A;  2KT9 A;  1O7P B;  3O8Y A;  2CFK A;  1N34 T;  4JI1 T;  4KMC A;  4QKN A;  1MNL A;  4HZ9 B;  3WOF B;  4N6V 0;  2IUJ A;  2QA4 3;  4TZ4 C;  3WA3 A;  3N9L A;  2M6B A;  3V99 A;  3HOH A;  2H0G A;  5KP3 A;  4V1A v;  1VQN 3;  3AE6 A;  1LVF A;  3JC6 D;  5LJM A;  2BMQ B;  2V6Y B;  3BQK A;  4QHO A;  4DID B;  4E7Z A;  4N6O B;  5FXZ A;  1NO3 A;  4P1N A;  3KSE D;  3FZH B;  2YKS A;  4FMA A;  1B21 A;  1ZOY A;  5LJN A;  3ZPO A;  1I2E A;  1QAK A;  2ZM8 A;  4OHF A;  1BSD A;  5FL1 A;  3NBJ A;  4PJN A;  1OGX A;  1SUM B;  3KV6 A;  1N32 T;  3IMA B;  3HKC E;  2YFL B;  3H3A A;  3O1J A;  3JVC A;  3PJA A;  3Q2P A;  3C51 A;  4DV2 T;  1IJ5 A;  1NJI 4;  1QVF 2;  4CQI A;  1Q7Y 4;  2KLQ A;  2OQE C;  3F7X A;  5GSP A;  3D79 A;  4CZZ B;  4YHH T;  1LQG C;  4YLH A;  3DM8 A;  4KZ1 A;  1ULI B;  3AB3 B;  3UQ7 A;  4B3T T;  3CX7 B;  2QA7 A;  1WLX A;  4I0U A;  2XHE B;  2WQY A;  1IVX A;  3HIG A;  1IJ6 A;  4HM4 B;  2XM2 A;  1HX1 B;  2BG9 E;  1UCI A;  1D0Y A;  4FCM A;  4LFB T;  3MPH A;  4R9L A;  2KWI B;  4R9K A;  1MWT A;  4UV8 B;  1I2G A;  3B8L A;  5AQI B;  2X0Y A;  3M8C A;  3IF8 B;  3OYZ A;  1FUS A;  5AQJ B;  5KDM C;  2F86 B;  1KSI A;  4ZEY A;  3L0R A;  3AE2 A;  2NW7 A;  3N9N A;  4I5Q A;  2AXD S;  5AQV B;  3A8Y C;  1OHO A;  1ULJ B;  3I0O A;  5HWX A;  3HX8 A;  3ZN0 B;  1MMD A;  2BG9 A;  1O7W B;  2P0X A;  1BSB A;  2L3L A;  2FJA A;  3RGR A;  3C4X A;  1BR1 A;  3HA4 A;  2UGI A;  5AQS B;  4ZI3 D;  1FUW A;  4TWF A;  2KCD A;  2JMH A;  2RPA A;  1IVV A;  5G2G A;  2VVN A;  3L09 A;  3RKG A;  3MZK B;  3FG3 A;  4EV6 A;  1T2I A;  1KD1 4;  1E3V A;  2LOP A;  1RGK A;  4QXH B;  5DRE A;  1SAR A;  3FLJ A;  3O4X E;  2I6H A;  2E2A A;  4DR3 T;  2KXP B;  5ADX L;  3HK4 A;  4IE5 A;  3T8O A;  4B3R T;  3NWI A;  1S35 A;  2LOS A;  5ABF B;  2B24 B;  1WYB A;  4Q53 A;  5H6R B;  4WWU C;  2DNX A;  2L4V A;  3J7Y q;  4DMW A;  2LT3 A;  5BXQ A;  2OTL 3;  1YW0 A;  2DHR A;  1Q82 4;  1G73 A;  2P38 A;  1VQ6 3;  3NM7 A;  4N6L A;  3BIR A;  3AEB A;  3DP7 A;  4FI5 A;  3HKE E;  3GN5 B;  5ABE A;  3PV0 F;  1XDO A;  1EA2 A;  4P0B A;  4X2H A;  5HEG A;  1EZ3 A;  1S5A A;  5LHH B;  3CX8 B;  1BVI A;  1LRA A;  4BTY A;  5LYJ E;  1OHS A;  1LOV A;  3T8N A;  1QLB A;  2LLY A;  3SED A;  3NX0 A;  4ZS2 A;  1KQS 2;  5HEJ A;  1YGW A;  3DH2 A;  4HM3 B;  3PJA J;  2CFL A;  5IG4 A;  1Q40 B;  3FG1 A;  4HFE A;  4IPB A;  1I8V A;  1EUI C;  3LZA A;  1BRG A;  3IHR A;  5JR9 A;  5HEO A;  2HPJ A;  3DUK A;  3LXU X;  5ELU A;  4KUM B;  3TLU A;  3DY5 A;  2UXB T;  1GY5 A;  5CF1 A;  2K3D A;  2V7I A;  4JI8 T;  4CI1 B;  1BNR A;  4X66 T;  1FMW A;  5F8P A;  3CC2 3;  4UIG A;  4AIS A;  4HWC A;  1GMR A;  1MMG A;  2M67 A;  4MBQ A;  2XUE A;  2E9X C;  4QWN B;  3UNL A;  4DV0 T;  4U74 A;  1IYY A;  5AQN B;  5HXC A;  5C2T A;  1TRQ A;  3E08 A;  3WI3 A;  1MWU A;  2YN6 A;  1ASK A;  2E9X B;  1Z0P A;  3ZMV B;  3LH4 A;  2RP4 A;  3Q5W A;  2PNC A;  1G02 A;  1PU4 A;  1YKE B;  4L0R A;  3UU6 A;  1BOX A;  2KF3 A;  1X1Y A;  2W6J H;  4RNY A;  2C11 A;  4YT0 A;  2DWG A;  4B3S T;  4AKR B;  1WYC A;  2LM9 A;  2Z7A A;  4OK0 A;  3V5U A;  3I1A A;  4DR5 T;  3G16 A;  1JN5 A;  4WP5 A;  3X3Y A;  5AYS C;  3DGY A;  2NW8 A;  2XSA A;  3ZLI A;  4O2B E;  5HYA A;  3H37 A;  5LGT B;  3ZCJ A;  1KC8 4;  4U2Z A;  5L3F B;  1BAO A;  1DMQ A;  2J47 A;  1CUN A;  4DV6 T;  5JDN A;  1STD A;  3KZT A;  3UJM A;  1UI7 A;  1YQ4 A;  1U8C B;  1IVW A;  3U1W A;  1OF5 A;  4AKH A;  3LTD A;  1TJD A;  3CU3 A;  5FKY A;  2IC9 A;  2C4B A;  3AEE A;  1LNI A;  1T98 A;  4EYC A;  2QEX 3;  3JUN A;  3UUM A;  1WMP A;  1K41 A;  4PJJ A;  1I2F A;  3QC9 A;  3EF8 A;  1BRK A;  1I0X A;  5AEU B;  5BIR A;  3ZMU B;  5AFU L;  3KBT A;  3MYT A;  1T5Y A;  1MWR A;  2BT3 A;  3WMD A;  2DLR A;  3N9H A;  2GXF A;  1AR0 A;  2YX9 A;  4TNW A;  1EG9 B;  1I70 A;  3ER7 A;  3CCS 3;  4KX6 A;  4UF0 B;  1RTU A;  3J9X 1;  2CHO A;  3I9Y A;  4B3M T;  5CLK A;  2WWU A;  4DR4 T;  1N9E A;  2MAW A;  3LTA A;  3QOF A;  2RFR A;  1STF I;  4K61 A;  1SPU A;  1I3F A;  1MWS A;  3P8C D;  2Q07 A;  4KFF A;  2XSB A;  5KX5 E;  3AGO A;  2XFS