4O8SA

Crystal structure of jhp933 from helicobacter pylori
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
232
Chain Sequence
b'SLSEQALNHEKLMRAIVKNLADTPMVLKGETALYLGYGLNRFSEDLDFDCHKKINLLGRVKSAIPNGIILNDIHIKKDTDSVGRYMVRYATKDNKEEQTLKLEISYRDAPKESEVNVIEGMRIAKIERIIDNKLCACFDGEHTRTKARDLFDLHFLAKHYEEHFNLDLASRLKDFSKDPDKLVSDYLVDVKLDALLNQIMDLEETALELGVMAQLIHKKLEKQSHSLNALQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative
publication title Crystal Structure Confirmation of JHP933 as a Nucleotidyltransferase Superfamily Protein from Helicobacter pylori Strain J99
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 76
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2013-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08843 AbiEii Nucleotidyl transferase AbiEii toxin, Type IV TA system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1790 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4o8sA02
3.10.450.620 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4o8sA01
4O8SA 4OK0A
chains in the Genus database with same CATH superfamily
2J8XB 5HXCA 1EUIC 2B1EA 3EB8A 2V7MA 3RC8A 4F8HA 1ULJB 4O3VA 2HN2A 1UI8A 3AA7B 2I59A 4YTMA 4A5XA 1I94T 1LKXA 1S35A 1BNRA 3PYJA 1GOUA 5F8PA 2Z6BA 4DKIA 2YDSA 1BUJA 3RC3A 3I0YA 2V5DA 1JJ22 3AB3B 4K61A 2KF5A 2BMQB 1NB5I 3AAAB 4YSYA 2BZBA 4JI8T 3AECA 3PU3A 4TWFA 3RQUA 2OV9A 5M18A 3H3MA 1Q7HA 2W0QA 1Q814 2DI4A 2E8IA 2JQ5A 1OH0A 3AE5A 3ZYKA 1HS7A 3LFMA 1GMRA 3I553 1T72A 4B6XA 2QGUA 1T2IA 1UK5A 4O4LE 1YJ93 3WAJA 4AEQA 1OHSA 3SWHA 2LKHA 1ULIB 5AIFA 3I9WA 3L09A 4OK0A 1LOWA 4N6V0 5AYRB 2LYXA 1R4YA 4XB5A 4KUMB 3MKDA 4DR7T 3J7Yd 3KV4A 4A97A 5D83A 1W4NA 4UV9B 3K8PC 1TRQA 4R4KA 4RNTA 3PUGA 1CYVA 3ONXA 2M7OA 4MALA 3FGYA 3FKAA 1RGGA 3ZMSB 1JNRA 3LK3B 4GL6A 3UULA 4ZEYA 4OX9T 2BVLA 1OPYA 1RTUA 2IW5B 4GKKT 1B27A 3HKCE 2IIUA 2W9QA 4YXDA 4LMKA 5LP6E 1FZUA 3OPCA 1ZX2A 1Q42A 2KCDA 5TAOA 3IEEA 1LXEA 1BNJA 3PCSA 2CLYC 3ZPOA 2LQVA 4FCMA 4HM4B 2CE7A 5KMGP 5LBQB 2XEPA 3LDQB 5EQLA 3A7MA 1UDII 3AE8A 2RSXA 3FZKB 4TUYE 3HK4A 4IE0A 5FXWA 3CCL3 4JI6T 1BSBA 2F4VT 2CX1A 1UCJA 2ZA4A 4ZI2C 2C11A 3MXZA 2QA7A 4IDNA 4P0AA 3DGLA 1RRHA 1T7SA 1IQXA 3K3NA 3Q1CA 3AVSA 3HI7A 2IDOB 4QH5A 4A98A 2CK3H 3ALAA 1RKYA 1UUWB 4TNWA 1RGLA 2W66A 5L47A 5JTGA 4ZI2D 5FL1A 1IQYA 3KSPA 1E3RA 3MWZA 2BKNA 2H89A 1RGCA 1Y01A 3UU5A 1SUMB 5AQIB 2E2VA 3CCJ3 4YY3T 3KIIA 5JREA 1I2GA 2F56A 1BRJA 1VCSA 3NKZA 5HCMA 1MMDA 1ZGXA 4U33A 5DQWA 3JCFA 4ISTA 2W4XA 4WP5A 4KI0F 4WHAA 3PTRB 4DVDA 2P38A 4AKRB 3O1IA 2XASB 2F5MA 2YFJB 5KX5E 1XZYA 5AQKB 3VR8A 5KDMC 5IERA 2PNCA 4WW0A 4N6OB 3SFEA 3A76A 1RJOA 2UU9T 2HPJA 4AIUA 1FJGT 1MNLA 1UCKA 1D0ZA 1E7PA 1FYSA 3CC73 2ML5A 3BU4A 3RYFE 1MWTA 3TLTA 3RPUA 2GEYA 3JUQA 3ZMTB 2CFDA 3LTAA 3CX6B 5AQOB 2WMOA 2BIRA 2X9XA 4HKAA 3UFGA 4HM8B 3ANWA 2FXTA 3RLFF 5AQFB 2FJAA 1AV4A 2XUEA 3CME3 4DNDA 4Z91A 3IPTA 1Q7Y4 4U13A 1ZS7A 1M1K4 3JUNA 2WS3A 1G8XA 5FY1A 4ANJA 3WOFB 5M4YA 3CCS3 4STDA 2WZHA 4H9PC 1EG9B 2ZDJA 4IREA 4DV4T 2XFSA 3M65A 3B8LA 4COFA 2W63A 2ZM0A 4LF6T 1T8BA 5HEJA 2N2NA 4YJ3E 5ELUA 1KD14 2CWVA 4BAYB 5JR9B 2O9UX 2J1DG 2Z76A 3HOHA 5ABFB 4U31A 3K5TA 3ZC1A 1U5OA 5CLKA 2GEXA 4L7KA 1D1CA 1WLXA 5M19A 4DBRA 4BL3A 4IT4A 4I50E 2AADA 5HXHA 2XQ5A 4LFBT 1J5ET 4LYLB 5JBSA 2AXDS 1UGIA 3CPZA 2ZM6T 5FY7A 1BSCA 1QVF2 1AR0A 2WU5A 3LSVA 3NV0B 3PDYA 2Y74A 3GZBA 2JMKA 1DVCA 4HM1B 4BTXA 2V6YA 3RRCA 4I5QA 2LOPA 2BHMA 1FGQA 3P4PA 5CA1E 5D81A 2NTYA 4K1VA 2IAKA 2V7IA 2CWOA 2V1LA 5I97A 3DY5A 5CA0E 3Q3FA 1V74A 5AQUB 1HG5A 3X3XA 3B4OA 1YIT3 4IIAA 1BRIA 3SOAA 4DIDB 4HZ9B 1B2ZA 1Z0PA 3OVUA 2GSPA 2C10A 1IZNB 2X66A 5AQPB 3H3HA 5IENA 2IUKA 5HEHA 3LBXB 4EZ4A 3EBYA 4DR1T 1RN4A 2CX0A 2FJEA 3HX8A 2WB5A 1TIJA 5H6RB 3KVBA 2LOSA 4QXHB 3S28A 3DGNA 1D6ZA 3QK9A 3NM2A 4NIQA 3N9NA 1IU7A 3TKLB 9RNTA 2UXNB 2CHOA 3GN5A 2KF6A 3CC43 4AKYA 1ZP0A 3DGMA 1HFAA 3RKGA 3C98B 4TX4A 4L9IA 3R84B 4IDQA 3O4XE 4TN7B 2XR8B 3F8HA 2BG9B 5JPUA 3C4ZA 4DV1T 3OX9A 4CN1A 3UL5A 3UT5E 2PG8A 5LXTE 5JVDE 3FBLA 2XSBA 4DUZT 4HFHA 2GBXB 3RKOA 2VL8A 3IMAB 3EC9A 1DE3A 3AVRA 4X1IE 4HVNA 3FH1A 1J5WA 5JRCA 3P4WA 4DV6T 2P05A 3LH4A 1PY3A 2KMFA 1I2FA 2GU1A 2C0SA 2JMHA 3DTOA 2OQEC 3GRDA 2YFIB 2QA43 2AE9A 1G0TA 4B3TT 2W00A 2VURA 4AQGA 2PFVA 2LEHA 2LRLA 4IE6A 4YFSA 3IA3A 4ZHQE 1RGFA 1FGMA 3MA9A 4HZBB 4QH4A 5LG3A 1W7CA 2X0YA 1ZKEA 2FUPA 3GAXA 4IE5A 4CJNA 5ABGA 2I0MA 4H63V 3Q5DA 1FGOA 1US1A 4N3VA 4OYJA 1B2XA 3PUZF 3LK2B 3X41A 1NENA 2JQ9A 4DR2T 3UB1A 1JV2B 3OW22 3G06A 5AQNB 1AY7A 1PU4A 1VQ83 1GS3A 2H7OA 4U7YA 1RSNA 4WFOA 3LTCA 2CCQA 3LT8A 5HGRA 4UF0B 1KC84 2XAFB 3N9LA 2D0TA 5J0ZA 2K54A 4HAAA 3FF0A 3U97A 2KAAA 1SARA 4Z8XA 4EV2A 3QK6A 3QC9A 1D6UA 4BL2A 4H61A 5BMVE 1IJ5A 5L3CB 5IG3A 1UURA 2XRXB 4ILCA 3K3OA 2A3DA 3WHOA 4HTEA 1NEKA 3VHLA 1X79A 3AA0B 3A8YC 2WSSV 1DETA 2NW8A 3S5CA 1S723 4LMJA 3OYZA 1EEJA 1SIHA 2JQHA 2JQQA 4YJ2E 1D0YA 4PFPA 3N8BA 5IG4A 3VR9A 4N6NB 4PEJA 2E9XB 2F4YA 5IEOA 8CHOA 3UNLA 2D0UA 4H9RC 1OEDC 2UGIA 3KZTA 4EV5A 3EX9A 2LSIA 1KF6A 5TGNA 2BKPA 1VQM3 2WU2A 1GQEA 2HMNB 1RNTA 4DO0A 2C5KT 3C64A 3T1YT 1A2VA 1AVLA 4LF7T 5A1LA 3MKIA 1IVWA 4X62T 1IBKT 1JBTA 3CCV3 5FXXA 5LB7B 2LHRA 2WAUA 3FLJA 1HR0T 4XBXA 5FW5A 1S94A 5FVLA 2A9UA 4EXTA 2XSAA 4LFAT 2L4VA 3PJAA 1O7WB 3SOYA 1HNXT 1VQQA 1EA2A 1CEWI 3OV4A 3FZMB 4HEAA 3Q5XA 1JB4A 2K0MA 3SFDA 3UUMA 2W04A 1HG2A 3CQXC 4L8OA 3BQIA 3HKBE 4AI6A 3N9QA 5FP3A 2Y6XA 5HAXA 4HFIA 4P09A 1GOVA 5EK3A 3NRXA 3NHXA 5GONE 3AE1A 1IT7A 4AQFA 2FGTA 3MHEA 1O7MB 1UCIA 4ILAA 2MAWA 3P4RA 1IQ8A 3AE9A 4MMZB 5FNVE 1E97A 2P0XA 3CMA3 2UXDT 1WMNA 2YFLB 1OWAA 2VQET 2MOZA 1TUHA 1N8QA 1GMPA 3HZPA 2HPLA 5HEGA 3EDUA 4WYKB 3UU8A 4TWDA 5JDLA 2CFGA 4IT7A 2R6GF 1LOVA 2CRBA 4FJOA 5JDQA 3GZXB 3P4SA 2XAHB 3RIFA 4CN4A 3N9HA 1NWMX 1HX1B 1W2ZA 2VKHA 3J7Yq 1JZDA 2RCDA 4ILFA 2Y48B 2E2AA 4HFVA 2OCTA 2CFLA 3ZT5A 1VQO3 1UW1A 4DBQA 2XY8B 3X40A 5LGTB 2IHR1 1MNDA 3EUHA 1LRAA 2FJBA 1TTOA 5DABA 3V92A 5H6QB 3BNCA 1BANA 3FZWA 5G2GA 3HKEE 4TZ4C 2N1GA 3A5XA 4CQIA 2UUAT 3WA3A 3F31A 1IVXA 2CXDA 2CC3A 3QRDA 4KMCA 3K1SA 2Q9QC 3EQQB 1PYLA 1VQ53 2KXGA 1FMVA 3V99A 2DNXA 3PCRA 2MYSA 4K90B 1YKEB 4H9OC 3RIUC 1H7CA 3PE0A 4EEBA 4CXXA 1G96A 1NJI4 3QB5A 3KVAA 5ABHA 3ZSTA 1W9RA 1BOXA 3VKHA 1UI7A 1U4QA 2I9WA 2XH9A 3UJMA 3C50A 2OQEA 1GMQA 5AQQB 1EZ3A 3AXJB 4QX8B 4I0UA 1BGSA 3DGYA 4TX5A 3RRWA 5CB4E 3G713 3MJXA 4OYKA 4N6MA 4GKJT 2QRXA 3Q90A 1X9BA 3RDEA 4O4JE 2L9QA 1VQ93 2BKOA 1YI23 4O4IE 2IC9A 3KV9A 1OHOA 2W6JH 2XQ8A 4LSOA 1WMOA 2WDQA 4AISA 1DU2A 3WMDA 1WR6A 3GA8A 1B2MA 3KKGA 2JJ9A 1T5YA 4O02B 2AAEA 1BSEA 2K3DA 2RBIA 4LGQA 1V57A 5AEWB 2YINA 1CUNA 2XSHB 4KHPT 3VSYA 1FGRA 1B3SA 3JADA 3V98A 4N6LA 4CCVA 4BJNA 4AKGA 2W56A 5AQVB 2IUBA 2KLQA 2CG1A 2YU2A 2KF3A 3JUOA 3HIGA 4DV2T 1BSDA 2X9YA 1ISKA 2A15A 2KWHA 5CF1A 4K1UA 1LNIA 3PGBA 4QHOA 3RGAA 2XM2A 3GZRA 1JRQA 3C4XA 1V58A 2VKOA 3CNMA 4CI2B 4HE8A 2W2UA 2W67A 4MBQA 2ZL8A 2XAGB 2UXCT 1LOXA 1Q864 4KFDA 1X1WA 5LCYA 2YOEA 1I8VA 1HKXA 3ZCJA 3ZLIA 3K7CA 1MOLA 5F3JA 4MLKA 4E7ZA 2L8KA 1WQLB 1QALA 3KSED 4EEDA 5DREA 4DV5T 3CNXA 1JKGA 1GD3A 4R9KA 2GBWB 4AKHA 4EYUA 1HCIA 1OEDA 3WODG 3JC6C 1B21A 4EBGA 1RGEA 4CI1B 1OEDE 4X2HA 3HIIA 3F9SA 1O7NB 1OGZA 3BNDA 2WQYA 4ZXLA 4K0KT 2M67A 1M1XB 3ZG0A 2XF3A 4EW5A 4B3RT 2LM9A 1SA0E 4JEHB 4RZMA 1G73A 1Y4KA 2K48A 5AEUB 1RGHA 1YQ4A 3ZMVB 2V26A 1RCLA 3ZEFB 2XQ9A 3CPW2 3ZCIA 4QXBB 1RLSA 5IG5A 2YKSA 5BR8T 4L0RA 4DR4T 2GU3A 2UUBT 3KBUA 4OUQA 4ZM8A 1DMMA 1W09A 1XNRT 4I4KA 2LHNA 3AEEA 3VGNA 2RFRA 1JB2A 4UVAB 1HNWT 2CXLA 3G8ZA 3IF8B 3PJAJ 5RNTA 5ADXL 1BIRA 2EHOC 2G0UA 4HOHA 2IC6A 4J8TA 5CGMA 1W5ZA 2UUCT 2M6IA 1B20A 4NPBA 1A2PA 3PURA 4AKZA 2HH7A 4YT0A 1JB5A 2BU4A 1DMNA 3N5LA 1QMAA 2X51A 3GZYB 2MPKA 2W0GA 2K24A 4PFOA 3U3IA 4GK5E 5IYZE 2OTL3 1WRDA 5L3EB 2YDRA 2E2TA 2NW9A 5JDFA 3MACA 2J4GA 1GOYA 2EHOD 5JDMA 1X1XA 3Q2MA 5EZYE 4NXNT 2P09A 4TNVA 5IUXA 2KF4A 5IEPA 5FYMA 1BRGA 3CVRA 5LYJE 