A;  1CH0 A;  3FB2 A;  3HI2 A;  3V98 A;  1WR0 A;  3L39 A;  3FZW A;  1JZO A;  2CM0 A;  5A1L A;  2WGQ A;  1O7N B;  2Z76 A;  1ZKE A;  5AQK B;  2UUA T;  1FGQ A;  4GHO A;  3RI5 A;  4H9R C;  2Y74 A;  4HKA A;  1XZY A;  3EDU A;  3KV5 A;  4P09 A;  4HM7 B;  4WNK A;  5AII A;  4YTM A;  3N9O A;  1GD3 A;  2XQ7 A;  2J4G A;  4B6X A;  2OQE A;  3TLT A;  4MLK A;  2EHO C;  3EQQ B;  3UTK A;  4ORL A;  2YFI B;  3AE9 A;  3GMI A;  3CCQ 3;  3F7S A;  1VQK 3;  2SBL A;  5DRV A;  3HII A;  5ETW A;  3SFE A;  3S67 A;  3VHL A;  4K1U A;  3P4Q A;  2EHO B;  1XMO T;  1TU5 A;  3EBT A;  2A9U A;  3TKL B;  1IBM T;  1K28 A;  3P4S A;  5KP4 A;  1R8I A;  3U78 A;  3HL6 A;  3SLU A;  1RNT A;  3AE7 A;  2K0M A;  4BAY B;  1BUQ A;  4UV9 B;  3PUX F;  3FZL B;  1BNI A;  1Y4K A;  1XDP A;  2ES0 A;  5CA0 E;  1B2X A;  1Q81 4;  4JI0 T;  1YHQ 3;  4U31 A;  5FVL A;  3ROB A;  5M4Y A;  3V5S A;  5JRE A;  4EV2 A;  2X66 A;  3PU3 A;  1TFK A;  1RRL A;  4H3U A;  4JI6 T;  2LKH A;  5KXJ A;  2CG1 A;  3A5E A;  4CXW A;  4EXR A;  4F6R C;  2IC6 A;  4L9I A;  1NNV A;  3D5I A;  5D81 A;  1SHZ C;  2V7J A;  4I4T E;  4QXC B;  4MMX B;  4QX7 B;  3CML A;  1UCK A;  1WFD A;  3LSV A;  4N6U A;  1RJO A;  5ABF A;  4O2H A;  3SOY A;  2BU4 A;  2BS3 A;  1OH0 A;  3AAA B;  3CKD A;  2P09 A;  1XWM A;  3RC8 A;  3AVS A;  3K63 A;  2C5K T;  2CHN A;  4CDL A;  1XMQ T;  3ZG0 A;  5AQQ B;  3UUN A;  1KNZ A;  2WO0 A;  3KVA A;  3UUX B;  1GOU A;  4CN4 A;  1Q7H A;  1IDP A;  2CH9 A;  4HM1 B;  2OA5 A;  3HKB E;  1VRB A;  3LK4 2;  3PE0 A;  4PAG A;  2A72 A;  1O7H B;  4A56 A;  5LG3 A;  4LFA T;  1GOV A;  4LF8 T;  3LDQ B;  3BLZ A;  2OCT A;  5LP6 E;  4CI2 B;  4ZOL E;  1BNS A;  2ACX A;  5FYM A;  4BTX A;  3K1S A;  2KF4 A;  2IUB A;  4HVN A;  1BU4 A;  5D83 A;  4Z8X A;  5HEU A;  3F2E A;  1SJW A;  3NBX X;  3AEC A;  2BMO B;  3ONJ A;  1E97 A;  4DKI A;  1C7H A;  4P0A A;  3NBB A;  3GZB A;  4H9S E;  3S27 A;  2LJL A;  5FGO A;  5FY0 A;  2BZB A;  2V5D A;  5AQT B;  2AAE A;  3O1H A;  1WCR A;  5BMV E;  3P4R A;  3Q2M A;  2A3D A;  4HFC A;  1W6C A;  3CNM A;  2UXX B;  5LHI B;  4LEH A;  1ZS7 A;  4IL4 A;  7STD A;  3IPT A;  3K3O A;  4HKV B;  4WBN E;  2CE7 A;  3WOD G;  4O8S A;  3ANW B;  4LF5 T;  1YIT 3;  4XBX A;  3IJE B;  2W0Q A;  3VR8 A;  4XDW A;  3RHW A;  2HMM B;  1KF6 A;  2CX0 A;  3EN1 B;  1CYV A;  2XQY A;  5HAX A;  3RF1 A;  4DV1 T;  4TX4 A;  3Q5D A;  3CPW 2;  2YDS A;  1FGO A;  4CXX A;  5M1A A;  4X20 E;  2N2N A;  1D1A A;  1VQM 3;  3IA3 A;  3L8R A;  3Q5X A;  5LBM A;  4KBM B;  2CRB A;  1BIR A;  4FCZ A;  1IBL T;  2GEX A;  1VZZ A;  4L8O A;  3E99 A;  1RNB A;  2BVL A;  2CPT A;  4I43 B;  3TLW A;  2RA1 A;  4M1P A;  1C54 A;  3AEF A;  3NXJ A;  3ZT6 A;  3CK6 A;  1DMN A;  2XQ3 A;  3N9M A;  5M18 A;  4ILU A;  1HU9 A;  1L0V A;  1D1B A;  2W62 A;  2VQE T;  4KFE A;  3ZN1 B;  7GSP A;  1N8Q A;  4TV8 E;  2KZ7 B;  3AA0 B;  2INX A;  2JRK A;  1ROV A;  1IV9 A;  4LMJ A;  1BNG A;  1OF5 B;  4H9N C;  3NM2 A;  2WOF A;  4HOH A;  1KWI A;  1BGS A;  1W0A A;  1QAL A;  1DU2 A;  2CX1 A;  3A76 A;  1J5W A;  4AKZ A;  4TNV A;  3U97 A;  5HOH A;  3FZM B;  4AI6 A;  5BU4 A;  1V58 A;  2Z77 A;  2WS3 A;  4IDN A;  2YU1 A;  4RNZ A;  3LML A;  3PUY F;  3R6N A;  5EK4 A;  1HX8 A;  4OYK A;  4UF0 A;  2QVA A;  1RGA A;  2GSP A;  5LC7 A;  2A2F X;  2XAQ B;  4QXB B;  4H9Q C;  2CXD A;  3N9Q A;  1O3X A;  3ZC0 A;  4U13 A;  4LF9 T;  2W2U A;  3S28 A;  2IYJ A;  5D82 A;  1OUN A;  3KVB A;  2VQF T;  1QAF A;  1VQ7 3;  4NIQ A;  2PG8 A;  5HXE A;  2XH9 A;  1RDS A;  3I55 3;  1MMN A;  1FUT A;  4HBR A;  5LMU T;  2CIU A;  2HMK B;  2KXG A;  3EUH A;  1BR4 A;  1NU3 A;  2E9X D;  4L8P A;  1RSN A;  1YGE A;  2R41 A;  3ZKR A;  3BU4 A;  2UXD T;  2ZHX B;  1EKM A;  3ZJ1 A;  3QB5 A;  3Q1C A;  2UUB T;  1HTJ F;  2JQK A;  3PUG A;  2GU1 A;  4TWH A;  1IT7 A;  1HCI A;  2WDV A;  2CCQ A;  2GEY A;  2XQA A;  4IIA A;  4R80 A;  4LSO A;  2UXC T;  1OXZ A;  5JVD E;  1CQS A;  4AXP A;  4U2Y A;  3OVU A;  4UEL A;  2XQ6 A;  3NZP A;  4YHJ A;  2HH7 A;  2XQ9 A;  2K48 A;  1G0T A;  4HFV A;  3FBZ A;  4IIJ E;  3UL5 A;  4ILF A;  5AIH A;  1BNJ A;  3X3X A;  2ODV A;  1T3B A;  3JUM A;  3PTR B;  2EHO A;  2RBI A;  4U7I A;  4U33 A;  4O02 B;  1LRZ A;  1ZGX A;  1UUG B;  4Q25 A;  1VQ5 3;  2W66 A;  3CPZ A;  1E1H B;  2OWP A;  3ZEF B;  2J8X B;  1RN4 A;  4DV3 T;  3JAE A;  3ZYM A;  4E7S A;  3D4A A;  3NHX A;  4HM5 B;  2X9W A;  4WBO A;  4J5K A;  4IE4 A;  2XGL A;  4OVM A;  1AJ3 A;  2BMR B;  3OYX A;  2RCD A;  2JDI H;  5LGU B;  5LNK A;  3D0T A;  1KNP A;  1I6Z A;  1WTH A;  2BBJ A;  4ANJ A;  4DR6 T;  5IG3 A;  2Q9Q C;  1W2Z A;  2CWT A;  3PXM A;  1GQE A;  2STD A;  3HI7 A;  1B2U A;  4EIW A;  2BHM A;  3CNX A;  3SXX A;  4EEB A;  2BBH A;  4IE0 A;  4EB6 E;  4U7Y A;  2Q9Q B;  2JPF A;  3D9R A;  3C4Z A;  1JB4 A;  3KV4 A;  5EQL A;  1E2A A;  1GS3 A;  1CYU A;  5F5W A;  1IAP A;  1BAN A;  5AQH B;  3MXZ A;  2D5U A;  4G1M B;  4FR9 A;  2VKH A;  1YJ9 3;  1RGL A;  4FCJ A;  4ZXL A;  1MIV A;  4CJN A;  1M7K A;  3A7M A;  4ZI2 C;  1M62 A;  3T0U A;  5L4E A;  3RC3 A;  3ZT7 A;  2BIR A;  2YOE A;  1HNZ T;  4HFH A;  1SA0 E;  4BTW A;  3UQ4 A;  2GK9 A;  3ONL C;  2L9Q A;  2H3R A;  4NXN T;  1AVK A;  4I4K A;  3UU3 A;  4IDZ A;  4PJM A;  1B2S A;  3NV0 A;  4PFP A;  3DXO A;  2FGT A;  1YQ3 A;  1BRH A;  2X51 A;  5G1K A;  3P50 A;  4ADZ A;  2LQV A;  4LGQ A;  4MMZ B;  1W9R A;  3G6E 3;  4HJL B;  3AMO B;  2BO9 B;  4G2A A;  4A98 A;  4N6N B;  2GBW B;  1QVG 2;  1NEN A;  2V8S V;  3JUO A;  1ZP0 A;  2MBG A;  3CQC B;  2XSO B;  2C5I T;  4X1K E;  2B1E A;  5FP3 A;  1LKX A;  3VRB A;  2CLY C;  4GKJ T;  1AY7 A;  3RRC A;  3UU5 A;  2BVM A;  4YSX A;  3UB1 A;  4O4I E;  2XZE A;  1B2M A;  2VB6 A;  2EHO D;  2PBI A;  3M65 A;  5CB4 E;  4CCV A;  4JEU B;  3ANW A;  4J8T A;  3JC6 C;  5CJ5 A;  1PY3 A;  2ZM2 A;  2K24 A;  2X67 A;  4K1V A;  2CLY B;  4RZM A;  4WYK B;  4YFS A;  5L3E B;  4K0K T;  2X9Y A;  3STD A;  4H9P C;  1A2P A;  2JIW A;  2XAJ B;  1K73 4;  2YIN A;  2HML B;  1Q9E A;  1TFO A;  3Q90 A;  2QIY A;  1RKY A;  3DZL A;  3SFD A;  1BRS A;  4AQF C;  1LXE A;  1BRN L;  3ONX A;  1N8R 4;  4BA9 A;  2CXF A;  3MG1 A;  3EB8 A;  2OTJ 3;  4RBN A;  4HWD A;  3GZY B;  3C98 B;  4IDP A;  5AYR B;  2MF7 A;  3OWY A;  4QWT A;  1YJW 3;  1WRD A;  2E2U A;  4LF6 T;  2LM2 A;  4AKI A;  2K54 A;  2X68 A;  1HZ1 A;  2H0I A;  3RKO A;  4X5T A;  4H63 V;  3BNC A;  4O4L E;  3KN4 A;  3ZSS A;  3FH1 A;  2JJ9 A;  1D0Z A;  3N2O A;  3T1Y T;  1FGT A;  3LOY A;  5EEO A;  2XAG B;  4J2C A;  2FXT A;  1RRH A;  4N78 D;  2XAF B;  5DQW A;  3RYH E;  2E5V A;  2MPK A;  2XR8 B;  2ZL8 A;  3BNE A;  2XFT A;  5EVH A;  2ML6 A;  1O7M B;  5FNV E;  1VQQ A;  4TX5 A;  3TLS A;  2DCF A;  3E0Z A;  3ZT5 A;  1UI8 A;  1G96 A;  3T8U A;  1BR0 A;  4LF4 T;  4NUU A;  2OOV C;  3AEG A;  2FJB A;  3CQX C;  4UVB B;  1S72 3;  5DQV A;  3B4P A;  4CPK A;  4UVA B;  5IER A;  1R4C A;  2ML5 A;  2H88 A;  2JQQ A;  4ISS A;  4ASK A;  4DV7 T;  4UVC B;  1BRJ A;  1TUH A;  1RGC A;  3CCE 3;  4ILC A;  1NWW A;  5HEH A;  1JNQ A;  5CK6 A;  2E5L T;  3N5L A;  1TIJ A;  3RGL A;  3X1D A;  5JDM A;  4AQG A;  5GON E;  2XRX B;  3DGO A;  3FGY A;  3KII A;  3EBY A;  2WMN A;  4QH5 A;  2KF5 A;  3KIN B;  2F5M A;  2J62 A;  3PUR A;  3QUJ A;  3LBX B;  1HF8 A;  1D1C A;  5AQF B;  3BND A;  4LFC T;  3AE5 A;  3C4W A;  1N33 T;  3J7Y d;  3ZYK A;  4BIR A;  2XGN A;  5G1L A;  1OAC A;  3GZX B;  5HXS A;  1M9G A;  2NR4 A;  2B76 A;  4COF A;  3H3H A;  2JQ9 A;  3MJX A;  5FXV A;  4IDQ A;  2E2T A;  2XAS B;  4TN7 B;  4EGW A;  2YDQ A;  3OKQ A;  3SOL A;  3G0K A;  1WR6 A;  5A0O B;  4KVH A;  1DYU A;  2NP9 A;  2YK0 A;  3OWU A;  2KND A;  2XQ5 A;  1IQX A;  1JBS A;  1NDO B;  1KEY A;  5AQO B;  4PK4 A;  4XM4 A;  1Y64 B;  3I9W A;  4EBG A;  4JI3 T;  4EAH A;  3ZMZ B;  3V92 A;  1J1J A;  2XJ7 A;  5J2T E;  4TV9 E;  3ETV A;  2WMO A;  2RSX A;  2IML A;  3H3M A;  2P05 A;  1Z8U A;  1MIY A;  5L3G B;  3I0Q A;  3IBP A;  5KP1 A;  2W04 A;  4HGA A;  2CA5 A;  4BL3 A;  3BNB A;  5IWA T;  4LF7 T;  2X9H A;  1ZEE A;  3AGN A;  3EAM A;  4C91 A;  2KAA A;  3Q5E A;  2KRT A;  3NVO A;  5KMG P;  2FBW A;  5AI1 A;  2Y8D A;  1US7 B;  3MAC A;  3KDS E;  3FCS B;  3NQY A;  2HPL A;  2IMJ A;  