4J5KA 2A72A 2XQ4A 5DJQC 3RIAA 1VQP3 1CQSA 4DV7T 3SYUA 1RCKA 3WAKA 3FZHB 2KT9A 3AMOA 4IHJE 3AE3A 1FEWA 4C91A 2F5WA 3NQZA 2ML6A 1FUTA 4JI7T 2QEX3 3CCM3 4MHCA 2UXXB 2PBIA 3RYIE 5LJNA 3ZSSA 2UX0A 3RGRA 4GHOA 4PK6A 4PJNA 1VQN3 3CMLA 5BXQA 2XJ7A 2W62A 1MMNA 1BNEA 1KNZA 3FZFB 4L8PA 3LXUX 5LGUB 3AEDA 1VOMA 2Q9QA 2WOHA 4GYRA 2CH9A 3FB2A 3L8RA 2DWGA 3CX8B 3W15B 2DL1A 1BRHA 1UCLA 2N9DA 4NXMT 3RIUA 5JDHA 1BRNL 3SX1A 5KP3A 2VQFT 5L3GB 4XZCA 4IGUA 2BBHA 1F8NA 3F40A 4N6TA 3NM7A 1E1HB 2LM2A 1BNSA 3AHWA 3ANWB 2BDEA 3VU7H 1X1YA 3KFQC 1D1AA 1VRBA 3LOYA 3B57A 1ZEEA 3Q9DA 1GY5A 1OUNA 2CHCA 1YD8G 5G1KA 2RNTA 2KWIB 4X66T 3ETVA 4YTNA 3AEGA 3PUVF 2F99A 4XBFB 1BRSA 1E3VA 1OACA 1Q824 4ZOLE 1QAKA 1YJW3 4A56A 5FXVA 1C54A 2H0HA 3UUNA 4ILBA 4KBMB 3LJCA 1MGWA 3ZJ2A 1CHUA 2ZMAA 4IDOA 4FMBA 2LRKA 4WBOA 3AAIA 4X64T 1HYFA 3BNBA 4LZIA 1V9DA 2CBIA 3ZJ1A 5L4HA 3UU3A 2B76A 5E0OA 5FXZA 2CKFB 1JN5A 4HM0B 3PUYF 1ZHCA 1N8R4 4MMXB 2SARA 3KCHA 1U5PA 3FZLB 2K3WA 4N78D 4YTPA 3VF1A 3KINB 5C8YE 1J1JA 3F8XA 2VL0A 1NU3A 1L5GB 3TLVA 2YK0A 1YXRA 2DWKA 3F14A 3NUVA 1MIYA 2JPFA 3EHCA 5LA6E 3AE2A 3UQ4A 2V6YB 4KFFA 2BMOB 4UR9A 2WOFA 3ETUA 1UGHI 4H9QC 2ACXA 2B1XB 1YGWA 2RA1A 4GOUA 1IK3A 3FF2A 2E2UA 4TV8E 5CK6A 2LE8A 4HYZA 2P0MA 5KP4A 4YLHA 1K41A 5LHHB 4KZ1A 1YKHB 3NZPA 3LTDA 4JI4T 2KZ7B 5AQJB 3CK6A 1IBMT 1TP6A 2L1SA 2Y73A 1TRPA 4O4HE 4H9SE 5BIRA 1O3XA 4FR9A 1VCTA 1TJDA 4UVCB 3F57A 4FMDA 5L3BB 3KV6A 1AJ3A 5HXEA 5AQTB 1S5AA 2XGLA 3CCU3 2Z7AA 3DMCA 2PTFA 1BNFA 5AQMB 4H9NC 1YNVX 3GN5B 2CFWA 1K8A4 4GB5A 5STDA 3WOEB 4EC6A 1GD4A 2XGNA 1L0VA 5IF6A 5HOHA 3G16A 1STDA 2LSKA 3V5UA 3NVOA 3PS8A 1WNHA 3SVAA 3QOFA 4EYYR 1FUWA 5FY0A 4V1Av 4H63H 2CWTA 2C5JA 5JH7E 3RYHE 3TLWA 4HKVB 5CF2A 4PW8A 2F86B 3KDSE 2VKDA 1Q40A 1U8CB 2KSRA 3L39A 5JRCB 3H37A 3UL6A 2CWUA 3MSOA 2VKJA 1QVG2 2SBLA 5CXOA 5EVHA 1X1UA 3BQLA 2EHOA 2DCFA 2WM9A 1QJGA 2CFKA 2J47A 4QKNA 3LMLA 1BU4A 2CG0A 3ONJA 4KHZF 4OVMA 1UX4A 4PNIA 1A67A 1W00A 3FBZA 3E08A 4CDLA 2H0IA 2LSJA 2Y8DA 2WDVA 2D5UA 1FA3A 2QIYA 4HM2B 2BT3A 2RGQA 1IVUA 2XQAA 2YEVC 1SPUA 2HOHA 1HX8A 1K28A 5LHGB 3H3AA 2XQYA 4BTWA 3CPOA 4ZI7E 1AVKA 4HWHA 3FG3A 3AA6B 1N9EA 1UCUA 2O3OA 5ETWA 1DYUA 1N36T 3AHSA 4FMAA 5D82A 4YSXA 1LVNA 3B5MA 1I3IA 4OFZA 1B2SA 3LZAA 4N6UA 2STDA 1NB3I 3BNEA 3ZT7A 3T8UA 1B7TA 4EIWA 3SEDA 3KE7A 5JR9C 2PZVA 2H88A 2ODUA 2VK9A 3RQWA 2RPAA 2A2FX 1YJN3 2XAQB 5AIHA 2W61A 3LT9A 5FVKA 3PUXF 1O7PB 3MPHA 2ZHXB 4Q25A 1UUSA 4HN9A 1R8IA 1RHLA 4I43B 3X3YA 3EHZA 3ROBA 4KT3B 1HTJF 2KXPB 2WY2A 4I4TE 1JNZA 3VRBA 4FCZA 4HJLB 3EE1A 4PAGA 5LG4A 2R41A 5L3FB 3SRZA 4IIJE 3M8CA 4IDPA 3B4PA 1JBSA 2B24B 3AAEB 2QGSA 1RRLA 3MK7C 1IT8A 5JPPA 2WMNA 4HFBA 1I6ZA 3S27A 3WDGB 2KRTA 1WR0A 1RN7A 2INXA 2V8SV 2XZEA 4QWNB 4C90A 5JDGA 1OCVA 2CW9A 3GSPA 1GSPA 3RX6A 2D2SA 3KV5A 5EEOA 4J9AA 5IG0A 3CWZB 2XM1A 2CHNA 2YDQA 4KX6A 4MFRA 3E22E 2CA5A 3KBTA 4WZXA 4EXRA 1IDPA 4BIRA 3DUKA 1WTHA 1VQ73 1AQZA 3I9YA 3BQKA 5C3JA 4BTYA 5LJMA 4TWHA 1YHQ3 2GK9A 4U2YA 2VB6A 3AA1B 2DHRA 4HWDA 4EB6E 1WCRA 1MMGA 3TDGA 3S67A 3RF1A 1ZO2A 4O2BE 2KNDA 4IE7A 3V5SA 1FW7A 3AEFA 1N9JA 4XM4A 2BG9C 4UV8B 3I1AA 3E0ZA 2ES0A 3P50A 2HMOB 5JQGE 3B13A 5AI1A 3GMIA 1N33T 1HNZT 2JRKA 4ISSA 3I563 4ILUA 2WGQA 3AGNA 3HI2A 1OXZA 5LMUT 1ASKA 5A0OB 2IY2A 3C4WA 3RYCE 4AKIA 2Q9QD 2XAJB 1NO3A 1XDOA 1VZZA 4LF4T 4CN6A 3ZKRA 2WO0A 3WR2A 2BO9B 4YSZA 5J1GA 3R6NA 3NBBA 1YW0A 2VVSA 1A2KA 3OBVE 1BR1A 3IJEB 2OOVC 2IMLA 3RGLA 3NQYA 1RNBA 4UELA 1LVFA 2ODVA 3O1JA 4WWUC 2NR4A 4MJDA 2D1WA 4XBTA 4XDVA 1K9M4 1OF5A 4IL4A 1SQWA 3EN1B 2V7KA 1SJWA 3FXEB 3ZN0B 4CI3B 1LOYA 5IHYA 1IV7A 3PUAA 3LTBA 3FCSB 2X0LB 1M904 1BR4A 1K734 2WWUA 5EK2A 5ABEA 1MIVA 1W6GA 4R80A 2WBLA 5DRVA 3JAEA 1GYBA 3PXMA 5LOVE 2YX9A 4LMIA 1E2AA 2CXFA 3OTOT 1UGOA 3CQCB 1KNRA 4PK4A 2YN6A 4XAXB 2ZLYA 1BSAA 3OXAA 2FBWA 1MMAA 3F7XA 4DV3T 3OJAA 3ZMZB 3CCR3 5L4EA 3CCE3 3PZWA 1GY7A 4LF5T 7GSPA 2VVNA 4U2ZA 6GSPA 2XSOB 5AIIA 2KINB 3AGOA 2F98A 1T2HA 3PV0F 4U74A 4H3UA 3NX0A 4AKLA 2Z77A 3ONLC 3QB5K 2XHEB 1MNEA 3ZC0A 1IYYA 2YU1A 1O7HB 2HN1A 3ECFA 3S29A 2R4IA 5LC7A 5HXRA 3CU3A 3JUPA 3N2OA 2WZIA 3RHWA 5LGNB 1NAFA 3IBPA 1JZOA 2E9XC 4ASKA 3ZT6A 3G6E3 3RI5A 1ROAA 3FXDB 3N9MA 3CQGB 1KSIA 2VASA 1OF5B 4R9LA 5M1AA 1G02A 1Z1SA 4G2AA 1RGKA 3D3LA 4GIWA 2W2CA 5HWXA 2UUGC 1W6YA 3RNTA 3PUSA 8RNTA 2W9PA 3JC6D 1N32T 3UTKA 1HU9A 1VQK3 3EDVA 1JNQA 3S4UA 4G1MB 2E9XD 2K9AA 1GY6A 1IBLT 5JR9A 4JI1T 2V6XA 3CIRA 3KN4A 5ABFA 3NBRA 2W56B 3HKDE 5J2UE 4YHHT 3FHNA 2D9DA 5LHIB 1IV9A 1FMWA 3ESLA 5AYSC 4LMLA 4JI0T 4JEUB 3DGOA 4QH1A 2XPKA 3EF8A 4FCJA 2E5LT 7RNTA 2H7VC 1FGTA 1ZV4X 1XMOT 2E5VA 4JI3T 3D79A 2CBJA 3N9OA 1D6YA 2LSGA 1N5HA 2K5BB 4O2AE 1KK7A 1LQMB 3N54B 1M7KA 3T1HT 3DM8A 4WYVA 3OWUA 4KVHA 3NV0A 3CX7B 4HWIB 3OWSA 3Q5WA 3K3QC 3OYXA 1KFYA 1Z8UA 1DMQA 3PU8A 4LF9T 4NUVA 4PK5A 2I6HA 1SHZC 5C2TA 5AQHB 4LEHA 5HWYA 2V7LA 1NDOB 1TU5A 1JKGB 3MG2A 3K63A 4HFCA 1OEDB 4U3CA 1D0XA 4EV6A 2BNGA 3SS1A 1W02A 4HFDA 3AEBA 3GWHA 4IE4A 3E99A 2QYWA 4NPPA 3N9PA 4P1NA 2C4BA 3ER7A 3EABA 4IPBA 1KNPA 4HGAA 5FMNA 4G63A 4X5TA 2IA7A 2W03A 4UXNB 4PJLA 4I55E 3K9MC 3LBXA 3D4AA 3JUMA 2XQ3A 4LF8T 7STDA 5GSPA 4JYAT 2ZM2A 2MTQA 5BVBA 1Y64B 1DVDA 1W0BA 3HA4A 1CH0A 1MGRA 1XWMA 5HXSA 2MF7A 2BMRB 2HMLB 4F6RC 3T8NA 2X9WA 4HM3B 4AXPA 2JQKA 2IYJA 1ROVA 4J5GA 3CXC2 4EYCA 4ERRA 3ZG5A 4WBNE 2NOXA 1OHPA 1XDPA 2NTXA 4U72A 2GXFA 2HMJB 3KFWX 1W6CA 3D0TA 2BG9A 1EKMA 4O8SA 4K0UA 4QX7B 3TLUA 3SXXA 4CZZB 2BG9E 1I3FA 2CPTA 1B2UA 5L3DB 4KP3C 2J62A 3LK42 4QWTA 3ZN1B 2V5CA 2V7JA 1VQ63 4X65T 4UEMA 2X0HA 4R1KA 2HMKB 4AQFC 2PJQA 4JRFA 4JLEA 1RN1A 3G0KA 3O1HA 3CCQ3 3ZYLA 4X20E 5BU4A 1LRZA 3WA2X 3U78A 2WCAA 3OKQA 5HCJA 2WWVA 1WYCA 2OOVA 2BBJA 4X2OA 3EJVA 4JBWF 4E7SA 1BR0A 2XQ6A 3VKGA 4DMWA 2XFTA 1YIJ3 4HM5B 4ZS3A 2JIWA 3NWIA 5ELJA 4DV0T 2RP4A 4B3ST 1T98A 2NW7A 3AMOB 1KEYA 1YGEA 4GYSA 2VWAA 4BJMA 4MEIA 1VQ43 1M62A 1RMSA 5AIGA 3X1DA 4JF8A 2M6BA 4QXCB 3L3PA 1Q9EA 2XQ7A 4EAHA 3MZKB 1C7HA 2BS2A 2QVAA 3T8OA 2WGOA 4NHFA 4JUYA 4HWCA 2Q9QB 5IWAT 2LT3A 4PJMA 3NZQA 1QSDA 1A90A 1FIOA 3DZLA 2D42A 1IVVA 1I0XA 4X1KE 5AQRB 3T0UA 4UF0A 2P9BA 4GK0E 4ZZBA 2UXBT 4NREA 5LMNT 1R4CA 1WMPA 3ZFZA 5DQVA 4CXYA 3AE7A 2DLRA 3UUBA 4DR6T 3WI3A 1QAFA 2X68A 3NXJA 2BS4A 1LNHA 4BA9A 3EAMA 1WYBA 4L5GA 2CMRA 1QUUA 4JV5T 4O2HA 3UUXB 2WDRA 5LBMA 3GWRA 4YHJA 5FL0A 1CYUA 4GSPA 3CC23 1W01A 3HR0A 3I0QA 2FNQA 3JAFA 5IW9A 2JDIH 4J2CA 1J2BA 3NBJA 4HM6B 4RNYA 3M3ZB 2E9XA 5F5WA 2H3RA 4CXWA 5AQGB 2OA5A 3QNUA 3ZYMA 3AE6A 3D9RA 5FKYA 3DJBA 5CFBA 2Q07A 4KFEA 3A5EA 3P4QA 3STDA 5JDNA 6RNTA 2BVMA 4FI5A 3EN8A 5KP1A 4XBYA 3NRYA 1HZ1A 3JVCA 3TLSA 3I0OA 3SLUA 1WFDA 3URPA 4UVBB 3CD63 4OHFA 1JN5B 5EK4A 2X67A 1SE7A 3BB9A 1XMQT 4PJJA 1JBRA 2FJDA 1IAPA 1XNQT 3PUWF 5HEUA 1T3BA 4EOZB 3FSDA 5L2LA 1ZOYA 1N34T 3UU6A 4B3MT 1RDSA 5CJ5A 1W2B2 1EQKA 2IMJA 1OGXA 2MBGA 4HBRA 3D5IA 2CLYB 3ABVA 1UX5A 2LJLA 1QLBA 1STFI 3DP7A 1BNIA 3N2GE 2CWYA 4JI2T 4XDWA 2OTJ3 3MG1A 1M9GA 5AQLB 3DH2A 5LNKA 3EI0A 3B7CA 3G4S3 1I2EA 3FG4A 2X9HA 3CKDA 1BAOA 3P8CD 1PFPA 3PUQA 3RH3A 4JI5T 3VRAA 4EZHA 2L3LA 3SOLA 3MYTA 5G1LA 3J9X1 2CIUA 3U1WA 1NWWA 1D1BA 3UQ7A 3Q5EA 4DR3T 4WYKA 4AQYT 5FGOA 2NP9A 1US7B 2SPCA 3LG7A 2Z6EA 3AE4A 1IJ6A 4ZS2A 1BRKA 2C5IT 1N5PA 1HF8A 3BLZA 3QUJA 4MMYB 4LFCT 2H0GA 2HHHT 3UU4A 4HWFA 4DMVA 1I70A 3X42A 3UFEA 3X3ZA 2ACZA 4M1PA 1YVSA 3DXOA 1KWIA 4DR5T 1BVIA 1MIWA 4IDZA 4U7IA 4ZI3C 1O7GB 3K0ZA 1BUQA 1MWUA 5KXJA 1Q40B 3AEAA 2LSYA 4Z90A 3HL6A 4EGWA 1LQGC 4FMCA 3H51A 3OWYA 4IL9A 2OLTA 1YVBI 1UUVB 3P7IA 2EHOB 3O8YA 1SIIA 3EVYA 1UUGB 3LYGA 2WP9A 4P0BA 4RBNA 4ZZCA 1TFOA 4HM7B 1MWSA 4ZI3D 2NWBA 3L0RA 2BS3A 3BIRA 1I0VA 2ZM8A 6STDA 5AQSB 2XTLA 5AFUL 1NNVA 3AXJA 4X1YE 5HYAA 3FG1A 1W0AA 3F2EA 3O9XA 3N2KE 3EBTA 2OWPA 4RNZA 1BNGA 3D5GA 3MG3A 1YQ3A 2LLYA 2IUJA 3ZMUB 1MWRA 4DUYT 4CPKA 4Q53A 4TV9E 5HEOA 2CEAA 1FUSA 4UIGA 1TFKA 2LKGA 1KQS2 3BK9A 1LVKA 4WNKA 1VQL3 2CM0A 4NUUA 2V1DB 3F7SA 4ADZA 3C51A 5LC6A 3NBXX 2MC8A 1RGAA 1BR2A 3Q2PA 4BU4A 5J2TE 4HFEA 3IHRA 4ORLA 2HMMB
chains in the Genus database with same CATH topology
5HXCA 3EB8A 2B1EA 2V7MA 3RC8A 1ULJB 4O3VA 1UI8A 3AA7B 2I59A 1LKXA 1S35A 3PYJA 5F8PA 2Z6BA 3RC3A 3I0YA 1JJ22 3AB3B 4K61A 2BMQB 1NB5I 3AAAB 2BZBA 3PU3A 2W0QA 1Q814 2DI4A 2E8IA 2JQ5A 1OH0A 3ZYKA 1HS7A 3LFMA 3I553 4B6XA 2QGUA 4O4LE 1YJ93 3WAJA 4AEQA 1OHSA 3SWHA 1ULIB 5AIFA 3I9WA 3L09A 4OK0A 4N6V0 5AYRB 2LYXA 4XB5A 4KUMB 3MKDA 3J7Yd 3KV4A 5D83A 1W4NA 4UV9B 3K8PC 4R4KA 3PUGA 1CYVA 3ONXA 2M7OA 4MALA 3FGYA 3FKAA 3ZMSB 3LK3B 4GL6A 3UULA 2BVLA 1OPYA 2IW5B 3HKCE 2W9QA 5LP6E 1ZX2A 1Q42A 2KCDA 5TAOA 3IEEA 1LXEA 3PCSA 2CLYC 2LQVA 3ZPOA 4FCMA 4HM4B 2CE7A 5KMGP 5LBQB 2XEPA 5EQLA 2RSXA 4TUYE 3HK4A 4IE0A 5FXWA 3CCL3 4ZI2C 2C11A 3MXZA 2QA7A 4P0AA 3DGLA 1RRHA 1IQXA 3K3NA 3Q1CA 3AVSA 3HI7A 2CK3H 3ALAA 1RKYA 1UUWB 4ZI2D 1IQYA 3KSPA 1E3RA 3MWZA 2E2VA 3CCJ3 3KIIA 5JREA 1MMDA 5DQWA 4ISTA 4WP5A 4WHAA 3PTRB 4DVDA 2P38A 4AKRB 3O1IA 2XASB 2YFJB 5KX5E 5KDMC 5IERA 2PNCA 4WW0A 4N6OB 3A76A 1RJOA 2HPJA 1MNLA 1D0ZA 3CC73 2ML5A 3RYFE 3RPUA 2GEYA 3JUQA 3ZMTB 2CFDA 3LTAA 3CX6B 2WMOA 2X9XA 4HKAA 4HM8B 3ANWA 2FXTA 1AV4A 2XUEA 3CME3 4DNDA 3IPTA 1Q7Y4 4U13A 1M1K4 3JUNA 1G8XA 5FY1A 4ANJA 3WOFB 5M4YA 3CCS3 4STDA 4H9PC 1EG9B 2ZDJA 2XFSA 3M65A 3B8LA 2W63A 2ZM0A 2N2NA 4YJ3E 5ELUA 1KD14 2CWVA 4BAYB 5JR9B 2O9UX 2J1DG 2Z76A 3K5TA 3ZC1A 1U5OA 5CLKA 2GEXA 4L7KA 1D1CA 1WLXA 4DBRA 4I50E 5HXHA 5JBSA 3CPZA 5FY7A 1QVF2 1AR0A 3NV0B 3PDYA 2Y74A 3GZBA 2JMKA 1DVCA 4HM1B 4BTXA 3RRCA 2LOPA 2BHMA 1FGQA 5CA1E 5D81A 2NTYA 4K1VA 2IAKA 2V7IA 2CWOA 2V1LA 5I97A 3DY5A 5CA0E 1V74A 1HG5A 3X3XA 3B4OA 1YIT3 4IIAA 3SOAA 4HZ9B 1Z0PA 2C10A 1IZNB 2X66A 3H3HA 5IENA 2IUKA 3LBXB 4EZ4A 3EBYA 3HX8A 1TIJA 5H6RB 3KVBA 2LOSA 4QXHB 3S28A 3DGNA 1D6ZA 3QK9A 3NM2A 3N9NA 1IU7A 3TKLB 2UXNB 3GN5A 3CC43 4AKYA 3DGMA 1HFAA 3C98B 4TX4A 4L9IA 3R84B 3O4XE 4TN7B 2XR8B 3F8HA 5JPUA 3C4ZA 3OX9A 3UL5A 3UT5E 2PG8A 5LXTE 5JVDE 3FBLA 2GBXB 3RKOA 2VL8A 3IMAB 3EC9A 3AVRA 4X1IE 4HVNA 3FH1A 5JRCA 2P05A 3LH4A 2KMFA 2GU1A 2C0SA 2JMHA 3DTOA 2OQEC 3GRDA 2YFIB 2QA43 2W00A 4AQGA 2PFVA 2LEHA 4IE6A 4YFSA 4ZHQE 1FGMA 3MA9A 4HZBB 1W7CA 1ZKEA 3GAXA 4IE5A 4H63V 1FGOA 1US1A 4N3VA 4OYJA 3LK2B 3X41A 3UB1A 1JV2B 3OW22 1PU4A 1VQ83 1GS3A 2H7OA 4WFOA 3LTCA 2CCQA 3LT8A 5HGRA 4UF0B 1KC84 2XAFB 3N9LA 2D0TA 2K54A 3FF0A 3U97A 4Z8XA 4EV2A 3QK6A 3QC9A 1D6UA 4H61A 5BMVE 1IJ5A 5L3CB 5IG3A 2XRXB 3K3OA 2A3DA 4HTEA 3VHLA 1X79A 3AA0B 2WSSV 1S723 2NW8A 3S5CA 3OYZA 1SIHA 2JQQA 4YJ2E 1D0YA 4PFPA 3N8BA 5IG4A 4N6NB 4PEJA 2E9XB 5IEOA 8CHOA 3UNLA 2D0UA 4H9RC 3KZTA 4EV5A 3EX9A 2LSIA 5TGNA 1VQM3 2HMNB 4DO0A 2C5KT 3C64A 1A2VA 1AVLA 3MKIA 5A1LA 1IVWA 3CCV3 5FXXA 2LHRA 2WAUA 3FLJA 4XBXA 5FW5A 1S94A 4EXTA 2L4VA 1O7WB 3SOYA 1EA2A 1CEWI 3OV4A 4HEAA 3Q5XA 1JB4A 2K0MA 3UUMA 2W04A 1HG2A 3CQXC 4L8OA 3BQIA 3HKBE 4AI6A 3N9QA 5FP3A 2Y6XA 5HAXA 4P09A 5EK3A 3NRXA 3NHXA 5GONE 1IT7A 4AQFA 2FGTA 3MHEA 1O7MB 1IQ8A 4MMZB 5FNVE 1E97A 2P0XA 3CMA3 1WMNA 2YFLB 1OWAA 2MOZA 1TUHA 1N8QA 3HZPA 2HPLA 3EDUA 4WYKB 5JDLA 2CFGA 4IT7A 4FJOA 5JDQA 3GZXB 2XAHB 3N9HA 1NWMX 1W2ZA 2VKHA 3J7Yq 2RCDA 2Y48B 4HFVA 2OCTA 2CFLA 1VQO3 1UW1A 4DBQA 3X40A 5LGTB 1MNDA 3EUHA 5DABA 3V92A 5H6QB 3BNCA 3FZWA 5G2GA 3HKEE 4TZ4C 2N1GA 3A5XA 4CQIA 3WA3A 3F31A 1IVXA 2CXDA 2CC3A 3QRDA 4KMCA 3EQQB 2Q9QC 1VQ53 2KXGA 1FMVA 3V99A 2DNXA 3PCRA 2MYSA 4K90B 1YKEB 4H9OC 1H7CA 3PE0A 4CXXA 1G96A 1NJI4 3KVAA 3VKHA 1UI7A 1U4QA 2I9WA 2XH9A 3UJMA 3C50A 2OQEA 1EZ3A 4QX8B 4TX5A 3RRWA 5CB4E 3G713 3MJXA 4OYKA 4N6MA 3Q90A 3RDEA 4O4JE 2L9QA 1VQ93 1YI23 4O4IE 2IC9A 3KV9A 1OHOA 2W6JH 4LSOA 1WMOA 3WMDA 1WR6A 3GA8A 3KKGA 2JJ9A 1T5YA 4O02B 4LGQA 5AEWB 2YINA 1CUNA 2XSHB 3VSYA 1FGRA 3V98A 4N6LA 4CCVA 4BJNA 4AKGA 2W56A 2KLQA 2CG1A 2YU2A 3JUOA 3HIGA 2X9YA 1ISKA 2A15A 2KWHA 5CF1A 4K1UA 3RGAA 3PGBA 4QHOA 3GZRA 1JRQA 3C4XA 2VKOA 3CNMA 4CI2B 4HE8A 4MBQA 2ZL8A 2XAGB 1LOXA 1Q864 4KFDA 5LCYA 1HKXA 3ZCJA 3ZLIA 3K7CA 1MOLA 5F3JA 4MLKA 4E7ZA 2L8KA 1WQLB 1QALA 3KSED 5DREA 3CNXA 1JKGA 1GD3A 4R9KA 2GBWB 4AKHA 4EYUA 1HCIA 3WODG 3JC6C 4EBGA 4CI1B 4X2HA 3HIIA 3F9SA 1O7NB 1OGZA 3BNDA 2M67A 1M1XB 2XF3A 2LM9A 1SA0E 4JEHB 4RZMA 1G73A 1Y4KA 2K48A 5AEUB 3ZMVB 2V26A 3ZEFB 3CPW2 3ZCIA 4QXBB 5IG5A 4L0RA 2GU3A 3KBUA 4OUQA 4ZM8A 1DMMA 4I4KA 2LHNA 3VGNA 2RFRA 1JB2A 4UVAB 2CXLA 3G8ZA 3IF8B 5ADXL 2EHOC 2G0UA 2IC6A 4J8TA 1W5ZA 3PURA 4AKZA 2HH7A 1JB5A 1DMNA 3N5LA 1QMAA 2X51A 3GZYB 2W0GA 3U3IA 2K24A 4PFOA 4GK5E 5IYZE 2OTL3 1WRDA 5L3EB 2E2TA 2NW9A 5JDFA 3MACA 2EHOD 5JDMA 3Q2MA 5EZYE 2P09A 5IEPA 5FYMA 3CVRA 5LYJE 2A72A 5DJQC 1VQP3 1CQSA 3WAKA 2KT9A 3AMOA 4IHJE 1FEWA 4C91A 3NQZA 2ML6A 2QEX3 3CCM3 4MHCA 2UXXB 2PBIA 3RYIE 5LJNA 2UX0A 3RGRA 4PK6A 4PJNA 1VQN3 3CMLA 5BXQA 2W62A 1MMNA 1KNZA 4L8PA 3LXUX 5LGUB 1VOMA 2Q9QA 2WOHA 4GYRA 2CH9A 3FB2A 2DWGA 3CX8B 3W15B 2N9DA 5JDHA 3SX1A 5KP3A 5L3GB 4XZCA 4IGUA 1F8NA 3F40A 4N6TA 3NM7A 1E1HB 3ANWB 2BDEA 3VU7H 3KFQC 1D1AA 1VRBA 3LOYA 3B57A 1ZEEA 3Q9DA 1GY5A 1OUNA 2CHCA 1YD8G 2KWIB 3ETVA 2F99A 4XBFB 1E3VA 1OACA 1Q824 4ZOLE 1QAKA 1YJW3 4A56A 5FXVA 3UUNA 4KBMB 3LJCA 3ZJ2A 2ZMAA 4FMBA 4WBOA 3AAIA 3BNBA 4LZIA 1V9DA 3ZJ1A 5E0OA 5FXZA 2CKFB 1JN5A 4HM0B 1ZHCA 1N8R4 4MMXB 1U5PA 4N78D 3VF1A 3KINB 5C8YE 3F8XA 1L5GB 1NU3A 2YK0A 2DWKA 3F14A 3NUVA 1MIYA 2JPFA 3EHCA 5LA6E 4KFFA 2BMOB 2WOFA 3ETUA 4H9QC 2ACXA 2B1XB 2RA1A 4GOUA 1IK3A 3FF2A 2E2UA 4TV8E 5CK6A 2LE8A 4HYZA 2P0MA 5KP4A 4YLHA 1K41A 5LHHB 4KZ1A 1YKHB 3NZPA 3LTDA 2KZ7B 1TP6A 2Y73A 4O4HE 4H9SE 1O3XA 4FR9A 4UVCB 3F57A 4FMDA 5L3BB 3KV6A 1AJ3A 5HXEA 1S5AA 2XGLA 3CCU3 2Z7AA 3DMCA 2CFWA 4H9NC 3GN5B 1K8A4 4GB5A 5STDA 3WOEB 4EC6A 1GD4A 2XGNA 5IF6A 3G16A 1STDA 2LSKA 3V5UA 3PS8A 1WNHA 3SVAA 4EYYR 1FUWA 5FY0A 4V1Av 4H63H 2CWTA 2C5JA 5JH7E 3RYHE 4HKVB 5CF2A 4PW8A 2F86B 3KDSE 2VKDA 1Q40A 1U8CB 5JRCB 3UL6A 3H37A 2CWUA 3MSOA 2VKJA 1QVG2 2SBLA 5CXOA 5EVHA 3BQLA 2EHOA 2DCFA 2WM9A 1QJGA 2CFKA 4QKNA 3LMLA 2CG0A 4OVMA 1UX4A 4PNIA 1A67A 1W00A 3FBZA 3E08A 4CDLA 2LSJA 2Y8DA 2D5UA 1FA3A 2QIYA 4HM2B 2BT3A 2RGQA 1IVUA 2YEVC 1SPUA 1HX8A 1K28A 5LHGB 3H3AA 2XQYA 4BTWA 3CPOA 4ZI7E 1AVKA 3FG3A 3AA6B 1N9EA 1UCUA 2O3OA 5ETWA 1DYUA 4FMAA 5D82A 1LVNA 4OFZA 3LZAA 4N6UA 2STDA 1NB3I 3BNEA 3T8UA 1B7TA 4EIWA 3SEDA 3KE7A 5JR9C 2PZVA 2ODUA 2VK9A 2A2FX 1YJN3 2XAQB 5AIHA 2W61A 3LT9A 1O7PB 3MPHA 4HN9A 4I43B 3X3YA 3ROBA 1HTJF 2KXPB 4I4TE 4FCZA 4HJLB 3EE1A 4PAGA 5LG4A 5L3FB 3SRZA 4IIJE 3M8CA 3B4PA 2B24B 3AAEB 2QGSA 1RRLA 3MK7C 1IT8A 5JPPA 2WMNA 3S27A 3WDGB 2KRTA 1RN7A 2INXA 4QWNB 4C90A 5JDGA 1OCVA 2CW9A 3RX6A 2D2SA 3KV5A 5EEOA 4J9AA 5IG0A 3CWZB 4MFRA 3E22E 2CA5A 3KBTA 4EXRA 1IDPA 3DUKA 1WTHA 1VQ73 3I9YA 3BQKA 4BTYA 5LJMA 1YHQ3 2GK9A 2VB6A 3AA1B 2DHRA 4EB6E 1MMGA 3TDGA 3S67A 1ZO2A 4O2BE 2KNDA 4IE7A 3V5SA 1N9JA 4XM4A 4UV8B 3I1AA 3E0ZA 2ES0A 2HMOB 5JQGE 3B13A 5AI1A 3GMIA 2JRKA 4ISSA 3I563 4ILUA 2WGQA 3HI2A 1OXZA 1ASKA 5A0OB 3C4WA 3RYCE 4AKIA 2Q9QD 2XAJB 1NO3A 1VZZA 2WO0A 2BO9B 5J1GA 3R6NA 3NBBA 1YW0A 1A2KA 3OBVE 1BR1A 3IJEB 2OOVC 3NQYA 4UELA 1LVFA 2ODVA 3O1JA 4WWUC 4MJDA 2D1WA 4XBTA 4XDVA 1K9M4 1OF5A 1SQWA 3EN1B 2V7KA 1SJWA 3FXEB 3ZN0B 4CI3B 5IHYA 1IV7A 3PUAA 3LTBA 3FCSB 2X0LB 1M904 1BR4A 1K734 2WWUA 5EK2A 1MIVA 1W6GA 4R80A 2WBLA 5DRVA 1GYBA 3PXMA 5LOVE 2YX9A 4LMIA 2CXFA 3CQCB 4PK4A 4XAXB 2ZLYA 3OXAA 1MMAA 3F7XA 3OJAA 3ZMZB 3CCR3 3CCE3 3PZWA 1GY7A 2XSOB 5AIIA 2KINB 2F98A 4U74A 4H3UA 3NX0A 4AKLA 2Z77A 2XHEB 1MNEA 3ZC0A 2YU1A 1O7HB 3ECFA 3S29A 2R4IA 5LC7A 5HXRA 3CU3A 3JUPA 3N2OA 5LGNB 1NAFA 3IBPA 2E9XC 4ASKA 3G6E3 1ROAA 3FXDB 3N9MA 3CQGB 1KSIA 2VASA 1OF5B 4R9LA 1Z1SA 4G2AA 3D3LA 4GIWA 2W2CA 5HWXA 1W6YA 3PUSA 2W9PA 3JC6D 1HU9A 3UTKA 1VQK3 3EDVA 1JNQA 3S4UA 4G1MB 2E9XD 2K9AA 1GY6A 5JR9A 3KN4A 3NBRA 2W56B 3HKDE 5J2UE 3FHNA 5LHIB 1IV9A 1FMWA 3ESLA 5AYSC 3DGOA 4JEUB 3EF8A 4FCJA 2H7VC 1FGTA 1ZV4X 3N9OA 1D6YA 2LSGA 1N5HA 2K5BB 4O2AE 