2Y48 B;  3FZK B;  1HG2 A;  3UUB A;  1CEW I;  2M7O A;  2G0U A;  3LFM A;  1BSC A;  4DVD A;  4HM2 B;  2P0M A;  5AQU B;  3PUZ F;  2DI4 A;  2KWH A;  2CWO A;  5IHY A;  3H51 A;  2Q9Q A;  1UCU A;  3RIA A;  2ZLY A;  4IST A;  5FL0 A;  3RIU C;  2LHR A;  1M1X B;  1UX5 A;  2I0M A;  4PNI A;  4AKY A;  1B27 A;  3VSY A;  3GWH A;  1B2Z A;  3RLF F;  1RGH A;  1LOY A;  4BJN A;  3L3P A;  2KIN B;  5CFB A;  4DBQ A;  1N5H A;  3AEA A;  3VRA A;  2HN1 A;  3RRW A;  3FBL A;  1VOM A;  3OW2 2;  1KFY A;  1QMA A;  5AIG A;  3K3Q C;  3DMC A;  1FGR A;  4DND A;  4NRE A;  4YSZ A;  2SAR A;  3AA1 B;  3CCU 3;  4IGU A;  3RYI E;  1W4N A;  1W2B 2;  3ZST A;  3X42 A;  4EYY R;  4GYS A;  1LVK A;  1I3I A;  5RNT A;  3AE3 A;  4MFR A;  3NV0 B;  5J0Z A;  2NTY A;  1RCK A;  1T2H A;  3GWR A;  2E2V A;  3AMO A;  1IBK T;  3KKG A;  2O9U X;  2VKD A;  3D5G A;  3GRD A;  2WU2 A;  1NB5 I;  4IE7 A;  2AAD A;  2OV9 A;  3FF0 A;  1N5P A;  1IZN B;  3EN8 A;  3PUS A;  1GOY A;  2W67 A;  3I0Y A;  3PUA A;  2UUC T;  4EXT A;  1AQZ A;  3GZR A;  2ZMA A;  1LVN A;  3GA8 A;  3NRX A;  3LTB A;  5LGN B;  1YD8 G;  2RGQ A;  1FMV A;  2L8K A;  2XAH B;  3RIF A;  3UFG A;  4DR7 T;  3VGN A;  1M90 4;  4WYK A;  4JBW F;  1V57 A;  4K90 B;  1IQ8 A;  1A67 A;  3WDG B;  1BR2 A;  4KI0 F;  2HHH T;  2VUR A;  1ISK A;  4GKK T;  1D6Z A;  1E7P A;  1HYF A;  2V1L A;  3WR2 A;  4ZZC A;  4GK0 E;  3U3I A;  3D3L A;  5LOV E;  5IUX A;  4XBY A;  6STD A;  5BR8 T;  1DET A;  3SVA A;  4DBR A;  4HWH A;  1K8A 4;  4KP3 C;  1W01 A;  3CMA 3;  4KHP T;  3OWS A;  4XZC A;  3S5C A;  3KFQ C;  4AQF A;  3LK2 B;  1W0B A;  4ZZB A;  4FMD A;  2CHC A;  2W00 A;  2XF3 A;  5M19 A;  4BL2 A;  2VK9 A;  2HOH A;  2MYS A;  2ZM6 T;  1UUV B;  4R4K A;  3CPO A;  4HM8 B;  4WHA A;  4BJM A;  1L5G B;  2YEV C;  1MIW A;  2Q9Q D;  2CC3 A;  2GBX B;  4HFB A;  1HR0 T;  4WZX A;  1EEJ A;  4NPB A;  2NWB A;  2MOZ A;  3PUV F;  2BDE A;  3EX9 A;  1B20 A;  1MNE A;  4LZI A;  4NUV A;  3CME 3;  4HYZ A;  5LCY A;  1I0V A;  1OCV A;  2MC8 A;  1A2V A;  3CXC 2;  5JPU A;  3EE1 A;  3ZC1 A;  4YSY A;  3K0Z A;  1NEK A;  4ZI2 D;  5LMN T;  1TRP A;  5AQG B;  5LG4 A;  2W03 A;  2WY2 A;  1FZU A;  2W56 B;  2YFJ B;  2ZA4 A;  3ZJ2 A;  3O9X A;  4O3V A;  4MHC A;  3NBR A;  2XM1 A;  4GIW A;  5AIF A;  1E3R A;  1GYB A;  1YVB I;  4YJ2 E;  3P4P A;  1V9D A;  1RN1 A;  1VQP 3;  4EV5 A;  4ZI7 E;  2OOV A;  3FSD A;  2D0T A;  3AAE B;  4EZH A;  1ZO2 A;  4MAL A;  4DMV A;  4JI4 T;  3PCR A;  2W4X A;  3OBV E;  3AED A;  3K8P C;  4JYA T;  5CXO A;  4C90 A;  3LTC A;  5HGR A;  3CCR 3;  1U4Q A;  2MTQ A;  2C10 A;  1JZD A;  3SX1 A;  2WAU A;  2W2C A;  2FJD A;  3VKG A;  4YXD A;  1MOL A;  1LNH A;  4WYV A;  3N2G E;  2UU9 T;  2QYW A;  3LBX A;  2D9D A;  1PFP A;  3CCM 3;  3UUL A;  1AV4 A;  1RMS A;  2NW9 A;  1W6G A;  3SS1 A;  5HCJ A;  3G71 3;  1S94 A;  5HCM A;  2KSR A;  1H7C A;  3PUQ A;  2VKO A;  1UDI I;  4GOU A;  2IUK A;  3F9S A;  1QSD A;  2LKG A;  1T7S A;  4JI2 T;  2CXL A;  3S4U A;  3RH3 A;  1VQO 3;  4H63 H;  3PYJ A;  5LB7 B;  3QK6 A;  2F99 A;  2LSY A;  4X1Y E;  1OED C;  1DE3 A;  4MJD A;  5BVB A;  2F98 A;  1GMP A;  3RQU A;  9RNT A;  2V1D B;  3RQW A;  3FXE B;  2Y6X A;  5H6Q B;  1UW1 A;  3RPU A;  4WFO A;  1OED B;  4PK6 A;  3KE7 A;  4DV4 T;  1BRI A;  2WSS V;  3OJA A;  3QRD A;  3N9P A;  2N1G A;  1J2B A;  4AKG A;  2GU3 A;  5JH7 E;  3EVY A;  5JDQ A;  1OGZ A;  5LC6 A;  7RNT A;  1QJG A;  4AEQ A;  3PDY A;  5EK3 A;  2LSG A;  3RNT A;  5J1G A;  3CCJ 3;  1NAF A;  2PFV A;  3CQG B;  2FJE A;  1BNE A;  5HXR A;  4HE8 A;  3P4W A;  3N54 B;  1IU7 A;  2CKF B;  4F8H A;  2LSK A;  1ZX2 A;  8RNT A;  3GAX A;  3FKA A;  5IW9 A;  1N36 T;  4PEJ A;  2CWY A;  1X1W A;  2C5J A;  4A97 A;  3I56 3;  1ROA A;  4RNT A;  4X1I E;  4FMB A;  4X2O A;  2YU2 A;  3FHN A;  3MG2 A;  2H7O A;  2VKJ A;  4G63 A;  3G8Z A;  3ZG5 A;  2WDQ A;  4EZ4 A;  1SIH A;  5STD A;  3SOA A;  1IVU A;  4JI5 T;  2IW5 B;  3LT9 A;  4OUQ A;  1DVC A;  5C3J A;  2O3O A;  4CN6 A;  4HWI B;  1AVL A;  3KV9 A;  3EC9 A;  5I97 A;  4XDV A;  3UL6 A;  2N9D A;  4J9A A;  2WM9 A;  1RN7 A;  5L2L A;  