1KK7A 3N54B 3DM8A 3OWUA 4KVHA 3NV0A 3CX7B 3OWSA 3Q5WA 3K3QC 3OYXA 1DMQA 3PU8A 4NUVA 4PK5A 1SHZC 4LEHA 5HWYA 2V7LA 1NDOB 1TU5A 1JKGB 3MG2A 3K63A 2BNGA 1D0XA 3SS1A 1W02A 4IE4A 3GWHA 3E99A 3N9PA 3ER7A 4IPBA 4HGAA 5FMNA 4G63A 2IA7A 2W03A 4UXNB 4PJLA 4I55E 3K9MC 3LBXA 3JUMA 7STDA 2ZM2A 2MTQA 5BVBA 1Y64B 1DVDA 3HA4A 2MF7A 5HXSA 2BMRB 2HMLB 4F6RC 3T8NA 2X9WA 4HM3B 4AXPA 1ROVA 3CXC2 4EYCA 4ERRA 4WBNE 2NOXA 1OHPA 2NTXA 4U72A 2GXFA 2HMJB 3KFWX 1W6CA 3D0TA 1EKMA 4O8SA 4K0UA 4QX7B 3SXXA 4CZZB 5L3DB 4KP3C 3LK42 4QWTA 3ZN1B 2V7JA 1VQ63 4UEMA 4R1KA 2HMKB 4AQFC 2PJQA 4JRFA 4JLEA 3G0KA 3O1HA 3CCQ3 3ZYLA 4X20E 1LRZA 3WA2X 3U78A 3OKQA 1WYCA 2OOVA 4X2OA 3EJVA 4E7SA 1BR0A 3VKGA 4DMWA 2XFTA 1YIJ3 4HM5B 4ZS3A 5ELJA 2RP4A 1T98A 2NW7A 3AMOB 1YGEA 4GYSA 2VWAA 4BJMA 4MEIA 1VQ43 5AIGA 4JF8A 4QXCB 3L3PA 4EAHA 3MZKB 1C7HA 3T8OA 2WGOA 4NHFA 4JUYA 2Q9QB 2LT3A 4PJMA 3NZQA 1QSDA 1A90A 1FIOA 3DZLA 2D42A 1IVVA 4X1KE 3T0UA 4UF0A 2P9BA 4GK0E 4NREA 1R4CA 1WMPA 5DQVA 4CXYA 2DLRA 3WI3A 1QAFA 2X68A 3NXJA 1LNHA 4BA9A 1WYBA 4L5GA 2CMRA 1QUUA 4O2HA 3UUXB 5LBMA 3GWRA 4YHJA 1CYUA 3CC23 1W01A 3HR0A 3I0QA 2FNQA 5IW9A 2JDIH 4J2CA 1J2BA 3NBJA 4HM6B 4RNYA 2E9XA 2H3RA 4CXWA 2OA5A 3ZYMA 3D9RA 3DJBA 2Q07A 4KFEA 3STDA 5JDNA 2BVMA 4FI5A 3EN8A 5KP1A 4XBYA 3NRYA 3JVCA 3I0OA 3SLUA 4UVBB 3CD63 4OHFA 1JN5B 5EK4A 2X67A 3BB9A 4PJJA 1IAPA 4EOZB 3FSDA 5L2LA 1W2B2 1EQKA 2IMJA 1OGXA 2MBGA 4HBRA 2CLYB 1UX5A 2LJLA 1STFI 3DP7A 3N2GE 2CWYA 4XDWA 2OTJ3 3MG1A 1M9GA 5LNKA 3B7CA 3G4S3 3FG4A 2X9HA 3CKDA 3P8CD 1PFPA 3PUQA 3RH3A 4EZHA 2L3LA 3SOLA 3MYTA 3J9X1 2CIUA 3U1WA 1NWWA 1D1BA 4WYKA 5FGOA 2NP9A 1US7B 2SPCA 3LG7A 2Z6EA 4ZS2A 1IJ6A 2C5IT 1N5PA 1HF8A 3BLZA 3QUJA 4MMYB 4DMVA 3X42A 3UFEA 3X3ZA 4M1PA 3DXOA 1KWIA 1MIWA 4IDZA 4ZI3C 1O7GB 3K0ZA 1BUQA 1Q40B 2LSYA 3HL6A 4FMCA 3H51A 3OWYA 1YVBI 1UUVB 3P7IA 2EHOB 3O8YA 1SIIA 3EVYA 3LYGA 4P0BA 4RBNA 1TFOA 4HM7B 4ZI3D 2NWBA 3L0RA 2ZM8A 6STDA 2XTLA 5AFUL 4X1YE 5HYAA 3FG1A 3F2EA 3O9XA 3N2KE 3EBTA 2OWPA 4RNZA 3MG3A 2IUJA 3ZMUB 4Q53A 4TV9E 2CEAA 4UIGA 1TFKA 1KQS2 3BK9A 1LVKA 4WNKA 1VQL3 2CM0A 4NUUA 2V1DB 3F7SA 4ADZA 3C51A 5LC6A 3NBXX 2MC8A 1BR2A 3Q2PA 5J2TE 3IHRA 4ORLA 2HMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8S A;  4OK0 A; 
#chains in the Genus database with same CATH topology
 2J8X B;  5HXC A;  1EUI C;  2B1E A;  3EB8 A;  2V7M A;  3RC8 A;  4F8H A;  1ULJ B;  4O3V A;  2HN2 A;  1UI8 A;  3AA7 B;  2I59 A;  4YTM A;  4A5X A;  1I94 T;  1LKX A;  1S35 A;  1BNR A;  3PYJ A;  1GOU A;  5F8P A;  2Z6B A;  4DKI A;  2YDS A;  1BUJ A;  3RC3 A;  3I0Y A;  2V5D A;  1JJ2 2;  3AB3 B;  4K61 A;  2KF5 A;  2BMQ B;  1NB5 I;  3AAA B;  4YSY A;  2BZB A;  4JI8 T;  3AEC A;  3PU3 A;  4TWF A;  3RQU A;  2OV9 A;  5M18 A;  3H3M A;  1Q7H A;  2W0Q A;  1Q81 4;  2DI4 A;  2E8I A;  2JQ5 A;  1OH0 A;  3AE5 A;  3ZYK A;  1HS7 A;  3LFM A;  1GMR A;  3I55 3;  1T72 A;  4B6X A;  2QGU A;  1T2I A;  1UK5 A;  4O4L E;  1YJ9 3;  3WAJ A;  4AEQ A;  1OHS A;  3SWH A;  2LKH A;  1ULI B;  5AIF A;  3I9W A;  3L09 A;  4OK0 A;  1LOW A;  4N6V 0;  5AYR B;  2LYX A;  1R4Y A;  4XB5 A;  4KUM B;  3MKD A;  4DR7 T;  3J7Y d;  3KV4 A;  4A97 A;  5D83 A;  1W4N A;  4UV9 B;  3K8P C;  1TRQ A;  4R4K A;  4RNT A;  3PUG A;  1CYV A;  3ONX A;  2M7O A;  4MAL A;  3FGY A;  3FKA A;  1RGG A;  3ZMS B;  1JNR A;  3LK3 B;  4GL6 A;  3UUL A;  4ZEY A;  4OX9 T;  2BVL A;  1OPY A;  1RTU A;  2IW5 B;  4GKK T;  1B27 A;  3HKC E;  2IIU A;  2W9Q A;  4YXD A;  4LMK A;  5LP6 E;  1FZU A;  3OPC A;  1ZX2 A;  1Q42 A;  2KCD A;  5TAO A;  3IEE A;  1LXE A;  1BNJ A;  3PCS A;  2CLY C;  3ZPO A;  2LQV A;  4FCM A;  4HM4 B;  2CE7 A;  5KMG P;  5LBQ B;  2XEP A;  3LDQ B;  5EQL A;  3A7M A;  1UDI I;  3AE8 A;  2RSX A;  3FZK B;  4TUY E;  3HK4 A;  4IE0 A;  5FXW A;  3CCL 3;  4JI6 T;  1BSB A;  2F4V T;  2CX1 A;  1UCJ A;  2ZA4 A;  4ZI2 C;  2C11 A;  3MXZ A;  2QA7 A;  4IDN A;  4P0A A;  3DGL A;  1RRH A;  1T7S A;  1IQX A;  3K3N A;  3Q1C A;  3AVS A;  3HI7 A;  2IDO B;  4QH5 A;  4A98 A;  2CK3 H;  3ALA A;  1RKY A;  1UUW B;  4TNW A;  1RGL A;  2W66 A;  5L47 A;  5JTG A;  4ZI2 D;  5FL1 A;  1IQY A;  3KSP A;  1E3R A;  3MWZ A;  2BKN A;  2H89 A;  1RGC A;  1Y01 A;  3UU5 A;  1SUM B;  5AQI B;  2E2V A;  3CCJ 3;  4YY3 T;  3KII A;  5JRE A;  1I2G A;  2F56 A;  1BRJ A;  1VCS A;  3NKZ A;  5HCM A;  1MMD A;  1ZGX A;  4U33 A;  5DQW A;  3JCF A;  4IST A;  2W4X A;  4WP5 A;  4KI0 F;  4WHA A;  3PTR B;  4DVD A;  2P38 A;  4AKR B;  3O1I A;  2XAS B;  2F5M A;  2YFJ B;  5KX5 E;  1XZY A;  5AQK B;  3VR8 A;  5KDM C;  5IER A;  2PNC A;  4WW0 A;  4N6O B;  3SFE A;  3A76 A;  1RJO A;  2UU9 T;  2HPJ A;  4AIU A;  1FJG T;  1MNL A;  1UCK A;  1D0Z A;  1E7P A;  1FYS A;  3CC7 3;  2ML5 A;  3BU4 A;  3RYF E;  1MWT A;  3TLT A;  3RPU A;  2GEY A;  3JUQ A;  3ZMT B;  2CFD A;  3LTA A;  3CX6 B;  5AQO B;  2WMO A;  2BIR A;  2X9X A;  4HKA A;  3UFG A;  4HM8 B;  3ANW A;  2FXT A;  3RLF F;  5AQF B;  2FJA A;  1AV4 A;  2XUE A;  3CME 3;  4DND A;  4Z91 A;  3IPT A;  1Q7Y 4;  4U13 A;  1ZS7 A;  1M1K 4;  3JUN A;  2WS3 A;  1G8X A;  5FY1 A;  4ANJ A;  3WOF B;  5M4Y A;  3CCS 3;  4STD A;  2WZH A;  4H9P C;  1EG9 B;  2ZDJ A;  4IRE A;  4DV4 T;  2XFS A;  3M65 A;  3B8L A;  4COF A;  2W63 A;  2ZM0 A;  4LF6 T;  1T8B A;  5HEJ A;  2N2N A;  4YJ3 E;  5ELU A;  1KD1 4;  2CWV A;  4BAY B;  5JR9 B;  2O9U X;  2J1D G;  2Z76 A;  3HOH A;  5ABF B;  4U31 A;  3K5T A;  3ZC1 A;  1U5O A;  5CLK A;  2GEX A;  4L7K A;  1D1C A;  1WLX A;  5M19 A;  4DBR A;  4BL3 A;  4IT4 A;  4I50 E;  2AAD A;  5HXH A;  2XQ5 A;  4LFB T;  1J5E T;  4LYL B;  5JBS A;  2AXD S;  1UGI A;  3CPZ A;  2ZM6 T;  5FY7 A;  1BSC A;  1QVF 2;  1AR0 A;  2WU5 A;  3LSV A;  3NV0 B;  3PDY A;  2Y74 A;  3GZB A;  2JMK A;  1DVC A;  4HM1 B;  4BTX A;  2V6Y A;  3RRC A;  4I5Q A;  2LOP A;  2BHM A;  1FGQ A;  3P4P A;  5CA1 E;  5D81 A;  2NTY A;  4K1V A;  2IAK A;  2V7I A;  2CWO A;  2V1L A;  5I97 A;  3DY5 A;  5CA0 E;  3Q3F A;  1V74 A;  5AQU B;  1HG5 A;  3X3X A;  3B4O A;  1YIT 3;  4IIA A;  1BRI A;  3SOA A;  4DID B;  4HZ9 B;  1B2Z A;  1Z0P A;  3OVU A;  2GSP A;  2C10 A;  1IZN B;  2X66 A;  5AQP B;  3H3H A;  5IEN A;  2IUK A;  5HEH A;  3LBX B;  4EZ4 A;  3EBY A;  4DR1 T;  1RN4 A;  2CX0 A;  2FJE A;  3HX8 A;  2WB5 A;  1TIJ A;  5H6R B;  3KVB A;  2LOS A;  4QXH B;  3S28 A;  3DGN A;  1D6Z A;  3QK9 A;  3NM2 A;  4NIQ A;  3N9N A;  1IU7 A;  3TKL B;  9RNT A;  2UXN B;  2CHO A;  3GN5 A;  2KF6 A;  3CC4 3;  4AKY A;  1ZP0 A;  3DGM A;  1HFA A;  3RKG A;  3C98 B;  4TX4 A;  4L9I A;  3R84 B;  4IDQ A;  3O4X E;  4TN7 B;  2XR8 B;  3F8H A;  2BG9 B;  5JPU A;  3C4Z A;  4DV1 T;  3OX9 A;  4CN1 A;  3UL5 A;  3UT5 E;  2PG8 A;  5LXT E;  5JVD E;  3FBL A;  2XSB A;  4DUZ T;  4HFH A;  2GBX B;  3RKO A;  2VL8 A;  3IMA B;  3EC9 A;  1DE3 A;  3AVR A;  4X1I E;  4HVN A;  3FH1 A;  1J5W A;  5JRC A;  3P4W A;  4DV6 T;  2P05 A;  3LH4 A;  1PY3 A;  2KMF A;  1I2F A;  2GU1 A;  2C0S A;  2JMH A;  3DTO A;  2OQE C;  3GRD A;  2YFI B;  2QA4 3;  2AE9 A;  1G0T A;  4B3T T;  2W00 A;  2VUR A;  4AQG A;  2PFV A;  2LEH A;  2LRL A;  4IE6 A;  4YFS A;  3IA3 A;  4ZHQ E;  1RGF A;  1FGM A;  3MA9 A;  4HZB B;  4QH4 A;  5LG3 A;  1W7C A;  2X0Y A;  1ZKE A;  2FUP A;  3GAX A;  4IE5 A;  4CJN A;  5ABG A;  2I0M A;  4H63 V;  3Q5D A;  1FGO A;  1US1 A;  4N3V A;  4OYJ A;  1B2X A;  3PUZ F;  3LK2 B;  3X41 A;  1NEN A;  2JQ9 A;  4DR2 T;  3UB1 A;  1JV2 B;  3OW2 2;  3G06 A;  5AQN B;  1AY7 A;  1PU4 A;  1VQ8 3;  1GS3 A;  2H7O A;  4U7Y A;  1RSN A;  4WFO A;  3LTC A;  2CCQ A;  3LT8 A;  5HGR A;  4UF0 B;  1KC8 4;  2XAF B;  3N9L A;  2D0T A;  5J0Z A;  2K54 A;  4HAA A;  3FF0 A;  3U97 A;  2KAA A;  1SAR A;  4Z8X A;  4EV2 A;  3QK6 A;  3QC9 A;  1D6U A;  4BL2 A;  4H61 A;  5BMV E;  1IJ5 A;  5L3C B;  5IG3 A;  1UUR A;  2XRX B;  4ILC A;  3K3O A;  2A3D A;  3WHO A;  4HTE A;  1NEK A;  3VHL A;  1X79 A;  3AA0 B;  3A8Y C;  2WSS V;  1DET A;  2NW8 A;  3S5C A;  1S72 3;  4LMJ A;  3OYZ A;  1EEJ A;  1SIH A;  2JQH A;  2JQQ A;  4YJ2 E;  1D0Y A;  4PFP A;  3N8B A;  5IG4 A;  3VR9 A;  4N6N B;  4PEJ A;  2E9X B;  2F4Y A;  5IEO A;  8CHO A;  3UNL A;  2D0U A;  4H9R C;  1OED C;  2UGI A;  3KZT A;  4EV5 A;  3EX9 A;  2LSI A;  1KF6 A;  5TGN A;  2BKP A;  1VQM 3;  2WU2 A;  1GQE A;  2HMN B;  1RNT A;  4DO0 A;  2C5K T;  3C64 A;  3T1Y T;  1A2V A;  1AVL A;  4LF7 T;  5A1L A;  3MKI A;  1IVW A;  4X62 T;  1IBK T;  1JBT A;  3CCV 3;  5FXX A;  5LB7 B;  2LHR A;  2WAU A;  3FLJ A;  1HR0 T;  4XBX A;  5FW5 A;  1S94 A;  5FVL A;  2A9U A;  4EXT A;  2XSA A;  4LFA T;  2L4V A;  3PJA A;  1O7W B;  3SOY A;  1HNX T;  1VQQ A;  1EA2 A;  1CEW I;  3OV4 A;  3FZM B;  4HEA A;  3Q5X A;  1JB4 A;  2K0M A;  3SFD A;  3UUM A;  2W04 A;  1HG2 A;  3CQX C;  4L8O A;  3BQI A;  3HKB E;  4AI6 A;  3N9Q A;  5FP3 A;  2Y6X A;  5HAX A;  4HFI A;  4P09 A;  1GOV A;  5EK3 A;  3NRX A;  3NHX A;  5GON E;  3AE1 A;  1IT7 A;  4AQF A;  2FGT A;  3MHE A;  1O7M B;  1UCI A;  4ILA A;  2MAW A;  3P4R A;  1IQ8 A;  3AE9 A;  4MMZ B;  5FNV E;  1E97 A;  2P0X A;  3CMA 3;  2UXD T;  1WMN A;  2YFL B;  1OWA A;  2VQE T;  2MOZ A;  1TUH A;  1N8Q A;  1GMP A;  3HZP A;  2HPL A;  5HEG A;  3EDU A;  4WYK B;  3UU8 A;  4TWD A;  5JDL A;  2CFG A;  4IT7 A;  2R6G F;  1LOV A;  2CRB A;  4FJO A;  5JDQ A;  3GZX B;  3P4S A;  2XAH B;  3RIF A;  4CN4 A;  3N9H A;  1NWM X;  1HX1 B;  1W2Z A;  2VKH A;  3J7Y q;  1JZD A;  2RCD A;  4ILF A;  2Y48 B;  2E2A A;  4HFV A;  2OCT A;  2CFL A;  3ZT5 A;  1VQO 3;  1UW1 A;  4DBQ A;  2XY8 B;  3X40 A;  5LGT B;  2IHR 1;  1MND A;  3EUH A;  1LRA A;  2FJB A;  1TTO A;  5DAB A;  3V92 A;  5H6Q B;  3BNC A;  1BAN A;  3FZW A;  5G2G A;  3HKE E;  4TZ4 C;  2N1G A;  3A5X A;  4CQI A;  2UUA T;  3WA3 A;  3F31 A;  1IVX A;  2CXD A;  2CC3 A;  3QRD A;  4KMC A;  3K1S A;  2Q9Q C;  3EQQ B;  1PYL A;  1VQ5 3;  2KXG A;  1FMV A;  3V99 A;  2DNX A;  3PCR A;  2MYS A;  4K90 B;  1YKE B;  4H9O C;  3RIU C;  1H7C A;  3PE0 A;  4EEB A;  4CXX A;  1G96 A;  1NJI 4;  3QB5 A;  3KVA A;  5ABH A;  3ZST A;  1W9R A;  1BOX A;  3VKH A;  1UI7 A;  1U4Q A;  2I9W A;  2XH9 A;  3UJM A;  3C50 A;  2OQE A;  1GMQ A;  5AQQ B;  1EZ3 A;  3AXJ B;  4QX8 B;  4I0U A;  1BGS A;  3DGY A;  4TX5 A;  3RRW A;  5CB4 E;  3G71 3;  3MJX A;  4OYK A;  4N6M A;  4GKJ T;  2QRX A;  3Q90 A;  1X9B A;  3RDE A;  4O4J E;  2L9Q A;  1VQ9 3;  2BKO A;  1YI2 3;  4O4I E;  2IC9 A;  3KV9 A;  1OHO A;  2W6J H;  2XQ8 A;  4LSO A;  1WMO A;  2WDQ A;  4AIS A;  1DU2 A;  3WMD A;  1WR6 A;  3GA8 A;  1B2M A;  3KKG A;  2JJ9 A;  1T5Y A;  4O02 B;  2AAE A;  1BSE A;  2K3D A;  2RBI A;  4LGQ A;  1V57 A;  5AEW B;  2YIN A;  1CUN A;  2XSH B;  4KHP T;  3VSY A;  1FGR A;  1B3S A;  3JAD A;  3V98 A;  4N6L A;  4CCV A;  4BJN A;  4AKG A;  2W56 A;  5AQV B;  2IUB A;  2KLQ A;  2CG1 A;  2YU2 A;  2KF3 A;  3JUO A;  3HIG A;  4DV2 T;  1BSD A;  2X9Y A;  1ISK A;  2A15 A;  2KWH A;  5CF1 A;  4K1U A;  1LNI A;  3PGB A;  4QHO A;  3RGA A;  2XM2 A;  3GZR A;  1JRQ A;  3C4X A;  1V58 A;  2VKO A;  3CNM A;  4CI2 B;  4HE8 A;  2W2U A;  2W67 A;  4MBQ A;  2ZL8 A;  2XAG B;  2UXC T;  1LOX A;  1Q86 4;  4KFD A;  1X1W A;  5LCY A;  2YOE A;  1I8V A;  1HKX A;  3ZCJ A;  3ZLI A;  3K7C A;  1MOL A;  5F3J A;  4MLK A;  4E7Z A;  2L8K A;  1WQL B;  1QAL A;  3KSE D;  4EED A;  5DRE A;  4DV5 T;  3CNX A;  1JKG A;  1GD3 A;  4R9K A;  2GBW B;  4AKH A;  4EYU A;  1HCI A;  1OED A;  3WOD G;  3JC6 C;  1B21 A;  4EBG A;  1RGE A;  4CI1 B;  1OED E;  4X2H A;  3HII A;  3F9S A;  1O7N B;  1OGZ A;  3BND A;  2WQY A;  4ZXL A;  4K0K T;  2M67 A;  1M1X B;  3ZG0 A;  2XF3 A;  4EW5 A;  4B3R T;  2LM9 A;  1SA0 E;  4JEH B;  4RZM A;  1G73 A;  1Y4K A;  2K48 A;  5AEU B;  1RGH A;  1YQ4 A;  3ZMV B;  2V26 A;  1RCL A;  3ZEF B;  2XQ9 A;  3CPW 2;  3ZCI A;  4QXB B;  1RLS A;  5IG5 A;  2YKS A;  5BR8 T;  4L0R A;  4DR4 T;  2GU3 A;  2UUB T;  3KBU A;  4OUQ A;  4ZM8 A;  1DMM A;  1W09 A;  1XNR T;  4I4K A;  2LHN A;  3AEE A;  3VGN A;  2RFR A;  1JB2 A;  4UVA B;  1HNW T;  2CXL A;  3G8Z A;  3IF8 B;  3PJA J;  5RNT A;  5ADX L;  1BIR A;  2EHO C;  2G0U A;  4HOH A;  2IC6 A;  4J8T A;  5CGM A;  1W5Z A;  2UUC T;  2M6I A;  1B20 A;  4NPB A;  1A2P A;  3PUR A;  4AKZ A;  2HH7 A;  4YT0 A;  1JB5 A;  2BU4 A;  1DMN A;  3N5L A;  1QMA A;  2X51 A;  3GZY B;  2MPK A;  2W0G A;  2K24 A;  4PFO A;  3U3I A;  4GK5 E;  5IYZ E;  2OTL 3;  1WRD A;  5L3E B;  2YDR A;  2E2T A;  2NW9 A;  5JDF A;  3MAC A;  2J4G A;  1GOY A;  2EHO D;  5JDM A;  1X1X A;  3Q2M A;  5EZY E;  4NXN T;  2P09 A;  4TNV A;  5IUX A;  2KF4 A;  5IEP A;  5FYM A;  1BRG A;  3CVR A;  5LYJ E;  4J5K A;  2A72 A;  2XQ4 A;  5DJQ C;  3RIA A;  1VQP 3;  1CQS A;  4DV7 T;  3SYU A;  1RCK A;  3WAK A;  3FZH B;  2KT9 A;  3AMO A;  4IHJ E;  3AE3 A;  1FEW A;  4C91 A;  2F5W A;  3NQZ A;  2ML6 A;  1FUT A;  4JI7 T;  2QEX 3;  3CCM 3;  4MHC A;  2UXX B;  2PBI A;  3RYI E;  5LJN A;  3ZSS A;  2UX0 A;  3RGR A;  4GHO A;  4PK6 A;  4PJN A;  1VQN 3;  3CML A;  5BXQ A;  2XJ7 A;  2W62 A;  1MMN A;  1BNE A;  1KNZ A;  3FZF B;  4L8P A;  3LXU X;  5LGU B;  3AED A;  1VOM A;  2Q9Q A;  2WOH A;  4GYR A;  2CH9 A;  3FB2 A;  3L8R A;  2DWG A;  3CX8 B;  3W15 B;  2DL1 A;  1BRH A;  1UCL A;  2N9D A;  4NXM T;  3RIU A;  5JDH A;  1BRN L;  3SX1 A;  5KP3 A;  2VQF T;  5L3G B;  4XZC A;  4IGU A;  2BBH A;  1F8N A;  3F40 A;  4N6T A;  3NM7 A;  1E1H B;  2LM2 A;  1BNS A;  3AHW A;  3ANW B;  2BDE A;  3VU7 H;  1X1Y A;  3KFQ C;  1D1A A;  1VRB A;  3LOY A;  3B57 A;  1ZEE A;  3Q9D A;  1GY5 A;  1OUN A;  2CHC A;  1YD8 G;  5G1K A;  2RNT A;  2KWI B;  4X66 T;  3ETV A;  4YTN A;  3AEG A;  3PUV F;  2F99 A;  4XBF B;  1BRS A;  1E3V A;  1OAC A;  1Q82 4;  4ZOL E;  1QAK A;  1YJW 3;  4A56 A;  5FXV A;  1C54 A;  2H0H A;  3UUN A;  4ILB A;  4KBM B;  3LJC A;  1MGW A;  3ZJ2 A;  1CHU A;  2ZMA A;  4IDO A;  4FMB A;  2LRK A;  4WBO A;  3AAI A;  4X64 T;  1HYF A;  3BNB A;  4LZI A;  1V9D A;  2CBI A;  3ZJ1 A;  5L4H A;  3UU3 A;  2B76 A;  5E0O A;  5FXZ A;  2CKF B;  1JN5 A;  4HM0 B;  3PUY F;  1ZHC A;  1N8R 4;  4MMX B;  2SAR A;  3KCH A;  1U5P A;  3FZL B;  2K3W A;  4N78 D;  4YTP A;  3VF1 A;  3KIN B;  5C8Y E;  1J1J A;  3F8X A;  2VL0 A;  1NU3 A;  1L5G B;  3TLV A;  2YK0 A;  1YXR A;  2DWK A;  3F14 A;  3NUV A;  1MIY A;  2JPF A;  3EHC A;  5LA6 E;  3AE2 A;  3UQ4 A;  2V6Y B;  4KFF A;  2BMO B;  4UR9 A;  2WOF A;  3ETU A;  1UGH I;  4H9Q C;  2ACX A;  2B1X B;  1YGW A;  2RA1 A;  4GOU A;  1IK3 A;  3FF2 A;  2E2U A;  4TV8 E;  5CK6 A;  2LE8 A;  4HYZ A;  2P0M A;  5KP4 A;  4YLH A;  1K41 A;  5LHH B;  4KZ1 A;  1YKH B;  3NZP A;  3LTD A;  4JI4 T;  2KZ7 B;  5AQJ B;  3CK6 A;  1IBM T;  1TP6 A;  2L1S A;  2Y73 A;  1TRP A;  4O4H E;  4H9S E;  5BIR A;  1O3X A;  4FR9 A;  1VCT A;  1TJD A;  4UVC B;  3F57 A;  4FMD A;  5L3B B;  3KV6 A;  1AJ3 A;  5HXE A;  5AQT B;  1S5A A;  2XGL A;  3CCU 3;  2Z7A A;  3DMC A;  2PTF A;  1BNF A;  5AQM B;  4H9N C;  1YNV X;  3GN5 B;  2CFW A;  1K8A 4;  4GB5 A;  5STD A;  3WOE B;  4EC6 A;  1GD4 A;  2XGN A;  1L0V A;  5IF6 A;  5HOH A;  3G16 A;  1STD A;  2LSK A;  3V5U A;  3NVO A;  3PS8 A;  1WNH A;  3SVA A;  3QOF A;  4EYY R;  1FUW A;  5FY0 A;  4V1A v;  4H63 H;  2CWT A;  2C5J A;  5JH7 E;  3RYH E;  3TLW A;  4HKV B;  5CF2 A;  4PW8 A;  2F86 B;  3KDS E;  2VKD A;  1Q40 A;  1U8C B;  2KSR A;  3L39 A;  5JRC B;  3H37 A;  3UL6 A;  2CWU A;  3MSO A;  2VKJ A;  1QVG 2;  2SBL A;  5CXO A;  5EVH A;  1X1U A;  3BQL A;  2EHO A;  2DCF A;  2WM9 A;  1QJG A;  2CFK A;  2J47 A;  4QKN A;  3LML A;  1BU4 A;  2CG0 A;  3ONJ A;  4KHZ F;  4OVM A;  1UX4 A;  4PNI A;  1A67 A;  1W00 A;  3FBZ A;  3E08 A;  4CDL A;  2H0I A;  2LSJ A;  2Y8D A;  2WDV A;  2D5U A;  1FA3 A;  2QIY A;  4HM2 B;  2BT3 A;  2RGQ A;  1IVU A;  2XQA A;  2YEV C;  1SPU A;  2HOH A;  1HX8 A;  1K28 A;  5LHG B;  3H3A A;  2XQY A;  4BTW A;  3CPO A;  4ZI7 E;  1AVK A;  4HWH A;  3FG3 A;  3AA6 B;  1N9E A;  1UCU A;  2O3O A;  5ETW A;  1DYU A;  1N36 T;  3AHS A;  4FMA A;  