1W02 A;  2LSI A;  3G4S 3;  5ABH A;  2XTL A;  3EDV A;  5IG5 A;  3RIU A;  1SII A;  1I94 T;  3QNU A;  4HN9 A;  3K7C A;  2Z6E A;  2CK3 H;  1MND A;  5FY1 A;  1VCS A;  4IDO A;  4DUY T;  3BQI A;  4QH4 A;  1ZHC A;  1BSA A;  2V6X A;  4L5G A;  4DUZ T;  5CF2 A;  1DVD A;  1JKG A;  2V7L A;  3NRY A;  1FA3 A;  1W5Z A;  5HWY A;  3JUP A;  2KMF A;  2D2S A;  4IHJ E;  3CCL 3;  5AQP B;  3JUQ A;  1O7G B;  3OV4 A;  1FIO A;  5JRC B;  1JB2 A;  2CFW A;  5FW5 A;  3CC4 3;  2BNG A;  5EK2 A;  1OPY A;  3BB9 A;  2CWV A;  5FMN A;  2ACZ A;  4STD A;  1UUW B;  1YVS A;  2V5C A;  2XEP A;  3F8X A;  3NQZ A;  3EAB A;  3EHZ A;  1RHL A;  1IQY A;  2HMJ B;  3LT8 A;  5JDF A;  2PZV A;  3PUW F;  4CN1 A;  2I9W A;  1F8N A;  3TLV A;  4O4H E;  3ALA A;  4X62 T;  5L3B B;  1JV2 B;  2BS2 A;  2LRK A;  4EW5 A;  1D0X A;  1SE7 A;  2IY2 A;  4LYL B;  2C0S A;  1RGF A;  1RGE A;  4HTE A;  2E8I A;  4DO0 A;  5EZY E;  2ZM0 A;  2UUG C;  1PYL A;  4GYR A;  3MKI A;  2V26 A;  2OLT A;  2LYX A;  4I55 E;  2HN2 A;  3KBU A;  2IDO B;  1W6Y A;  3JCF A;  1T72 A;  4GL6 A;  3UU8 A;  2X0H A;  2DL1 A;  2JMK A;  2WP9 A;  4YTP A;  2L1S A;  1SQW A;  3X3Z A;  4ILA A;  3P7I A;  5AQL B;  3MWZ A;  2LEH A;  3HZP A;  3WAJ A;  3M3Z B;  1VQ4 3;  3BQL A;  3WA2 X;  3SWH A;  1BUJ A;  2RNT A;  3K3N A; 
#chains in the Genus database with same CATH homology
 3FXD B;  3KFW X;  3F31 A;  3OXA A;  3CCV 3;  2CW9 A;  3CVR A;  2Y73 A;  3RDE A;  2WGO A;  4AKL A;  1JRQ A;  2CG0 A;  1W7C A;  4MEI A;  3K5T A;  5LXT E;  3TDG A;  1M1K 4;  3VKH A;  2PJQ A;  2LE8 A;  2W56 A;  3F57 A;  1EQK A;  1NB3 I;  5IYZ E;  5TGN A;  3N8B A;  4FJO A;  1G8X A;  4PK5 A;  3LG7 A;  3AA7 B;  1B7T A;  2R4I A;  3MKD A;  2B1X B;  5E0O A;  4HM6 B;  3CC7 3;  3HKD E;  5JQG E;  3X41 A;  5J2U E;  2H7V C;  4ZI3 C;  1YKH B;  3CX6 B;  2NTX A;  4H9O C;  4XAX B;  4JLE A;  2Z6B A;  2CWU A;  1V74 A;  1U5P A;  1FGM A;  1VQL 3;  3X40 A;  3LYG A;  3AA6 B;  2CMR A;  3Q9D A;  1MMA A;  1UX4 A;  4JF8 A;  2V7K A;  1HKX A;  3S29 A;  5HXH A;  4TUY E;  5IF6 A;  3FG4 A;  2W61 A;  2ODU A;  1X79 A;  4XBF B;  1IV7 A;  1Q42 A;  5LBQ B;  2FNQ A;  1WQL B;  4ZM8 A;  2HMN B;  5IEP A;  3WOE B;  3F8H A;  5ELJ A;  2W63 A;  3R84 B;  3EJV A;  2W0G A;  1Q86 4;  2X9X A;  2WBL A;  5FXX A;  3B4O A;  3RX6 A;  3LK3 B;  3VU7 H;  5TAO A;  3CWZ B;  4XBT A;  2XSH B;  3ZMS B;  2QGU A;  1HG5 A;  1A2K A;  2IAK A;  2VAS A;  3PU8 A;  2UX0 A;  3B13 A;  2ZDJ A;  5IG0 A;  5FY7 A;  3F14 A;  3N2K E;  2VL8 A;  3FF2 A;  4EC6 A;  5C8Y E;  2DWK A;  4LMI A;  1U5O A;  5JPP A;  3CD6 3;  1ZV4 X;  3LJC A;  2J1D G;  2QGS A;  3DGM A;  4GK5 E;  5L3C B;  2K9A A;  1QUU A;  3AAI A;  2X0L B;  4JRF A;  1JJ2 2;  3DGL A;  4O4J E;  4U72 A;  4N3V A;  4HM0 B;  3ZMT B;  3RGA A;  3RYC E;  1OWA A;  2A15 A;  5LA6 E;  1YI2 3;  3NZQ A;  4PJL A;  5AEW B;  8CHO A;  1YJN 3;  4FMC A;  4UEM A;  2UXN B;  5CA1 E;  3MG3 A;  3PGB A;  3EHC A;  3K9M C;  4JEH B;  3W15 B;  1JKG B;  1WNH A;  5JRC A;  3C64 A;  1GY6 A;  3DGN A;  1N9J A;  2D42 A;  5IEO A;  1US1 A;  3B57 A;  4IE6 A;  1NWM X;  2D0U A;  4UXN B;  1IT8 A;  2CEA A;  3MSO A;  3GN5 A;  1FEW A;  3ZYL A;  4YJ3 E;  3IEE A;  1GY7 A;  4CXY A;  1IK3 A;  1LOX A;  3O1I A;  4EYU A;  2IA7 A;  4GB5 A;  3ZCI A;  4ERR A;  5IEN A;  5L3D B;  4MMY B;  1Q40 A;  2LSJ A;  1KK7 A;  1OHP A;  3ECF A;  3PCS A;  5DAB A;  5JR9 C;  4WW0 A;  4XB5 A;  4O2A E;  5FXW A;  3C50 A;  4K0U A;  3DTO A;  1VQ8 3;  4PW8 A;  1D6Y A;  2W9Q A;  3AVR A;  4ZS3 A;  1JB5 A;  5JR9 B;  5DJQ C;  2NOX A;  2K5B B;  1A90 A;  5JDG A;  3E22 E;  4I50 E;  4N6M A;  1WMO A;  5JDH A;  4PFO A;  3SRZ A;  2V7M A;  1Z1S A;  2VWA A;  3KSP A;  3BK9 A;  3UFE A;  3HR0 A;  1DMM A;  2E9X A;  3ESL A;  4JUY A;  2SPC A;  3B7C A;  2I59 A;  1K9M 4;  3PZW A;  4H61 A;  2P9B A;  2LHN A;  4EOZ B;  1WMN A;  3DJB A;  3MHE A;  2CFD A;  4R1K A;  4IT7 A;  3F40 A;  2WOH A;  1VQ9 3;  2HMO B;  3A5X A;  3MK7 C;  1TP6 A;  1GD4 A;  2CFG A;  3NUV A;  1HFA A;  4N6T A;  3MA9 A;  1JN5 B;  4OFZ A;  4CI3 B;  2D1W A;  1HS7 A;  1D6U A;  4QX8 B;  4KFD A;  