5D82 A;  4YSX A;  1LVN A;  3B5M A;  1I3I A;  4OFZ A;  1B2S A;  3LZA A;  4N6U A;  2STD A;  1NB3 I;  3BNE A;  3ZT7 A;  3T8U A;  1B7T A;  4EIW A;  3SED A;  3KE7 A;  5JR9 C;  2PZV A;  2H88 A;  2ODU A;  2VK9 A;  3RQW A;  2RPA A;  2A2F X;  1YJN 3;  2XAQ B;  5AIH A;  2W61 A;  3LT9 A;  5FVK A;  3PUX F;  1O7P B;  3MPH A;  2ZHX B;  4Q25 A;  1UUS A;  4HN9 A;  1R8I A;  1RHL A;  4I43 B;  3X3Y A;  3EHZ A;  3ROB A;  4KT3 B;  1HTJ F;  2KXP B;  2WY2 A;  4I4T E;  1JNZ A;  3VRB A;  4FCZ A;  4HJL B;  3EE1 A;  4PAG A;  5LG4 A;  2R41 A;  5L3F B;  3SRZ A;  4IIJ E;  3M8C A;  4IDP A;  3B4P A;  1JBS A;  2B24 B;  3AAE B;  2QGS A;  1RRL A;  3MK7 C;  1IT8 A;  5JPP A;  2WMN A;  4HFB A;  1I6Z A;  3S27 A;  3WDG B;  2KRT A;  1WR0 A;  1RN7 A;  2INX A;  2V8S V;  2XZE A;  4QWN B;  4C90 A;  5JDG A;  1OCV A;  2CW9 A;  3GSP A;  1GSP A;  3RX6 A;  2D2S A;  3KV5 A;  5EEO A;  4J9A A;  5IG0 A;  3CWZ B;  2XM1 A;  2CHN A;  2YDQ A;  4KX6 A;  4MFR A;  3E22 E;  2CA5 A;  3KBT A;  4WZX A;  4EXR A;  1IDP A;  4BIR A;  3DUK A;  1WTH A;  1VQ7 3;  1AQZ A;  3I9Y A;  3BQK A;  5C3J A;  4BTY A;  5LJM A;  4TWH A;  1YHQ 3;  2GK9 A;  4U2Y A;  2VB6 A;  3AA1 B;  2DHR A;  4HWD A;  4EB6 E;  1WCR A;  1MMG A;  3TDG A;  3S67 A;  3RF1 A;  1ZO2 A;  4O2B E;  2KND A;  4IE7 A;  3V5S A;  1FW7 A;  3AEF A;  1N9J A;  4XM4 A;  2BG9 C;  4UV8 B;  3I1A A;  3E0Z A;  2ES0 A;  3P50 A;  2HMO B;  5JQG E;  3B13 A;  5AI1 A;  3GMI A;  1N33 T;  1HNZ T;  2JRK A;  4ISS A;  3I56 3;  4ILU A;  2WGQ A;  3AGN A;  3HI2 A;  1OXZ A;  5LMU T;  1ASK A;  5A0O B;  2IY2 A;  3C4W A;  3RYC E;  4AKI A;  2Q9Q D;  2XAJ B;  1NO3 A;  1XDO A;  1VZZ A;  4LF4 T;  4CN6 A;  3ZKR A;  2WO0 A;  3WR2 A;  2BO9 B;  4YSZ A;  5J1G A;  3R6N A;  3NBB A;  1YW0 A;  2VVS A;  1A2K A;  3OBV E;  1BR1 A;  3IJE B;  2OOV C;  2IML A;  3RGL A;  3NQY A;  1RNB A;  4UEL A;  1LVF A;  2ODV A;  3O1J A;  4WWU C;  2NR4 A;  4MJD A;  2D1W A;  4XBT A;  4XDV A;  1K9M 4;  1OF5 A;  4IL4 A;  1SQW A;  3EN1 B;  2V7K A;  1SJW A;  3FXE B;  3ZN0 B;  4CI3 B;  1LOY A;  5IHY A;  1IV7 A;  3PUA A;  3LTB A;  3FCS B;  2X0L B;  1M90 4;  1BR4 A;  1K73 4;  2WWU A;  5EK2 A;  5ABE A;  1MIV A;  1W6G A;  4R80 A;  2WBL A;  5DRV A;  3JAE A;  1GYB A;  3PXM A;  5LOV E;  2YX9 A;  4LMI A;  1E2A A;  2CXF A;  3OTO T;  1UGO A;  3CQC B;  1KNR A;  4PK4 A;  2YN6 A;  4XAX B;  2ZLY A;  1BSA A;  3OXA A;  2FBW A;  1MMA A;  3F7X A;  4DV3 T;  3OJA A;  3ZMZ B;  3CCR 3;  5L4E A;  3CCE 3;  3PZW A;  1GY7 A;  4LF5 T;  7GSP A;  2VVN A;  4U2Z A;  6GSP A;  2XSO B;  5AII A;  2KIN B;  3AGO A;  2F98 A;  1T2H A;  3PV0 F;  4U74 A;  4H3U A;  3NX0 A;  4AKL A;  2Z77 A;  3ONL C;  3QB5 K;  2XHE B;  1MNE A;  3ZC0 A;  1IYY A;  2YU1 A;  1O7H B;  2HN1 A;  3ECF A;  3S29 A;  2R4I A;  5LC7 A;  5HXR A;  3CU3 A;  3JUP A;  3N2O A;  2WZI A;  3RHW A;  5LGN B;  1NAF A;  3IBP A;  1JZO A;  2E9X C;  4ASK A;  3ZT6 A;  3G6E 3;  3RI5 A;  1ROA A;  3FXD B;  3N9M A;  3CQG B;  1KSI A;  2VAS A;  1OF5 B;  4R9L A;  5M1A A;  1G02 A;  1Z1S A;  4G2A A;  1RGK A;  3D3L A;  4GIW A;  2W2C A;  5HWX A;  2UUG C;  1W6Y A;  3RNT A;  3PUS A;  8RNT A;  2W9P A;  3JC6 D;  1N32 T;  3UTK A;  1HU9 A;  1VQK 3;  3EDV A;  1JNQ A;  3S4U A;  4G1M B;  2E9X D;  2K9A A;  1GY6 A;  1IBL T;  5JR9 A;  4JI1 T;  2V6X A;  3CIR A;  3KN4 A;  5ABF A;  3NBR A;  2W56 B;  3HKD E;  5J2U E;  4YHH T;  3FHN A;  2D9D A;  5LHI B;  1IV9 A;  1FMW A;  3ESL A;  5AYS C;  4LML A;  4JI0 T;  4JEU B;  3DGO A;  4QH1 A;  2XPK A;  3EF8 A;  4FCJ A;  2E5L T;  7RNT A;  2H7V C;  1FGT A;  1ZV4 X;  1XMO T;  2E5V A;  4JI3 T;  3D79 A;  2CBJ A;  3N9O A;  1D6Y A;  2LSG A;  1N5H A;  2K5B B;  4O2A E;  1KK7 A;  1LQM B;  3N54 B;  1M7K A;  3T1H T;  3DM8 A;  4WYV A;  3OWU A;  4KVH A;  3NV0 A;  3CX7 B;  4HWI B;  3OWS A;  3Q5W A;  3K3Q C;  3OYX A;  1KFY A;  1Z8U A;  1DMQ A;  3PU8 A;  4LF9 T;  4NUV A;  4PK5 A;  2I6H A;  1SHZ C;  5C2T A;  5AQH B;  4LEH A;  5HWY A;  2V7L A;  1NDO B;  1TU5 A;  1JKG B;  3MG2 A;  3K63 A;  4HFC A;  1OED B;  4U3C A;  1D0X A;  4EV6 A;  2BNG A;  3SS1 A;  1W02 A;  4HFD A;  3AEB A;  3GWH A;  4IE4 A;  3E99 A;  2QYW A;  4NPP A;  3N9P A;  4P1N A;  2C4B A;  3ER7 A;  3EAB A;  4IPB A;  1KNP A;  4HGA A;  5FMN A;  4G63 A;  4X5T A;  2IA7 A;  2W03 A;  4UXN B;  4PJL A;  4I55 E;  3K9M C;  3LBX A;  3D4A A;  3JUM A;  2XQ3 A;  4LF8 T;  7STD A;  5GSP A;  4JYA T;  2ZM2 A;  2MTQ A;  5BVB A;  1Y64 B;  1DVD A;  1W0B A;  3HA4 A;  1CH0 A;  1MGR A;  1XWM A;  5HXS A;  2MF7 A;  2BMR B;  2HML B;  4F6R C;  3T8N A;  2X9W A;  4HM3 B;  4AXP A;  2JQK A;  2IYJ A;  1ROV A;  4J5G A;  3CXC 2;  4EYC A;  4ERR A;  3ZG5 A;  4WBN E;  2NOX A;  1OHP A;  1XDP A;  2NTX A;  4U72 A;  2GXF A;  2HMJ B;  3KFW X;  1W6C A;  3D0T A;  2BG9 A;  1EKM A;  4O8S A;  4K0U A;  4QX7 B;  3TLU A;  3SXX A;  4CZZ B;  2BG9 E;  1I3F A;  2CPT A;  1B2U A;  5L3D B;  4KP3 C;  2J62 A;  3LK4 2;  4QWT A;  3ZN1 B;  2V5C A;  2V7J A;  1VQ6 3;  4X65 T;  4UEM A;  2X0H A;  4R1K A;  2HMK B;  4AQF C;  2PJQ A;  4JRF A;  4JLE A;  1RN1 A;  3G0K A;  3O1H A;  3CCQ 3;  3ZYL A;  4X20 E;  5BU4 A;  1LRZ A;  3WA2 X;  3U78 A;  2WCA A;  3OKQ A;  5HCJ A;  2WWV A;  1WYC A;  2OOV A;  2BBJ A;  4X2O A;  3EJV A;  4JBW F;  4E7S A;  1BR0 A;  2XQ6 A;  3VKG A;  4DMW A;  2XFT A;  1YIJ 3;  4HM5 B;  4ZS3 A;  2JIW A;  3NWI A;  5ELJ A;  4DV0 T;  2RP4 A;  4B3S T;  1T98 A;  2NW7 A;  3AMO B;  1KEY A;  1YGE A;  4GYS A;  2VWA A;  4BJM A;  4MEI A;  1VQ4 3;  1M62 A;  1RMS A;  5AIG A;  3X1D A;  4JF8 A;  2M6B A;  4QXC B;  3L3P A;  1Q9E A;  2XQ7 A;  4EAH A;  3MZK B;  1C7H A;  2BS2 A;  2QVA A;  3T8O A;  2WGO A;  4NHF A;  4JUY A;  4HWC A;  2Q9Q B;  5IWA T;  2LT3 A;  4PJM A;  3NZQ A;  1QSD A;  1A90 A;  1FIO A;  3DZL A;  2D42 A;  1IVV A;  1I0X A;  4X1K E;  5AQR B;  3T0U A;  4UF0 A;  2P9B A;  4GK0 E;  4ZZB A;  2UXB T;  4NRE A;  5LMN T;  1R4C A;  1WMP A;  3ZFZ A;  5DQV A;  4CXY A;  3AE7 A;  2DLR A;  3UUB A;  4DR6 T;  3WI3 A;  1QAF A;  2X68 A;  3NXJ A;  2BS4 A;  1LNH A;  4BA9 A;  3EAM A;  1WYB A;  4L5G A;  2CMR A;  1QUU A;  4JV5 T;  4O2H A;  3UUX B;  2WDR A;  5LBM A;  3GWR A;  4YHJ A;  5FL0 A;  1CYU A;  4GSP A;  3CC2 3;  1W01 A;  3HR0 A;  3I0Q A;  2FNQ A;  3JAF A;  5IW9 A;  2JDI H;  4J2C A;  1J2B A;  3NBJ A;  4HM6 B;  4RNY A;  3M3Z B;  2E9X A;  5F5W A;  2H3R A;  4CXW A;  5AQG B;  2OA5 A;  3QNU A;  3ZYM A;  3AE6 A;  3D9R A;  5FKY A;  3DJB A;  5CFB A;  2Q07 A;  4KFE A;  3A5E A;  3P4Q A;  3STD A;  5JDN A;  6RNT A;  2BVM A;  4FI5 A;  3EN8 A;  5KP1 A;  4XBY A;  3NRY A;  1HZ1 A;  3JVC A;  3TLS A;  3I0O A;  3SLU A;  1WFD A;  3URP A;  4UVB B;  3CD6 3;  4OHF A;  1JN5 B;  5EK4 A;  2X67 A;  1SE7 A;  3BB9 A;  1XMQ T;  4PJJ A;  1JBR A;  2FJD A;  1IAP A;  1XNQ T;  3PUW F;  5HEU A;  1T3B A;  4EOZ B;  3FSD A;  5L2L A;  1ZOY A;  1N34 T;  3UU6 A;  4B3M T;  1RDS A;  5CJ5 A;  1W2B 2;  1EQK A;  2IMJ A;  1OGX A;  2MBG A;  4HBR A;  3D5I A;  2CLY B;  3ABV A;  1UX5 A;  2LJL A;  1QLB A;  1STF I;  3DP7 A;  1BNI A;  3N2G E;  2CWY A;  4JI2 T;  4XDW A;  2OTJ 3;  3MG1 A;  1M9G A;  5AQL B;  3DH2 A;  5LNK A;  3EI0 A;  3B7C A;  3G4S 3;  1I2E A;  3FG4 A;  2X9H A;  3CKD A;  1BAO A;  3P8C D;  1PFP A;  3PUQ A;  3RH3 A;  4JI5 T;  3VRA A;  4EZH A;  2L3L A;  3SOL A;  3MYT A;  5G1L A;  3J9X 1;  2CIU A;  3U1W A;  1NWW A;  1D1B A;  3UQ7 A;  3Q5E A;  4DR3 T;  4WYK A;  4AQY T;  5FGO A;  2NP9 A;  1US7 B;  2SPC A;  3LG7 A;  2Z6E A;  3AE4 A;  1IJ6 A;  4ZS2 A;  1BRK A;  2C5I T;  1N5P A;  1HF8 A;  3BLZ A;  3QUJ A;  4MMY B;  4LFC T;  2H0G A;  2HHH T;  3UU4 A;  4HWF A;  4DMV A;  1I70 A;  3X42 A;  3UFE A;  3X3Z A;  2ACZ A;  4M1P A;  1YVS A;  3DXO A;  1KWI A;  4DR5 T;  1BVI A;  1MIW A;  4IDZ A;  4U7I A;  4ZI3 C;  1O7G B;  3K0Z A;  1BUQ A;  1MWU A;  5KXJ A;  1Q40 B;  3AEA A;  2LSY A;  4Z90 A;  3HL6 A;  4EGW A;  1LQG C;  4FMC A;  3H51 A;  3OWY A;  4IL9 A;  2OLT A;  1YVB I;  1UUV B;  3P7I A;  2EHO B;  3O8Y A;  1SII A;  3EVY A;  1UUG B;  3LYG A;  2WP9 A;  4P0B A;  4RBN A;  4ZZC A;  1TFO A;  4HM7 B;  1MWS A;  4ZI3 D;  2NWB A;  3L0R A;  2BS3 A;  3BIR A;  1I0V A;  2ZM8 A;  6STD A;  5AQS B;  2XTL A;  5AFU L;  1NNV A;  3AXJ A;  4X1Y E;  5HYA A;  3FG1 A;  1W0A A;  3F2E A;  3O9X A;  3N2K E;  3EBT A;  2OWP A;  4RNZ A;  1BNG A;  3D5G A;  3MG3 A;  1YQ3 A;  2LLY A;  2IUJ A;  3ZMU B;  1MWR A;  4DUY T;  4CPK A;  4Q53 A;  4TV9 E;  5HEO A;  2CEA A;  1FUS A;  4UIG A;  1TFK A;  2LKG A;  1KQS 2;  3BK9 A;  1LVK A;  4WNK A;  1VQL 3;  2CM0 A;  4NUU A;  2V1D B;  3F7S A;  4ADZ A;  3C51 A;  5LC6 A;  3NBX X;  2MC8 A;  1RGA A;  1BR2 A;  3Q2P A;  4BU4 A;  5J2T E;  4HFE A;  3IHR A;  4ORL A;  2HMM B; 