4OYJ A;  5LHG B;  2JQ5 A;  3QK9 A;  1W00 A;  4HEA A;  3ETU A;  3OX9 A;  3VF1 A;  5JBS A;  4HZB B;  2W9P A;  3RYF E;  3WAK A;  3UT5 E;  4L7K A;  5F3J A;  4NHF A;  3PS8 A;  1YIJ 3;  5JDL A;  4ZHQ E;  2KT9 A;  1O7P B;  3O8Y A;  2CFK A;  1MNL A;  4KMC A;  4QKN A;  4HZ9 B;  3WOF B;  4N6V 0;  2IUJ A;  2QA4 3;  4TZ4 C;  3WA3 A;  3N9L A;  3V99 A;  5KP3 A;  4V1A v;  1VQN 3;  3JC6 D;  1LVF A;  5LJM A;  2BMQ B;  3BQK A;  4QHO A;  4E7Z A;  4N6O B;  5FXZ A;  1NO3 A;  3KSE D;  4FMA A;  5LJN A;  3ZPO A;  1QAK A;  2ZM8 A;  4OHF A;  3NBJ A;  4PJN A;  1OGX A;  3KV6 A;  3IMA B;  3HKC E;  2YFL B;  3H3A A;  3O1J A;  3JVC A;  3Q2P A;  3C51 A;  1IJ5 A;  1NJI 4;  1QVF 2;  4CQI A;  1Q7Y 4;  2KLQ A;  2OQE C;  3F7X A;  4CZZ B;  4YLH A;  3DM8 A;  4KZ1 A;  1ULI B;  3AB3 B;  3CX7 B;  2QA7 A;  1WLX A;  2XHE B;  1IVX A;  3HIG A;  1IJ6 A;  4HM4 B;  4FCM A;  4R9L A;  1D0Y A;  3MPH A;  4R9K A;  2KWI B;  4UV8 B;  3B8L A;  3M8C A;  3IF8 B;  3OYZ A;  2F86 B;  5KDM C;  1KSI A;  3L0R A;  2NW7 A;  3N9N A;  1OHO A;  1ULJ B;  3I0O A;  5HWX A;  3HX8 A;  3ZN0 B;  1MMD A;  1O7W B;  2P0X A;  2L3L A;  3RGR A;  3C4X A;  1BR1 A;  3HA4 A;  4ZI3 D;  1FUW A;  2KCD A;  2JMH A;  1IVV A;  5G2G A;  3L09 A;  3MZK B;  3FG3 A;  1KD1 4;  1E3V A;  2LOP A;  4QXH B;  5DRE A;  3FLJ A;  3O4X E;  2KXP B;  5ADX L;  3HK4 A;  4IE5 A;  3T8O A;  1S35 A;  2LOS A;  2B24 B;  1WYB A;  4Q53 A;  5H6R B;  4WWU C;  2DNX A;  2L4V A;  3J7Y q;  4DMW A;  2LT3 A;  5BXQ A;  2OTL 3;  1YW0 A;  2DHR A;  1Q82 4;  1G73 A;  2P38 A;  1VQ6 3;  3NM7 A;  4N6L A;  3DP7 A;  4FI5 A;  3HKE E;  3GN5 B;  1EA2 A;  4P0B A;  4X2H A;  1EZ3 A;  1S5A A;  5LHH B;  3CX8 B;  4BTY A;  5LYJ E;  1OHS A;  3T8N A;  3SED A;  3NX0 A;  4ZS2 A;  1KQS 2;  4HM3 B;  2CFL A;  5IG4 A;  1Q40 B;  3FG1 A;  4IPB A;  3LZA A;  3IHR A;  5JR9 A;  3DUK A;  2HPJ A;  3LXU X;  5ELU A;  4KUM B;  3DY5 A;  1GY5 A;  5CF1 A;  2V7I A;  4CI1 B;  1FMW A;  5F8P A;  3CC2 3;  4UIG A;  1MMG A;  2M67 A;  4MBQ A;  2XUE A;  2E9X C;  4QWN B;  3UNL A;  4U74 A;  5HXC A;  3E08 A;  3WI3 A;  1ASK A;  2E9X B;  1Z0P A;  3ZMV B;  3LH4 A;  2RP4 A;  3Q5W A;  2PNC A;  1PU4 A;  1YKE B;  4L0R A;  2W6J H;  4RNY A;  2C11 A;  2DWG A;  4AKR B;  1WYC A;  2LM9 A;  2Z7A A;  4OK0 A;  3V5U A;  3I1A A;  3G16 A;  1JN5 A;  4WP5 A;  3X3Y A;  5AYS C;  2NW8 A;  3ZLI A;  4O2B E;  5HYA A;  3H37 A;  5LGT B;  3ZCJ A;  1KC8 4;  5L3F B;  1DMQ A;  1CUN A;  5JDN A;  1STD A;  3KZT A;  3UJM A;  1UI7 A;  1U8C B;  1IVW A;  3U1W A;  1OF5 A;  4AKH A;  3LTD A;  3CU3 A;  2IC9 A;  1T98 A;  4EYC A;  2QEX 3;  3JUN A;  3UUM A;  1WMP A;  1K41 A;  4PJJ A;  3QC9 A;  3EF8 A;  5AEU B;  3ZMU B;  5AFU L;  3KBT A;  3MYT A;  1T5Y A;  2BT3 A;  3WMD A;  2DLR A;  3N9H A;  2GXF A;  1AR0 A;  2YX9 A;  1EG9 B;  3ER7 A;  3CCS 3;  4UF0 B;  3J9X 1;  3I9Y A;  5CLK A;  2WWU A;  1N9E A;  3LTA A;  2RFR A;  1STF I;  4K61 A;  1SPU A;  3P8C D;  2Q07 A;  4KFF A;  5KX5 E;  2XFS A;  3FB2 A;  3HI2 A;  3V98 A;  3FZW A;  2CM0 A;  5A1L A;  2WGQ A;  1O7N B;  2Z76 A;  1ZKE A;  1FGQ A;  4H9R C;  2Y74 A;  4HKA A;  3EDU A;  3KV5 A;  4P09 A;  4HM7 B;  4WNK A;  5AII A;  3N9O A;  1GD3 A;  4B6X A;  2OQE A;  4MLK A;  2EHO C;  3EQQ B;  3UTK A;  4ORL A;  2YFI B;  3GMI A;  3CCQ 3;  3F7S A;  1VQK 3;  2SBL A;  5DRV A;  3HII A;  5ETW A;  3S67 A;  3VHL A;  4K1U A;  2EHO B;  1TU5 A;  3EBT A;  3TKL B;  1K28 A;  5KP4 A;  3U78 A;  3HL6 A;  3SLU A;  2K0M A;  4BAY B;  1BUQ A;  4UV9 B;  1Y4K A;  2ES0 A;  5CA0 E;  1Q81 4;  1YHQ 3;  3ROB A;  5M4Y A;  3V5S A;  5JRE A;  4EV2 A;  2X66 A;  3PU3 A;  1TFK A;  1RRL A;  4H3U A;  2CG1 A;  4CXW A;  4EXR A;  4F6R C;  2IC6 A;  4L9I A;  5D81 A;  1SHZ C;  2V7J A;  4I4T E;  4QXC B;  4MMX B;  4QX7 B;  3CML A;  4N6U A;  1RJO A;  4O2H A;  3SOY A;  1OH0 A;  3AAA B;  3CKD A;  2P09 A;  3RC8 A;  3AVS A;  3K63 A;  2C5K T;  4CDL A;  3UUN A;  1KNZ A;  2WO0 A;  3KVA A;  3UUX B;  1IDP A;  2CH9 A;  4HM1 B;  2OA5 A;  3HKB E;  1VRB A;  3LK4 2;  3PE0 A;  4PAG A;  2A72 A;  1O7H B;  4A56 A;  3BLZ A;  2OCT A;  5LP6 