#chains in the Genus database with same CATH homology
 5HXC A;  3EB8 A;  2B1E A;  2V7M A;  3RC8 A;  1ULJ B;  4O3V A;  1UI8 A;  3AA7 B;  2I59 A;  1LKX A;  1S35 A;  3PYJ A;  5F8P A;  2Z6B A;  3RC3 A;  3I0Y A;  1JJ2 2;  3AB3 B;  4K61 A;  2BMQ B;  1NB5 I;  3AAA B;  2BZB A;  3PU3 A;  2W0Q A;  1Q81 4;  2DI4 A;  2E8I A;  2JQ5 A;  1OH0 A;  3ZYK A;  1HS7 A;  3LFM A;  3I55 3;  4B6X A;  2QGU A;  4O4L E;  1YJ9 3;  3WAJ A;  4AEQ A;  1OHS A;  3SWH A;  1ULI B;  5AIF A;  3I9W A;  3L09 A;  4OK0 A;  4N6V 0;  5AYR B;  2LYX A;  4XB5 A;  4KUM B;  3MKD A;  3J7Y d;  3KV4 A;  5D83 A;  1W4N A;  4UV9 B;  3K8P C;  4R4K A;  3PUG A;  1CYV A;  3ONX A;  2M7O A;  4MAL A;  3FGY A;  3FKA A;  3ZMS B;  3LK3 B;  4GL6 A;  3UUL A;  2BVL A;  1OPY A;  2IW5 B;  3HKC E;  2W9Q A;  5LP6 E;  1ZX2 A;  1Q42 A;  2KCD A;  5TAO A;  3IEE A;  1LXE A;  3PCS A;  2CLY C;  2LQV A;  3ZPO A;  4FCM A;  4HM4 B;  2CE7 A;  5KMG P;  5LBQ B;  2XEP A;  5EQL A;  2RSX A;  4TUY E;  3HK4 A;  4IE0 A;  5FXW A;  3CCL 3;  4ZI2 C;  2C11 A;  3MXZ A;  2QA7 A;  4P0A A;  3DGL A;  1RRH A;  1IQX A;  3K3N A;  3Q1C A;  3AVS A;  3HI7 A;  2CK3 H;  3ALA A;  1RKY A;  1UUW B;  4ZI2 D;  1IQY A;  3KSP A;  1E3R A;  3MWZ A;  2E2V A;  3CCJ 3;  3KII A;  5JRE A;  1MMD A;  5DQW A;  4IST A;  4WP5 A;  4WHA A;  3PTR B;  4DVD A;  2P38 A;  4AKR B;  3O1I A;  2XAS B;  2YFJ B;  5KX5 E;  5KDM C;  5IER A;  2PNC A;  4WW0 A;  4N6O B;  3A76 A;  1RJO A;  2HPJ A;  1MNL A;  1D0Z A;  3CC7 3;  2ML5 A;  3RYF E;  3RPU A;  2GEY A;  3JUQ A;  3ZMT B;  2CFD A;  3LTA A;  3CX6 B;  2WMO A;  2X9X A;  4HKA A;  4HM8 B;  3ANW A;  2FXT A;  1AV4 A;  2XUE A;  3CME 3;  4DND A;  3IPT A;  1Q7Y 4;  4U13 A;  1M1K 4;  3JUN A;  1G8X A;  5FY1 A;  4ANJ A;  3WOF B;  5M4Y A;  3CCS 3;  4STD A;  4H9P C;  1EG9 B;  2ZDJ A;  2XFS A;  3M65 A;  3B8L A;  2W63 A;  2ZM0 A;  2N2N A;  4YJ3 E;  5ELU A;  1KD1 4;  2CWV A;  4BAY B;  5JR9 B;  2O9U X;  2J1D G;  2Z76 A;  3K5T A;  3ZC1 A;  1U5O A;  5CLK A;  2GEX A;  4L7K A;  1D1C A;  1WLX A;  4DBR A;  4I50 E;  5HXH A;  5JBS A;  3CPZ A;  5FY7 A;  1QVF 2;  1AR0 A;  3NV0 B;  3PDY A;  2Y74 A;  3GZB A;  2JMK A;  1DVC A;  4HM1 B;  4BTX A;  3RRC A;  2LOP A;  2BHM A;  1FGQ A;  5CA1 E;  5D81 A;  2NTY A;  4K1V A;  2IAK A;  2V7I A;  2CWO A;  2V1L A;  5I97 A;  3DY5 A;  5CA0 E;  1V74 A;  1HG5 A;  3X3X A;  3B4O A;  1YIT 3;  4IIA A;  3SOA A;  4HZ9 B;  1Z0P A;  2C10 A;  1IZN B;  2X66 A;  3H3H A;  5IEN A;  2IUK A;  3LBX B;  4EZ4 A;  3EBY A;  3HX8 A;  1TIJ A;  5H6R B;  3KVB A;  2LOS A;  4QXH B;  3S28 A;  3DGN A;  1D6Z A;  3QK9 A;  3NM2 A;  3N9N A;  1IU7 A;  3TKL B;  2UXN B;  3GN5 A;  3CC4 3;  4AKY A;  3DGM A;  1HFA A;  3C98 B;  4TX4 A;  4L9I A;  3R84 B;  3O4X E;  4TN7 B;  2XR8 B;  3F8H A;  5JPU A;  3C4Z A;  3OX9 A;  3UL5 A;  3UT5 E;  2PG8 A;  5LXT E;  5JVD E;  3FBL A;  2GBX B;  3RKO A;  2VL8 A;  3IMA B;  3EC9 A;  3AVR A;  4X1I E;  4HVN A;  3FH1 A;  5JRC A;  2P05 A;  3LH4 A;  2KMF A;  2GU1 A;  2C0S A;  2JMH A;  3DTO A;  2OQE C;  3GRD A;  2YFI B;  2QA4 3;  2W00 A;  4AQG A;  2PFV A;  2LEH A;  4IE6 A;  4YFS A;  4ZHQ E;  1FGM A;  3MA9 A;  4HZB B;  1W7C A;  1ZKE A;  3GAX A;  4IE5 A;  4H63 V;  1FGO A;  1US1 A;  4N3V A;  4OYJ A;  3LK2 B;  3X41 A;  3UB1 A;  1JV2 B;  3OW2 2;  1PU4 A;  1VQ8 3;  1GS3 A;  2H7O A;  4WFO A;  3LTC A;  2CCQ A;  3LT8 A;  5HGR A;  4UF0 B;  1KC8 4;  2XAF B;  3N9L A;  2D0T A;  2K54 A;  3FF0 A;  3U97 A;  4Z8X A;  4EV2 A;  3QK6 A;  3QC9 A;  1D6U A;  4H61 A;  5BMV E;  1IJ5 A;  5L3C B;  5IG3 A;  2XRX B;  3K3O A;  2A3D A;  4HTE A;  3VHL A;  1X79 A;  3AA0 B;  2WSS V;  1S72 3;  2NW8 A;  3S5C A;  3OYZ A;  1SIH A;  2JQQ A;  4YJ2 E;  1D0Y A;  4PFP A;  3N8B A;  5IG4 A;  4N6N B;  4PEJ A;  2E9X B;  5IEO A;  8CHO A;  3UNL A;  2D0U A;  4H9R C;  3KZT A;  4EV5 A;  3EX9 A;  2LSI A;  5TGN A;  1VQM 3;  2HMN B;  4DO0 A;  2C5K T;  3C64 A;  1A2V A;  1AVL A;  3MKI A;  5A1L A;  1IVW A;  3CCV 3;  5FXX A;  2LHR A;  2WAU A;  3FLJ A;  4XBX A;  5FW5 A;  1S94 A;  4EXT A;  2L4V A;  1O7W B;  3SOY A;  1EA2 A;  1CEW I;  3OV4 A;  4HEA A;  3Q5X A;  1JB4 A;  2K0M A;  3UUM A;  2W04 A;  1HG2 A;  3CQX C;  4L8O A;  3BQI A;  3HKB E;  4AI6 A;  3N9Q A;  5FP3 A;  2Y6X A;  5HAX A;  4P09 A;  5EK3 A;  3NRX A;  3NHX A;  5GON E;  1IT7 A;  4AQF A;  2FGT A;  3MHE A;  1O7M B;  1IQ8 A;  4MMZ B;  5FNV E;  1E97 A;  2P0X A;  3CMA 3;  1WMN A;  2YFL B;  1OWA A;  2MOZ A;  1TUH A;  1N8Q A;  3HZP A;  2HPL A;  3EDU A;  4WYK B;  5JDL A;  2CFG A;  4IT7 A;  4FJO A;  5JDQ A;  3GZX B;  2XAH B;  3N9H A;  1NWM X;  1W2Z A;  2VKH A;  3J7Y q;  2RCD A;  2Y48 B;  4HFV A;  2OCT A;  2CFL A;  1VQO 3;  1UW1 A;  4DBQ A;  3X40 A;  5LGT B;  1MND A;  3EUH A;  5DAB A;  3V92 A;  5H6Q B;  3BNC A;  3FZW A;  5G2G A;  3HKE E;  4TZ4 C;  2N1G A;  3A5X A;  4CQI A;  3WA3 A;  3F31 A;  1IVX A;  2CXD A;  2CC3 A;  3QRD A;  4KMC A;  3EQQ B;  2Q9Q C;  1VQ5 3;  2KXG A;  1FMV A;  3V99 A;  2DNX A;  3PCR A;  2MYS A;  4K90 B;  1YKE B;  4H9O C;  1H7C A;  3PE0 A;  4CXX A;  1G96 A;  1NJI 4;  3KVA A;  3VKH A;  1UI7 A;  1U4Q A;  2I9W A;  2XH9 A;  3UJM A;  3C50 A;  2OQE A;  1EZ3 A;  4QX8 B;  4TX5 A;  3RRW A;  5CB4 E;  3G71 3;  3MJX A;  4OYK A;  4N6M A;  3Q90 A;  3RDE A;  4O4J E;  2L9Q A;  1VQ9 3;  1YI2 3;  4O4I E;  2IC9 A;  3KV9 A;  1OHO A;  2W6J H;  4LSO A;  1WMO A;  3WMD A;  1WR6 A;  3GA8 A;  3KKG A;  2JJ9 A;  1T5Y A;  4O02 B;  4LGQ A;  5AEW B;  2YIN A;  1CUN A;  2XSH B;  3VSY A;  1FGR A;  3V98 A;  4N6L A;  4CCV A;  4BJN A;  4AKG A;  2W56 A;  2KLQ A;  2CG1 A;  2YU2 A;  3JUO A;  3HIG A;  2X9Y A;  1ISK A;  2A15 A;  2KWH A;  5CF1 A;  4K1U A;  3RGA A;  3PGB A;  4QHO A;  3GZR A;  1JRQ A;  3C4X A;  2VKO A;  3CNM A;  4CI2 B;  4HE8 A;  4MBQ A;  2ZL8 A;  2XAG B;  1LOX A;  1Q86 4;  4KFD A;  5LCY A;  1HKX A;  3ZCJ A;  3ZLI A;  3K7C A;  1MOL A;  5F3J A;  4MLK A;  4E7Z A;  2L8K A;  1WQL B;  1QAL A;  3KSE D;  5DRE A;  3CNX A;  1JKG A;  1GD3 A;  4R9K A;  2GBW B;  4AKH A;  4EYU A;  1HCI A;  3WOD G;  3JC6 C;  4EBG A;  4CI1 B;  4X2H A;  3HII A;  3F9S A;  1O7N B;  1OGZ A;  3BND A;  2M67 A;  1M1X B;  2XF3 A;  2LM9 A;  1SA0 E;  4JEH B;  4RZM A;  1G73 A;  1Y4K A;  2K48 A;  5AEU B;  3ZMV B;  2V26 A;  3ZEF B;  3CPW 2;  3ZCI A;  4QXB B;  5IG5 A;  4L0R A;  2GU3 A;  3KBU A;  4OUQ A;  4ZM8 A;  1DMM A;  4I4K A;  2LHN A;  3VGN A;  2RFR A;  1JB2 A;  4UVA B;  2CXL A;  3G8Z A;  3IF8 B;  5ADX L;  2EHO C;  2G0U A;  2IC6 A;  4J8T A;  1W5Z A;  3PUR A;  4AKZ A;  2HH7 A;  1JB5 A;  1DMN A;  3N5L A;  1QMA A;  2X51 A;  3GZY B;  2W0G A;  3U3I A;  2K24 A;  4PFO A;  4GK5 E;  5IYZ E;  2OTL 3;  1WRD A;  5L3E B;  2E2T A;  2NW9 A;  5JDF A;  3MAC A;  2EHO D;  5JDM A;  3Q2M A;  5EZY E;  2P09 A;  5IEP A;  5FYM A;  3CVR A;  5LYJ E;  2A72 A;  5DJQ C;  1VQP 3;  1CQS A;  3WAK A;  2KT9 A;  3AMO A;  4IHJ E;  1FEW A;  4C91 A;  3NQZ A;  2ML6 A;  2QEX 3;  3CCM 3;  4MHC A;  2UXX B;  2PBI A;  3RYI E;  5LJN A;  2UX0 A;  3RGR A;  4PK6 A;  4PJN A;  1VQN 3;  3CML A;  5BXQ A;  2W62 A;  1MMN A;  1KNZ A;  4L8P A;  3LXU X;  5LGU B;  1VOM A;  2Q9Q A;  2WOH A;  4GYR A;  2CH9 A;  3FB2 A;  2DWG A;  