E;  4CI2 B;  4ZOL E;  2ACX A;  5FYM A;  4BTX A;  4HVN A;  5D83 A;  4Z8X A;  3F2E A;  1SJW A;  3NBX X;  2BMO B;  1E97 A;  1C7H A;  4P0A A;  3NBB A;  3GZB A;  4H9S E;  3S27 A;  2LJL A;  5FGO A;  5FY0 A;  2BZB A;  3O1H A;  5BMV E;  3Q2M A;  2A3D A;  1W6C A;  3CNM A;  2UXX B;  5LHI B;  4LEH A;  7STD A;  3IPT A;  3K3O A;  4HKV B;  4WBN E;  2CE7 A;  3WOD G;  4O8S A;  3ANW B;  1YIT 3;  4XBX A;  3IJE B;  2W0Q A;  4XDW A;  2HMM B;  3EN1 B;  1CYV A;  2XQY A;  5HAX A;  4TX4 A;  3CPW 2;  1FGO A;  4CXX A;  4X20 E;  2N2N A;  1D1A A;  1VQM 3;  3Q5X A;  5LBM A;  4KBM B;  4FCZ A;  2GEX A;  1VZZ A;  4L8O A;  3E99 A;  2BVL A;  4I43 B;  2RA1 A;  4M1P A;  3NXJ A;  1DMN A;  3N9M A;  4ILU A;  1HU9 A;  1D1B A;  2W62 A;  4KFE A;  3ZN1 B;  1N8Q A;  4TV8 E;  2KZ7 B;  3AA0 B;  2INX A;  2JRK A;  1ROV A;  1IV9 A;  1OF5 B;  4H9N C;  3NM2 A;  2WOF A;  1KWI A;  1QAL A;  3A76 A;  4AKZ A;  3U97 A;  4AI6 A;  2Z77 A;  2YU1 A;  4RNZ A;  3LML A;  3R6N A;  5EK4 A;  1HX8 A;  4OYK A;  4UF0 A;  5LC7 A;  2A2F X;  2XAQ B;  4QXB B;  4H9Q C;  2CXD A;  3N9Q A;  1O3X A;  3ZC0 A;  4U13 A;  3S28 A;  5D82 A;  1OUN A;  3KVB A;  1QAF A;  1VQ7 3;  2PG8 A;  5HXE A;  2XH9 A;  3I55 3;  1MMN A;  4HBR A;  2CIU A;  2HMK B;  2KXG A;  3EUH A;  1BR4 A;  1NU3 A;  2E9X D;  4L8P A;  1YGE A;  1EKM A;  3ZJ1 A;  3Q1C A;  1HTJ F;  3PUG A;  2GU1 A;  1IT7 A;  1HCI A;  2GEY A;  2CCQ A;  4IIA A;  4R80 A;  4LSO A;  1OXZ A;  5JVD E;  1CQS A;  4AXP A;  4UEL A;  3NZP A;  4YHJ A;  2HH7 A;  2K48 A;  4HFV A;  3FBZ A;  4IIJ E;  3UL5 A;  5AIH A;  3X3X A;  2ODV A;  3JUM A;  3PTR B;  2EHO A;  4O02 B;  1LRZ A;  1VQ5 3;  3CPZ A;  1E1H B;  2OWP A;  3ZEF B;  3ZYM A;  4HM5 B;  4E7S A;  3NHX A;  2X9W A;  4WBO A;  4IE4 A;  2XGL A;  4OVM A;  1AJ3 A;  2BMR B;  3OYX A;  2RCD A;  2JDI H;  5LGU B;  5LNK A;  3D0T A;  1WTH A;  4ANJ A;  5IG3 A;  2Q9Q C;  1W2Z A;  2CWT A;  3PXM A;  2STD A;  3HI7 A;  4EIW A;  2BHM A;  3CNX A;  3SXX A;  4IE0 A;  4EB6 E;  2Q9Q B;  2JPF A;  3D9R A;  3C4Z A;  1JB4 A;  3KV4 A;  5EQL A;  1GS3 A;  1CYU A;  1IAP A;  3MXZ A;  2D5U A;  4G1M B;  4FR9 A;  2VKH A;  1YJ9 3;  4FCJ A;  1MIV A;  4ZI2 C;  3T0U A;  3RC3 A;  1SA0 E;  4BTW A;  2GK9 A;  2L9Q A;  2H3R A;  1AVK A;  4I4K A;  4IDZ A;  4PJM A;  3NV0 A;  4PFP A;  3DXO A;  2FGT A;  2X51 A;  4ADZ A;  2LQV A;  4LGQ A;  4MMZ B;  3G6E 3;  4HJL B;  3AMO B;  2BO9 B;  4G2A A;  4N6N B;  2GBW B;  1QVG 2;  3JUO A;  2MBG A;  3CQC B;  2XSO B;  2C5I T;  4X1K E;  2B1E A;  5FP3 A;  1LKX A;  2CLY C;  3RRC A;  2BVM A;  3UB1 A;  4O4I E;  2VB6 A;  2EHO D;  2PBI A;  3M65 A;  5CB4 E;  4CCV A;  4JEU B;  3ANW A;  4J8T A;  3JC6 C;  2ZM2 A;  2K24 A;  2X67 A;  4K1V A;  2CLY B;  4RZM A;  4WYK B;  4YFS A;  5L3E B;  2X9Y A;  3STD A;  4H9P C;  2XAJ B;  1K73 4;  2YIN A;  2HML B;  1TFO A;  3Q90 A;  2QIY A;  1RKY A;  3DZL A;  1LXE A;  4AQF C;  3ONX A;  1N8R 4;  4BA9 A;  2CXF A;  3MG1 A;  3EB8 A;  2OTJ 3;  4RBN A;  3GZY B;  3C98 B;  5AYR B;  2MF7 A;  3OWY A;  4QWT A;  1YJW 3;  1WRD A;  2E2U A;  4AKI A;  2K54 A;  2X68 A;  3RKO A;  4H63 V;  3BNC A;  4O4L E;  3KN4 A;  3FH1 A;  2JJ9 A;  1D0Z A;  3N2O A;  1FGT A;  3LOY A;  5EEO A;  2XAG B;  4J2C A;  2FXT A;  1RRH A;  4N78 D;  2XAF B;  2ZL8 A;  5DQW A;  2XR8 B;  3RYH E;  3BNE A;  2XFT A;  5EVH A;  2ML6 A;  1O7M B;  5FNV E;  4TX5 A;  2DCF A;  3E0Z A;  1UI8 A;  1G96 A;  3T8U A;  1BR0 A;  4NUU A;  2OOV C;  3CQX C;  4UVB B;  1S72 3;  5DQV A;  3B4P A;  4UVA B;  5IER A;  1R4C A;  2ML5 A;  2JQQ A;  4ISS A;  4ASK A;  4UVC B;  1TUH A;  3CCE 3;  1NWW A;  1JNQ A;  5CK6 A;  3N5L A;  1TIJ A;  5JDM A;  4AQG A;  5GON E;  2XRX B;  3DGO A;  3FGY A;  3KII A;  3EBY A;  2WMN A;  3KIN B;  3PUR A;  3QUJ A;  3LBX B;  1HF8 A;  1D1C A;  3BND A;  3C4W A;  3J7Y d;  3ZYK A;  2XGN A;  1OAC A;  3GZX B;  5HXS A;  1M9G A;  3H3H A;  3MJX A;  5FXV A;  2E2T A;  2XAS B;  4TN7 B;  3OKQ A;  3SOL A;  3G0K A;  1WR6 A;  5A0O B;  4KVH A;  1DYU A;  2NP9 A;  2YK0 A;  3OWU A;  2KND A;  1IQX A;  1NDO B;  4PK4 A;  4XM4 A;  1Y64 B;  3I9W A;  4EBG