3CX8 B;  3W15 B;  2N9D A;  5JDH A;  3SX1 A;  5KP3 A;  5L3G B;  4XZC A;  4IGU A;  1F8N A;  3F40 A;  4N6T A;  3NM7 A;  1E1H B;  3ANW B;  2BDE A;  3VU7 H;  3KFQ C;  1D1A A;  1VRB A;  3LOY A;  3B57 A;  1ZEE A;  3Q9D A;  1GY5 A;  1OUN A;  2CHC A;  1YD8 G;  2KWI B;  3ETV A;  2F99 A;  4XBF B;  1E3V A;  1OAC A;  1Q82 4;  4ZOL E;  1QAK A;  1YJW 3;  4A56 A;  5FXV A;  3UUN A;  4KBM B;  3LJC A;  3ZJ2 A;  2ZMA A;  4FMB A;  4WBO A;  3AAI A;  3BNB A;  4LZI A;  1V9D A;  3ZJ1 A;  5E0O A;  5FXZ A;  2CKF B;  1JN5 A;  4HM0 B;  1ZHC A;  1N8R 4;  4MMX B;  1U5P A;  4N78 D;  3VF1 A;  3KIN B;  5C8Y E;  3F8X A;  1L5G B;  1NU3 A;  2YK0 A;  2DWK A;  3F14 A;  3NUV A;  1MIY A;  2JPF A;  3EHC A;  5LA6 E;  4KFF A;  2BMO B;  2WOF A;  3ETU A;  4H9Q C;  2ACX A;  2B1X B;  2RA1 A;  4GOU A;  1IK3 A;  3FF2 A;  2E2U A;  4TV8 E;  5CK6 A;  2LE8 A;  4HYZ A;  2P0M A;  5KP4 A;  4YLH A;  1K41 A;  5LHH B;  4KZ1 A;  1YKH B;  3NZP A;  3LTD A;  2KZ7 B;  1TP6 A;  2Y73 A;  4O4H E;  4H9S E;  1O3X A;  4FR9 A;  4UVC B;  3F57 A;  4FMD A;  5L3B B;  3KV6 A;  1AJ3 A;  5HXE A;  1S5A A;  2XGL A;  3CCU 3;  2Z7A A;  3DMC A;  2CFW A;  4H9N C;  3GN5 B;  1K8A 4;  4GB5 A;  5STD A;  3WOE B;  4EC6 A;  1GD4 A;  2XGN A;  5IF6 A;  3G16 A;  1STD A;  2LSK A;  3V5U A;  3PS8 A;  1WNH A;  3SVA A;  4EYY R;  1FUW A;  5FY0 A;  4V1A v;  4H63 H;  2CWT A;  2C5J A;  5JH7 E;  3RYH E;  4HKV B;  5CF2 A;  4PW8 A;  2F86 B;  3KDS E;  2VKD A;  1Q40 A;  1U8C B;  5JRC B;  3UL6 A;  3H37 A;  2CWU A;  3MSO A;  2VKJ A;  1QVG 2;  2SBL A;  5CXO A;  5EVH A;  3BQL A;  2EHO A;  2DCF A;  2WM9 A;  1QJG A;  2CFK A;  4QKN A;  3LML A;  2CG0 A;  4OVM A;  1UX4 A;  4PNI A;  1A67 A;  1W00 A;  3FBZ A;  3E08 A;  4CDL A;  2LSJ A;  2Y8D A;  2D5U A;  1FA3 A;  2QIY A;  4HM2 B;  2BT3 A;  2RGQ A;  1IVU A;  2YEV C;  1SPU A;  1HX8 A;  1K28 A;  5LHG B;  3H3A A;  2XQY A;  4BTW A;  3CPO A;  4ZI7 E;  1AVK A;  3FG3 A;  3AA6 B;  1N9E A;  1UCU A;  2O3O A;  5ETW A;  1DYU A;  4FMA A;  5D82 A;  1LVN A;  4OFZ A;  3LZA A;  4N6U A;  2STD A;  1NB3 I;  3BNE A;  3T8U A;  1B7T A;  4EIW A;  3SED A;  3KE7 A;  5JR9 C;  2PZV A;  2ODU A;  2VK9 A;  2A2F X;  1YJN 3;  2XAQ B;  5AIH A;  2W61 A;  3LT9 A;  1O7P B;  3MPH A;  4HN9 A;  4I43 B;  3X3Y A;  3ROB A;  1HTJ F;  2KXP B;  4I4T E;  4FCZ A;  4HJL B;  3EE1 A;  4PAG A;  5LG4 A;  5L3F B;  3SRZ A;  4IIJ E;  3M8C A;  3B4P A;  2B24 B;  3AAE B;  2QGS A;  1RRL A;  3MK7 C;  1IT8 A;  5JPP A;  2WMN A;  3S27 A;  3WDG B;  2KRT A;  1RN7 A;  2INX A;  4QWN B;  4C90 A;  5JDG A;  1OCV A;  2CW9 A;  3RX6 A;  2D2S A;  3KV5 A;  5EEO A;  4J9A A;  5IG0 A;  3CWZ B;  4MFR A;  3E22 E;  2CA5 A;  3KBT A;  4EXR A;  1IDP A;  3DUK A;  1WTH A;  1VQ7 3;  3I9Y A;  3BQK A;  4BTY A;  5LJM A;  1YHQ 3;  2GK9 A;  2VB6 A;  3AA1 B;  2DHR A;  4EB6 E;  1MMG A;  3TDG A;  3S67 A;  1ZO2 A;  4O2B E;  2KND A;  4IE7 A;  3V5S A;  1N9J A;  4XM4 A;  4UV8 B;  3I1A A;  3E0Z A;  2ES0 A;  2HMO B;  5JQG E;  3B13 A;  5AI1 A;  3GMI A;  2JRK A;  4ISS A;  3I56 3;  4ILU A;  2WGQ A;  3HI2 A;  1OXZ A;  1ASK A;  5A0O B;  3C4W A;  3RYC E;  4AKI A;  2Q9Q D;  2XAJ B;  1NO3 A;  1VZZ A;  2WO0 A;  2BO9 B;  5J1G A;  3R6N A;  3NBB A;  1YW0 A;  1A2K A;  3OBV E;  1BR1 A;  3IJE B;  2OOV C;  3NQY A;  4UEL A;  1LVF A;  2ODV A;  3O1J A;  4WWU C;  4MJD A;  2D1W A;  4XBT A;  4XDV A;  1K9M 4;  1OF5 A;  1SQW A;  3EN1 B;  2V7K A;  1SJW A;  3FXE B;  3ZN0 B;  4CI3 B;  5IHY A;  1IV7 A;  3PUA A;  3LTB A;  3FCS B;  2X0L B;  1M90 4;  1BR4 A;  1K73 4;  2WWU A;  5EK2 A;  1MIV A;  1W6G A;  4R80 A;  2WBL A;  5DRV A;  1GYB A;  3PXM A;  5LOV E;  2YX9 A;  4LMI A;  2CXF A;  3CQC B;  4PK4 A;  4XAX B;  2ZLY A;  3OXA A;  1MMA A;  3F7X A;  3OJA A;  3ZMZ B;  3CCR 3;  3CCE 3;  3PZW A;  1GY7 A;  2XSO B;  5AII A;  2KIN B;  2F98 A;  4U74 A;  4H3U A;  3NX0 A;  4AKL A;  2Z77 A;  2XHE B;  1MNE A;  3ZC0 A;  2YU1 A;  1O7H B;  3ECF A;  3S29 A;  2R4I A;  5LC7 A;  5HXR A;  3CU3 A;  3JUP A;  3N2O A;  5LGN B;  1NAF A;  3IBP A;  2E9X C;  4ASK A;  3G6E 3;  1ROA A;  3FXD B;  3N9M A;  3CQG B;  1KSI A;  2VAS A;  1OF5 B;  4R9L A;  1Z1S A;  4G2A A;  3D3L A;  4GIW A;  2W2C A;  5HWX A;  1W6Y A;  3PUS A;  2W9P A;  3JC6 D;  1HU9 A;  3UTK A;  1VQK 3;  3EDV A;  1JNQ A;  3S4U A;  4G1M B;  2E9X D;  2K9A A;  1GY6 A;  5JR9 A;  3KN4 A;  3NBR A;  2W56 B;  3HKD E;  5J2U E;  3FHN A;  5LHI B;  1IV9 A;  1FMW A;  3ESL A;  5AYS C;  3DGO A;  4JEU B;  3EF8 A;  4FCJ A;  2H7V C;  1FGT A;  1ZV4 X;  3N9O A;  1D6Y A;  2LSG A;  1N5H A;  2K5B B;  4O2A E;  1KK7 A;  3N54 B;  3DM8 A;  3OWU A;  4KVH A;  3NV0 A;  3CX7 B;  3OWS A;  3Q5W A;  3K3Q C;  3OYX A;  1DMQ A;  3PU8 A;  4NUV A;  4PK5 A;  1SHZ C;  4LEH A;  5HWY A;  2V7L A;  1NDO B;  1TU5 A;  1JKG B;  3MG2 A;  3K63 A;  2BNG A;  1D0X A;  3SS1 A;  1W02 A;  4IE4 A;  3GWH A;  3E99 A;  3N9P A;  3ER7 A;  4IPB A;  4HGA A;  5FMN A;  4G63 A;  2IA7 A;  2W03 A;  4UXN B;  4PJL A;  4I55 E;  3K9M C;  3LBX A;  3JUM A;  7STD A;  2ZM2 A;  2MTQ A;  5BVB A;  1Y64 B;  1DVD A;  3HA4 A;  2MF7 A;  5HXS A;  2BMR B;  2HML B;  4F6R C;  3T8N A;  2X9W A;  4HM3 B;  4AXP A;  1ROV A;  3CXC 2;  4EYC A;  4ERR A;  4WBN E;  2NOX A;  1OHP A;  2NTX A;  4U72 A;  2GXF A;  2HMJ B;  3KFW X;  1W6C A;  3D0T A;  1EKM A;  4O8S A;  4K0U A;  4QX7 B;  3SXX A;  4CZZ B;  5L3D B;  4KP3 C;  3LK4 2;  4QWT A;  3ZN1 B;  2V7J A;  1VQ6 3;  4UEM A;  4R1K A;  2HMK B;  4AQF C;  2PJQ A;  4JRF A;  4JLE A;  3G0K A;  3O1H A;  3CCQ 3;  3ZYL A;  4X20 E;  1LRZ A;  3WA2 X;  3U78 A;  3OKQ A;  1WYC A;  2OOV A;  4X2O A;  3EJV A;  4E7S A;  1BR0 A;  3VKG A;  4DMW A;  2XFT A;  1YIJ 3;  4HM5 B;  4ZS3 A;  5ELJ A;  2RP4 A;  1T98 A;  2NW7 A;  3AMO B;  1YGE A;  4GYS A;  2VWA A;  4BJM A;  4MEI A;  1VQ4 3;  5AIG A;  4JF8 A;  4QXC B;  3L3P A;  4EAH A;  3MZK B;  1C7H A;  3T8O A;  2WGO A;  4NHF A;  4JUY A;  2Q9Q B;  2LT3 A;  4PJM A;  3NZQ A;  1QSD A;  1A90 A;  1FIO A;  3DZL A;  2D42 A;  1IVV A;  4X1K E;  3T0U A;  4UF0 A;  2P9B A;  4GK0 E;  4NRE A;  1R4C A;  1WMP A;  5DQV A;  4CXY A;  2DLR A;  3WI3 A;  1QAF A;  2X68 A;  3NXJ A;  1LNH A;  4BA9 A;  1WYB A;  4L5G A;  2CMR A;  1QUU A;  4O2H A;  3UUX B;  5LBM A;  3GWR A;  4YHJ A;  1CYU A;  3CC2 3;  1W01 A;  3HR0 A;  3I0Q A;  2FNQ A;  5IW9 A;  2JDI H;  4J2C A;  1J2B A;  3NBJ A;  4HM6 B;  4RNY A;  2E9X A;  2H3R A;  4CXW A;  2OA5 A;  3ZYM A;  3D9R A;  3DJB A;  2Q07 A;  4KFE A;  3STD A;  5JDN A;  2BVM A;  4FI5 A;  3EN8 A;  5KP1 A;  4XBY A;  3NRY A;  3JVC A;  3I0O A;  3SLU A;  4UVB B;  3CD6 3;  4OHF A;  1JN5 B;  5EK4 A;  2X67 A;  3BB9 A;  4PJJ A;  1IAP A;  4EOZ B;  3FSD A;  5L2L A;  1W2B 2;  1EQK A;  2IMJ A;  1OGX A;  2MBG A;  4HBR A;  2CLY B;  1UX5 A;  2LJL A;  1STF I;  3DP7 A;  3N2G E;  2CWY A;  4XDW A;  2OTJ 3;  3MG1 A;  1M9G A;  5LNK A;  3B7C A;  3G4S 3;  3FG4 A;  2X9H A;  3CKD A;  3P8C D;  1PFP A;  3PUQ A;  3RH3 A;  4EZH A;  2L3L A;  3SOL A;  3MYT A;  3J9X 1;  2CIU A;  3U1W A;  1NWW A;  1D1B A;  4WYK A;  5FGO A;  2NP9 A;  1US7 B;  2SPC A;  3LG7 A;  2Z6E A;  4ZS2 A;  1IJ6 A;  2C5I T;  1N5P A;  1HF8 A;  3BLZ A;  3QUJ A;  4MMY B;  4DMV A;  3X42 A;  3UFE A;  3X3Z A;  4M1P A;  3DXO A;  1KWI A;  1MIW A;  4IDZ A;  4ZI3 C;  1O7G B;  3K0Z A;  1BUQ A;  1Q40 B;  2LSY A;  3HL6 A;  4FMC A;  3H51 A;  3OWY A;  1YVB I;  1UUV B;  3P7I A;  2EHO B;  3O8Y A;  1SII A;  3EVY A;  3LYG A;  4P0B A;  4RBN A;  1TFO A;  4HM7 B;  4ZI3 D;  2NWB A;  3L0R A;  2ZM8 A;  6STD A;  2XTL A;  5AFU L;  4X1Y E;  5HYA A;  3FG1 A;  3F2E A;  3O9X A;  3N2K E;  3EBT A;  2OWP A;  4RNZ A;  3MG3 A;  2IUJ A;  3ZMU B;  4Q53 A;  4TV9 E;  2CEA A;  4UIG A;  1TFK A;  1KQS 2;  3BK9 A;  1LVK A;  4WNK A;  1VQL 3;  2CM0 A;  4NUU A;  2V1D B;  3F7S A;  4ADZ A;  3C51 A;  5LC6 A;  3NBX X;  2MC8 A;  1BR2 A;  3Q2P A;  5J2T E;  3IHR A;  4ORL A;  2HMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...