A;  4EAH A;  3ZMZ B;  3V92 A;  5J2T E;  4TV9 E;  3ETV A;  2WMO A;  2RSX A;  2P05 A;  1MIY A;  5L3G B;  3I0Q A;  3IBP A;  5KP1 A;  2W04 A;  4HGA A;  2CA5 A;  3BNB A;  2X9H A;  1ZEE A;  4C91 A;  2KRT A;  5KMG P;  5AI1 A;  2Y8D A;  1US7 B;  3MAC A;  3KDS E;  3FCS B;  3NQY A;  2HPL A;  2IMJ A;  2Y48 B;  1HG2 A;  1CEW I;  2M7O A;  2G0U A;  3LFM A;  4DVD A;  4HM2 B;  2P0M A;  2DI4 A;  2KWH A;  2CWO A;  5IHY A;  3H51 A;  2Q9Q A;  1UCU A;  2ZLY A;  4IST A;  2LHR A;  1M1X B;  1UX5 A;  4PNI A;  4AKY A;  3VSY A;  3GWH A;  4BJN A;  3L3P A;  2KIN B;  4DBQ A;  1N5H A;  3RRW A;  3FBL A;  1VOM A;  3OW2 2;  1QMA A;  5AIG A;  3K3Q C;  3DMC A;  1FGR A;  4DND A;  4NRE A;  3AA1 B;  3CCU 3;  4IGU A;  3RYI E;  1W4N A;  1W2B 2;  3X42 A;  4EYY R;  4GYS A;  1LVK A;  4MFR A;  3NV0 B;  2NTY A;  3GWR A;  2E2V A;  3AMO A;  3KKG A;  2O9U X;  2VKD A;  3GRD A;  1NB5 I;  4IE7 A;  3FF0 A;  1N5P A;  1IZN B;  3EN8 A;  3PUS A;  3I0Y A;  3PUA A;  4EXT A;  3GZR A;  2ZMA A;  1LVN A;  3GA8 A;  3NRX A;  3LTB A;  5LGN B;  1YD8 G;  2RGQ A;  1FMV A;  2L8K A;  2XAH B;  3VGN A;  1M90 4;  4WYK A;  4K90 B;  1IQ8 A;  1A67 A;  3WDG B;  1BR2 A;  1ISK A;  1D6Z A;  2V1L A;  4GK0 E;  3U3I A;  3D3L A;  5LOV E;  6STD A;  4XBY A;  3SVA A;  4DBR A;  1K8A 4;  4KP3 C;  1W01 A;  3CMA 3;  3OWS A;  4XZC A;  3S5C A;  3KFQ C;  4AQF A;  3LK2 B;  4FMD A;  2CHC A;  2W00 A;  2XF3 A;  2VK9 A;  2MYS A;  1UUV B;  4WHA A;  4R4K A;  3CPO A;  4HM8 B;  4BJM A;  1L5G B;  2YEV C;  1MIW A;  2Q9Q D;  2CC3 A;  2GBX B;  2NWB A;  2MOZ A;  2BDE A;  3EX9 A;  1MNE A;  4LZI A;  4NUV A;  3CME 3;  4HYZ A;  5LCY A;  1OCV A;  2MC8 A;  1A2V A;  3CXC 2;  5JPU A;  3EE1 A;  3ZC1 A;  3K0Z A;  4ZI2 D;  2W03 A;  5LG4 A;  2W56 B;  2YFJ B;  3ZJ2 A;  3O9X A;  4O3V A;  4MHC A;  3NBR A;  4GIW A;  5AIF A;  1E3R A;  1GYB A;  1YVB I;  4YJ2 E;  1V9D A;  1VQP 3;  4EV5 A;  4ZI7 E;  2OOV A;  3FSD A;  2D0T A;  3AAE B;  4EZH A;  1ZO2 A;  4MAL A;  4DMV A;  3PCR A;  3OBV E;  3K8P C;  5CXO A;  4C90 A;  3LTC A;  5HGR A;  3CCR 3;  1U4Q A;  2MTQ A;  2C10 A;  3SX1 A;  2WAU A;  2W2C A;  3VKG A;  1MOL A;  1LNH A;  3N2G E;  3LBX A;  1PFP A;  3CCM 3;  3UUL A;  1AV4 A;  2NW9 A;  1W6G A;  3SS1 A;  3G71 3;  1S94 A;  1H7C A;  3PUQ A;  2VKO A;  4GOU A;  2IUK A;  3F9S A;  1QSD A;  2CXL A;  3S4U A;  3RH3 A;  1VQO 3;  4H63 H;  3PYJ A;  2F99 A;  3QK6 A;  2LSY A;  4X1Y E;  4MJD A;  5BVB A;  2F98 A;  2V1D B;  3FXE B;  2Y6X A;  5H6Q B;  1UW1 A;  3RPU A;  4WFO A;  4PK6 A;  3KE7 A;  2WSS V;  3OJA A;  3QRD A;  3N9P A;  2N1G A;  1J2B A;  4AKG A;  2GU3 A;  5JH7 E;  3EVY A;  5JDQ A;  1OGZ A;  5LC6 A;  1QJG A;  4AEQ A;  3PDY A;  5EK3 A;  2LSG A;  5J1G A;  3CCJ 3;  1NAF A;  2PFV A;  3CQG B;  5HXR A;  4HE8 A;  3N54 B;  1IU7 A;  2CKF B;  2LSK A;  1ZX2 A;  3GAX A;  3FKA A;  5IW9 A;  4PEJ A;  2CWY A;  2C5J A;  3I56 3;  1ROA A;  4X1I E;  4FMB A;  4X2O A;  2YU2 A;  3FHN A;  3MG2 A;  2H7O A;  2VKJ A;  4G63 A;  3G8Z A;  4EZ4 A;  1SIH A;  5STD A;  3SOA A;  1IVU A;  2IW5 B;  3LT9 A;  4OUQ A;  1DVC A;  2O3O A;  1AVL A;  3KV9 A;  3EC9 A;  5I97 A;  4XDV A;  3UL6 A;  2N9D A;  4J9A A;  2WM9 A;  1RN7 A;  5L2L A;  1W02 A;  2LSI A;  3G4S 3;  2XTL A;  3EDV A;  5IG5 A;  1SII A;  4HN9 A;  3K7C A;  2Z6E A;  2CK3 H;  1MND A;  5FY1 A;  3BQI A;  1ZHC A;  4L5G A;  5CF2 A;  1DVD A;  1JKG A;  2V7L A;  3NRY A;  1FA3 A;  1W5Z A;  5HWY A;  3JUP A;  2KMF A;  2D2S A;  4IHJ E;  3CCL 3;  3JUQ A;  1O7G B;  3OV4 A;  1FIO A;  5JRC B;  1JB2 A;  2CFW A;  5FW5 A;  3CC4 3;  2BNG A;  5EK2 A;  1OPY A;  3BB9 A;  2CWV A;  5FMN A;  4STD A;  1UUW B;  2XEP A;  3F8X A;  3NQZ A;  1IQY A;  2HMJ B;  3LT8 A;  5JDF A;  2PZV A;  2I9W A;  1F8N A;  4O4H E;  3ALA A;  5L3B B;  1JV2 B;  1D0X A;  2C0S A;  4HTE A;  2E8I A;  4DO0 A;  5EZY E;  2ZM0 A;  4GYR A;  3MKI A;  2V26 A;  2LYX A;  4I55 E;  3KBU A;  1W6Y A;  4GL6 A;  2JMK A;  1SQW A;  3X3Z A;  3P7I A;  3MWZ A;  2LEH A;  3HZP A;  3WAJ A;  1VQ4 3;  3BQL A;  3WA2 X;  3SWH A;  3K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...